F495221

General Info

Members Datasets Scaffolds Average Seq Length
1654 593 1617 249

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_42252_c1|nmdc:mga03n38_42252_c1_103_1023
Length 306
Sequence MLFVLQNGFLEKEVPQFVRQLIDERRLLRKRTLSLFPGGAGKSEAEAEQLPGTMGRQRLVAVLELTNISKHFGAIQAVNDVSLSIEPGQVVGLMGDNGAGKSTLVKMIAGNFHPSHGTMQMDGKELILNKPVEARQHGIEIVHQDLALCNNLTAAANVYLGRELRRGVGPFRILDYAAMYKRAGQIFAELKSETRPRDLVKQMSGGQRQAVAIARTMLSQAKIVLMDEPTAAISVRQVAEVLNLIRHLRDQGIAVVLISHRMPDVFDVADRVIVMRRGRKVADKTIASSSPEEVTGLITGAIEQVL

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
3 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
4 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
5 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
6 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
7 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
8 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
9 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
10 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
11 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
12 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
13 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
14 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
15 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
16 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
17 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
18 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
19 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
20 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
21 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
22 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
23 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
24 2996887358 Rhizobium sp. R711 Isolate Nodule
25 2996893221 Rhizobium sp. R635 Isolate Nodule
26 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
27 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
28 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
34 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
41 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
55 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
68 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
80 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
81 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
82 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
83 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
84 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
85 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
86 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
132 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
135 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
136 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
139 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
140 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
141 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
142 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
143 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
144 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
145 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
149 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
163 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
176 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
177 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
178 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
179 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
180 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
181 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
182 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
183 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
186 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
187 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
188 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
189 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
190 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
198 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
199 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
284 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
285 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
286 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
287 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
288 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
289 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
290 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
291 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
292 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
293 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
294 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
295 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
296 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
297 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
298 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
299 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
300 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
301 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
302 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
303 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
304 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
305 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
306 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
307 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
308 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
309 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
310 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
311 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
312 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
313 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
314 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
315 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
316 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
317 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
318 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
319 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
320 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
321 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
322 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
323 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
324 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
325 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
326 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
327 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
328 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
329 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
330 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
332 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
333 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
334 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
335 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
338 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
339 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
340 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
341 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
342 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
343 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
344 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
345 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
346 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
347 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
348 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
349 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
350 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
351 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
352 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
353 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
354 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
355 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
356 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
357 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
358 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
359 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
360 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
361 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
362 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
363 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
364 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
365 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
366 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
367 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
368 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
369 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
370 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
373 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
374 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
375 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
376 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
377 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
378 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
379 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
380 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
381 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
382 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
383 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
384 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
385 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
386 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
387 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
388 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
389 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
392 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
393 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
394 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
395 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
396 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
397 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
398 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
399 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
400 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
401 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
404 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
405 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
406 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
407 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
408 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
409 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
410 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
411 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
412 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
413 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
414 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
415 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
416 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
417 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
418 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
419 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
420 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
421 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
422 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
423 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
424 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
425 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
426 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
427 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
428 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
429 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
430 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
431 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
432 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
433 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
434 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
435 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
436 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
437 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
438 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
439 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
440 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
441 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
442 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
443 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
444 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
445 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
446 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
447 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
448 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
449 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
450 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
451 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
452 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
453 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
454 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
455 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
456 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
457 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
458 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
459 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
460 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
461 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
462 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
463 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
464 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
465 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
466 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
467 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
468 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
469 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
470 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
471 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
472 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
473 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
474 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
475 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
476 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
477 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
478 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
495 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
496 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
497 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
498 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
499 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
503 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
504 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
505 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
506 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
507 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
508 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
509 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
510 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
513 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
514 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
515 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
516 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
517 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
518 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
519 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
520 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
521 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
522 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
523 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
524 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
525 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
526 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
527 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
528 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
529 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
530 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
531 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
532 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
533 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
534 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
535 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
536 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
537 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
538 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
539 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
540 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
541 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
542 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
543 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
544 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
545 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
546 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
547 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
548 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
549 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
550 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
551 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
552 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
553 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
554 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
555 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
556 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
557 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
558 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
559 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
560 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
561 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
562 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
563 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
564 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
565 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
566 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
567 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
568 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
569 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
570 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
571 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
572 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
573 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
574 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
575 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
576 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
577 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
578 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
579 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
580 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
581 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
582 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
583 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
584 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
585 8005258706 Rhizobium sp. R693 Isolate Nodule
586 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
587 8005321885 Rhizobium sp. R72 Isolate Nodule
588 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
589 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
590 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
591 8024501048 Rhizobium sp. H4 Isolate Nodule
592 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
593 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 0
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.6
Nodule 2
Rhizoplane 2.54
Rhizosphere 72.43
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10040824 3300001979 Bacteria 1403
2 JGI25158J39367_1000548 3300002739 Bacteria 7548
3 JGI25157J39369_1001276 3300002741 Bacteria 10204
4 JGI25152J39213_1005130 3300002773 Bacteria 3929
5 JGI25152J39213_1006776 3300002773 Bacteria 3047
6 JGI25150J39212_1007959 3300002774 Bacteria 2100
7 JGI25159J45721_1000012 3300002987 Bacteria 149808
8 JGI25159J45721_1001972 3300002987 Bacteria 8179
9 JGI25151J46595_10005842 3300003187 Bacteria 6295
10 JGI25406J46586_10005327 3300003203 Bacteria 5968
11 JGI25165J46597_1000015 3300003214 Bacteria 380891
12 JGI25165J46597_1002828 3300003214 Bacteria 4982
13 JGI25153J46596_10000033 3300003215 Bacteria 194912
14 JGI25153J46596_10000047 3300003215 Bacteria 146400
15 JGI25153J46596_10024486 3300003215 Bacteria 2176
16 rootH2_10079132 3300003320 Bacteria 7066
17 JGI25160J50197_1000042 3300003354 Bacteria 149808
18 JGI25160J50197_1000068 3300003354 Bacteria 112790
19 JGI25160J50197_1006678 3300003354 Bacteria 4637
20 JGI25161J50226_1000048 3300003374 Bacteria 112790
21 JGI25161J50226_1000254 3300003374 Bacteria 31906
22 JGI25161J50226_1002172 3300003374 Bacteria 5231
23 Ga0055542_1000406 3300003762 Bacteria 42163
24 Ga0055526_1003068 3300003771 Bacteria 10857
25 Ga0055526_1003780 3300003771 Bacteria 9437
26 Ga0055526_1005774 3300003771 Bacteria 6976
27 Ga0055524_1022164 3300003775 Bacteria 2084
28 Ga0055536_1007787 3300003781 Bacteria 4729
29 Ga0055536_1009742 3300003781 Bacteria 3925
30 Ga0055534_1002995 3300003784 Bacteria 5557
31 Ga0055528_1000081 3300003790 Bacteria 75261
32 Ga0055528_1002961 3300003790 Bacteria 8807
33 Ga0055528_1010205 3300003790 Bacteria 3843
34 Ga0055530_10023412 3300003791 Bacteria 1775
35 Ga0055540_1005863 3300003792 Bacteria 5031
36 Ga0055540_1007063 3300003792 Bacteria 4318
37 Ga0055531_10000775 3300003794 Bacteria 26585
38 Ga0055531_10020004 3300003794 Bacteria 2671
39 Ga0055543_1000031 3300004625 Bacteria 130583
40 Ga0055543_1000046 3300004625 Bacteria 113628
41 Ga0055543_1000452 3300004625 Bacteria 24678
42 Ga0065165_1000174 3300005262 Bacteria 113769
43 Ga0065165_1000175 3300005262 Bacteria 113628
44 Ga0065165_1016574 3300005262 Bacteria 2751
45 Ga0065704_10243647 3300005289 Bacteria 993
46 Ga0065712_10084375 3300005290 Bacteria 2768
47 Ga0065715_10005719 3300005293 Bacteria 4176
48 Ga0070658_10072794 3300005327 Bacteria 2817
49 Ga0070658_10121171 3300005327 Bacteria 2173
50 Ga0070676_10001690 3300005328 Bacteria 11215
51 Ga0070676_10032420 3300005328 Bacteria 2993
52 Ga0070690_100000104 3300005330 Bacteria 43588
53 Ga0070690_100006691 3300005330 Bacteria 6547
54 Ga0070690_100093173 3300005330 Bacteria 1987
55 Ga0070690_100115124 3300005330 Bacteria 1799
56 Ga0070670_100234182 3300005331 Bacteria 1598
57 Ga0070677_10006920 3300005333 Bacteria 3768
58 Ga0070677_10087821 3300005333 Bacteria 1346
59 Ga0068869_100006830 3300005334 Bacteria 7259
60 Ga0068869_100010468 3300005334 Bacteria 6049
61 Ga0068869_100013291 3300005334 Bacteria 5471
62 Ga0068869_100037678 3300005334 Bacteria 3439
63 Ga0068869_100045381 3300005334 Bacteria 3164
64 Ga0068869_100195193 3300005334 Bacteria 1594
65 Ga0070666_10003654 3300005335 Bacteria 9323
66 Ga0070666_10266559 3300005335 Bacteria 1215
67 Ga0070666_10374691 3300005335 Bacteria 1021
68 Ga0070680_100106467 3300005336 Bacteria 2332
69 Ga0070680_100140641 3300005336 Bacteria 2024
70 Ga0068868_100001028 3300005338 Bacteria 19079
71 Ga0068868_100002870 3300005338 Bacteria 11952
72 Ga0068868_100020673 3300005338 Bacteria 4951
73 Ga0068868_100028159 3300005338 Bacteria 4293
74 Ga0068868_100101056 3300005338 Bacteria 2334
75 Ga0070660_100021992 3300005339 Bacteria 4711
76 Ga0070660_100027337 3300005339 Bacteria 4256
77 Ga0070660_100160073 3300005339 Bacteria 1814
78 Ga0070689_100002051 3300005340 Bacteria 13079
79 Ga0070689_100039569 3300005340 Bacteria 3611
80 Ga0070689_100262363 3300005340 Bacteria 1428
81 Ga0070691_10032040 3300005341 Bacteria 2468
82 Ga0070687_100375729 3300005343 Bacteria 925
83 Ga0070661_100003782 3300005344 Bacteria 10428
84 Ga0070661_100135355 3300005344 Bacteria 1854
85 Ga0070668_100004957 3300005347 Bacteria 9855
86 Ga0070668_100021056 3300005347 Bacteria 4928
87 Ga0070668_100060860 3300005347 Bacteria 2925
88 Ga0070668_100423111 3300005347 Bacteria 1141
89 Ga0070669_100007652 3300005353 Bacteria 7722
90 Ga0070669_100047893 3300005353 Bacteria 3119
91 Ga0070669_100058280 3300005353 Bacteria 2834
92 Ga0070669_100107389 3300005353 Bacteria 2114
93 Ga0070669_100124903 3300005353 Bacteria 1968
94 Ga0070669_100232146 3300005353 Bacteria 1463
95 Ga0070675_100002408 3300005354 Bacteria 13959
96 Ga0070675_100011906 3300005354 Bacteria 6816
97 Ga0070675_100174674 3300005354 Bacteria 1854
98 Ga0070671_100009046 3300005355 Bacteria 7993
99 Ga0070671_100012205 3300005355 Bacteria 6913
100 Ga0070671_100022921 3300005355 Bacteria 5103
101 Ga0070671_100050547 3300005355 Bacteria 3457
102 Ga0070671_100420339 3300005355 Bacteria 1145
103 Ga0070674_100014204 3300005356 Bacteria 4945
104 Ga0070674_100017014 3300005356 Bacteria 4564
105 Ga0070674_100018973 3300005356 Bacteria 4361
106 Ga0070674_100060883 3300005356 Bacteria 2633
107 Ga0070674_100283065 3300005356 Bacteria 1315
108 Ga0070674_100326663 3300005356 Bacteria 1231
109 Ga0070674_100353166 3300005356 Bacteria 1188
110 Ga0070674_100422101 3300005356 Bacteria 1094
111 Ga0070673_100008458 3300005364 Bacteria 6843
112 Ga0070673_100028973 3300005364 Bacteria 4124
113 Ga0070673_100338482 3300005364 Bacteria 1333
114 Ga0070688_100160781 3300005365 Bacteria 1543
115 Ga0070688_100422618 3300005365 Bacteria 991
116 Ga0070659_100040241 3300005366 Bacteria 3652
117 Ga0070659_100056900 3300005366 Bacteria 3083
118 Ga0070659_100181776 3300005366 Bacteria 1726
119 Ga0070659_100573082 3300005366 Bacteria 968
120 Ga0070667_100010392 3300005367 Bacteria 7684
121 Ga0070667_100040888 3300005367 Bacteria 3888
122 Ga0070667_100136027 3300005367 Bacteria 2149
123 Ga0070667_100429243 3300005367 Bacteria 1205
124 Ga0070709_10012841 3300005434 Bacteria 4696
125 Ga0070714_100005358 3300005435 Bacteria 9786
126 Ga0070713_100100618 3300005436 Bacteria 2503
127 Ga0070713_100399502 3300005436 Bacteria 1283
128 Ga0070710_10001811 3300005437 Bacteria 10101
129 Ga0070701_10000723 3300005438 Bacteria 11685
130 Ga0070711_100000775 3300005439 Bacteria 16660
131 Ga0070711_100215371 3300005439 Bacteria 1490
132 Ga0070700_100043222 3300005441 Bacteria 2771
133 Ga0070700_100453120 3300005441 Bacteria 977
134 Ga0070694_100049626 3300005444 Bacteria 2827
135 Ga0070663_100256134 3300005455 Bacteria 1387
136 Ga0070663_100299082 3300005455 Bacteria 1287
137 Ga0070663_100416249 3300005455 Bacteria 1101
138 Ga0070678_100003442 3300005456 Bacteria 8830
139 Ga0070678_100030637 3300005456 Bacteria 3701
140 Ga0070678_100032986 3300005456 Bacteria 3590
141 Ga0070678_100036530 3300005456 Bacteria 3440
142 Ga0070678_100124938 3300005456 Bacteria 2035
143 Ga0070662_100072730 3300005457 Bacteria 2539
144 Ga0070662_100124422 3300005457 Bacteria 1980
145 Ga0070662_100128016 3300005457 Bacteria 1954
146 Ga0070681_10673650 3300005458 Bacteria 949
147 Ga0068867_100000091 3300005459 Bacteria 57689
148 Ga0068867_100010378 3300005459 Bacteria 6572
149 Ga0068867_100035822 3300005459 Bacteria 3600
150 Ga0068867_100039441 3300005459 Bacteria 3443
151 Ga0068867_100040970 3300005459 Bacteria 3384
152 Ga0068867_100056274 3300005459 Bacteria 2909
153 Ga0068867_100104180 3300005459 Bacteria 2171
154 Ga0068867_100213062 3300005459 Bacteria 1552
155 Ga0070685_10147600 3300005466 Bacteria 1487
156 Ga0070685_10356336 3300005466 Bacteria 1002
157 Ga0070706_100154516 3300005467 Bacteria 2142
158 Ga0070706_100239790 3300005467 Bacteria 1693
159 Ga0070707_100251578 3300005468 Bacteria 1720
160 Ga0070679_100515053 3300005530 Bacteria 1140
161 Ga0070684_100214762 3300005535 Bacteria 1754
162 Ga0068853_100000533 3300005539 Bacteria 25847
163 Ga0068853_100008721 3300005539 Bacteria 8155
164 Ga0068853_100062492 3300005539 Bacteria 3223
165 Ga0068853_100392547 3300005539 Bacteria 1297
166 Ga0070672_100004518 3300005543 Bacteria 9106
167 Ga0070672_100006066 3300005543 Bacteria 8076
168 Ga0070672_100091402 3300005543 Bacteria 2455
169 Ga0070672_100133529 3300005543 Bacteria 2042
170 Ga0070672_100194448 3300005543 Bacteria 1695
171 Ga0070686_100001185 3300005544 Bacteria 14822
172 Ga0070695_100012848 3300005545 Bacteria 5027
173 Ga0070695_100567310 3300005545 Bacteria 887
174 Ga0070696_100003912 3300005546 Bacteria 9951
175 Ga0070665_100011966 3300005548 Bacteria 8759
176 Ga0070665_100021983 3300005548 Bacteria 6416
177 Ga0070665_100026315 3300005548 Bacteria 5859
178 Ga0070665_100228629 3300005548 Bacteria 1860
179 Ga0070665_100284493 3300005548 Bacteria 1655
180 Ga0070665_100408231 3300005548 Bacteria 1366
181 Ga0070665_100834977 3300005548 Bacteria 934
182 Ga0070704_100130432 3300005549 Bacteria 1947
183 Ga0068855_100059452 3300005563 Bacteria 4472
184 Ga0068855_100138782 3300005563 Bacteria 2773
185 Ga0070664_100035788 3300005564 Bacteria 4169
186 Ga0068857_100007296 3300005577 Bacteria 9520
187 Ga0068857_100049797 3300005577 Bacteria 3717
188 Ga0068854_100006614 3300005578 Bacteria 7384
189 Ga0068854_100111128 3300005578 Bacteria 2067
190 Ga0068854_100367257 3300005578 Bacteria 1182
191 Ga0068854_100448352 3300005578 Bacteria 1077
192 Ga0068856_100030869 3300005614 Bacteria 5240
193 Ga0068856_100105689 3300005614 Bacteria 2809
194 Ga0068856_100170805 3300005614 Bacteria 2186
195 Ga0068856_100209837 3300005614 Bacteria 1963
196 Ga0068856_100252995 3300005614 Bacteria 1777
197 Ga0068856_100320316 3300005614 Bacteria 1568
198 Ga0068856_100528222 3300005614 Bacteria 1201
199 Ga0070702_100000465 3300005615 Bacteria 14450
200 Ga0070702_100181716 3300005615 Bacteria 1377
201 Ga0070702_100187663 3300005615 Bacteria 1358
202 Ga0068852_100004682 3300005616 Bacteria 9691
203 Ga0068852_100018895 3300005616 Bacteria 5442
204 Ga0068852_100038314 3300005616 Bacteria 4028
205 Ga0068852_100518076 3300005616 Bacteria 1189
206 Ga0068852_100523866 3300005616 Bacteria 1183
207 Ga0068852_100898063 3300005616 Bacteria 903
208 Ga0068859_100004139 3300005617 Bacteria 14808
209 Ga0068859_100024768 3300005617 Bacteria 6022
210 Ga0068859_100066366 3300005617 Bacteria 3643
211 Ga0068859_100258096 3300005617 Bacteria 1834
212 Ga0068859_100281564 3300005617 Bacteria 1756
213 Ga0068859_100407028 3300005617 Bacteria 1456
214 Ga0068864_100017958 3300005618 Bacteria 5902
215 Ga0068864_100124212 3300005618 Bacteria 2311
216 Ga0068864_100180333 3300005618 Bacteria 1930
217 Ga0068864_100270219 3300005618 Bacteria 1584
218 Ga0068864_100350494 3300005618 Bacteria 1393
219 Ga0068866_10002429 3300005718 Bacteria 7686
220 Ga0068866_10042055 3300005718 Bacteria 2272
221 Ga0068866_10052992 3300005718 Bacteria 2072
222 Ga0068866_10105319 3300005718 Bacteria 1563
223 Ga0068861_100002134 3300005719 Bacteria 12795
224 Ga0068861_100004235 3300005719 Bacteria 9622
225 Ga0068861_100015953 3300005719 Bacteria 5303
226 Ga0068861_100067724 3300005719 Bacteria 2756
227 Ga0068861_100077139 3300005719 Bacteria 2598
228 Ga0068861_100188954 3300005719 Bacteria 1720
229 Ga0068861_100413072 3300005719 Bacteria 1201
230 Ga0068851_10158537 3300005834 Bacteria 1241
231 Ga0068870_10121037 3300005840 Bacteria 1508
232 Ga0068870_10170422 3300005840 Bacteria 1299
233 Ga0068863_100057708 3300005841 Bacteria 3674
234 Ga0068863_100156268 3300005841 Bacteria 2184
235 Ga0068863_100192197 3300005841 Bacteria 1962
236 Ga0068863_100218540 3300005841 Bacteria 1836
237 Ga0068858_100000679 3300005842 Bacteria 35449
238 Ga0068858_100000774 3300005842 Bacteria 33365
239 Ga0068858_100039707 3300005842 Bacteria 4363
240 Ga0068858_100062433 3300005842 Bacteria 3444
241 Ga0068858_100113932 3300005842 Bacteria 2526
242 Ga0068858_100208795 3300005842 Bacteria 1848
243 Ga0068858_100257248 3300005842 Bacteria 1659
244 Ga0068858_100294160 3300005842 Bacteria 1548
245 Ga0068860_100005264 3300005843 Bacteria 13132
246 Ga0068860_100021326 3300005843 Bacteria 6272
247 Ga0068860_100114065 3300005843 Bacteria 2584
248 Ga0068860_100398874 3300005843 Bacteria 1360
249 Ga0068860_100473424 3300005843 Bacteria 1248
250 Ga0068862_100004858 3300005844 Bacteria 11313
251 Ga0068862_100037860 3300005844 Bacteria 4090
252 Ga0068862_100039976 3300005844 Bacteria 3985
253 Ga0068862_100053778 3300005844 Bacteria 3447
254 Ga0068862_100155416 3300005844 Bacteria 2039
255 Ga0068862_100204281 3300005844 Bacteria 1783
256 Ga0068862_100470055 3300005844 Bacteria 1188
257 Ga0068862_100644166 3300005844 Bacteria 1021
258 Ga0081455_10033573 3300005937 Bacteria 4609
259 Ga0081538_10037477 3300005981 Bacteria 3145
260 Ga0081540_1007796 3300005983 Bacteria 7577
261 Ga0081540_1018556 3300005983 Bacteria 4261
262 Ga0081540_1028680 3300005983 Bacteria 3119
263 Ga0081540_1034711 3300005983 Bacteria 2714
264 Ga0081539_10001065 3300005985 Bacteria 50187
265 Ga0081539_10002462 3300005985 Bacteria 26092
266 Ga0070717_10049598 3300006028 Bacteria 3446
267 Ga0070717_10060157 3300006028 Bacteria 3145
268 Ga0070717_10174840 3300006028 Bacteria 1869
269 Ga0070717_10521222 3300006028 Bacteria 1075
270 Ga0075365_10001077 3300006038 Bacteria 11841
271 Ga0075365_10005631 3300006038 Bacteria 6781
272 Ga0075365_10015495 3300006038 Bacteria 4614
273 Ga0075365_10028179 3300006038 Bacteria 3580
274 Ga0075365_10033264 3300006038 Bacteria 3321
275 Ga0075365_10051810 3300006038 Bacteria 2712
276 Ga0075365_10057918 3300006038 Bacteria 2578
277 Ga0075365_10077386 3300006038 Bacteria 2247
278 Ga0075365_10086523 3300006038 Bacteria 2130
279 Ga0075365_10162450 3300006038 Bacteria 1557
280 Ga0075365_10187535 3300006038 Bacteria 1447
281 Ga0075368_10000497 3300006042 Bacteria 11660
282 Ga0075363_100019120 3300006048 Bacteria 3422
283 Ga0075363_100034775 3300006048 Bacteria 2632
284 Ga0075364_10043362 3300006051 Bacteria 2924
285 Ga0075364_10053411 3300006051 Bacteria 2642
286 Ga0075364_10093419 3300006051 Bacteria 1997
287 Ga0075364_10126716 3300006051 Bacteria 1712
288 Ga0075364_10145322 3300006051 Bacteria 1597
289 Ga0075432_10161255 3300006058 Bacteria 867
290 Ga0070715_10052960 3300006163 Bacteria 1752
291 Ga0070716_100002789 3300006173 Bacteria 8121
292 Ga0070716_100060583 3300006173 Bacteria 2187
293 Ga0075362_10015521 3300006177 Bacteria 3099
294 Ga0075362_10076585 3300006177 Bacteria 1536
295 Ga0075367_10005545 3300006178 Bacteria 6285
296 Ga0075367_10029428 3300006178 Bacteria 3141
297 Ga0075367_10102443 3300006178 Bacteria 1751
298 Ga0075367_10241541 3300006178 Bacteria 1132
299 Ga0075369_10000668 3300006186 Bacteria 10918
300 Ga0075369_10003981 3300006186 Bacteria 5421
301 Ga0075369_10007492 3300006186 Bacteria 4158
302 Ga0075369_10100272 3300006186 Bacteria 1299
303 Ga0075369_10123852 3300006186 Bacteria 1171
304 Ga0075366_10001925 3300006195 Bacteria 10502
305 Ga0075366_10032269 3300006195 Bacteria 3083
306 Ga0075366_10083112 3300006195 Bacteria 1914
307 Ga0075366_10155636 3300006195 Bacteria 1384
308 Ga0075366_10207258 3300006195 Bacteria 1193
309 Ga0097621_100014601 3300006237 Bacteria 5884
310 Ga0097621_100023403 3300006237 Bacteria 4811
311 Ga0097621_100027531 3300006237 Bacteria 4471
312 Ga0097621_100141217 3300006237 Bacteria 2058
313 Ga0097621_100182239 3300006237 Bacteria 1815
314 Ga0097621_100585443 3300006237 Bacteria 1019
315 Ga0075370_10003750 3300006353 Bacteria 7273
316 Ga0075370_10012857 3300006353 Bacteria 4435
317 Ga0075370_10014816 3300006353 Bacteria 4163
318 Ga0075370_10076779 3300006353 Bacteria 1916
319 Ga0068871_100072151 3300006358 Bacteria 2842
320 Ga0068871_100117432 3300006358 Bacteria 2244
321 Ga0075428_100297821 3300006844 Bacteria 1734
322 Ga0075428_100385730 3300006844 Bacteria 1502
323 Ga0075430_100056046 3300006846 Bacteria 3314
324 Ga0075430_100289627 3300006846 Bacteria 1355
325 Ga0075431_100008686 3300006847 Bacteria 10180
326 Ga0075431_100014607 3300006847 Bacteria 7944
327 Ga0075431_100802983 3300006847 Bacteria 914
328 Ga0075433_10004359 3300006852 Bacteria 10998
329 Ga0075433_10111317 3300006852 Bacteria 2429
330 Ga0075433_10246146 3300006852 Bacteria 1587
331 Ga0075434_100001107 3300006871 Bacteria 22100
332 Ga0075434_100080113 3300006871 Bacteria 3262
333 Ga0075434_100716813 3300006871 Bacteria 1017
334 Ga0075429_100162181 3300006880 Bacteria 1958
335 Ga0075429_100315527 3300006880 Bacteria 1368
336 Ga0068865_100002181 3300006881 Bacteria 11531
337 Ga0068865_100005350 3300006881 Bacteria 7775
338 Ga0068865_100006891 3300006881 Bacteria 6962
339 Ga0068865_100043120 3300006881 Bacteria 3080
340 Ga0068865_100057693 3300006881 Bacteria 2709
341 Ga0097620_100004139 3300006931 Bacteria 14808
342 Ga0097620_100024768 3300006931 Bacteria 6022
343 Ga0097620_100066364 3300006931 Bacteria 3643
344 Ga0097620_100239842 3300006931 Bacteria 1902
345 Ga0097620_100258095 3300006931 Bacteria 1834
346 Ga0097620_100281543 3300006931 Bacteria 1756
347 Ga0097620_100407008 3300006931 Bacteria 1456
348 Ga0075435_100084847 3300007076 Bacteria 2607
349 Ga0075435_100096110 3300007076 Bacteria 2451
350 Ga0099795_10197466 3300007788 Bacteria 847
351 Ga0105240_10030702 3300009093 Bacteria 6980
352 Ga0105240_10188585 3300009093 Bacteria 2426
353 Ga0105240_10193464 3300009093 Bacteria 2390
354 Ga0105240_10317039 3300009093 Bacteria 1778
355 Ga0105240_10445115 3300009093 Bacteria 1451
356 Ga0105240_10470161 3300009093 Bacteria 1403
357 Ga0111539_10000090 3300009094 Bacteria 94888
358 Ga0111539_10095317 3300009094 Bacteria 3495
359 Ga0111539_10106388 3300009094 Bacteria 3291
360 Ga0111539_10228537 3300009094 Bacteria 2167
361 Ga0111539_10594395 3300009094 Bacteria 1289
362 Ga0111539_10741676 3300009094 Bacteria 1143
363 Ga0111539_11228693 3300009094 Bacteria 870
364 Ga0105245_10008017 3300009098 Bacteria 9237
365 Ga0105245_10063580 3300009098 Bacteria 3333
366 Ga0105245_10091787 3300009098 Bacteria 2795
367 Ga0105245_10413657 3300009098 Bacteria 1350
368 Ga0105245_10444206 3300009098 Bacteria 1304
369 Ga0105245_10470834 3300009098 Bacteria 1268
370 Ga0105245_10577174 3300009098 Bacteria 1149
371 Ga0105247_10006831 3300009101 Bacteria 7031
372 Ga0105247_10146901 3300009101 Bacteria 1550
373 Ga0105247_10398480 3300009101 Bacteria 980
374 Ga0114129_10179262 3300009147 Bacteria 2884
375 Ga0114129_10271647 3300009147 Bacteria 2268
376 Ga0114129_10286300 3300009147 Bacteria 2200
377 Ga0105243_10000959 3300009148 Bacteria 26971
378 Ga0105243_10015761 3300009148 Bacteria 5716
379 Ga0105243_10105952 3300009148 Bacteria 2342
380 Ga0105243_10155973 3300009148 Bacteria 1963
381 Ga0105243_10182807 3300009148 Bacteria 1825
382 Ga0105243_10292051 3300009148 Bacteria 1473
383 Ga0105243_10616879 3300009148 Bacteria 1046
384 Ga0105241_10002442 3300009174 Bacteria 13945
385 Ga0105241_10113365 3300009174 Bacteria 2173
386 Ga0105241_10292450 3300009174 Bacteria 1395
387 Ga0105242_10002489 3300009176 Bacteria 14439
388 Ga0105242_10193932 3300009176 Bacteria 1800
389 Ga0105248_10000901 3300009177 Bacteria 33234
390 Ga0105248_10013900 3300009177 Bacteria 8858
391 Ga0105248_10015246 3300009177 Bacteria 8470
392 Ga0105248_10019917 3300009177 Bacteria 7426
393 Ga0105248_10060349 3300009177 Bacteria 4257
394 Ga0105248_10479903 3300009177 Bacteria 1401
395 Ga0105237_10000174 3300009545 Bacteria 90431
396 Ga0105237_10009955 3300009545 Bacteria 10142
397 Ga0105237_10018733 3300009545 Bacteria 7158
398 Ga0105237_10034874 3300009545 Bacteria 5092
399 Ga0105237_10035664 3300009545 Bacteria 5032
400 Ga0105237_10043232 3300009545 Bacteria 4540
401 Ga0105237_10049540 3300009545 Bacteria 4221
402 Ga0105237_10186456 3300009545 Bacteria 2074
403 Ga0105237_10364295 3300009545 Bacteria 1450
404 Ga0105237_10403976 3300009545 Bacteria 1371
405 Ga0105237_10673565 3300009545 Bacteria 1041
406 Ga0105238_10010957 3300009551 Bacteria 9118
407 Ga0105238_10029974 3300009551 Bacteria 5538
408 Ga0105238_10033358 3300009551 Bacteria 5241
409 Ga0105238_10045923 3300009551 Bacteria 4411
410 Ga0105238_10487166 3300009551 Bacteria 1233
411 Ga0105249_10049194 3300009553 Bacteria 3845
412 Ga0105249_10185849 3300009553 Bacteria 2025
413 Ga0105249_10247261 3300009553 Bacteria 1766
414 Ga0105249_10400273 3300009553 Bacteria 1403
415 Ga0105249_10444825 3300009553 Bacteria 1334
416 Ga0105249_10504884 3300009553 Bacteria 1255
417 Ga0123340_1040575 3300009763 Bacteria 2182
418 Ga0123342_1032370 3300009766 Bacteria 2456
419 Ga0105239_10002107 3300010375 Bacteria 25697
420 Ga0105239_10007703 3300010375 Bacteria 12329
421 Ga0105239_10039185 3300010375 Bacteria 5191
422 Ga0105239_10122143 3300010375 Bacteria 2893
423 Ga0105239_10243808 3300010375 Bacteria 2017
424 Ga0105239_10301175 3300010375 Bacteria 1805
425 Ga0105239_10307747 3300010375 Bacteria 1785
426 Ga0105239_10343654 3300010375 Bacteria 1684
427 Ga0105239_10374542 3300010375 Bacteria 1609
428 Ga0105239_11306396 3300010375 Bacteria 837
429 Ga0105246_10021121 3300011119 Bacteria 4186
430 Ga0105246_10103356 3300011119 Bacteria 2079
431 Ga0105246_10183024 3300011119 Bacteria 1615
432 Ga0105246_10211017 3300011119 Bacteria 1516
433 Ga0105246_10322074 3300011119 Bacteria 1256
434 Ga0157338_1002466 3300012515 Bacteria 1454
435 Ga0157371_10047155 3300013102 Bacteria 3063
436 Ga0157370_10056251 3300013104 Bacteria 3744
437 Ga0157370_10134148 3300013104 Bacteria 2308
438 Ga0157369_10035139 3300013105 Bacteria 5497
439 Ga0157369_10181288 3300013105 Bacteria 2215
440 Ga0157369_10229048 3300013105 Bacteria 1943
441 Ga0157374_10100093 3300013296 Bacteria 2778
442 Ga0157374_10640703 3300013296 Bacteria 1074
443 Ga0157378_10004511 3300013297 Bacteria 12212
444 Ga0157378_10006489 3300013297 Bacteria 10226
445 Ga0157378_10053222 3300013297 Bacteria 3604
446 Ga0157378_10212835 3300013297 Bacteria 1833
447 Ga0157378_10390105 3300013297 Bacteria 1369
448 Ga0157378_10792357 3300013297 Bacteria 973
449 Ga0163162_10000204 3300013306 Bacteria 54853
450 Ga0163162_10004677 3300013306 Bacteria 13200
451 Ga0163162_10049112 3300013306 Bacteria 4229
452 Ga0163162_10118334 3300013306 Bacteria 2751
453 Ga0163162_10544590 3300013306 Bacteria 1289
454 Ga0157372_10514203 3300013307 Bacteria 1396
455 Ga0157375_10006400 3300013308 Bacteria 10263
456 Ga0157375_10024647 3300013308 Bacteria 5572
457 Ga0157375_10041032 3300013308 Bacteria 4466
458 Ga0157375_10057714 3300013308 Bacteria 3838
459 Ga0157375_10794743 3300013308 Bacteria 1095
460 Ga0163163_10828742 3300014325 Bacteria 988
461 Ga0157380_10002708 3300014326 Bacteria 12017
462 Ga0157380_10004478 3300014326 Bacteria 9681
463 Ga0157380_10012997 3300014326 Bacteria 6053
464 Ga0157380_10041949 3300014326 Bacteria 3574
465 Ga0157380_10319433 3300014326 Bacteria 1439
466 Ga0157380_10721693 3300014326 Bacteria 1004
467 Ga0182008_10000774 3300014497 Bacteria 22409
468 Ga0182008_10013499 3300014497 Bacteria 4295
469 Ga0157377_10000107 3300014745 Bacteria 57351
470 Ga0157377_10241541 3300014745 Bacteria 1166
471 Ga0157379_10002672 3300014968 Bacteria 15018
472 Ga0157379_10035395 3300014968 Bacteria 4452
473 Ga0157379_10091786 3300014968 Bacteria 2724
474 Ga0157379_10171246 3300014968 Bacteria 1960
475 Ga0157379_10201941 3300014968 Bacteria 1798
476 Ga0157379_10350293 3300014968 Bacteria 1352
477 Ga0157379_10396532 3300014968 Bacteria 1268
478 Ga0157379_10553319 3300014968 Bacteria 1071
479 Ga0157379_10841194 3300014968 Bacteria 868
480 Ga0157376_10093303 3300014969 Bacteria 2613
481 Ga0157376_10232454 3300014969 Bacteria 1713
482 Ga0157376_10389772 3300014969 Bacteria 1344
483 Ga0157376_10402833 3300014969 Bacteria 1323
484 Ga0182007_10004305 3300015262 Bacteria 6480
485 Ga0183362_10001 3300015683 Bacteria 2046624
486 Ga0183363_1026 3300015690 Bacteria 53052
487 Ga0163161_10020746 3300017792 Bacteria 4613
488 Ga0163161_10105260 3300017792 Bacteria 2104
489 Ga0163161_10201719 3300017792 Bacteria 1533
490 Ga0163161_10366484 3300017792 Bacteria 1149
491 Ga0163161_10387294 3300017792 Bacteria 1118
492 Ga0214544_1007335 3300021320 Bacteria 19472
493 Ga0214542_1000027 3300021321 Bacteria 175107
494 Ga0214543_1000047 3300021327 Bacteria 150894
495 Ga0213873_10001600 3300021358 Bacteria 3780
496 Ga0213873_10006410 3300021358 Bacteria 2314
497 Ga0213874_10011559 3300021377 Bacteria 2240
498 Ga0213874_10060082 3300021377 Bacteria 1188
499 Ga0213876_10001084 3300021384 Bacteria 17452
500 Ga0213876_10006877 3300021384 Bacteria 6200
501 Ga0213876_10010546 3300021384 Bacteria 4952
502 Ga0213875_10001310 3300021388 Bacteria 16493
503 Ga0213875_10121679 3300021388 Bacteria 1220
504 Ga0213875_10219999 3300021388 Bacteria 894
505 Ga0209436_100043 3300025208 Bacteria 71870
506 Ga0209436_100252 3300025208 Bacteria 24622
507 Ga0209563_101905 3300025230 Bacteria 5047
508 Ga0207427_101361 3300025231 Bacteria 9016
509 Ga0209026_1000025 3300025250 Bacteria 352548
510 Ga0209148_1000181 3300025254 Bacteria 124691
511 Ga0209759_1000226 3300025256 Bacteria 84383
512 Ga0209129_1001447 3300025258 Bacteria 13241
513 Ga0209129_1001476 3300025258 Bacteria 13078
514 Ga0209129_1001744 3300025258 Bacteria 11677
515 Ga0209233_1000010 3300025261 Bacteria 1194329
516 Ga0209233_1000208 3300025261 Bacteria 115633
517 Ga0209233_1007445 3300025261 Bacteria 3467
518 Ga0209233_1011692 3300025261 Bacteria 2579
519 Ga0209455_1000127 3300025272 Bacteria 162518
520 Ga0209673_1000025 3300025273 Bacteria 404572
521 Ga0209673_1000550 3300025273 Bacteria 60329
522 Ga0209673_1002222 3300025273 Bacteria 14107
523 Ga0209673_1012262 3300025273 Bacteria 3465
524 Ga0209673_1015978 3300025273 Bacteria 2826
525 Ga0209673_1058556 3300025273 Bacteria 974
526 Ga0209130_1000023 3300025284 Bacteria 359355
527 Ga0209130_1000075 3300025284 Bacteria 171698
528 Ga0209130_1000144 3300025284 Bacteria 114000
529 Ga0209130_1001459 3300025284 Bacteria 15538
530 Ga0209130_1014845 3300025284 Bacteria 1940
531 Ga0209130_1022823 3300025284 Bacteria 1389
532 Ga0209675_1000577 3300025291 Bacteria 26469
533 Ga0209675_1016073 3300025291 Bacteria 2194
534 Ga0209676_1002745 3300025292 Bacteria 11797
535 Ga0209676_1011940 3300025292 Bacteria 3458
536 Ga0209025_1000747 3300025294 Bacteria 54721
537 Ga0209025_1019972 3300025294 Bacteria 3692
538 Ga0209025_1034575 3300025294 Bacteria 2303
539 Ga0209025_1037564 3300025294 Bacteria 2146
540 Ga0209025_1047418 3300025294 Bacteria 1754
541 Ga0209564_1000278 3300025295 Bacteria 105405
542 Ga0209564_1000365 3300025295 Bacteria 84031
543 Ga0209564_1000558 3300025295 Bacteria 59623
544 Ga0209564_1033341 3300025295 Bacteria 1533
545 Ga0209758_1000070 3300025297 Bacteria 284093
546 Ga0209758_1000706 3300025297 Bacteria 49585
547 Ga0209758_1003235 3300025297 Bacteria 15130
548 Ga0209758_1014914 3300025297 Bacteria 4078
549 Ga0209758_1021677 3300025297 Bacteria 2986
550 Ga0209758_1027676 3300025297 Bacteria 2416
551 Ga0209050_1018895 3300025298 Bacteria 2651
552 Ga0209256_1000315 3300025299 Bacteria 84048
553 Ga0209256_1000411 3300025299 Bacteria 67351
554 Ga0209256_1000718 3300025299 Bacteria 43876
555 Ga0207426_1000087 3300025302 Bacteria 288870
556 Ga0207426_1000126 3300025302 Bacteria 213341
557 Ga0207426_1000163 3300025302 Bacteria 171698
558 Ga0207426_1002369 3300025302 Bacteria 12212
559 Ga0209051_1000176 3300025303 Bacteria 115875
560 Ga0209051_1000241 3300025303 Bacteria 91816
561 Ga0209051_1001845 3300025303 Bacteria 16708
562 Ga0209051_1005280 3300025303 Bacteria 7613
563 Ga0209051_1009714 3300025303 Bacteria 4930
564 Ga0209051_1010914 3300025303 Bacteria 4535
565 Ga0209051_1018933 3300025303 Bacteria 3026
566 Ga0209051_1027372 3300025303 Bacteria 2274
567 Ga0209257_1000015 3300025304 Bacteria 908141
568 Ga0209257_1000296 3300025304 Bacteria 109517
569 Ga0209257_1001085 3300025304 Bacteria 35621
570 Ga0209257_1010756 3300025304 Bacteria 4555
571 Ga0209257_1018952 3300025304 Bacteria 2616
572 Ga0209257_1019528 3300025304 Bacteria 2547
573 Ga0207697_10010156 3300025315 Bacteria 4037
574 Ga0207682_10003824 3300025893 Bacteria 6462
575 Ga0207692_10002105 3300025898 Bacteria 7597
576 Ga0207642_10006968 3300025899 Bacteria 3789
577 Ga0207642_10062734 3300025899 Bacteria 1735
578 Ga0207642_10262657 3300025899 Bacteria 985
579 Ga0207710_10016400 3300025900 Bacteria 3133
580 Ga0207688_10014947 3300025901 Bacteria 4212
581 Ga0207688_10021443 3300025901 Bacteria 3529
582 Ga0207688_10066618 3300025901 Bacteria 2037
583 Ga0207688_10107200 3300025901 Bacteria 1619
584 Ga0207680_10000693 3300025903 Bacteria 15837
585 Ga0207680_10275558 3300025903 Bacteria 1168
586 Ga0207647_10043242 3300025904 Bacteria 2819
587 Ga0207685_10034520 3300025905 Bacteria 1838
588 Ga0207699_10017480 3300025906 Bacteria 3776
589 Ga0207645_10001681 3300025907 Bacteria 18001
590 Ga0207645_10012052 3300025907 Bacteria 5879
591 Ga0207645_10149681 3300025907 Bacteria 1523
592 Ga0207645_10259896 3300025907 Bacteria 1150
593 Ga0207645_10366974 3300025907 Bacteria 965
594 Ga0207643_10012550 3300025908 Bacteria 4577
595 Ga0207643_10021802 3300025908 Bacteria 3524
596 Ga0207705_10007543 3300025909 Bacteria 7994
597 Ga0207705_10038277 3300025909 Bacteria 3433
598 Ga0207705_10102103 3300025909 Bacteria 2111
599 Ga0207705_10421710 3300025909 Bacteria 1033
600 Ga0207654_10005276 3300025911 Bacteria 6526
601 Ga0207654_10010388 3300025911 Bacteria 4739
602 Ga0207654_10206933 3300025911 Bacteria 1295
603 Ga0207707_10016219 3300025912 Bacteria 6500
604 Ga0207695_10123128 3300025913 Bacteria 2559
605 Ga0207695_10199422 3300025913 Bacteria 1916
606 Ga0207671_10000098 3300025914 Bacteria 133010
607 Ga0207671_10016385 3300025914 Bacteria 5761
608 Ga0207671_10027171 3300025914 Bacteria 4279
609 Ga0207671_10036385 3300025914 Bacteria 3651
610 Ga0207671_10038267 3300025914 Bacteria 3555
611 Ga0207671_10065373 3300025914 Bacteria 2705
612 Ga0207671_10214649 3300025914 Bacteria 1506
613 Ga0207671_10328979 3300025914 Bacteria 1210
614 Ga0207693_10015759 3300025915 Bacteria 6057
615 Ga0207663_10002594 3300025916 Bacteria 8693
616 Ga0207660_10150888 3300025917 Bacteria 1785
617 Ga0207662_10062892 3300025918 Bacteria 2231
618 Ga0207657_10032176 3300025919 Bacteria 4742
619 Ga0207657_10042901 3300025919 Bacteria 3988
620 Ga0207657_10046890 3300025919 Bacteria 3783
621 Ga0207657_10067886 3300025919 Bacteria 3031
622 Ga0207649_10004269 3300025920 Bacteria 7778
623 Ga0207652_10082409 3300025921 Bacteria 2815
624 Ga0207652_10452232 3300025921 Bacteria 1158
625 Ga0207681_10018257 3300025923 Bacteria 4418
626 Ga0207681_10039810 3300025923 Bacteria 3123
627 Ga0207681_10068503 3300025923 Bacteria 2465
628 Ga0207681_10122552 3300025923 Bacteria 1909
629 Ga0207681_10136522 3300025923 Bacteria 1821
630 Ga0207681_10389484 3300025923 Bacteria 1123
631 Ga0207681_10616992 3300025923 Bacteria 897
632 Ga0207694_10069851 3300025924 Bacteria 2744
633 Ga0207694_10100132 3300025924 Bacteria 2296
634 Ga0207694_10275218 3300025924 Bacteria 1382
635 Ga0207694_10383931 3300025924 Bacteria 1166
636 Ga0207650_10017853 3300025925 Bacteria 4971
637 Ga0207659_10002593 3300025926 Bacteria 10766
638 Ga0207659_10071354 3300025926 Bacteria 2536
639 Ga0207659_10085589 3300025926 Bacteria 2342
640 Ga0207659_10178576 3300025926 Bacteria 1680
641 Ga0207687_10003093 3300025927 Bacteria 11287
642 Ga0207687_10007241 3300025927 Bacteria 7319
643 Ga0207687_10050899 3300025927 Bacteria 2886
644 Ga0207687_10265131 3300025927 Bacteria 1371
645 Ga0207700_10031915 3300025928 Bacteria 3749
646 Ga0207700_10038178 3300025928 Bacteria 3484
647 Ga0207664_10006954 3300025929 Bacteria 7827
648 Ga0207664_10132657 3300025929 Bacteria 2098
649 Ga0207644_10006260 3300025931 Bacteria 7754
650 Ga0207644_10018313 3300025931 Bacteria 4736
651 Ga0207644_10045368 3300025931 Bacteria 3127
652 Ga0207690_10016088 3300025932 Bacteria 4547
653 Ga0207690_10139221 3300025932 Bacteria 1786
654 Ga0207690_10474299 3300025932 Bacteria 1009
655 Ga0207706_10003308 3300025933 Bacteria 15436
656 Ga0207706_10022986 3300025933 Bacteria 5599
657 Ga0207706_10184051 3300025933 Bacteria 1834
658 Ga0207706_10193365 3300025933 Bacteria 1785
659 Ga0207686_10002718 3300025934 Bacteria 9599
660 Ga0207686_10015735 3300025934 Bacteria 4236
661 Ga0207709_10001119 3300025935 Bacteria 19668
662 Ga0207709_10005283 3300025935 Bacteria 7347
663 Ga0207709_10024912 3300025935 Bacteria 3421
664 Ga0207709_10059177 3300025935 Bacteria 2384
665 Ga0207709_10113242 3300025935 Bacteria 1818
666 Ga0207709_10119585 3300025935 Bacteria 1776
667 Ga0207709_10145283 3300025935 Bacteria 1636
668 Ga0207709_10309967 3300025935 Bacteria 1177
669 Ga0207670_10005570 3300025936 Bacteria 6921
670 Ga0207670_10009557 3300025936 Bacteria 5539
671 Ga0207670_10292173 3300025936 Bacteria 1273
672 Ga0207669_10024389 3300025937 Bacteria 3250
673 Ga0207669_10024588 3300025937 Bacteria 3240
674 Ga0207669_10025755 3300025937 Bacteria 3186
675 Ga0207669_10029638 3300025937 Bacteria 3029
676 Ga0207669_10062917 3300025937 Bacteria 2288
677 Ga0207669_10174879 3300025937 Bacteria 1532
678 Ga0207704_10001177 3300025938 Bacteria 11657
679 Ga0207704_10009761 3300025938 Bacteria 4648
680 Ga0207704_10044084 3300025938 Bacteria 2640
681 Ga0207704_10209565 3300025938 Bacteria 1433
682 Ga0207704_10344545 3300025938 Bacteria 1158
683 Ga0207665_10005896 3300025939 Bacteria 8151
684 Ga0207665_10112843 3300025939 Bacteria 1911
685 Ga0207691_10003792 3300025940 Bacteria 14671
686 Ga0207691_10035477 3300025940 Bacteria 4628
687 Ga0207691_10099364 3300025940 Bacteria 2598
688 Ga0207691_10208710 3300025940 Bacteria 1698
689 Ga0207691_10216614 3300025940 Bacteria 1661
690 Ga0207691_10239163 3300025940 Bacteria 1570
691 Ga0207691_10655160 3300025940 Bacteria 887
692 Ga0207711_10001117 3300025941 Bacteria 25666
693 Ga0207711_10073953 3300025941 Bacteria 2963
694 Ga0207711_10141307 3300025941 Bacteria 2166
695 Ga0207689_10003529 3300025942 Bacteria 14293
696 Ga0207689_10004524 3300025942 Bacteria 12591
697 Ga0207689_10016932 3300025942 Bacteria 6166
698 Ga0207689_10026403 3300025942 Bacteria 4862
699 Ga0207689_10071557 3300025942 Bacteria 2848
700 Ga0207689_10213752 3300025942 Bacteria 1593
701 Ga0207661_10155033 3300025944 Bacteria 1983
702 Ga0207679_10579823 3300025945 Bacteria 1009
703 Ga0207667_10002257 3300025949 Bacteria 24224
704 Ga0207667_10019765 3300025949 Bacteria 7508
705 Ga0207667_10432121 3300025949 Bacteria 1339
706 Ga0207651_10330865 3300025960 Bacteria 1277
707 Ga0207651_10413170 3300025960 Bacteria 1150
708 Ga0207712_10093622 3300025961 Bacteria 2218
709 Ga0207712_10132278 3300025961 Bacteria 1903
710 Ga0207712_10452389 3300025961 Bacteria 1089
711 Ga0207712_10794292 3300025961 Bacteria 832
712 Ga0207668_10004719 3300025972 Bacteria 8016
713 Ga0207668_10007648 3300025972 Bacteria 6430
714 Ga0207668_10022961 3300025972 Bacteria 4000
715 Ga0207668_10054878 3300025972 Bacteria 2767
716 Ga0207668_10091056 3300025972 Bacteria 2240
717 Ga0207668_10107072 3300025972 Bacteria 2090
718 Ga0207668_10148672 3300025972 Bacteria 1811
719 Ga0207668_10252672 3300025972 Bacteria 1432
720 Ga0207668_10325583 3300025972 Bacteria 1277
721 Ga0207640_10004957 3300025981 Bacteria 7236
722 Ga0207640_10163554 3300025981 Bacteria 1650
723 Ga0207640_10218584 3300025981 Bacteria 1457
724 Ga0207658_10001163 3300025986 Bacteria 21016
725 Ga0207658_10002997 3300025986 Bacteria 12076
726 Ga0207658_10154102 3300025986 Bacteria 1876
727 Ga0207658_10471536 3300025986 Bacteria 1114
728 Ga0207677_10000686 3300026023 Bacteria 20040
729 Ga0207677_10081529 3300026023 Bacteria 2322
730 Ga0207677_10148763 3300026023 Bacteria 1803
731 Ga0207703_10000702 3300026035 Bacteria 33148
732 Ga0207703_10148135 3300026035 Bacteria 2044
733 Ga0207703_10322585 3300026035 Bacteria 1415
734 Ga0207639_10004702 3300026041 Bacteria 9189
735 Ga0207639_10017059 3300026041 Bacteria 5144
736 Ga0207639_10043662 3300026041 Bacteria 3367
737 Ga0207639_10197789 3300026041 Bacteria 1722
738 Ga0207639_10228345 3300026041 Bacteria 1612
739 Ga0207678_10055733 3300026067 Bacteria 3405
740 Ga0207678_10139218 3300026067 Bacteria 2071
741 Ga0207678_10239799 3300026067 Bacteria 1553
742 Ga0207678_10368317 3300026067 Bacteria 1241
743 Ga0207708_10023248 3300026075 Bacteria 4683
744 Ga0207708_10063677 3300026075 Bacteria 2817
745 Ga0207708_10174109 3300026075 Bacteria 1706
746 Ga0207702_10020818 3300026078 Bacteria 5425
747 Ga0207702_10021279 3300026078 Bacteria 5368
748 Ga0207702_10080204 3300026078 Bacteria 2831
749 Ga0207702_10085088 3300026078 Bacteria 2755
750 Ga0207702_10091452 3300026078 Bacteria 2664
751 Ga0207702_10258663 3300026078 Bacteria 1638
752 Ga0207641_10000926 3300026088 Bacteria 30280
753 Ga0207641_10135643 3300026088 Bacteria 2215
754 Ga0207641_10167392 3300026088 Bacteria 2003
755 Ga0207641_10330977 3300026088 Bacteria 1447
756 Ga0207648_10000227 3300026089 Bacteria 60175
757 Ga0207648_10001863 3300026089 Bacteria 23045
758 Ga0207648_10004241 3300026089 Bacteria 14815
759 Ga0207648_10027604 3300026089 Bacteria 5039
760 Ga0207648_10052018 3300026089 Bacteria 3581
761 Ga0207648_10077381 3300026089 Bacteria 2900
762 Ga0207648_10137674 3300026089 Bacteria 2151
763 Ga0207648_10152176 3300026089 Bacteria 2041
764 Ga0207648_10182587 3300026089 Bacteria 1857
765 Ga0207648_10209896 3300026089 Bacteria 1728
766 Ga0207676_10000656 3300026095 Bacteria 27723
767 Ga0207676_10055756 3300026095 Bacteria 3104
768 Ga0207676_10171438 3300026095 Bacteria 1891
769 Ga0207676_10220263 3300026095 Bacteria 1689
770 Ga0207676_10406427 3300026095 Bacteria 1274
771 Ga0207674_10026564 3300026116 Bacteria 6144
772 Ga0207674_10196987 3300026116 Bacteria 1964
773 Ga0207675_100001409 3300026118 Bacteria 24039
774 Ga0207675_100003635 3300026118 Bacteria 15040
775 Ga0207675_100004839 3300026118 Bacteria 12970
776 Ga0207675_100005359 3300026118 Bacteria 12311
777 Ga0207675_100025107 3300026118 Bacteria 5547
778 Ga0207675_100040984 3300026118 Bacteria 4325
779 Ga0207675_100063281 3300026118 Bacteria 3456
780 Ga0207675_100131377 3300026118 Bacteria 2375
781 Ga0207683_10000463 3300026121 Bacteria 37729
782 Ga0207683_10028847 3300026121 Bacteria 4801
783 Ga0207683_10041326 3300026121 Bacteria 4026
784 Ga0207683_10049390 3300026121 Bacteria 3683
785 Ga0207683_10059609 3300026121 Bacteria 3353
786 Ga0207683_10116269 3300026121 Bacteria 2398
787 Ga0207683_10360331 3300026121 Bacteria 1335
788 Ga0207698_10008240 3300026142 Bacteria 6578
789 Ga0207698_10015130 3300026142 Bacteria 5157
790 Ga0207698_10139450 3300026142 Bacteria 2086
791 Ga0207698_10210576 3300026142 Bacteria 1749
792 Ga0207698_10216552 3300026142 Bacteria 1727
793 Ga0207698_10412347 3300026142 Bacteria 1294
794 Ga0209588_1024000 3300027671 Bacteria 1925
795 Ga0209974_10014701 3300027876 Bacteria 2601
796 Ga0207428_10000055 3300027907 Bacteria 166460
797 Ga0207428_10198334 3300027907 Bacteria 1511
798 Ga0207428_10373913 3300027907 Bacteria 1046
799 Ga0268266_10001688 3300028379 Bacteria 25375
800 Ga0268266_10004161 3300028379 Bacteria 13950
801 Ga0268266_10013435 3300028379 Bacteria 7050
802 Ga0268266_10014245 3300028379 Bacteria 6838
803 Ga0268266_10022514 3300028379 Bacteria 5369
804 Ga0268266_10268317 3300028379 Bacteria 1584
805 Ga0268265_10019073 3300028380 Bacteria 4762
806 Ga0268265_10020317 3300028380 Bacteria 4634
807 Ga0268265_10031758 3300028380 Bacteria 3816
808 Ga0268265_10036898 3300028380 Bacteria 3583
809 Ga0268265_10045858 3300028380 Bacteria 3265
810 Ga0268265_10060622 3300028380 Bacteria 2900
811 Ga0268265_10120812 3300028380 Bacteria 2158
812 Ga0268265_10487658 3300028380 Bacteria 1159
813 Ga0268264_10027008 3300028381 Bacteria 4689
814 Ga0268264_10031040 3300028381 Bacteria 4381
815 Ga0268264_10050132 3300028381 Bacteria 3475
816 Ga0268264_10102078 3300028381 Bacteria 2495
817 Ga0268264_10146821 3300028381 Bacteria 2110
818 Ga0268264_10245924 3300028381 Bacteria 1659
819 Ga0268264_10359369 3300028381 Bacteria 1388
820 Ga0268264_10395543 3300028381 Bacteria 1327
821 Ga0307517_10000102 3300028786 Bacteria 123775
822 Ga0307517_10091558 3300028786 Bacteria 2482
823 Ga0307515_10000026 3300028794 Bacteria 382411
824 Ga0307515_10000130 3300028794 Bacteria 179263
825 Ga0307515_10005868 3300028794 Bacteria 24773
826 Ga0307511_10062115 3300030521 Bacteria 2839
827 Ga0307511_10105332 3300030521 Bacteria 1826
828 Ga0307512_10066553 3300030522 Bacteria 2721
829 Ga0265332_10044610 3300031238 Bacteria 1912
830 Ga0265328_10075366 3300031239 Bacteria 1241
831 Ga0265325_10033572 3300031241 Bacteria 2735
832 Ga0265325_10090164 3300031241 Bacteria 1513
833 Ga0265339_10001056 3300031249 Bacteria 20966
834 Ga0265331_10024029 3300031250 Bacteria 3089
835 Ga0265331_10027234 3300031250 Bacteria 2867
836 Ga0265316_10102464 3300031344 Bacteria 2174
837 Ga0307513_10004550 3300031456 Bacteria 18498
838 Ga0307513_10006865 3300031456 Bacteria 14820
839 Ga0307513_10011752 3300031456 Bacteria 10858
840 Ga0307513_10161071 3300031456 Bacteria 2137
841 Ga0307513_10207476 3300031456 Bacteria 1794
842 Ga0307513_10237260 3300031456 Bacteria 1632
843 Ga0307513_10412727 3300031456 Bacteria 1082
844 Ga0307509_10020922 3300031507 Bacteria 7415
845 Ga0307509_10077468 3300031507 Bacteria 3448
846 Ga0307509_10382066 3300031507 Bacteria 1121
847 Ga0307509_10434821 3300031507 Bacteria 1009
848 Ga0307408_100009454 3300031548 Bacteria 6431
849 Ga0307408_100190984 3300031548 Bacteria 1650
850 Ga0307408_100223010 3300031548 Bacteria 1539
851 Ga0307408_100306894 3300031548 Bacteria 1332
852 Ga0307408_100589190 3300031548 Bacteria 986
853 Ga0265313_10000044 3300031595 Bacteria 117063
854 Ga0265313_10040982 3300031595 Bacteria 2285
855 Ga0265313_10123276 3300031595 Bacteria 1128
856 Ga0307508_10066442 3300031616 Bacteria 3175
857 Ga0307508_10141035 3300031616 Bacteria 2014
858 Ga0307508_10206694 3300031616 Bacteria 1564
859 Ga0307508_10286396 3300031616 Bacteria 1241
860 Ga0307508_10387937 3300031616 Bacteria 987
861 Ga0265314_10060748 3300031711 Bacteria 2578
862 Ga0265314_10072215 3300031711 Bacteria 2306
863 Ga0265342_10037361 3300031712 Bacteria 2962
864 Ga0307516_10002286 3300031730 Bacteria 25850
865 Ga0307516_10003926 3300031730 Bacteria 18739
866 Ga0307516_10020911 3300031730 Bacteria 6753
867 Ga0307516_10042688 3300031730 Bacteria 4497
868 Ga0307516_10047076 3300031730 Bacteria 4252
869 Ga0307516_10130828 3300031730 Bacteria 2289
870 Ga0307516_10155104 3300031730 Bacteria 2046
871 Ga0307516_10345991 3300031730 Bacteria 1153
872 Ga0307516_10349497 3300031730 Bacteria 1144
873 Ga0307516_10421155 3300031730 Bacteria 993
874 Ga0307405_10179969 3300031731 Bacteria 1517
875 Ga0307410_10019322 3300031852 Bacteria 4142
876 Ga0307410_10041221 3300031852 Bacteria 3044
877 Ga0307410_10083488 3300031852 Bacteria 2250
878 Ga0307410_10203151 3300031852 Bacteria 1514
879 Ga0307410_10407633 3300031852 Bacteria 1100
880 Ga0307406_10061645 3300031901 Bacteria 2423
881 Ga0307406_10458268 3300031901 Bacteria 1025
882 Ga0307406_10537513 3300031901 Bacteria 954
883 Ga0307406_10613626 3300031901 Bacteria 898
884 Ga0307412_10152043 3300031911 Bacteria 1709
885 Ga0307412_10200185 3300031911 Bacteria 1516
886 Ga0307412_10303683 3300031911 Bacteria 1263
887 Ga0307412_10415584 3300031911 Bacteria 1099
888 Ga0307409_100018544 3300031995 Bacteria 4682
889 Ga0307409_100039177 3300031995 Bacteria 3514
890 Ga0307409_100043282 3300031995 Bacteria 3380
891 Ga0307416_100007618 3300032002 Bacteria 6907
892 Ga0307416_100037447 3300032002 Bacteria 3733
893 Ga0307416_100056078 3300032002 Bacteria 3177
894 Ga0307416_100615651 3300032002 Bacteria 1167
895 Ga0307416_100628839 3300032002 Bacteria 1156
896 Ga0307414_10024513 3300032004 Bacteria 3849
897 Ga0307414_10049458 3300032004 Bacteria 2907
898 Ga0307414_10114087 3300032004 Bacteria 2064
899 Ga0307414_10410036 3300032004 Bacteria 1179
900 Ga0307411_10074874 3300032005 Bacteria 2309
901 Ga0307411_10132876 3300032005 Bacteria 1822
902 Ga0307415_100068726 3300032126 Bacteria 2481
903 Ga0307507_10009514 3300033179 Bacteria 12901
904 Ga0307510_10000403 3300033180 Bacteria 41043
905 Ga0307510_10159973 3300033180 Bacteria 1851
906 Ga0373930_0002314 3300034816 Bacteria 2940
907 Ga0373958_0010594 3300034819 Bacteria 1541
908 Ga0373959_0059970 3300034820 Bacteria 840
909 Ga0373938_0021680 3300034957 Bacteria 1305
910 Ga0373928_0025870 3300035084 Bacteria 1268
911 Ga0373940_0001803 3300035088 Bacteria 3999
912 Ga0373940_0013447 3300035088 Bacteria 1981
913 Ga0373949_0035880 3300035090 Bacteria 1201
914 Ga0373932_0065455 3300035112 Bacteria 1115
915 Ga0373936_0058868 3300035113 Bacteria 1565
916 Ga0373945_0075361 3300035116 Bacteria 1284
917 Ga0373954_0065142 3300035118 Bacteria 1724
918 Ga0373956_0088068 3300035119 Bacteria 1430
919 Ga0373960_0108071 3300035121 Bacteria 909
920 Ga0373943_0183297 3300035170 Bacteria 1152
921 Ga0373943_0218080 3300035170 Bacteria 1062
922 Ga0373943_0238149 3300035170 Bacteria 1019
923 Ga0373946_0043305 3300035171 Bacteria 1854
924 Ga0373955_0031994 3300035172 Bacteria 2758
925 Ga0373955_0036165 3300035172 Bacteria 2619
926 Ga0373942_0013968 3300035207 Bacteria 1937
927 Ga0373962_0007243 3300035242 Bacteria 2715
928 Ga0373924_0013697 3300035410 Bacteria 3051
929 Ga0373931_0000221 3300035691 Bacteria 24293
930 Ga0373931_0144426 3300035691 Bacteria 1382
931 Ga0373931_0361801 3300035691 Bacteria 910
932 Ga0373935_0001741 3300035692 Bacteria 12210
933 Ga0373935_0029145 3300035692 Bacteria 3416
934 Ga0373935_0059489 3300035692 Bacteria 2442
935 Ga0373927_0000139 3300035695 Bacteria 56397
936 Ga0373927_0001969 3300035695 Bacteria 15149
937 Ga0373927_0021434 3300035695 Bacteria 4236
938 Ga0373927_0021765 3300035695 Bacteria 4202
939 Ga0373927_0028636 3300035695 Bacteria 3634
940 Ga0373927_0151088 3300035695 Bacteria 1520
941 Ga0373933_0007649 3300035724 Bacteria 5900
942 Ga0373933_0041090 3300035724 Bacteria 2728
943 Ga0373947_0001689 3300035725 Bacteria 13524
944 Ga0373947_0023523 3300035725 Bacteria 3585
945 Ga0373937_0009205 3300036401 Bacteria 8573
946 Ga0373937_0039005 3300036401 Bacteria 4328
947 Ga0373937_0050691 3300036401 Bacteria 3802
948 Ga0373937_0061257 3300036401 Bacteria 3459
949 Ga0373937_0177910 3300036401 Bacteria 1997
950 Ga0373937_0689912 3300036401 Bacteria 967
951 Ga0373925_0002233 3300037068 Bacteria 15725
952 Ga0373925_0014218 3300037068 Bacteria 5759
953 Ga0373925_0186614 3300037068 Bacteria 1644
954 Ga0373925_0336393 3300037068 Bacteria 1224
955 Ga0373925_0487456 3300037068 Bacteria 1011
956 Ga0373925_0770095 3300037068 Bacteria 793
957 Ga0395899_0027674 3300037312 Bacteria 4272
958 Ga0395899_0116590 3300037312 Bacteria 1916
959 Ga0395900_0029660 3300037418 Bacteria 5612
960 Ga0395900_0091357 3300037418 Bacteria 3129
961 Ga0395900_0095506 3300037418 Bacteria 3054
962 Ga0395900_0217555 3300037418 Bacteria 1927
963 Ga0395900_0376925 3300037418 Bacteria 1387
964 Ga0395898_0088943 3300037466 Bacteria 2972
965 Ga0395905_0000972 3300037471 Bacteria 36749
966 Ga0395905_0001399 3300037471 Bacteria 29219
967 Ga0395905_0021902 3300037471 Bacteria 6044
968 Ga0395905_0079268 3300037471 Bacteria 3078
969 Ga0395905_0083018 3300037471 Bacteria 3002
970 Ga0395905_0169130 3300037471 Bacteria 2053
971 Ga0395905_0888678 3300037471 Bacteria 794
972 Ga0436364_0432791 3300037853 Bacteria 1460
973 Ga0436364_1006337 3300037853 Bacteria 2505
974 Ga0436364_1104972 3300037853 Bacteria 3261
975 Ga0436364_1224731 3300037853 Bacteria 1368
976 Ga0436364_1463980 3300037853 Bacteria 6279
977 Ga0395901_0068908 3300038443 Bacteria 3684
978 Ga0395901_0119894 3300038443 Bacteria 2764
979 Ga0400483_085697 3300039062 Bacteria 5242
980 Ga0400483_125610 3300039062 Bacteria 3336
981 Ga0400483_202169 3300039062 Bacteria 8497
982 Ga0436365_0080604 3300039437 Bacteria 50922
983 Ga0436365_0095350 3300039437 Bacteria 3081
984 Ga0436365_0291258 3300039437 Bacteria 51712
985 Ga0436365_0484605 3300039437 Bacteria 1957
986 Ga0436365_0528920 3300039437 Bacteria 1726
987 Ga0436365_0709674 3300039437 Bacteria 6817
988 Ga0436365_1106760 3300039437 Bacteria 2716
989 Ga0436365_1107580 3300039437 Bacteria 3937
990 Ga0436365_1113050 3300039437 Bacteria 4531
991 Ga0436360_0806014 3300039438 Bacteria 1369
992 Ga0436360_1247364 3300039438 Bacteria 2145
993 Ga0436361_0316835 3300039447 Bacteria 2244
994 Ga0436361_0438285 3300039447 Bacteria 2408
995 Ga0436361_0655965 3300039447 Bacteria 2076
996 Ga0436363_0250085 3300039450 Bacteria 26739
997 Ga0436363_0470149 3300039450 Bacteria 2009
998 Ga0436363_0691653 3300039450 Bacteria 2687
999 Ga0436363_0706677 3300039450 Bacteria 4790
1000 Ga0436362_0039268 3300039453 Bacteria 3827
1001 Ga0436362_1130295 3300039453 Bacteria 10966
1002 Ga0439436_0007480 3300041404 Bacteria 3360
1003 Ga0439439_0029003 3300041406 Bacteria 1404
1004 Ga0439453_0000158 3300041408 Bacteria 6141
1005 Ga0439465_0001656 3300041413 Bacteria 7272
1006 Ga0439465_0005428 3300041413 Bacteria 4068
1007 Ga0439465_0040068 3300041413 Bacteria 1513
1008 Ga0451798_0384754 3300041458 Bacteria 1400
1009 Ga0451855_1802886 3300041511 Bacteria 1509
1010 Ga0439443_008804 3300042003 Bacteria 1433
1011 Ga0439449_0037385 3300042007 Bacteria 1806
1012 Ga0439449_0063712 3300042007 Bacteria 1360
1013 Ga0439455_0022404 3300042012 Bacteria 1514
1014 Ga0450920_003262 3300042122 Bacteria 2801
1015 Ga0439458_0011139 3300042157 Bacteria 2009
1016 Ga0439434_0017132 3300042435 Bacteria 2167
1017 Ga0439435_0001732 3300042436 Bacteria 4136
1018 Ga0439435_0036134 3300042436 Bacteria 1364
1019 Ga0439460_0014937 3300042461 Bacteria 2048
1020 Ga0450918_001827 3300042531 Bacteria 4141
1021 Ga0466969_0003525 3300044656 Bacteria 8316
1022 Ga0466966_0010452 3300044684 Bacteria 6165
1023 Ga0466961_0005081 3300044693 Bacteria 8279
1024 Ga0453684_0015661 3300044712 Bacteria 11951
1025 Ga0453684_0418952 3300044712 Bacteria 1496
1026 Ga0466959_0012816 3300045049 Bacteria 6066
1027 Ga0451576_0294890 3300045051 Bacteria 1695
1028 Ga0451576_0350453 3300045051 Bacteria 1546
1029 Ga0466967_0096052 3300045976 Bacteria 2703
1030 Ga0466967_0416290 3300045976 Bacteria 1309
1031 Ga0495617_056816 3300046452 Bacteria 1297
1032 Ga0495592_0057749 3300046454 Bacteria 2864
1033 Ga0495592_0118533 3300046454 Bacteria 1865
1034 Ga0495592_0216459 3300046454 Bacteria 1283
1035 Ga0495603_0051016 3300046455 Bacteria 2459
1036 Ga0495603_0130629 3300046455 Bacteria 1463
1037 Ga0495603_0214800 3300046455 Bacteria 1110
1038 Ga0495590_0007845 3300046457 Bacteria 4097
1039 Ga0495590_0014862 3300046457 Bacteria 2837
1040 Ga0495629_0089881 3300046459 Bacteria 2142
1041 Ga0495638_0010023 3300046460 Bacteria 6606
1042 Ga0495638_0019892 3300046460 Bacteria 4439
1043 Ga0495638_0023502 3300046460 Bacteria 4030
1044 Ga0495638_0052267 3300046460 Bacteria 2545
1045 Ga0495638_0078706 3300046460 Bacteria 2005
1046 Ga0495651_0099829 3300046462 Bacteria 2164
1047 Ga0495651_0298201 3300046462 Bacteria 1082
1048 Ga0495580_0044247 3300046472 Bacteria 3167
1049 Ga0495605_0009156 3300046474 Bacteria 5570
1050 Ga0495639_0009873 3300046475 Bacteria 4099
1051 Ga0495639_0093753 3300046475 Bacteria 1411
1052 Ga0495639_0128881 3300046475 Bacteria 1210
1053 Ga0495662_0123159 3300046476 Bacteria 1273
1054 Ga0495664_0001193 3300046477 Bacteria 13561
1055 Ga0495664_0006956 3300046477 Bacteria 6264
1056 Ga0495664_0010170 3300046477 Bacteria 5280
1057 Ga0495664_0046765 3300046477 Bacteria 2568
1058 Ga0495584_0040470 3300046491 Bacteria 2353
1059 Ga0495584_0131277 3300046491 Bacteria 1271
1060 Ga0495585_0023268 3300046492 Bacteria 3556
1061 Ga0495585_0031741 3300046492 Bacteria 2997
1062 Ga0495585_0057444 3300046492 Bacteria 2147
1063 Ga0495594_0117183 3300046499 Bacteria 1504
1064 Ga0495596_0018291 3300046500 Bacteria 2889
1065 Ga0495607_0106584 3300046501 Bacteria 1492
1066 Ga0495583_0073517 3300046506 Bacteria 1498
1067 Ga0495606_0002308 3300046507 Bacteria 22483
1068 Ga0495606_0242604 3300046507 Bacteria 1004
1069 Ga0495608_0013378 3300046511 Bacteria 5691
1070 Ga0495608_0091303 3300046511 Bacteria 1970
1071 Ga0495610_0016205 3300046512 Bacteria 4302
1072 Ga0495610_0021848 3300046512 Bacteria 3511
1073 Ga0495610_0167975 3300046512 Bacteria 922
1074 Ga0495616_0020982 3300046513 Bacteria 3546
1075 Ga0495618_0087433 3300046514 Bacteria 1993
1076 Ga0495620_0019783 3300046515 Bacteria 3301
1077 Ga0495620_0027127 3300046515 Bacteria 2685
1078 Ga0495620_0084744 3300046515 Bacteria 1278
1079 Ga0495628_0040093 3300046516 Bacteria 3744
1080 Ga0495628_0206249 3300046516 Bacteria 1480
1081 Ga0495630_0002691 3300046517 Bacteria 12335
1082 Ga0495630_0009681 3300046517 Bacteria 6932
1083 Ga0495630_0179043 3300046517 Bacteria 1616
1084 Ga0495631_0027363 3300046518 Bacteria 2610
1085 Ga0495631_0161637 3300046518 Bacteria 961
1086 Ga0495637_0048020 3300046520 Bacteria 1800
1087 Ga0495643_0016345 3300046522 Bacteria 4358
1088 Ga0495643_0016823 3300046522 Bacteria 4291
1089 Ga0495643_0031187 3300046522 Bacteria 2968
1090 Ga0495644_0031331 3300046523 Bacteria 2009
1091 Ga0495644_0056906 3300046523 Bacteria 1469
1092 Ga0495648_0019848 3300046524 Bacteria 4706
1093 Ga0495648_0033917 3300046524 Bacteria 3329
1094 Ga0495648_0165670 3300046524 Bacteria 1138
1095 Ga0495666_0016302 3300046526 Bacteria 3701
1096 Ga0495642_0021749 3300046528 Bacteria 2524
1097 Ga0495642_0024106 3300046528 Bacteria 2406
1098 Ga0495642_0036830 3300046528 Bacteria 1978
1099 Ga0495654_0027025 3300046530 Bacteria 2945
1100 Ga0495665_0010250 3300046531 Bacteria 5072
1101 Ga0495665_0050823 3300046531 Bacteria 2197
1102 Ga0495640_0030810 3300046533 Bacteria 3836
1103 Ga0495640_0139113 3300046533 Bacteria 1566
1104 Ga0495587_0054018 3300046536 Bacteria 2368
1105 Ga0495598_0001316 3300046537 Bacteria 4867
1106 Ga0495621_0028212 3300046539 Bacteria 1907
1107 Ga0495621_0073041 3300046539 Bacteria 1267
1108 Ga0495597_0011373 3300046542 Bacteria 4316
1109 Ga0495597_0013824 3300046542 Bacteria 3858
1110 Ga0495597_0060331 3300046542 Bacteria 1655
1111 Ga0495645_0002601 3300046543 Bacteria 12270
1112 Ga0495667_0012733 3300046559 Bacteria 5701
1113 Ga0495667_0013502 3300046559 Bacteria 5526
1114 Ga0495667_0186767 3300046559 Bacteria 1329
1115 Ga0495656_0000201 3300046615 Bacteria 21369
1116 Ga0495656_0001707 3300046615 Bacteria 7194
1117 Ga0495656_0038424 3300046615 Bacteria 1982
1118 Ga0495656_0069385 3300046615 Bacteria 1561
1119 Ga0495668_0093858 3300046616 Bacteria 1643
1120 Ga0495634_0032374 3300046642 Bacteria 3596
1121 Ga0495611_0125277 3300046648 Bacteria 1198
1122 Ga0495625_0003440 3300046660 Bacteria 15790
1123 Ga0495625_0157101 3300046660 Bacteria 1525
1124 Ga0495625_0209204 3300046660 Bacteria 1283
1125 Ga0495635_0315518 3300046663 Bacteria 1047
1126 Ga0495661_0111480 3300046665 Bacteria 1524
1127 Ga0495588_0066318 3300046674 Bacteria 1873
1128 Ga0495588_0218852 3300046674 Bacteria 1005
1129 Ga0495657_0127373 3300046675 Bacteria 1598
1130 Ga0495599_0014021 3300046678 Bacteria 4961
1131 Ga0495623_0140356 3300046679 Bacteria 1438
1132 Ga0495646_0034557 3300046680 Bacteria 3139
1133 Ga0495646_0049579 3300046680 Bacteria 2548
1134 Ga0495658_0086519 3300046683 Bacteria 1849
1135 Ga0495658_0152836 3300046683 Bacteria 1419
1136 Ga0495658_0169234 3300046683 Bacteria 1351
1137 Ga0495669_0014685 3300046684 Bacteria 3348
1138 Ga0495669_0068550 3300046684 Bacteria 1614
1139 Ga0495613_0165200 3300046689 Bacteria 1573
1140 Ga0495624_0084998 3300046690 Bacteria 1955
1141 Ga0495670_0077621 3300046691 Bacteria 1688
1142 Ga0495671_0013120 3300046692 Bacteria 4501
1143 Ga0495649_0073721 3300046694 Bacteria 1829
1144 Ga0495600_0014445 3300046809 Bacteria 4977
1145 Ga0495600_0121970 3300046809 Bacteria 1695
1146 Ga0495660_0068273 3300046810 Bacteria 1892
1147 Ga0495581_0183313 3300047315 Bacteria 1224
1148 Ga0495581_0358551 3300047315 Bacteria 851
1149 Ga0495604_0017364 3300047317 Bacteria 5760
1150 Ga0495604_0050776 3300047317 Bacteria 3219
1151 Ga0495674_0003734 3300047319 Bacteria 14802
1152 Ga0495674_0019590 3300047319 Bacteria 6277
1153 Ga0495674_0066087 3300047319 Bacteria 3139
1154 Ga0495674_0075206 3300047319 Bacteria 2907
1155 Ga0495674_0635030 3300047319 Bacteria 843
1156 Ga0495672_0120073 3300047320 Bacteria 1398
1157 Ga0495676_0252845 3300047321 Bacteria 1201
1158 Ga0495680_0318562 3300047322 Bacteria 1089
1159 Ga0495687_000636 3300047443 Bacteria 40190
1160 Ga0495687_053901 3300047443 Bacteria 1691
1161 Ga0495675_0016558 3300047444 Bacteria 4664
1162 Ga0495675_0243056 3300047444 Bacteria 1083
1163 Ga0495677_0039577 3300047445 Bacteria 1723
1164 Ga0495673_0019819 3300047469 Bacteria 3363
1165 Ga0495684_0260261 3300047471 Bacteria 1259
1166 Ga0495686_0001513 3300047472 Bacteria 25024
1167 Ga0495686_0044699 3300047472 Bacteria 2803
1168 Ga0495686_0050724 3300047472 Bacteria 2607
1169 Ga0495686_0092606 3300047472 Bacteria 1833
1170 Ga0495686_0122347 3300047472 Bacteria 1549
1171 Ga0495593_0120701 3300047673 Bacteria 1334
1172 Ga0495602_0004753 3300048088 Bacteria 14201
1173 Ga0495602_0125217 3300048088 Bacteria 2060
1174 Ga0495614_0138734 3300048089 Bacteria 1080
1175 Ga0495614_0176856 3300048089 Bacteria 959
1176 Ga0495615_0008681 3300048090 Bacteria 1974
1177 Ga0495626_0028174 3300048091 Bacteria 2725
1178 Ga0495626_0159647 3300048091 Bacteria 946
1179 Ga0496100_0029263 3300048903 Bacteria 3405
1180 Ga0496101_0088114 3300048904 Bacteria 2305
1181 Ga0496101_0159819 3300048904 Bacteria 1728
1182 Ga0496102_0003637 3300048905 Bacteria 13037
1183 Ga0496102_0269043 3300048905 Bacteria 1607
1184 Ga0496102_0371850 3300048905 Bacteria 1345
1185 Ga0496102_0633484 3300048905 Bacteria 992
1186 Ga0496104_0167233 3300048907 Bacteria 2108
1187 Ga0496105_0003045 3300048908 Bacteria 12322
1188 Ga0496105_0004996 3300048908 Bacteria 10039
1189 Ga0496105_0377778 3300048908 Bacteria 1128
1190 Ga0496106_0000089 3300048909 Bacteria 72356
1191 Ga0496106_0000244 3300048909 Bacteria 37887
1192 Ga0496106_0006866 3300048909 Bacteria 8425
1193 Ga0496106_0070480 3300048909 Bacteria 2670
1194 Ga0496106_0530957 3300048909 Bacteria 945
1195 Ga0496106_0610108 3300048909 Bacteria 874
1196 Ga0496107_0016369 3300048910 Bacteria 5204
1197 Ga0496107_0458134 3300048910 Bacteria 947
1198 Ga0496108_0035648 3300048911 Bacteria 4136
1199 Ga0496108_0287346 3300048911 Bacteria 1432
1200 Ga0496108_0661789 3300048911 Bacteria 907
1201 Ga0496108_0698079 3300048911 Bacteria 880
1202 Ga0496109_0006604 3300048912 Bacteria 9767
1203 Ga0496109_0145378 3300048912 Bacteria 2218
1204 Ga0496109_0456873 3300048912 Bacteria 1206
1205 Ga0496109_0511747 3300048912 Bacteria 1133
1206 Ga0496110_0001819 3300048913 Bacteria 15723
1207 Ga0496110_0050345 3300048913 Bacteria 3657
1208 Ga0496110_0085247 3300048913 Bacteria 2820
1209 Ga0496110_0248324 3300048913 Bacteria 1619
1210 Ga0496111_0143633 3300048914 Bacteria 1769
1211 Ga0496112_0003238 3300048915 Bacteria 13412
1212 Ga0496112_0012529 3300048915 Bacteria 7790
1213 Ga0496112_0138882 3300048915 Bacteria 2400
1214 Ga0496112_0145815 3300048915 Bacteria 2336
1215 Ga0496113_0012993 3300048916 Bacteria 5618
1216 Ga0496113_0140626 3300048916 Bacteria 1899
1217 Ga0496114_0287786 3300048917 Bacteria 1449
1218 Ga0496115_0033571 3300048918 Bacteria 4052
1219 Ga0496115_0167400 3300048918 Bacteria 1818
1220 Ga0496117_0051502 3300048920 Bacteria 2910
1221 Ga0496117_0079523 3300048920 Bacteria 2160
1222 Ga0496118_0004232 3300048921 Bacteria 17221
1223 Ga0496118_0021785 3300048921 Bacteria 5627
1224 Ga0496118_0027353 3300048921 Bacteria 4829
1225 Ga0496118_0039503 3300048921 Bacteria 3764
1226 Ga0496118_0049073 3300048921 Bacteria 3253
1227 Ga0496118_0054398 3300048921 Bacteria 3032
1228 Ga0496118_0146758 3300048921 Bacteria 1484
1229 Ga0496118_0157581 3300048921 Bacteria 1410
1230 Ga0496119_0030275 3300048922 Bacteria 3654
1231 Ga0496119_0038482 3300048922 Bacteria 3090
1232 Ga0496119_0075543 3300048922 Bacteria 1958
1233 Ga0496120_0004296 3300048923 Bacteria 12080
1234 Ga0496120_0060488 3300048923 Bacteria 2119
1235 Ga0496121_0009702 3300048924 Bacteria 11021
1236 Ga0496121_0012571 3300048924 Bacteria 9209
1237 Ga0496121_0013490 3300048924 Bacteria 8771
1238 Ga0496121_0016499 3300048924 Bacteria 7621
1239 Ga0496121_0024781 3300048924 Bacteria 5722
1240 Ga0496121_0035975 3300048924 Bacteria 4423
1241 Ga0496121_0056807 3300048924 Bacteria 3248
1242 Ga0496121_0059968 3300048924 Bacteria 3134
1243 Ga0496121_0095041 3300048924 Bacteria 2317
1244 Ga0496121_0095365 3300048924 Bacteria 2312
1245 Ga0496121_0098369 3300048924 Bacteria 2264
1246 Ga0496122_0116596 3300048925 Bacteria 1736
1247 Ga0496123_0215154 3300048926 Bacteria 973
1248 Ga0496124_0004856 3300048927 Bacteria 15458
1249 Ga0496124_0016982 3300048927 Bacteria 6889
1250 Ga0496124_0056724 3300048927 Bacteria 3302
1251 Ga0496124_0187153 3300048927 Bacteria 1588
1252 Ga0496124_0243589 3300048927 Bacteria 1335
1253 Ga0496125_0002684 3300048928 Bacteria 22676
1254 Ga0496125_0014515 3300048928 Bacteria 7668
1255 Ga0496125_0040917 3300048928 Bacteria 3968
1256 Ga0496125_0147210 3300048928 Bacteria 1625
1257 Ga0496126_0001193 3300048929 Bacteria 42367
1258 Ga0496126_0015119 3300048929 Bacteria 7773
1259 Ga0496126_0019399 3300048929 Bacteria 6697
1260 Ga0496126_0066929 3300048929 Bacteria 3211
1261 Ga0496126_0148270 3300048929 Bacteria 2013
1262 Ga0496126_0236359 3300048929 Bacteria 1528
1263 Ga0496126_0339699 3300048929 Bacteria 1230
1264 Ga0496126_0369161 3300048929 Bacteria 1170
1265 Ga0495678_020140 3300049459 Bacteria 2960
1266 Ga0501298_001895 3300049521 Bacteria 3113
1267 Ga0501031_0000009 3300049568 Bacteria 155116
1268 Ga0501031_0014617 3300049568 Bacteria 5103
1269 Ga0501031_0018659 3300049568 Bacteria 4517
1270 Ga0501032_0000017 3300049569 Bacteria 158303
1271 Ga0501032_0042254 3300049569 Bacteria 3092
1272 Ga0501032_0042410 3300049569 Bacteria 3086
1273 Ga0501032_0055957 3300049569 Bacteria 2653
1274 Ga0501032_0077697 3300049569 Bacteria 2210
1275 Ga0501032_0116702 3300049569 Bacteria 1765
1276 Ga0501032_0375624 3300049569 Bacteria 914
1277 Ga0501033_0000029 3300049570 Bacteria 158294
1278 Ga0501033_0000210 3300049570 Bacteria 55950
1279 Ga0501033_0014151 3300049570 Bacteria 6065
1280 Ga0501033_0029259 3300049570 Bacteria 4140
1281 Ga0501033_0040867 3300049570 Bacteria 3462
1282 Ga0501033_0050293 3300049570 Bacteria 3092
1283 Ga0501033_0142089 3300049570 Bacteria 1735
1284 Ga0501033_0226633 3300049570 Bacteria 1329
1285 Ga0501034_0000102 3300049571 Bacteria 158302
1286 Ga0501034_0010066 3300049571 Bacteria 9869
1287 Ga0501034_0022378 3300049571 Bacteria 6443
1288 Ga0501034_0058070 3300049571 Bacteria 3889
1289 Ga0501034_0080355 3300049571 Bacteria 3263
1290 Ga0501034_0111704 3300049571 Bacteria 2723
1291 Ga0501034_0131166 3300049571 Bacteria 2489
1292 Ga0501034_0138098 3300049571 Bacteria 2418
1293 Ga0501034_0154056 3300049571 Bacteria 2273
1294 Ga0501034_0185301 3300049571 Bacteria 2045
1295 Ga0501036_0000011 3300049572 Bacteria 158302
1296 Ga0501036_0028446 3300049572 Bacteria 4723
1297 Ga0501036_0029066 3300049572 Bacteria 4672
1298 Ga0501036_0112113 3300049572 Bacteria 2305
1299 Ga0501036_0151100 3300049572 Bacteria 1959
1300 Ga0501036_0167560 3300049572 Bacteria 1851
1301 Ga0501036_0270847 3300049572 Bacteria 1422
1302 Ga0501036_0308729 3300049572 Bacteria 1323
1303 Ga0501036_0505528 3300049572 Bacteria 1005
1304 Ga0501036_0580523 3300049572 Bacteria 931
1305 Ga0501036_0754375 3300049572 Bacteria 803
1306 Ga0501037_0000015 3300049573 Bacteria 161311
1307 Ga0501037_0015564 3300049573 Bacteria 5597
1308 Ga0501037_0036508 3300049573 Bacteria 3621
1309 Ga0501037_0140858 3300049573 Bacteria 1726
1310 Ga0501037_0154317 3300049573 Bacteria 1640
1311 Ga0501037_0220141 3300049573 Bacteria 1336
1312 Ga0501037_0226416 3300049573 Bacteria 1314
1313 Ga0501038_0000016 3300049574 Bacteria 159150
1314 Ga0501038_0016141 3300049574 Bacteria 6777
1315 Ga0501038_0017713 3300049574 Bacteria 6438
1316 Ga0501038_0043422 3300049574 Bacteria 3909
1317 Ga0501038_0064206 3300049574 Bacteria 3132
1318 Ga0501038_0071775 3300049574 Bacteria 2936
1319 Ga0501038_0089947 3300049574 Bacteria 2574
1320 Ga0501038_0093812 3300049574 Bacteria 2510
1321 Ga0501038_0345032 3300049574 Bacteria 1161
1322 Ga0501039_0000023 3300049575 Bacteria 158026
1323 Ga0501039_0004433 3300049575 Bacteria 10598
1324 Ga0501039_0028219 3300049575 Bacteria 4319
1325 Ga0501039_0031181 3300049575 Bacteria 4109
1326 Ga0501039_0119894 3300049575 Bacteria 2061
1327 Ga0501039_0133599 3300049575 Bacteria 1948
1328 Ga0501039_0325715 3300049575 Bacteria 1208
1329 Ga0501039_0417542 3300049575 Bacteria 1054
1330 Ga0501040_0008206 3300049576 Bacteria 6790
1331 Ga0501040_0019932 3300049576 Bacteria 4465
1332 Ga0501040_0026385 3300049576 Bacteria 3907
1333 Ga0501040_0026743 3300049576 Bacteria 3881
1334 Ga0501040_0148247 3300049576 Bacteria 1654
1335 Ga0501040_0181154 3300049576 Bacteria 1494
1336 Ga0501041_0025799 3300049577 Bacteria 3533
1337 Ga0501041_0408741 3300049577 Bacteria 860
1338 Ga0501042_0013408 3300049578 Bacteria 5577
1339 Ga0501042_0013841 3300049578 Bacteria 5495
1340 Ga0501043_0023532 3300049579 Bacteria 4832
1341 Ga0501043_0032719 3300049579 Bacteria 4089
1342 Ga0501043_0033981 3300049579 Bacteria 4011
1343 Ga0501043_0035819 3300049579 Bacteria 3904
1344 Ga0501043_0062648 3300049579 Bacteria 2920
1345 Ga0501043_0098517 3300049579 Bacteria 2298
1346 Ga0501043_0157612 3300049579 Bacteria 1775
1347 Ga0501046_0025041 3300049580 Bacteria 4888
1348 Ga0501046_0059780 3300049580 Bacteria 2984
1349 Ga0501046_0174005 3300049580 Bacteria 1614
1350 Ga0501047_0003203 3300049581 Bacteria 15516
1351 Ga0501047_0026623 3300049581 Bacteria 5565
1352 Ga0501047_0047340 3300049581 Bacteria 4155
1353 Ga0501047_0048280 3300049581 Bacteria 4110
1354 Ga0501047_0068877 3300049581 Bacteria 3408
1355 Ga0501047_0075275 3300049581 Bacteria 3248
1356 Ga0501047_0172479 3300049581 Bacteria 2031
1357 Ga0501047_0396161 3300049581 Bacteria 1214
1358 Ga0501048_0001620 3300049582 Bacteria 17135
1359 Ga0501067_0058783 3300049583 Bacteria 2128
1360 Ga0501067_0070588 3300049583 Bacteria 1934
1361 Ga0501067_0257412 3300049583 Bacteria 972
1362 Ga0501068_0009831 3300049584 Bacteria 5357
1363 Ga0501068_0015059 3300049584 Bacteria 4434
1364 Ga0501068_0016664 3300049584 Bacteria 4238
1365 Ga0501068_0225359 3300049584 Bacteria 1192
1366 Ga0501068_0251236 3300049584 Bacteria 1127
1367 Ga0501069_0084739 3300049585 Bacteria 1788
1368 Ga0501070_0018522 3300049586 Bacteria 5841
1369 Ga0501070_0018945 3300049586 Bacteria 5773
1370 Ga0501070_0020275 3300049586 Bacteria 5576
1371 Ga0501070_0025557 3300049586 Bacteria 4953
1372 Ga0501070_0037015 3300049586 Bacteria 4074
1373 Ga0501070_0068629 3300049586 Bacteria 2935
1374 Ga0501070_0133287 3300049586 Bacteria 2052
1375 Ga0501070_0209466 3300049586 Bacteria 1600
1376 Ga0501071_0017388 3300049587 Bacteria 4959
1377 Ga0501071_0039620 3300049587 Bacteria 3371
1378 Ga0501071_0050093 3300049587 Bacteria 3008
1379 Ga0501071_0184284 3300049587 Bacteria 1565
1380 Ga0501071_0205630 3300049587 Bacteria 1480
1381 Ga0501071_0217406 3300049587 Bacteria 1438
1382 Ga0501071_0315002 3300049587 Bacteria 1187
1383 Ga0501072_0037641 3300049588 Bacteria 3794
1384 Ga0501072_0049250 3300049588 Bacteria 3316
1385 Ga0501072_0083812 3300049588 Bacteria 2527
1386 Ga0501073_0005813 3300049589 Bacteria 9217
1387 Ga0501073_0008806 3300049589 Bacteria 7463
1388 Ga0501073_0019992 3300049589 Bacteria 4829
1389 Ga0501073_0042901 3300049589 Bacteria 3191
1390 Ga0501073_0066141 3300049589 Bacteria 2520
1391 Ga0501073_0073408 3300049589 Bacteria 2382
1392 Ga0501073_0077498 3300049589 Bacteria 2313
1393 Ga0501073_0138474 3300049589 Bacteria 1687
1394 Ga0501074_0047062 3300049590 Bacteria 3118
1395 Ga0501074_0060169 3300049590 Bacteria 2736
1396 Ga0501074_0065331 3300049590 Bacteria 2619
1397 Ga0501074_0155968 3300049590 Bacteria 1631
1398 Ga0501074_0165729 3300049590 Bacteria 1578
1399 Ga0501074_0385325 3300049590 Bacteria 994
1400 Ga0501075_0000163 3300049591 Bacteria 34323
1401 Ga0501075_0020817 3300049591 Bacteria 4775
1402 Ga0501075_0087012 3300049591 Bacteria 2368
1403 Ga0501076_0000053 3300049592 Bacteria 56853
1404 Ga0501076_0011116 3300049592 Bacteria 6697
1405 Ga0501076_0025466 3300049592 Bacteria 4578
1406 Ga0501076_0152505 3300049592 Bacteria 1880
1407 Ga0501076_0227431 3300049592 Bacteria 1525
1408 Ga0501076_0322436 3300049592 Bacteria 1267
1409 Ga0501077_0015654 3300049593 Bacteria 4777
1410 Ga0501077_0039624 3300049593 Bacteria 3002
1411 Ga0501077_0137745 3300049593 Bacteria 1548
1412 Ga0501077_0399241 3300049593 Bacteria 879
1413 Ga0501257_006345 3300049686 Bacteria 2624
1414 Ga0501079_0014659 3300049741 Bacteria 5977
1415 Ga0501079_0035053 3300049741 Bacteria 3861
1416 Ga0501079_0045986 3300049741 Bacteria 3368
1417 Ga0501079_0305361 3300049741 Bacteria 1245
1418 Ga0501079_0394709 3300049741 Bacteria 1085
1419 Ga0501079_0406008 3300049741 Bacteria 1069
1420 Ga0501080_0021292 3300049742 Bacteria 6001
1421 Ga0501080_0033395 3300049742 Bacteria 4802
1422 Ga0501080_0034299 3300049742 Bacteria 4737
1423 Ga0501080_0036427 3300049742 Bacteria 4592
1424 Ga0501080_0044767 3300049742 Bacteria 4119
1425 Ga0501080_0053973 3300049742 Bacteria 3742
1426 Ga0501080_0073436 3300049742 Bacteria 3182
1427 Ga0501080_0212505 3300049742 Bacteria 1773
1428 Ga0501081_0005369 3300049743 Bacteria 8270
1429 Ga0501081_0074096 3300049743 Bacteria 2375
1430 Ga0501081_0102062 3300049743 Bacteria 2029
1431 Ga0501081_0326101 3300049743 Bacteria 1129
1432 Ga0501083_0031312 3300049744 Bacteria 3651
1433 Ga0501083_0057902 3300049744 Bacteria 2594
1434 Ga0501083_0072113 3300049744 Bacteria 2296
1435 Ga0501083_0137946 3300049744 Bacteria 1597
1436 Ga0501083_0374056 3300049744 Bacteria 926
1437 Ga0501035_0000038 3300049822 Bacteria 158818
1438 Ga0501035_0003069 3300049822 Bacteria 16026
1439 Ga0501035_0025834 3300049822 Bacteria 5381
1440 Ga0501035_0076163 3300049822 Bacteria 2967
1441 Ga0501035_0105264 3300049822 Bacteria 2473
1442 Ga0501035_0194557 3300049822 Bacteria 1742
1443 Ga0501035_0198470 3300049822 Bacteria 1722
1444 Ga0501035_0259307 3300049822 Bacteria 1474
1445 Ga0501035_0500299 3300049822 Bacteria 1000
1446 Ga0501035_0518539 3300049822 Bacteria 979
1447 Ga0501044_0000046 3300049823 Bacteria 146812
1448 Ga0501044_0028299 3300049823 Bacteria 5915
1449 Ga0501044_0060853 3300049823 Bacteria 3864
1450 Ga0501044_0085509 3300049823 Bacteria 3187
1451 Ga0501044_0155718 3300049823 Bacteria 2264
1452 Ga0501044_0165843 3300049823 Bacteria 2183
1453 Ga0501044_0223045 3300049823 Bacteria 1835
1454 Ga0501044_0574492 3300049823 Bacteria 1022
1455 Ga0501045_0026735 3300049824 Bacteria 4153
1456 Ga0501045_0033596 3300049824 Bacteria 3719
1457 Ga0501045_0126575 3300049824 Bacteria 1898
1458 Ga0501045_0195777 3300049824 Bacteria 1506
1459 Ga0501045_0243791 3300049824 Bacteria 1338
1460 Ga0501045_0530819 3300049824 Bacteria 873
1461 nmdc:mga03n38_24270_c1 3300050490 Bacteria 2477
1462 nmdc:mga03n38_299517_c1 3300050490 Bacteria 863
1463 nmdc:mga03n38_42252_c1 3300050490 Bacteria 1992
1464 nmdc:mga00v17_46612_c1 3300050491 Bacteria 2623
1465 nmdc:mga00v17_68047_c1 3300050491 Bacteria 2201
1466 nmdc:mga00v17_78770_c1 3300050491 Bacteria 2054
1467 nmdc:mga0yw44_104110_c1 3300050492 Bacteria 1811
1468 nmdc:mga0yw44_114611_c1 3300050492 Bacteria 1730
1469 nmdc:mga0yw44_17726_c1 3300050492 Bacteria 3883
1470 nmdc:mga0yw44_5085_c1 3300050492 Bacteria 6149
1471 nmdc:mga0yw44_71757_c1 3300050492 Bacteria 2151
1472 nmdc:mga0yw44_7481_c1 3300050492 Bacteria 5379
1473 nmdc:mga0yw44_8283_c1 3300050492 Bacteria 5167
1474 nmdc:mga0k408_137152_c1 3300050493 Bacteria 1454
1475 nmdc:mga0k408_1436_c1 3300050493 Bacteria 12900
1476 nmdc:mga0k408_37877_c1 3300050493 Bacteria 2769
1477 nmdc:mga0k408_4087_c1 3300050493 Bacteria 7746
1478 nmdc:mga06z11_10062_c1 3300050494 Bacteria 4013
1479 nmdc:mga06z11_18996_c1 3300050494 Bacteria 3151
1480 nmdc:mga06z11_96099_c1 3300050494 Bacteria 1618
1481 nmdc:mga04h51_141771_c1 3300050495 Bacteria 912
1482 nmdc:mga04h51_3374_c1 3300050495 Bacteria 3879
1483 nmdc:mga07m45_15562_c1 3300050496 Bacteria 4062
1484 nmdc:mga07m45_38336_c1 3300050496 Bacteria 2674
1485 nmdc:mga05p37_155007_c1 3300050507 Bacteria 2800
1486 nmdc:mga05p37_233069_c1 3300050507 Bacteria 2217
1487 nmdc:mga09592_244179_c1 3300050508 Bacteria 1556
1488 nmdc:mga0qj67_49363_c1 3300050509 Bacteria 3327
1489 nmdc:mga06r32_3096_c1 3300050510 Bacteria 14894
1490 nmdc:mga06r32_76935_c1 3300050510 Bacteria 3241
1491 nmdc:mga08y16_212436_c1 3300050511 Bacteria 2004
1492 nmdc:mga08y16_473803_c1 3300050511 Bacteria 1274
1493 nmdc:mga08y16_595_c1 3300050511 Bacteria 33721
1494 nmdc:mga08y16_955572_c1 3300050511 Bacteria 840
1495 nmdc:mga0n895_71252_c1 3300050512 Bacteria 3446
1496 nmdc:mga0n895_782_c1 3300050512 Bacteria 22642
1497 nmdc:mga0rr50_24139_c1 3300050513 Bacteria 4207
1498 nmdc:mga0a205_216920_c1 3300050515 Bacteria 1800
1499 nmdc:mga0a205_377503_c1 3300050515 Bacteria 1283
1500 nmdc:mga0a205_6389_c1 3300050515 Bacteria 10647
1501 nmdc:mga0sz30_2709_c1 3300050516 Bacteria 6320
1502 nmdc:mga0sz30_42656_c1 3300050516 Bacteria 1909
1503 nmdc:mga0sz30_51037_c1 3300050516 Bacteria 1754
1504 Ga0495601_0000401 3300053077 Bacteria 22929
1505 Ga0495601_0041759 3300053077 Bacteria 2876
1506 Ga0495612_0004593 3300053078 Bacteria 5724
1507 Ga0500635_0001263 3300053080 Bacteria 6038
1508 Ga0495655_0006637 3300053083 Bacteria 2115
1509 Ga0495595_0028715 3300053084 Bacteria 2486
1510 Ga0495619_0021683 3300053085 Bacteria 4104
1511 Ga0495619_0065107 3300053085 Bacteria 2431
1512 Ga0495619_0086737 3300053085 Bacteria 2116
1513 Ga0495619_0119100 3300053085 Bacteria 1809
1514 Ga0500578_0039666 3300053086 Bacteria 3026
1515 Ga0500643_051840 3300053087 Bacteria 1171
1516 Ga0500644_0034129 3300053088 Bacteria 1639
1517 Ga0500646_0017535 3300053090 Bacteria 1878
1518 Ga0500647_0006028 3300053091 Bacteria 5097
1519 Ga0500647_0106100 3300053091 Bacteria 1339
1520 Ga0500583_0016915 3300053092 Bacteria 2923
1521 Ga0500651_0048095 3300053093 Bacteria 2680
1522 Ga0500566_0007888 3300053094 Bacteria 6303
1523 Ga0500566_0031098 3300053094 Bacteria 3113
1524 Ga0500566_0158317 3300053094 Bacteria 1183
1525 Ga0500641_0152109 3300053096 Bacteria 999
1526 Ga0500650_0033296 3300053098 Bacteria 2350
1527 Ga0500555_003111 3300053103 Bacteria 4735
1528 Ga0500555_012168 3300053103 Bacteria 2474
1529 Ga0500556_0024413 3300053104 Bacteria 1986
1530 Ga0500562_006674 3300053108 Bacteria 2908
1531 Ga0500562_079513 3300053108 Bacteria 887
1532 Ga0500572_024060 3300053111 Bacteria 1640
1533 Ga0500592_008699 3300053116 Bacteria 1612
1534 Ga0500594_0004484 3300053118 Bacteria 3078
1535 Ga0500594_0047780 3300053118 Bacteria 1195
1536 Ga0500595_000266 3300053119 Bacteria 34654
1537 Ga0500595_001200 3300053119 Bacteria 14322
1538 Ga0500595_015995 3300053119 Bacteria 2802
1539 Ga0500595_020314 3300053119 Bacteria 2393
1540 Ga0500595_028672 3300053119 Bacteria 1896
1541 Ga0500608_063462 3300053122 Bacteria 1763
1542 Ga0500608_117175 3300053122 Bacteria 1213
1543 Ga0500614_043074 3300053123 Bacteria 1155
1544 Ga0500642_0000900 3300053130 Bacteria 8630
1545 Ga0500642_0065334 3300053130 Bacteria 1643
1546 Ga0500642_0129993 3300053130 Bacteria 1180
1547 Ga0500658_0007094 3300053134 Bacteria 4146
1548 Ga0500658_0016918 3300053134 Bacteria 2719
1549 Ga0500658_0113384 3300053134 Bacteria 1195
1550 Ga0500561_0044642 3300053137 Bacteria 1185
1551 Ga0500568_0000415 3300053139 Bacteria 32506
1552 Ga0500568_0001174 3300053139 Bacteria 17524
1553 Ga0500573_0060387 3300053140 Bacteria 2171
1554 Ga0500577_0068019 3300053142 Bacteria 1389
1555 Ga0500577_0105596 3300053142 Bacteria 1156
1556 Ga0500588_0001609 3300053146 Bacteria 4352
1557 Ga0500588_0007470 3300053146 Bacteria 2520
1558 Ga0500603_021372 3300053150 Bacteria 1591
1559 Ga0500604_0009878 3300053151 Bacteria 2545
1560 Ga0500604_0019145 3300053151 Bacteria 1914
1561 Ga0500616_0002694 3300053153 Bacteria 14436
1562 Ga0500616_0055477 3300053153 Bacteria 2072
1563 Ga0500616_0088404 3300053153 Bacteria 1540
1564 Ga0500616_0208982 3300053153 Bacteria 859
1565 Ga0500619_122099 3300053154 Bacteria 888
1566 Ga0500620_000234 3300053155 Bacteria 11002
1567 Ga0500622_0000646 3300053156 Bacteria 31129
1568 Ga0500622_0000772 3300053156 Bacteria 27803
1569 Ga0500622_0059991 3300053156 Bacteria 1942
1570 Ga0500622_0084763 3300053156 Bacteria 1582
1571 Ga0500627_0006268 3300053158 Bacteria 4036
1572 Ga0500627_0032262 3300053158 Bacteria 2206
1573 Ga0500627_0073122 3300053158 Bacteria 1520
1574 Ga0500627_0079467 3300053158 Bacteria 1460
1575 Ga0500627_0099687 3300053158 Bacteria 1303
1576 Ga0500627_0236847 3300053158 Bacteria 811
1577 Ga0500630_121514 3300053159 Bacteria 1156
1578 Ga0500633_0030142 3300053160 Bacteria 1741
1579 Ga0500634_0037402 3300053161 Bacteria 2639
1580 Ga0500634_0062976 3300053161 Bacteria 1963
1581 Ga0500638_158005 3300053162 Bacteria 1001
1582 Ga0500639_004632 3300053163 Bacteria 6991
1583 Ga0500639_089488 3300053163 Bacteria 1536
1584 Ga0500636_0011613 3300053177 Bacteria 5156
1585 Ga0500636_0044811 3300053177 Bacteria 2608
1586 Ga0500636_0050905 3300053177 Bacteria 2435
1587 Ga0500636_0121702 3300053177 Bacteria 1463
1588 Ga0500636_0166768 3300053177 Bacteria 1195
1589 Ga0500636_0237738 3300053177 Bacteria 938
1590 Ga0500637_0060181 3300053178 Bacteria 2174
1591 Ga0500611_003636 3300053727 Bacteria 1999
1592 Ga0500645_030897 3300053730 Bacteria 1610
1593 Ga0500609_004076 3300053731 Bacteria 2032
1594 Ga0500609_012380 3300053731 Bacteria 1153
1595 Ga0500609_027406 3300053731 Bacteria 781
1596 Ga0500596_015532 3300053735 Bacteria 1143
1597 Ga0500587_000428 3300053739 Bacteria 4934
1598 Ga0501084_0007550 3300054114 Bacteria 8968
1599 Ga0501084_0018918 3300054114 Bacteria 5734
1600 Ga0501084_0074772 3300054114 Bacteria 2838
1601 Ga0501084_0144096 3300054114 Bacteria 2006
1602 Ga0501084_0189154 3300054114 Bacteria 1737
1603 Ga0501084_0724310 3300054114 Bacteria 838
1604 Ga0500661_008047 3300055283 Bacteria 1942
1605 Ga0590075_003951 3300059424 Bacteria 3512
1606 Ga0501082_0032387 3300060353 Bacteria 4508
1607 Ga0501082_0060048 3300060353 Bacteria 3275
1608 Ga0501082_0062878 3300060353 Bacteria 3196
1609 Ga0501082_0097519 3300060353 Bacteria 2541
1610 Ga0501082_0108271 3300060353 Bacteria 2405
1611 Ga0501082_0403043 3300060353 Bacteria 1194
1612 Ga0501082_0538073 3300060353 Bacteria 1021
1613 Ga0530510_0000093 3300061734 Bacteria 48352
1614 Ga0530510_0013400 3300061734 Bacteria 5765
1615 Ga0530510_0040966 3300061734 Bacteria 3344
1616 Ga0530510_0047637 3300061734 Bacteria 3097
1617 Ga0530510_0182661 3300061734 Bacteria 1555

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0010170 Ga0495664_0010170_3817_4548 243
2 3300005334 Ga0068869_100045381 Ga0068869_1000453815 244
3 3300005436 Ga0070713_100399502 Ga0070713_1003995022 244
4 3300013297 Ga0157378_10792357 Ga0157378_107923571 244
5 3300025924 Ga0207694_10383931 Ga0207694_103839312 244
6 3300002987 JGI25159J45721_1000012 JGI25159J45721_100001271 245
7 3300003187 JGI25151J46595_10005842 JGI25151J46595_100058424 245
8 3300003354 JGI25160J50197_1000042 JGI25160J50197_100004282 245
9 3300003374 JGI25161J50226_1000254 JGI25161J50226_100025425 245
10 3300003771 Ga0055526_1003780 Ga0055526_10037804 245
11 3300003781 Ga0055536_1007787 Ga0055536_10077876 245
12 3300003791 Ga0055530_10023412 Ga0055530_100234122 245
13 3300003794 Ga0055531_10020004 Ga0055531_100200042 245
14 3300004625 Ga0055543_1000452 Ga0055543_100045213 245
15 3300005262 Ga0065165_1000174 Ga0065165_100017471 245
16 3300015690 Ga0183363_1026 Ga0183363_102644 245
17 3300025208 Ga0209436_100252 Ga0209436_10025216 245
18 3300025284 Ga0209130_1000075 Ga0209130_100007584 245
19 3300025292 Ga0209676_1002745 Ga0209676_10027452 245
20 3300025294 Ga0209025_1000747 Ga0209025_100074726 245
21 3300025295 Ga0209564_1000278 Ga0209564_100027818 245
22 3300025299 Ga0209256_1000411 Ga0209256_100041154 245
23 3300025302 Ga0207426_1000163 Ga0207426_100016384 245
24 3300025303 Ga0209051_1018933 Ga0209051_10189332 245
25 3300028794 Ga0307515_10000026 Ga0307515_10000026124 245
26 3300046517 Ga0495630_0009681 Ga0495630_0009681_3660_4397 245
27 3300046533 Ga0495640_0030810 Ga0495640_0030810_672_1409 245
28 3300046683 Ga0495658_0086519 Ga0495658_0086519_488_1225 245
29 3300047319 Ga0495674_0019590 Ga0495674_0019590_461_1198 245
30 3300049575 Ga0501039_0417542 Ga0501039_0417542_217_954 245
31 3300001979 JGI24740J21852_10040824 JGI24740J21852_100408243 246
32 3300002739 JGI25158J39367_1000548 JGI25158J39367_10005482 246
33 3300002741 JGI25157J39369_1001276 JGI25157J39369_10012769 246
34 3300002773 JGI25152J39213_1005130 JGI25152J39213_10051304 246
35 3300002773 JGI25152J39213_1006776 JGI25152J39213_10067762 246
36 3300002774 JGI25150J39212_1007959 JGI25150J39212_10079591 246
37 3300002987 JGI25159J45721_1001972 JGI25159J45721_10019726 246
38 3300003203 JGI25406J46586_10005327 JGI25406J46586_100053275 246
39 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015243 246
40 3300003214 JGI25165J46597_1002828 JGI25165J46597_10028283 246
41 3300003215 JGI25153J46596_10000033 JGI25153J46596_1000003326 246
42 3300003215 JGI25153J46596_10000047 JGI25153J46596_10000047106 246
43 3300003215 JGI25153J46596_10024486 JGI25153J46596_100244862 246
44 3300003320 rootH2_10079132 rootH2_100791328 246
45 3300003354 JGI25160J50197_1000068 JGI25160J50197_100006832 246
46 3300003354 JGI25160J50197_1006678 JGI25160J50197_10066783 246
47 3300003374 JGI25161J50226_1000048 JGI25161J50226_100004832 246
48 3300003374 JGI25161J50226_1002172 JGI25161J50226_10021725 246
49 3300003762 Ga0055542_1000406 Ga0055542_100040626 246
50 3300003771 Ga0055526_1003068 Ga0055526_10030686 246
51 3300003771 Ga0055526_1005774 Ga0055526_10057744 246
52 3300003775 Ga0055524_1022164 Ga0055524_10221642 246
53 3300003781 Ga0055536_1009742 Ga0055536_10097422 246
54 3300003784 Ga0055534_1002995 Ga0055534_10029953 246
55 3300003790 Ga0055528_1000081 Ga0055528_100008128 246
56 3300003790 Ga0055528_1002961 Ga0055528_10029611 246
57 3300003790 Ga0055528_1010205 Ga0055528_10102052 246
58 3300003792 Ga0055540_1005863 Ga0055540_10058635 246
59 3300003792 Ga0055540_1007063 Ga0055540_10070634 246
60 3300003794 Ga0055531_10000775 Ga0055531_1000077518 246
61 3300004625 Ga0055543_1000031 Ga0055543_1000031121 246
62 3300004625 Ga0055543_1000046 Ga0055543_100004673 246
63 3300005262 Ga0065165_1000175 Ga0065165_100017532 246
64 3300005262 Ga0065165_1016574 Ga0065165_10165743 246
65 3300005289 Ga0065704_10243647 Ga0065704_102436471 246
66 3300005290 Ga0065712_10084375 Ga0065712_100843752 246
67 3300005293 Ga0065715_10005719 Ga0065715_100057192 246
68 3300005327 Ga0070658_10072794 Ga0070658_100727942 246
69 3300005327 Ga0070658_10121171 Ga0070658_101211712 246
70 3300005328 Ga0070676_10001690 Ga0070676_100016906 246
71 3300005328 Ga0070676_10032420 Ga0070676_100324203 246
72 3300005330 Ga0070690_100000104 Ga0070690_10000010436 246
73 3300005330 Ga0070690_100006691 Ga0070690_1000066913 246
74 3300005330 Ga0070690_100093173 Ga0070690_1000931731 246
75 3300005330 Ga0070690_100115124 Ga0070690_1001151243 246
76 3300005331 Ga0070670_100234182 Ga0070670_1002341822 246
77 3300005333 Ga0070677_10006920 Ga0070677_100069204 246
78 3300005333 Ga0070677_10087821 Ga0070677_100878212 246
79 3300005334 Ga0068869_100006830 Ga0068869_1000068305 246
80 3300005334 Ga0068869_100010468 Ga0068869_1000104685 246
81 3300005334 Ga0068869_100013291 Ga0068869_1000132915 246
82 3300005334 Ga0068869_100037678 Ga0068869_1000376784 246
83 3300005334 Ga0068869_100195193 Ga0068869_1001951932 246
84 3300005335 Ga0070666_10003654 Ga0070666_100036548 246
85 3300005335 Ga0070666_10266559 Ga0070666_102665592 246
86 3300005335 Ga0070666_10374691 Ga0070666_103746911 246
87 3300005336 Ga0070680_100106467 Ga0070680_1001064672 246
88 3300005336 Ga0070680_100140641 Ga0070680_1001406411 246
89 3300005338 Ga0068868_100001028 Ga0068868_1000010289 246
90 3300005338 Ga0068868_100002870 Ga0068868_1000028704 246
91 3300005338 Ga0068868_100020673 Ga0068868_1000206735 246
92 3300005338 Ga0068868_100028159 Ga0068868_1000281594 246
93 3300005338 Ga0068868_100101056 Ga0068868_1001010561 246
94 3300005339 Ga0070660_100021992 Ga0070660_1000219923 246
95 3300005339 Ga0070660_100027337 Ga0070660_1000273374 246
96 3300005339 Ga0070660_100160073 Ga0070660_1001600731 246
97 3300005340 Ga0070689_100002051 Ga0070689_10000205113 246
98 3300005340 Ga0070689_100039569 Ga0070689_1000395693 246
99 3300005340 Ga0070689_100262363 Ga0070689_1002623631 246
100 3300005341 Ga0070691_10032040 Ga0070691_100320403 246
101 3300005343 Ga0070687_100375729 Ga0070687_1003757291 246
102 3300005344 Ga0070661_100003782 Ga0070661_1000037825 246
103 3300005344 Ga0070661_100135355 Ga0070661_1001353552 246
104 3300005347 Ga0070668_100004957 Ga0070668_1000049578 246
105 3300005347 Ga0070668_100021056 Ga0070668_1000210565 246
106 3300005347 Ga0070668_100060860 Ga0070668_1000608602 246
107 3300005347 Ga0070668_100423111 Ga0070668_1004231112 246
108 3300005353 Ga0070669_100007652 Ga0070669_1000076523 246
109 3300005353 Ga0070669_100047893 Ga0070669_1000478935 246
110 3300005353 Ga0070669_100058280 Ga0070669_1000582804 246
111 3300005353 Ga0070669_100107389 Ga0070669_1001073892 246
112 3300005353 Ga0070669_100124903 Ga0070669_1001249032 246
113 3300005353 Ga0070669_100232146 Ga0070669_1002321462 246
114 3300005354 Ga0070675_100002408 Ga0070675_1000024087 246
115 3300005354 Ga0070675_100011906 Ga0070675_1000119068 246
116 3300005354 Ga0070675_100174674 Ga0070675_1001746742 246
117 3300005355 Ga0070671_100009046 Ga0070671_1000090463 246
118 3300005355 Ga0070671_100012205 Ga0070671_1000122059 246
119 3300005355 Ga0070671_100022921 Ga0070671_1000229214 246
120 3300005355 Ga0070671_100050547 Ga0070671_1000505474 246
121 3300005355 Ga0070671_100420339 Ga0070671_1004203392 246
122 3300005356 Ga0070674_100014204 Ga0070674_1000142044 246
123 3300005356 Ga0070674_100017014 Ga0070674_1000170144 246
124 3300005356 Ga0070674_100018973 Ga0070674_1000189735 246
125 3300005356 Ga0070674_100060883 Ga0070674_1000608832 246
126 3300005356 Ga0070674_100283065 Ga0070674_1002830651 246
127 3300005356 Ga0070674_100326663 Ga0070674_1003266632 246
128 3300005356 Ga0070674_100353166 Ga0070674_1003531662 246
129 3300005356 Ga0070674_100422101 Ga0070674_1004221011 246
130 3300005364 Ga0070673_100008458 Ga0070673_1000084588 246
131 3300005364 Ga0070673_100028973 Ga0070673_1000289732 246
132 3300005364 Ga0070673_100338482 Ga0070673_1003384822 246
133 3300005365 Ga0070688_100160781 Ga0070688_1001607812 246
134 3300005365 Ga0070688_100422618 Ga0070688_1004226182 246
135 3300005366 Ga0070659_100040241 Ga0070659_1000402413 246
136 3300005366 Ga0070659_100056900 Ga0070659_1000569002 246
137 3300005366 Ga0070659_100181776 Ga0070659_1001817761 246
138 3300005366 Ga0070659_100573082 Ga0070659_1005730822 246
139 3300005367 Ga0070667_100010392 Ga0070667_1000103922 246
140 3300005367 Ga0070667_100040888 Ga0070667_1000408883 246
141 3300005367 Ga0070667_100136027 Ga0070667_1001360272 246
142 3300005367 Ga0070667_100429243 Ga0070667_1004292432 246
143 3300005434 Ga0070709_10012841 Ga0070709_100128413 246
144 3300005435 Ga0070714_100005358 Ga0070714_1000053587 246
145 3300005436 Ga0070713_100100618 Ga0070713_1001006182 246
146 3300005437 Ga0070710_10001811 Ga0070710_100018117 246
147 3300005438 Ga0070701_10000723 Ga0070701_1000072315 246
148 3300005439 Ga0070711_100000775 Ga0070711_1000007753 246
149 3300005439 Ga0070711_100215371 Ga0070711_1002153712 246
150 3300005441 Ga0070700_100043222 Ga0070700_1000432221 246
151 3300005441 Ga0070700_100453120 Ga0070700_1004531201 246
152 3300005444 Ga0070694_100049626 Ga0070694_1000496263 246
153 3300005455 Ga0070663_100256134 Ga0070663_1002561342 246
154 3300005455 Ga0070663_100299082 Ga0070663_1002990822 246
155 3300005455 Ga0070663_100416249 Ga0070663_1004162491 246
156 3300005456 Ga0070678_100003442 Ga0070678_1000034425 246
157 3300005456 Ga0070678_100030637 Ga0070678_1000306374 246
158 3300005456 Ga0070678_100032986 Ga0070678_1000329864 246
159 3300005456 Ga0070678_100036530 Ga0070678_1000365303 246
160 3300005456 Ga0070678_100124938 Ga0070678_1001249382 246
161 3300005457 Ga0070662_100072730 Ga0070662_1000727302 246
162 3300005457 Ga0070662_100124422 Ga0070662_1001244222 246
163 3300005457 Ga0070662_100128016 Ga0070662_1001280162 246
164 3300005458 Ga0070681_10673650 Ga0070681_106736501 246
165 3300005459 Ga0068867_100000091 Ga0068867_10000009119 246
166 3300005459 Ga0068867_100010378 Ga0068867_1000103781 246
167 3300005459 Ga0068867_100035822 Ga0068867_1000358222 246
168 3300005459 Ga0068867_100039441 Ga0068867_1000394412 246
169 3300005459 Ga0068867_100040970 Ga0068867_1000409704 246
170 3300005459 Ga0068867_100056274 Ga0068867_1000562742 246
171 3300005459 Ga0068867_100104180 Ga0068867_1001041801 246
172 3300005459 Ga0068867_100213062 Ga0068867_1002130622 246
173 3300005466 Ga0070685_10147600 Ga0070685_101476001 246
174 3300005466 Ga0070685_10356336 Ga0070685_103563361 246
175 3300005467 Ga0070706_100154516 Ga0070706_1001545163 246
176 3300005467 Ga0070706_100239790 Ga0070706_1002397902 246
177 3300005468 Ga0070707_100251578 Ga0070707_1002515782 246
178 3300005530 Ga0070679_100515053 Ga0070679_1005150531 246
179 3300005535 Ga0070684_100214762 Ga0070684_1002147622 246
180 3300005539 Ga0068853_100000533 Ga0068853_1000005336 246
181 3300005539 Ga0068853_100008721 Ga0068853_1000087216 246
182 3300005539 Ga0068853_100062492 Ga0068853_1000624923 246
183 3300005539 Ga0068853_100392547 Ga0068853_1003925471 246
184 3300005543 Ga0070672_100004518 Ga0070672_1000045186 246
185 3300005543 Ga0070672_100006066 Ga0070672_1000060662 246
186 3300005543 Ga0070672_100091402 Ga0070672_1000914023 246
187 3300005543 Ga0070672_100133529 Ga0070672_1001335292 246
188 3300005543 Ga0070672_100194448 Ga0070672_1001944482 246
189 3300005544 Ga0070686_100001185 Ga0070686_10000118513 246
190 3300005545 Ga0070695_100012848 Ga0070695_1000128484 246
191 3300005545 Ga0070695_100567310 Ga0070695_1005673101 246
192 3300005546 Ga0070696_100003912 Ga0070696_1000039124 246
193 3300005548 Ga0070665_100011966 Ga0070665_1000119665 246
194 3300005548 Ga0070665_100021983 Ga0070665_1000219833 246
195 3300005548 Ga0070665_100026315 Ga0070665_1000263153 246
196 3300005548 Ga0070665_100228629 Ga0070665_1002286291 246
197 3300005548 Ga0070665_100284493 Ga0070665_1002844932 246
198 3300005548 Ga0070665_100408231 Ga0070665_1004082311 246
199 3300005548 Ga0070665_100834977 Ga0070665_1008349771 246
200 3300005549 Ga0070704_100130432 Ga0070704_1001304322 246
201 3300005563 Ga0068855_100059452 Ga0068855_1000594522 246
202 3300005563 Ga0068855_100138782 Ga0068855_1001387821 246
203 3300005564 Ga0070664_100035788 Ga0070664_1000357884 246
204 3300005577 Ga0068857_100007296 Ga0068857_10000729610 246
205 3300005577 Ga0068857_100049797 Ga0068857_1000497973 246
206 3300005578 Ga0068854_100006614 Ga0068854_1000066142 246
207 3300005578 Ga0068854_100111128 Ga0068854_1001111282 246
208 3300005578 Ga0068854_100367257 Ga0068854_1003672572 246
209 3300005578 Ga0068854_100448352 Ga0068854_1004483522 246
210 3300005614 Ga0068856_100030869 Ga0068856_1000308693 246
211 3300005614 Ga0068856_100105689 Ga0068856_1001056894 246
212 3300005614 Ga0068856_100170805 Ga0068856_1001708051 246
213 3300005614 Ga0068856_100209837 Ga0068856_1002098372 246
214 3300005614 Ga0068856_100252995 Ga0068856_1002529952 246
215 3300005614 Ga0068856_100320316 Ga0068856_1003203162 246
216 3300005614 Ga0068856_100528222 Ga0068856_1005282221 246
217 3300005615 Ga0070702_100000465 Ga0070702_1000004655 246
218 3300005615 Ga0070702_100181716 Ga0070702_1001817161 246
219 3300005615 Ga0070702_100187663 Ga0070702_1001876632 246
220 3300005616 Ga0068852_100004682 Ga0068852_1000046824 246
221 3300005616 Ga0068852_100018895 Ga0068852_1000188956 246
222 3300005616 Ga0068852_100038314 Ga0068852_1000383142 246
223 3300005616 Ga0068852_100518076 Ga0068852_1005180762 246
224 3300005616 Ga0068852_100523866 Ga0068852_1005238662 246
225 3300005616 Ga0068852_100898063 Ga0068852_1008980631 246
226 3300005617 Ga0068859_100004139 Ga0068859_1000041398 246
227 3300005617 Ga0068859_100024768 Ga0068859_1000247685 246
228 3300005617 Ga0068859_100066366 Ga0068859_1000663662 246
229 3300005617 Ga0068859_100258096 Ga0068859_1002580962 246
230 3300005617 Ga0068859_100281564 Ga0068859_1002815642 246
231 3300005617 Ga0068859_100407028 Ga0068859_1004070282 246
232 3300005618 Ga0068864_100017958 Ga0068864_1000179585 246
233 3300005618 Ga0068864_100124212 Ga0068864_1001242122 246
234 3300005618 Ga0068864_100180333 Ga0068864_1001803332 246
235 3300005618 Ga0068864_100270219 Ga0068864_1002702192 246
236 3300005618 Ga0068864_100350494 Ga0068864_1003504942 246
237 3300005718 Ga0068866_10002429 Ga0068866_100024297 246
238 3300005718 Ga0068866_10042055 Ga0068866_100420553 246
239 3300005718 Ga0068866_10052992 Ga0068866_100529923 246
240 3300005718 Ga0068866_10105319 Ga0068866_101053192 246
241 3300005719 Ga0068861_100002134 Ga0068861_1000021344 246
242 3300005719 Ga0068861_100004235 Ga0068861_1000042355 246
243 3300005719 Ga0068861_100015953 Ga0068861_1000159532 246
244 3300005719 Ga0068861_100067724 Ga0068861_1000677243 246
245 3300005719 Ga0068861_100077139 Ga0068861_1000771392 246
246 3300005719 Ga0068861_100188954 Ga0068861_1001889542 246
247 3300005719 Ga0068861_100413072 Ga0068861_1004130722 246
248 3300005834 Ga0068851_10158537 Ga0068851_101585372 246
249 3300005840 Ga0068870_10121037 Ga0068870_101210372 246
250 3300005840 Ga0068870_10170422 Ga0068870_101704221 246
251 3300005841 Ga0068863_100057708 Ga0068863_1000577084 246
252 3300005841 Ga0068863_100156268 Ga0068863_1001562682 246
253 3300005841 Ga0068863_100192197 Ga0068863_1001921971 246
254 3300005841 Ga0068863_100218540 Ga0068863_1002185402 246
255 3300005842 Ga0068858_100000679 Ga0068858_10000067927 246
256 3300005842 Ga0068858_100000774 Ga0068858_1000007747 246
257 3300005842 Ga0068858_100039707 Ga0068858_1000397072 246
258 3300005842 Ga0068858_100062433 Ga0068858_1000624333 246
259 3300005842 Ga0068858_100113932 Ga0068858_1001139323 246
260 3300005842 Ga0068858_100208795 Ga0068858_1002087952 246
261 3300005842 Ga0068858_100257248 Ga0068858_1002572482 246
262 3300005842 Ga0068858_100294160 Ga0068858_1002941602 246
263 3300005843 Ga0068860_100005264 Ga0068860_1000052648 246
264 3300005843 Ga0068860_100021326 Ga0068860_1000213265 246
265 3300005843 Ga0068860_100114065 Ga0068860_1001140652 246
266 3300005843 Ga0068860_100398874 Ga0068860_1003988742 246
267 3300005843 Ga0068860_100473424 Ga0068860_1004734242 246
268 3300005844 Ga0068862_100004858 Ga0068862_1000048585 246
269 3300005844 Ga0068862_100037860 Ga0068862_1000378602 246
270 3300005844 Ga0068862_100039976 Ga0068862_1000399763 246
271 3300005844 Ga0068862_100053778 Ga0068862_1000537782 246
272 3300005844 Ga0068862_100155416 Ga0068862_1001554162 246
273 3300005844 Ga0068862_100204281 Ga0068862_1002042812 246
274 3300005844 Ga0068862_100470055 Ga0068862_1004700552 246
275 3300005844 Ga0068862_100644166 Ga0068862_1006441661 246
276 3300005937 Ga0081455_10033573 Ga0081455_100335735 246
277 3300005981 Ga0081538_10037477 Ga0081538_100374773 246
278 3300005983 Ga0081540_1007796 Ga0081540_10077964 246
279 3300005983 Ga0081540_1018556 Ga0081540_10185563 246
280 3300005983 Ga0081540_1028680 Ga0081540_10286802 246
281 3300005983 Ga0081540_1034711 Ga0081540_10347113 246
282 3300005985 Ga0081539_10001065 Ga0081539_1000106544 246
283 3300005985 Ga0081539_10002462 Ga0081539_1000246220 246
284 3300006028 Ga0070717_10049598 Ga0070717_100495982 246
285 3300006028 Ga0070717_10060157 Ga0070717_100601572 246
286 3300006028 Ga0070717_10174840 Ga0070717_101748402 246
287 3300006028 Ga0070717_10521222 Ga0070717_105212222 246
288 3300006038 Ga0075365_10001077 Ga0075365_100010775 246
289 3300006038 Ga0075365_10005631 Ga0075365_100056312 246
290 3300006038 Ga0075365_10015495 Ga0075365_100154953 246
291 3300006038 Ga0075365_10028179 Ga0075365_100281792 246
292 3300006038 Ga0075365_10033264 Ga0075365_100332643 246
293 3300006038 Ga0075365_10051810 Ga0075365_100518102 246
294 3300006038 Ga0075365_10057918 Ga0075365_100579182 246
295 3300006038 Ga0075365_10077386 Ga0075365_100773862 246
296 3300006038 Ga0075365_10086523 Ga0075365_100865232 246
297 3300006038 Ga0075365_10162450 Ga0075365_101624501 246
298 3300006038 Ga0075365_10187535 Ga0075365_101875352 246
299 3300006042 Ga0075368_10000497 Ga0075368_100004978 246
300 3300006048 Ga0075363_100019120 Ga0075363_1000191202 246
301 3300006048 Ga0075363_100034775 Ga0075363_1000347752 246
302 3300006051 Ga0075364_10043362 Ga0075364_100433622 246
303 3300006051 Ga0075364_10053411 Ga0075364_100534113 246
304 3300006051 Ga0075364_10093419 Ga0075364_100934192 246
305 3300006051 Ga0075364_10126716 Ga0075364_101267162 246
306 3300006051 Ga0075364_10145322 Ga0075364_101453222 246
307 3300006058 Ga0075432_10161255 Ga0075432_101612551 246
308 3300006163 Ga0070715_10052960 Ga0070715_100529602 246
309 3300006173 Ga0070716_100002789 Ga0070716_1000027897 246
310 3300006173 Ga0070716_100060583 Ga0070716_1000605833 246
311 3300006177 Ga0075362_10015521 Ga0075362_100155213 246
312 3300006177 Ga0075362_10076585 Ga0075362_100765852 246
313 3300006178 Ga0075367_10005545 Ga0075367_100055454 246
314 3300006178 Ga0075367_10029428 Ga0075367_100294283 246
315 3300006178 Ga0075367_10102443 Ga0075367_101024432 246
316 3300006178 Ga0075367_10241541 Ga0075367_102415412 246
317 3300006186 Ga0075369_10000668 Ga0075369_100006686 246
318 3300006186 Ga0075369_10003981 Ga0075369_100039816 246
319 3300006186 Ga0075369_10007492 Ga0075369_100074926 246
320 3300006186 Ga0075369_10100272 Ga0075369_101002722 246
321 3300006186 Ga0075369_10123852 Ga0075369_101238522 246
322 3300006195 Ga0075366_10001925 Ga0075366_100019254 246
323 3300006195 Ga0075366_10032269 Ga0075366_100322692 246
324 3300006195 Ga0075366_10083112 Ga0075366_100831122 246
325 3300006195 Ga0075366_10155636 Ga0075366_101556362 246
326 3300006195 Ga0075366_10207258 Ga0075366_102072582 246
327 3300006237 Ga0097621_100014601 Ga0097621_1000146015 246
328 3300006237 Ga0097621_100023403 Ga0097621_1000234033 246
329 3300006237 Ga0097621_100027531 Ga0097621_1000275317 246
330 3300006237 Ga0097621_100141217 Ga0097621_1001412172 246
331 3300006237 Ga0097621_100182239 Ga0097621_1001822392 246
332 3300006237 Ga0097621_100585443 Ga0097621_1005854432 246
333 3300006353 Ga0075370_10003750 Ga0075370_100037504 246
334 3300006353 Ga0075370_10012857 Ga0075370_100128572 246
335 3300006353 Ga0075370_10014816 Ga0075370_100148164 246
336 3300006353 Ga0075370_10076779 Ga0075370_100767792 246
337 3300006358 Ga0068871_100072151 Ga0068871_1000721513 246
338 3300006358 Ga0068871_100117432 Ga0068871_1001174322 246
339 3300006844 Ga0075428_100297821 Ga0075428_1002978212 246
340 3300006844 Ga0075428_100385730 Ga0075428_1003857302 246
341 3300006846 Ga0075430_100056046 Ga0075430_1000560463 246
342 3300006846 Ga0075430_100289627 Ga0075430_1002896272 246
343 3300006847 Ga0075431_100008686 Ga0075431_1000086866 246
344 3300006847 Ga0075431_100014607 Ga0075431_10001460711 246
345 3300006847 Ga0075431_100802983 Ga0075431_1008029831 246
346 3300006852 Ga0075433_10004359 Ga0075433_100043599 246
347 3300006852 Ga0075433_10111317 Ga0075433_101113173 246
348 3300006852 Ga0075433_10246146 Ga0075433_102461462 246
349 3300006871 Ga0075434_100001107 Ga0075434_1000011076 246
350 3300006871 Ga0075434_100080113 Ga0075434_1000801133 246
351 3300006871 Ga0075434_100716813 Ga0075434_1007168132 246
352 3300006880 Ga0075429_100162181 Ga0075429_1001621812 246
353 3300006880 Ga0075429_100315527 Ga0075429_1003155272 246
354 3300006881 Ga0068865_100002181 Ga0068865_1000021815 246
355 3300006881 Ga0068865_100005350 Ga0068865_1000053506 246
356 3300006881 Ga0068865_100006891 Ga0068865_1000068918 246
357 3300006881 Ga0068865_100043120 Ga0068865_1000431202 246
358 3300006881 Ga0068865_100057693 Ga0068865_1000576932 246
359 3300006931 Ga0097620_100004139 Ga0097620_1000041398 246
360 3300006931 Ga0097620_100024768 Ga0097620_1000247682 246
361 3300006931 Ga0097620_100066364 Ga0097620_1000663642 246
362 3300006931 Ga0097620_100239842 Ga0097620_1002398422 246
363 3300006931 Ga0097620_100258095 Ga0097620_1002580952 246
364 3300006931 Ga0097620_100281543 Ga0097620_1002815432 246
365 3300006931 Ga0097620_100407008 Ga0097620_1004070082 246
366 3300007076 Ga0075435_100084847 Ga0075435_1000848472 246
367 3300007076 Ga0075435_100096110 Ga0075435_1000961102 246
368 3300007788 Ga0099795_10197466 Ga0099795_101974661 246
369 3300009093 Ga0105240_10030702 Ga0105240_100307021 246
370 3300009093 Ga0105240_10188585 Ga0105240_101885853 246
371 3300009093 Ga0105240_10193464 Ga0105240_101934642 246
372 3300009093 Ga0105240_10317039 Ga0105240_103170391 246
373 3300009093 Ga0105240_10445115 Ga0105240_104451152 246
374 3300009093 Ga0105240_10470161 Ga0105240_104701611 246
375 3300009094 Ga0111539_10000090 Ga0111539_1000009037 246
376 3300009094 Ga0111539_10095317 Ga0111539_100953173 246
377 3300009094 Ga0111539_10106388 Ga0111539_101063881 246
378 3300009094 Ga0111539_10228537 Ga0111539_102285372 246
379 3300009094 Ga0111539_10594395 Ga0111539_105943952 246
380 3300009094 Ga0111539_10741676 Ga0111539_107416762 246
381 3300009094 Ga0111539_11228693 Ga0111539_112286931 246
382 3300009098 Ga0105245_10008017 Ga0105245_100080175 246
383 3300009098 Ga0105245_10063580 Ga0105245_100635804 246
384 3300009098 Ga0105245_10091787 Ga0105245_100917872 246
385 3300009098 Ga0105245_10413657 Ga0105245_104136572 246
386 3300009098 Ga0105245_10444206 Ga0105245_104442061 246
387 3300009098 Ga0105245_10470834 Ga0105245_104708342 246
388 3300009098 Ga0105245_10577174 Ga0105245_105771742 246
389 3300009101 Ga0105247_10006831 Ga0105247_100068315 246
390 3300009101 Ga0105247_10146901 Ga0105247_101469012 246
391 3300009101 Ga0105247_10398480 Ga0105247_103984801 246
392 3300009147 Ga0114129_10179262 Ga0114129_101792621 246
393 3300009147 Ga0114129_10271647 Ga0114129_102716472 246
394 3300009147 Ga0114129_10286300 Ga0114129_102863002 246
395 3300009148 Ga0105243_10000959 Ga0105243_1000095911 246
396 3300009148 Ga0105243_10015761 Ga0105243_100157613 246
397 3300009148 Ga0105243_10105952 Ga0105243_101059522 246
398 3300009148 Ga0105243_10155973 Ga0105243_101559732 246
399 3300009148 Ga0105243_10182807 Ga0105243_101828072 246
400 3300009148 Ga0105243_10292051 Ga0105243_102920511 246
401 3300009148 Ga0105243_10616879 Ga0105243_106168792 246
402 3300009174 Ga0105241_10002442 Ga0105241_100024428 246
403 3300009174 Ga0105241_10113365 Ga0105241_101133652 246
404 3300009174 Ga0105241_10292450 Ga0105241_102924502 246
405 3300009176 Ga0105242_10002489 Ga0105242_100024898 246
406 3300009176 Ga0105242_10193932 Ga0105242_101939322 246
407 3300009177 Ga0105248_10000901 Ga0105248_100009015 246
408 3300009177 Ga0105248_10013900 Ga0105248_100139006 246
409 3300009177 Ga0105248_10015246 Ga0105248_100152466 246
410 3300009177 Ga0105248_10019917 Ga0105248_100199177 246
411 3300009177 Ga0105248_10060349 Ga0105248_100603494 246
412 3300009177 Ga0105248_10479903 Ga0105248_104799031 246
413 3300009545 Ga0105237_10000174 Ga0105237_1000017460 246
414 3300009545 Ga0105237_10009955 Ga0105237_100099552 246
415 3300009545 Ga0105237_10018733 Ga0105237_100187334 246
416 3300009545 Ga0105237_10034874 Ga0105237_100348745 246
417 3300009545 Ga0105237_10035664 Ga0105237_100356642 246
418 3300009545 Ga0105237_10043232 Ga0105237_100432323 246
419 3300009545 Ga0105237_10049540 Ga0105237_100495404 246
420 3300009545 Ga0105237_10186456 Ga0105237_101864562 246
421 3300009545 Ga0105237_10364295 Ga0105237_103642952 246
422 3300009545 Ga0105237_10403976 Ga0105237_104039762 246
423 3300009545 Ga0105237_10673565 Ga0105237_106735652 246
424 3300009551 Ga0105238_10010957 Ga0105238_100109575 246
425 3300009551 Ga0105238_10029974 Ga0105238_100299743 246
426 3300009551 Ga0105238_10033358 Ga0105238_100333582 246
427 3300009551 Ga0105238_10045923 Ga0105238_100459235 246
428 3300009551 Ga0105238_10487166 Ga0105238_104871662 246
429 3300009553 Ga0105249_10049194 Ga0105249_100491943 246
430 3300009553 Ga0105249_10185849 Ga0105249_101858492 246
431 3300009553 Ga0105249_10247261 Ga0105249_102472612 246
432 3300009553 Ga0105249_10400273 Ga0105249_104002731 246
433 3300009553 Ga0105249_10444825 Ga0105249_104448252 246
434 3300009553 Ga0105249_10504884 Ga0105249_105048842 246
435 3300009763 Ga0123340_1040575 Ga0123340_10405751 246
436 3300009766 Ga0123342_1032370 Ga0123342_10323702 246
437 3300010375 Ga0105239_10002107 Ga0105239_1000210719 246
438 3300010375 Ga0105239_10007703 Ga0105239_100077034 246
439 3300010375 Ga0105239_10039185 Ga0105239_100391853 246
440 3300010375 Ga0105239_10122143 Ga0105239_101221432 246
441 3300010375 Ga0105239_10243808 Ga0105239_102438082 246
442 3300010375 Ga0105239_10301175 Ga0105239_103011752 246
443 3300010375 Ga0105239_10307747 Ga0105239_103077472 246
444 3300010375 Ga0105239_10343654 Ga0105239_103436542 246
445 3300010375 Ga0105239_10374542 Ga0105239_103745422 246
446 3300010375 Ga0105239_11306396 Ga0105239_113063961 246
447 3300011119 Ga0105246_10021121 Ga0105246_100211214 246
448 3300011119 Ga0105246_10103356 Ga0105246_101033562 246
449 3300011119 Ga0105246_10183024 Ga0105246_101830242 246
450 3300011119 Ga0105246_10211017 Ga0105246_102110172 246
451 3300011119 Ga0105246_10322074 Ga0105246_103220741 246
452 3300012515 Ga0157338_1002466 Ga0157338_10024663 246
453 3300013102 Ga0157371_10047155 Ga0157371_100471552 246
454 3300013104 Ga0157370_10056251 Ga0157370_100562512 246
455 3300013104 Ga0157370_10134148 Ga0157370_101341482 246
456 3300013105 Ga0157369_10035139 Ga0157369_100351395 246
457 3300013105 Ga0157369_10181288 Ga0157369_101812882 246
458 3300013105 Ga0157369_10229048 Ga0157369_102290482 246
459 3300013296 Ga0157374_10100093 Ga0157374_101000933 246
460 3300013296 Ga0157374_10640703 Ga0157374_106407032 246
461 3300013297 Ga0157378_10004511 Ga0157378_1000451112 246
462 3300013297 Ga0157378_10006489 Ga0157378_100064896 246
463 3300013297 Ga0157378_10053222 Ga0157378_100532222 246
464 3300013297 Ga0157378_10212835 Ga0157378_102128352 246
465 3300013297 Ga0157378_10390105 Ga0157378_103901052 246
466 3300013306 Ga0163162_10000204 Ga0163162_1000020443 246
467 3300013306 Ga0163162_10004677 Ga0163162_100046776 246
468 3300013306 Ga0163162_10049112 Ga0163162_100491123 246
469 3300013306 Ga0163162_10118334 Ga0163162_101183343 246
470 3300013306 Ga0163162_10544590 Ga0163162_105445902 246
471 3300013307 Ga0157372_10514203 Ga0157372_105142032 246
472 3300013308 Ga0157375_10006400 Ga0157375_100064004 246
473 3300013308 Ga0157375_10024647 Ga0157375_100246472 246
474 3300013308 Ga0157375_10041032 Ga0157375_100410324 246
475 3300013308 Ga0157375_10057714 Ga0157375_100577144 246
476 3300013308 Ga0157375_10794743 Ga0157375_107947432 246
477 3300014325 Ga0163163_10828742 Ga0163163_108287421 246
478 3300014326 Ga0157380_10002708 Ga0157380_100027086 246
479 3300014326 Ga0157380_10004478 Ga0157380_100044782 246
480 3300014326 Ga0157380_10012997 Ga0157380_100129972 246
481 3300014326 Ga0157380_10041949 Ga0157380_100419492 246
482 3300014326 Ga0157380_10319433 Ga0157380_103194332 246
483 3300014326 Ga0157380_10721693 Ga0157380_107216931 246
484 3300014497 Ga0182008_10000774 Ga0182008_1000077417 246
485 3300014497 Ga0182008_10013499 Ga0182008_100134995 246
486 3300014745 Ga0157377_10000107 Ga0157377_1000010719 246
487 3300014745 Ga0157377_10241541 Ga0157377_102415412 246
488 3300014968 Ga0157379_10002672 Ga0157379_1000267214 246
489 3300014968 Ga0157379_10035395 Ga0157379_100353954 246
490 3300014968 Ga0157379_10091786 Ga0157379_100917862 246
491 3300014968 Ga0157379_10171246 Ga0157379_101712462 246
492 3300014968 Ga0157379_10201941 Ga0157379_102019412 246
493 3300014968 Ga0157379_10350293 Ga0157379_103502933 246
494 3300014968 Ga0157379_10396532 Ga0157379_103965322 246
495 3300014968 Ga0157379_10553319 Ga0157379_105533192 246
496 3300014968 Ga0157379_10841194 Ga0157379_108411941 246
497 3300014969 Ga0157376_10093303 Ga0157376_100933033 246
498 3300014969 Ga0157376_10232454 Ga0157376_102324542 246
499 3300014969 Ga0157376_10389772 Ga0157376_103897722 246
500 3300014969 Ga0157376_10402833 Ga0157376_104028332 246
501 3300015262 Ga0182007_10004305 Ga0182007_100043055 246
502 3300015683 Ga0183362_10001 Ga0183362_10001954 246
503 3300017792 Ga0163161_10020746 Ga0163161_100207462 246
504 3300017792 Ga0163161_10105260 Ga0163161_101052603 246
505 3300017792 Ga0163161_10201719 Ga0163161_102017191 246
506 3300017792 Ga0163161_10366484 Ga0163161_103664842 246
507 3300017792 Ga0163161_10387294 Ga0163161_103872942 246
508 3300021320 Ga0214544_1007335 Ga0214544_10073353 246
509 3300021321 Ga0214542_1000027 Ga0214542_1000027142 246
510 3300021327 Ga0214543_1000047 Ga0214543_1000047116 246
511 3300021358 Ga0213873_10001600 Ga0213873_100016003 246
512 3300021358 Ga0213873_10006410 Ga0213873_100064102 246
513 3300021377 Ga0213874_10011559 Ga0213874_100115592 246
514 3300021377 Ga0213874_10060082 Ga0213874_100600821 246
515 3300021384 Ga0213876_10001084 Ga0213876_1000108413 246
516 3300021384 Ga0213876_10006877 Ga0213876_100068773 246
517 3300021384 Ga0213876_10010546 Ga0213876_100105463 246
518 3300021388 Ga0213875_10001310 Ga0213875_100013104 246
519 3300021388 Ga0213875_10121679 Ga0213875_101216792 246
520 3300021388 Ga0213875_10219999 Ga0213875_102199991 246
521 3300025208 Ga0209436_100043 Ga0209436_10004366 246
522 3300025230 Ga0209563_101905 Ga0209563_1019053 246
523 3300025231 Ga0207427_101361 Ga0207427_1013619 246
524 3300025250 Ga0209026_1000025 Ga0209026_100002569 246
525 3300025254 Ga0209148_1000181 Ga0209148_100018127 246
526 3300025256 Ga0209759_1000226 Ga0209759_100022633 246
527 3300025258 Ga0209129_1001447 Ga0209129_10014473 246
528 3300025258 Ga0209129_1001476 Ga0209129_10014769 246
529 3300025258 Ga0209129_1001744 Ga0209129_10017447 246
530 3300025261 Ga0209233_1000010 Ga0209233_1000010341 246
531 3300025261 Ga0209233_1000208 Ga0209233_1000208120 246
532 3300025261 Ga0209233_1007445 Ga0209233_10074454 246
533 3300025261 Ga0209233_1011692 Ga0209233_10116922 246
534 3300025272 Ga0209455_1000127 Ga0209455_100012727 246
535 3300025273 Ga0209673_1000025 Ga0209673_100002592 246
536 3300025273 Ga0209673_1000550 Ga0209673_100055023 246
537 3300025273 Ga0209673_1002222 Ga0209673_100222211 246
538 3300025273 Ga0209673_1012262 Ga0209673_10122622 246
539 3300025273 Ga0209673_1015978 Ga0209673_10159782 246
540 3300025273 Ga0209673_1058556 Ga0209673_10585561 246
541 3300025284 Ga0209130_1000023 Ga0209130_1000023356 246
542 3300025284 Ga0209130_1000144 Ga0209130_100014434 246
543 3300025284 Ga0209130_1001459 Ga0209130_10014597 246
544 3300025284 Ga0209130_1014845 Ga0209130_10148452 246
545 3300025284 Ga0209130_1022823 Ga0209130_10228232 246
546 3300025291 Ga0209675_1000577 Ga0209675_10005779 246
547 3300025291 Ga0209675_1016073 Ga0209675_10160732 246
548 3300025292 Ga0209676_1011940 Ga0209676_10119402 246
549 3300025294 Ga0209025_1019972 Ga0209025_10199723 246
550 3300025294 Ga0209025_1034575 Ga0209025_10345752 246
551 3300025294 Ga0209025_1037564 Ga0209025_10375641 246
552 3300025294 Ga0209025_1047418 Ga0209025_10474182 246
553 3300025295 Ga0209564_1000365 Ga0209564_100036541 246
554 3300025295 Ga0209564_1000558 Ga0209564_10005583 246
555 3300025295 Ga0209564_1033341 Ga0209564_10333412 246
556 3300025297 Ga0209758_1000070 Ga0209758_1000070108 246
557 3300025297 Ga0209758_1000706 Ga0209758_10007065 246
558 3300025297 Ga0209758_1003235 Ga0209758_10032352 246
559 3300025297 Ga0209758_1014914 Ga0209758_10149144 246
560 3300025297 Ga0209758_1021677 Ga0209758_10216773 246
561 3300025297 Ga0209758_1027676 Ga0209758_10276762 246
562 3300025298 Ga0209050_1018895 Ga0209050_10188952 246
563 3300025299 Ga0209256_1000315 Ga0209256_100031534 246
564 3300025299 Ga0209256_1000718 Ga0209256_100071823 246
565 3300025302 Ga0207426_1000087 Ga0207426_10000876 246
566 3300025302 Ga0207426_1000126 Ga0207426_100012633 246
567 3300025302 Ga0207426_1002369 Ga0207426_10023698 246
568 3300025303 Ga0209051_1000176 Ga0209051_100017640 246
569 3300025303 Ga0209051_1000241 Ga0209051_100024136 246
570 3300025303 Ga0209051_1001845 Ga0209051_10018456 246
571 3300025303 Ga0209051_1005280 Ga0209051_10052802 246
572 3300025303 Ga0209051_1009714 Ga0209051_10097147 246
573 3300025303 Ga0209051_1010914 Ga0209051_10109143 246
574 3300025303 Ga0209051_1027372 Ga0209051_10273722 246
575 3300025304 Ga0209257_1000015 Ga0209257_1000015176 246
576 3300025304 Ga0209257_1000296 Ga0209257_100029673 246
577 3300025304 Ga0209257_1001085 Ga0209257_100108535 246
578 3300025304 Ga0209257_1010756 Ga0209257_10107565 246
579 3300025304 Ga0209257_1018952 Ga0209257_10189523 246
580 3300025304 Ga0209257_1019528 Ga0209257_10195282 246
581 3300025315 Ga0207697_10010156 Ga0207697_100101562 246
582 3300025893 Ga0207682_10003824 Ga0207682_100038244 246
583 3300025898 Ga0207692_10002105 Ga0207692_100021057 246
584 3300025899 Ga0207642_10006968 Ga0207642_100069683 246
585 3300025899 Ga0207642_10062734 Ga0207642_100627342 246
586 3300025899 Ga0207642_10262657 Ga0207642_102626572 246
587 3300025900 Ga0207710_10016400 Ga0207710_100164003 246
588 3300025901 Ga0207688_10014947 Ga0207688_100149472 246
589 3300025901 Ga0207688_10021443 Ga0207688_100214432 246
590 3300025901 Ga0207688_10066618 Ga0207688_100666182 246
591 3300025901 Ga0207688_10107200 Ga0207688_101072001 246
592 3300025903 Ga0207680_10000693 Ga0207680_1000069310 246
593 3300025903 Ga0207680_10275558 Ga0207680_102755582 246
594 3300025904 Ga0207647_10043242 Ga0207647_100432422 246
595 3300025905 Ga0207685_10034520 Ga0207685_100345202 246
596 3300025906 Ga0207699_10017480 Ga0207699_100174802 246
597 3300025907 Ga0207645_10001681 Ga0207645_100016812 246
598 3300025907 Ga0207645_10012052 Ga0207645_100120524 246
599 3300025907 Ga0207645_10149681 Ga0207645_101496812 246
600 3300025907 Ga0207645_10259896 Ga0207645_102598962 246
601 3300025907 Ga0207645_10366974 Ga0207645_103669741 246
602 3300025908 Ga0207643_10012550 Ga0207643_100125503 246
603 3300025908 Ga0207643_10021802 Ga0207643_100218023 246
604 3300025909 Ga0207705_10007543 Ga0207705_100075437 246
605 3300025909 Ga0207705_10038277 Ga0207705_100382772 246
606 3300025909 Ga0207705_10102103 Ga0207705_101021032 246
607 3300025909 Ga0207705_10421710 Ga0207705_104217101 246
608 3300025911 Ga0207654_10005276 Ga0207654_100052768 246
609 3300025911 Ga0207654_10010388 Ga0207654_100103882 246
610 3300025911 Ga0207654_10206933 Ga0207654_102069332 246
611 3300025912 Ga0207707_10016219 Ga0207707_100162194 246
612 3300025913 Ga0207695_10123128 Ga0207695_101231282 246
613 3300025913 Ga0207695_10199422 Ga0207695_101994222 246
614 3300025914 Ga0207671_10000098 Ga0207671_1000009840 246
615 3300025914 Ga0207671_10016385 Ga0207671_100163852 246
616 3300025914 Ga0207671_10027171 Ga0207671_100271714 246
617 3300025914 Ga0207671_10036385 Ga0207671_100363852 246
618 3300025914 Ga0207671_10038267 Ga0207671_100382672 246
619 3300025914 Ga0207671_10065373 Ga0207671_100653732 246
620 3300025914 Ga0207671_10214649 Ga0207671_102146491 246
621 3300025914 Ga0207671_10328979 Ga0207671_103289792 246
622 3300025915 Ga0207693_10015759 Ga0207693_100157591 246
623 3300025916 Ga0207663_10002594 Ga0207663_100025948 246
624 3300025917 Ga0207660_10150888 Ga0207660_101508882 246
625 3300025918 Ga0207662_10062892 Ga0207662_100628922 246
626 3300025919 Ga0207657_10032176 Ga0207657_100321763 246
627 3300025919 Ga0207657_10042901 Ga0207657_100429013 246
628 3300025919 Ga0207657_10046890 Ga0207657_100468905 246
629 3300025919 Ga0207657_10067886 Ga0207657_100678862 246
630 3300025920 Ga0207649_10004269 Ga0207649_100042694 246
631 3300025921 Ga0207652_10082409 Ga0207652_100824092 246
632 3300025921 Ga0207652_10452232 Ga0207652_104522322 246
633 3300025923 Ga0207681_10018257 Ga0207681_100182573 246
634 3300025923 Ga0207681_10039810 Ga0207681_100398102 246
635 3300025923 Ga0207681_10068503 Ga0207681_100685032 246
636 3300025923 Ga0207681_10122552 Ga0207681_101225522 246
637 3300025923 Ga0207681_10136522 Ga0207681_101365222 246
638 3300025923 Ga0207681_10389484 Ga0207681_103894841 246
639 3300025923 Ga0207681_10616992 Ga0207681_106169922 246
640 3300025924 Ga0207694_10069851 Ga0207694_100698511 246
641 3300025924 Ga0207694_10100132 Ga0207694_101001322 246
642 3300025924 Ga0207694_10275218 Ga0207694_102752182 246
643 3300025925 Ga0207650_10017853 Ga0207650_100178532 246
644 3300025926 Ga0207659_10002593 Ga0207659_100025937 246
645 3300025926 Ga0207659_10071354 Ga0207659_100713543 246
646 3300025926 Ga0207659_10085589 Ga0207659_100855892 246
647 3300025926 Ga0207659_10178576 Ga0207659_101785762 246
648 3300025927 Ga0207687_10003093 Ga0207687_100030933 246
649 3300025927 Ga0207687_10007241 Ga0207687_100072415 246
650 3300025927 Ga0207687_10050899 Ga0207687_100508992 246
651 3300025927 Ga0207687_10265131 Ga0207687_102651312 246
652 3300025928 Ga0207700_10031915 Ga0207700_100319152 246
653 3300025928 Ga0207700_10038178 Ga0207700_100381783 246
654 3300025929 Ga0207664_10006954 Ga0207664_100069543 246
655 3300025929 Ga0207664_10132657 Ga0207664_101326573 246
656 3300025931 Ga0207644_10006260 Ga0207644_100062608 246
657 3300025931 Ga0207644_10018313 Ga0207644_100183134 246
658 3300025931 Ga0207644_10045368 Ga0207644_100453683 246
659 3300025932 Ga0207690_10016088 Ga0207690_100160883 246
660 3300025932 Ga0207690_10139221 Ga0207690_101392212 246
661 3300025932 Ga0207690_10474299 Ga0207690_104742992 246
662 3300025933 Ga0207706_10003308 Ga0207706_100033085 246
663 3300025933 Ga0207706_10022986 Ga0207706_100229867 246
664 3300025933 Ga0207706_10184051 Ga0207706_101840512 246
665 3300025933 Ga0207706_10193365 Ga0207706_101933652 246
666 3300025934 Ga0207686_10002718 Ga0207686_100027186 246
667 3300025934 Ga0207686_10015735 Ga0207686_100157352 246
668 3300025935 Ga0207709_10001119 Ga0207709_100011196 246
669 3300025935 Ga0207709_10005283 Ga0207709_100052833 246
670 3300025935 Ga0207709_10024912 Ga0207709_100249123 246
671 3300025935 Ga0207709_10059177 Ga0207709_100591772 246
672 3300025935 Ga0207709_10113242 Ga0207709_101132422 246
673 3300025935 Ga0207709_10119585 Ga0207709_101195852 246
674 3300025935 Ga0207709_10145283 Ga0207709_101452832 246
675 3300025935 Ga0207709_10309967 Ga0207709_103099672 246
676 3300025936 Ga0207670_10005570 Ga0207670_100055707 246
677 3300025936 Ga0207670_10009557 Ga0207670_100095575 246
678 3300025936 Ga0207670_10292173 Ga0207670_102921732 246
679 3300025937 Ga0207669_10024389 Ga0207669_100243894 246
680 3300025937 Ga0207669_10024588 Ga0207669_100245883 246
681 3300025937 Ga0207669_10025755 Ga0207669_100257553 246
682 3300025937 Ga0207669_10029638 Ga0207669_100296385 246
683 3300025937 Ga0207669_10062917 Ga0207669_100629172 246
684 3300025937 Ga0207669_10174879 Ga0207669_101748792 246
685 3300025938 Ga0207704_10001177 Ga0207704_100011778 246
686 3300025938 Ga0207704_10009761 Ga0207704_100097612 246
687 3300025938 Ga0207704_10044084 Ga0207704_100440842 246
688 3300025938 Ga0207704_10209565 Ga0207704_102095652 246
689 3300025938 Ga0207704_10344545 Ga0207704_103445451 246
690 3300025939 Ga0207665_10005896 Ga0207665_100058963 246
691 3300025939 Ga0207665_10112843 Ga0207665_101128432 246
692 3300025940 Ga0207691_10003792 Ga0207691_100037929 246
693 3300025940 Ga0207691_10035477 Ga0207691_100354774 246
694 3300025940 Ga0207691_10099364 Ga0207691_100993643 246
695 3300025940 Ga0207691_10208710 Ga0207691_102087102 246
696 3300025940 Ga0207691_10216614 Ga0207691_102166142 246
697 3300025940 Ga0207691_10239163 Ga0207691_102391632 246
698 3300025940 Ga0207691_10655160 Ga0207691_106551601 246
699 3300025941 Ga0207711_10001117 Ga0207711_1000111724 246
700 3300025941 Ga0207711_10073953 Ga0207711_100739533 246
701 3300025941 Ga0207711_10141307 Ga0207711_101413072 246
702 3300025942 Ga0207689_10003529 Ga0207689_1000352913 246
703 3300025942 Ga0207689_10004524 Ga0207689_100045249 246
704 3300025942 Ga0207689_10016932 Ga0207689_100169325 246
705 3300025942 Ga0207689_10026403 Ga0207689_100264033 246
706 3300025942 Ga0207689_10071557 Ga0207689_100715573 246
707 3300025942 Ga0207689_10213752 Ga0207689_102137522 246
708 3300025944 Ga0207661_10155033 Ga0207661_101550332 246
709 3300025945 Ga0207679_10579823 Ga0207679_105798231 246
710 3300025949 Ga0207667_10002257 Ga0207667_100022577 246
711 3300025949 Ga0207667_10019765 Ga0207667_100197657 246
712 3300025949 Ga0207667_10432121 Ga0207667_104321211 246
713 3300025960 Ga0207651_10330865 Ga0207651_103308652 246
714 3300025960 Ga0207651_10413170 Ga0207651_104131702 246
715 3300025961 Ga0207712_10093622 Ga0207712_100936223 246
716 3300025961 Ga0207712_10132278 Ga0207712_101322782 246
717 3300025961 Ga0207712_10452389 Ga0207712_104523892 246
718 3300025961 Ga0207712_10794292 Ga0207712_107942921 246
719 3300025972 Ga0207668_10004719 Ga0207668_100047196 246
720 3300025972 Ga0207668_10007648 Ga0207668_100076486 246
721 3300025972 Ga0207668_10022961 Ga0207668_100229612 246
722 3300025972 Ga0207668_10054878 Ga0207668_100548782 246
723 3300025972 Ga0207668_10091056 Ga0207668_100910562 246
724 3300025972 Ga0207668_10107072 Ga0207668_101070722 246
725 3300025972 Ga0207668_10148672 Ga0207668_101486722 246
726 3300025972 Ga0207668_10252672 Ga0207668_102526722 246
727 3300025972 Ga0207668_10325583 Ga0207668_103255831 246
728 3300025981 Ga0207640_10004957 Ga0207640_100049576 246
729 3300025981 Ga0207640_10163554 Ga0207640_101635542 246
730 3300025981 Ga0207640_10218584 Ga0207640_102185841 246
731 3300025986 Ga0207658_10001163 Ga0207658_1000116318 246
732 3300025986 Ga0207658_10002997 Ga0207658_100029977 246
733 3300025986 Ga0207658_10154102 Ga0207658_101541021 246
734 3300025986 Ga0207658_10471536 Ga0207658_104715361 246
735 3300026023 Ga0207677_10000686 Ga0207677_100006868 246
736 3300026023 Ga0207677_10081529 Ga0207677_100815292 246
737 3300026023 Ga0207677_10148763 Ga0207677_101487632 246
738 3300026035 Ga0207703_10000702 Ga0207703_1000070227 246
739 3300026035 Ga0207703_10148135 Ga0207703_101481352 246
740 3300026035 Ga0207703_10322585 Ga0207703_103225852 246
741 3300026041 Ga0207639_10004702 Ga0207639_100047026 246
742 3300026041 Ga0207639_10017059 Ga0207639_100170593 246
743 3300026041 Ga0207639_10043662 Ga0207639_100436622 246
744 3300026041 Ga0207639_10197789 Ga0207639_101977892 246
745 3300026041 Ga0207639_10228345 Ga0207639_102283452 246
746 3300026067 Ga0207678_10055733 Ga0207678_100557333 246
747 3300026067 Ga0207678_10139218 Ga0207678_101392182 246
748 3300026067 Ga0207678_10239799 Ga0207678_102397992 246
749 3300026067 Ga0207678_10368317 Ga0207678_103683172 246
750 3300026075 Ga0207708_10023248 Ga0207708_100232483 246
751 3300026075 Ga0207708_10063677 Ga0207708_100636772 246
752 3300026075 Ga0207708_10174109 Ga0207708_101741092 246
753 3300026078 Ga0207702_10020818 Ga0207702_100208184 246
754 3300026078 Ga0207702_10021279 Ga0207702_100212792 246
755 3300026078 Ga0207702_10080204 Ga0207702_100802042 246
756 3300026078 Ga0207702_10085088 Ga0207702_100850883 246
757 3300026078 Ga0207702_10091452 Ga0207702_100914523 246
758 3300026078 Ga0207702_10258663 Ga0207702_102586632 246
759 3300026088 Ga0207641_10000926 Ga0207641_100009268 246
760 3300026088 Ga0207641_10135643 Ga0207641_101356433 246
761 3300026088 Ga0207641_10167392 Ga0207641_101673922 246
762 3300026088 Ga0207641_10330977 Ga0207641_103309772 246
763 3300026089 Ga0207648_10000227 Ga0207648_1000022721 246
764 3300026089 Ga0207648_10001863 Ga0207648_100018638 246
765 3300026089 Ga0207648_10004241 Ga0207648_1000424113 246
766 3300026089 Ga0207648_10027604 Ga0207648_100276043 246
767 3300026089 Ga0207648_10052018 Ga0207648_100520183 246
768 3300026089 Ga0207648_10077381 Ga0207648_100773813 246
769 3300026089 Ga0207648_10137674 Ga0207648_101376741 246
770 3300026089 Ga0207648_10152176 Ga0207648_101521762 246
771 3300026089 Ga0207648_10182587 Ga0207648_101825872 246
772 3300026089 Ga0207648_10209896 Ga0207648_102098961 246
773 3300026095 Ga0207676_10000656 Ga0207676_1000065615 246
774 3300026095 Ga0207676_10055756 Ga0207676_100557562 246
775 3300026095 Ga0207676_10171438 Ga0207676_101714382 246
776 3300026095 Ga0207676_10220263 Ga0207676_102202632 246
777 3300026095 Ga0207676_10406427 Ga0207676_104064271 246
778 3300026116 Ga0207674_10026564 Ga0207674_100265646 246
779 3300026116 Ga0207674_10196987 Ga0207674_101969872 246
780 3300026118 Ga0207675_100001409 Ga0207675_10000140910 246
781 3300026118 Ga0207675_100003635 Ga0207675_10000363514 246
782 3300026118 Ga0207675_100004839 Ga0207675_1000048399 246
783 3300026118 Ga0207675_100005359 Ga0207675_10000535912 246
784 3300026118 Ga0207675_100025107 Ga0207675_1000251072 246
785 3300026118 Ga0207675_100040984 Ga0207675_1000409842 246
786 3300026118 Ga0207675_100063281 Ga0207675_1000632812 246
787 3300026118 Ga0207675_100131377 Ga0207675_1001313773 246
788 3300026121 Ga0207683_10000463 Ga0207683_1000046334 246
789 3300026121 Ga0207683_10028847 Ga0207683_100288473 246
790 3300026121 Ga0207683_10041326 Ga0207683_100413264 246
791 3300026121 Ga0207683_10049390 Ga0207683_100493902 246
792 3300026121 Ga0207683_10059609 Ga0207683_100596092 246
793 3300026121 Ga0207683_10116269 Ga0207683_101162692 246
794 3300026121 Ga0207683_10360331 Ga0207683_103603312 246
795 3300026142 Ga0207698_10008240 Ga0207698_100082401 246
796 3300026142 Ga0207698_10015130 Ga0207698_100151304 246
797 3300026142 Ga0207698_10139450 Ga0207698_101394502 246
798 3300026142 Ga0207698_10210576 Ga0207698_102105762 246
799 3300026142 Ga0207698_10216552 Ga0207698_102165522 246
800 3300026142 Ga0207698_10412347 Ga0207698_104123472 246
801 3300027671 Ga0209588_1024000 Ga0209588_10240002 246
802 3300027876 Ga0209974_10014701 Ga0209974_100147012 246
803 3300027907 Ga0207428_10000055 Ga0207428_1000005513 246
804 3300027907 Ga0207428_10198334 Ga0207428_101983342 246
805 3300027907 Ga0207428_10373913 Ga0207428_103739131 246
806 3300028379 Ga0268266_10001688 Ga0268266_1000168824 246
807 3300028379 Ga0268266_10004161 Ga0268266_100041612 246
808 3300028379 Ga0268266_10013435 Ga0268266_100134357 246
809 3300028379 Ga0268266_10014245 Ga0268266_100142457 246
810 3300028379 Ga0268266_10022514 Ga0268266_100225143 246
811 3300028379 Ga0268266_10268317 Ga0268266_102683172 246
812 3300028380 Ga0268265_10019073 Ga0268265_100190736 246
813 3300028380 Ga0268265_10020317 Ga0268265_100203173 246
814 3300028380 Ga0268265_10031758 Ga0268265_100317582 246
815 3300028380 Ga0268265_10036898 Ga0268265_100368983 246
816 3300028380 Ga0268265_10045858 Ga0268265_100458583 246
817 3300028380 Ga0268265_10060622 Ga0268265_100606222 246
818 3300028380 Ga0268265_10120812 Ga0268265_101208122 246
819 3300028380 Ga0268265_10487658 Ga0268265_104876581 246
820 3300028381 Ga0268264_10027008 Ga0268264_100270081 246
821 3300028381 Ga0268264_10031040 Ga0268264_100310403 246
822 3300028381 Ga0268264_10050132 Ga0268264_100501325 246
823 3300028381 Ga0268264_10102078 Ga0268264_101020782 246
824 3300028381 Ga0268264_10146821 Ga0268264_101468212 246
825 3300028381 Ga0268264_10245924 Ga0268264_102459242 246
826 3300028381 Ga0268264_10359369 Ga0268264_103593692 246
827 3300028381 Ga0268264_10395543 Ga0268264_103955431 246
828 3300028786 Ga0307517_10000102 Ga0307517_1000010264 246
829 3300028786 Ga0307517_10091558 Ga0307517_100915583 246
830 3300028794 Ga0307515_10000130 Ga0307515_1000013089 246
831 3300028794 Ga0307515_10005868 Ga0307515_1000586814 246
832 3300030521 Ga0307511_10062115 Ga0307511_100621152 246
833 3300030521 Ga0307511_10105332 Ga0307511_101053322 246
834 3300030522 Ga0307512_10066553 Ga0307512_100665532 246
835 3300031238 Ga0265332_10044610 Ga0265332_100446102 246
836 3300031239 Ga0265328_10075366 Ga0265328_100753661 246
837 3300031241 Ga0265325_10033572 Ga0265325_100335723 246
838 3300031241 Ga0265325_10090164 Ga0265325_100901642 246
839 3300031249 Ga0265339_10001056 Ga0265339_1000105616 246
840 3300031250 Ga0265331_10024029 Ga0265331_100240292 246
841 3300031250 Ga0265331_10027234 Ga0265331_100272342 246
842 3300031344 Ga0265316_10102464 Ga0265316_101024642 246
843 3300031456 Ga0307513_10004550 Ga0307513_1000455012 246
844 3300031456 Ga0307513_10006865 Ga0307513_100068654 246
845 3300031456 Ga0307513_10011752 Ga0307513_100117529 246
846 3300031456 Ga0307513_10161071 Ga0307513_101610712 246
847 3300031456 Ga0307513_10207476 Ga0307513_102074762 246
848 3300031456 Ga0307513_10237260 Ga0307513_102372601 246
849 3300031456 Ga0307513_10412727 Ga0307513_104127271 246
850 3300031507 Ga0307509_10020922 Ga0307509_100209224 246
851 3300031507 Ga0307509_10077468 Ga0307509_100774682 246
852 3300031507 Ga0307509_10382066 Ga0307509_103820662 246
853 3300031507 Ga0307509_10434821 Ga0307509_104348211 246
854 3300031548 Ga0307408_100009454 Ga0307408_1000094544 246
855 3300031548 Ga0307408_100190984 Ga0307408_1001909842 246
856 3300031548 Ga0307408_100223010 Ga0307408_1002230102 246
857 3300031548 Ga0307408_100306894 Ga0307408_1003068941 246
858 3300031548 Ga0307408_100589190 Ga0307408_1005891901 246
859 3300031595 Ga0265313_10000044 Ga0265313_1000004415 246
860 3300031595 Ga0265313_10040982 Ga0265313_100409821 246
861 3300031595 Ga0265313_10123276 Ga0265313_101232762 246
862 3300031616 Ga0307508_10066442 Ga0307508_100664422 246
863 3300031616 Ga0307508_10141035 Ga0307508_101410352 246
864 3300031616 Ga0307508_10206694 Ga0307508_102066942 246
865 3300031616 Ga0307508_10286396 Ga0307508_102863962 246
866 3300031616 Ga0307508_10387937 Ga0307508_103879372 246
867 3300031711 Ga0265314_10060748 Ga0265314_100607482 246
868 3300031711 Ga0265314_10072215 Ga0265314_100722152 246
869 3300031712 Ga0265342_10037361 Ga0265342_100373612 246
870 3300031730 Ga0307516_10002286 Ga0307516_100022869 246
871 3300031730 Ga0307516_10003926 Ga0307516_1000392616 246
872 3300031730 Ga0307516_10020911 Ga0307516_100209113 246
873 3300031730 Ga0307516_10042688 Ga0307516_100426882 246
874 3300031730 Ga0307516_10047076 Ga0307516_100470762 246
875 3300031730 Ga0307516_10130828 Ga0307516_101308283 246
876 3300031730 Ga0307516_10155104 Ga0307516_101551042 246
877 3300031730 Ga0307516_10345991 Ga0307516_103459912 246
878 3300031730 Ga0307516_10349497 Ga0307516_103494972 246
879 3300031730 Ga0307516_10421155 Ga0307516_104211551 246
880 3300031731 Ga0307405_10179969 Ga0307405_101799692 246
881 3300031852 Ga0307410_10019322 Ga0307410_100193222 246
882 3300031852 Ga0307410_10041221 Ga0307410_100412213 246
883 3300031852 Ga0307410_10083488 Ga0307410_100834883 246
884 3300031852 Ga0307410_10203151 Ga0307410_102031512 246
885 3300031852 Ga0307410_10407633 Ga0307410_104076332 246
886 3300031901 Ga0307406_10061645 Ga0307406_100616453 246
887 3300031901 Ga0307406_10458268 Ga0307406_104582682 246
888 3300031901 Ga0307406_10537513 Ga0307406_105375131 246
889 3300031901 Ga0307406_10613626 Ga0307406_106136261 246
890 3300031911 Ga0307412_10152043 Ga0307412_101520432 246
891 3300031911 Ga0307412_10200185 Ga0307412_102001851 246
892 3300031911 Ga0307412_10303683 Ga0307412_103036832 246
893 3300031911 Ga0307412_10415584 Ga0307412_104155842 246
894 3300031995 Ga0307409_100018544 Ga0307409_1000185443 246
895 3300031995 Ga0307409_100039177 Ga0307409_1000391772 246
896 3300031995 Ga0307409_100043282 Ga0307409_1000432823 246
897 3300032002 Ga0307416_100007618 Ga0307416_1000076182 246
898 3300032002 Ga0307416_100037447 Ga0307416_1000374472 246
899 3300032002 Ga0307416_100056078 Ga0307416_1000560783 246
900 3300032002 Ga0307416_100615651 Ga0307416_1006156512 246
901 3300032002 Ga0307416_100628839 Ga0307416_1006288392 246
902 3300032004 Ga0307414_10024513 Ga0307414_100245133 246
903 3300032004 Ga0307414_10049458 Ga0307414_100494582 246
904 3300032004 Ga0307414_10114087 Ga0307414_101140872 246
905 3300032004 Ga0307414_10410036 Ga0307414_104100361 246
906 3300032005 Ga0307411_10074874 Ga0307411_100748741 246
907 3300032005 Ga0307411_10132876 Ga0307411_101328762 246
908 3300032126 Ga0307415_100068726 Ga0307415_1000687263 246
909 3300033179 Ga0307507_10009514 Ga0307507_100095144 246
910 3300033180 Ga0307510_10000403 Ga0307510_1000040329 246
911 3300033180 Ga0307510_10159973 Ga0307510_101599732 246
912 3300034816 Ga0373930_0002314 Ga0373930_0002314_287_1027 246
913 3300034819 Ga0373958_0010594 Ga0373958_0010594_584_1324 246
914 3300034820 Ga0373959_0059970 Ga0373959_0059970_19_759 246
915 3300034957 Ga0373938_0021680 Ga0373938_0021680_297_1037 246
916 3300035084 Ga0373928_0025870 Ga0373928_0025870_339_1079 246
917 3300035088 Ga0373940_0001803 Ga0373940_0001803_1808_2548 246
918 3300035088 Ga0373940_0013447 Ga0373940_0013447_1030_1770 246
919 3300035090 Ga0373949_0035880 Ga0373949_0035880_217_957 246
920 3300035112 Ga0373932_0065455 Ga0373932_0065455_28_768 246
921 3300035113 Ga0373936_0058868 Ga0373936_0058868_506_1246 246
922 3300035116 Ga0373945_0075361 Ga0373945_0075361_42_782 246
923 3300035118 Ga0373954_0065142 Ga0373954_0065142_582_1382 246
924 3300035119 Ga0373956_0088068 Ga0373956_0088068_566_1312 246
925 3300035121 Ga0373960_0108071 Ga0373960_0108071_132_872 246
926 3300035170 Ga0373943_0183297 Ga0373943_0183297_12_794 246
927 3300035170 Ga0373943_0218080 Ga0373943_0218080_303_1043 246
928 3300035170 Ga0373943_0238149 Ga0373943_0238149_115_879 246
929 3300035171 Ga0373946_0043305 Ga0373946_0043305_1037_1837 246
930 3300035172 Ga0373955_0031994 Ga0373955_0031994_1427_2173 246
931 3300035172 Ga0373955_0036165 Ga0373955_0036165_511_1311 246
932 3300035207 Ga0373942_0013968 Ga0373942_0013968_50_790 246
933 3300035242 Ga0373962_0007243 Ga0373962_0007243_1820_2560 246
934 3300035410 Ga0373924_0013697 Ga0373924_0013697_947_1693 246
935 3300035691 Ga0373931_0000221 Ga0373931_0000221_5501_6241 246
936 3300035691 Ga0373931_0144426 Ga0373931_0144426_522_1262 246
937 3300035691 Ga0373931_0361801 Ga0373931_0361801_117_857 246
938 3300035692 Ga0373935_0001741 Ga0373935_0001741_4280_5080 246
939 3300035692 Ga0373935_0029145 Ga0373935_0029145_2024_2764 246
940 3300035692 Ga0373935_0059489 Ga0373935_0059489_1574_2314 246
941 3300035695 Ga0373927_0000139 Ga0373927_0000139_19356_20096 246
942 3300035695 Ga0373927_0001969 Ga0373927_0001969_11742_12542 246
943 3300035695 Ga0373927_0021434 Ga0373927_0021434_224_988 246
944 3300035695 Ga0373927_0021765 Ga0373927_0021765_607_1347 246
945 3300035695 Ga0373927_0028636 Ga0373927_0028636_2387_3127 246
946 3300035695 Ga0373927_0151088 Ga0373927_0151088_466_1206 246
947 3300035724 Ga0373933_0007649 Ga0373933_0007649_1860_2606 246
948 3300035724 Ga0373933_0041090 Ga0373933_0041090_1260_2006 246
949 3300035725 Ga0373947_0001689 Ga0373947_0001689_10135_10935 246
950 3300035725 Ga0373947_0023523 Ga0373947_0023523_2676_3440 246
951 3300036401 Ga0373937_0009205 Ga0373937_0009205_924_1670 246
952 3300036401 Ga0373937_0039005 Ga0373937_0039005_2608_3408 246
953 3300036401 Ga0373937_0050691 Ga0373937_0050691_1053_1799 246
954 3300036401 Ga0373937_0061257 Ga0373937_0061257_2145_2909 246
955 3300036401 Ga0373937_0177910 Ga0373937_0177910_94_840 246
956 3300036401 Ga0373937_0689912 Ga0373937_0689912_153_893 246
957 3300037068 Ga0373925_0002233 Ga0373925_0002233_2051_2791 246
958 3300037068 Ga0373925_0014218 Ga0373925_0014218_2726_3526 246
959 3300037068 Ga0373925_0186614 Ga0373925_0186614_857_1597 246
960 3300037068 Ga0373925_0336393 Ga0373925_0336393_309_1049 246
961 3300037068 Ga0373925_0487456 Ga0373925_0487456_82_822 246
962 3300037068 Ga0373925_0770095 Ga0373925_0770095_34_774 246
963 3300037312 Ga0395899_0027674 Ga0395899_0027674_2528_3268 246
964 3300037312 Ga0395899_0116590 Ga0395899_0116590_163_936 246
965 3300037418 Ga0395900_0029660 Ga0395900_0029660_4447_5187 246
966 3300037418 Ga0395900_0091357 Ga0395900_0091357_532_1272 246
967 3300037418 Ga0395900_0095506 Ga0395900_0095506_1882_2625 246
968 3300037418 Ga0395900_0217555 Ga0395900_0217555_159_902 246
969 3300037418 Ga0395900_0376925 Ga0395900_0376925_283_1023 246
970 3300037466 Ga0395898_0088943 Ga0395898_0088943_2195_2935 246
971 3300037471 Ga0395905_0000972 Ga0395905_0000972_17311_18087 246
972 3300037471 Ga0395905_0001399 Ga0395905_0001399_19448_20188 246
973 3300037471 Ga0395905_0021902 Ga0395905_0021902_2184_2927 246
974 3300037471 Ga0395905_0079268 Ga0395905_0079268_499_1239 246
975 3300037471 Ga0395905_0083018 Ga0395905_0083018_684_1457 246
976 3300037471 Ga0395905_0169130 Ga0395905_0169130_45_788 246
977 3300037471 Ga0395905_0888678 Ga0395905_0888678_35_775 246
978 3300037853 Ga0436364_0432791 Ga0436364_0432791_413_1153 246
979 3300037853 Ga0436364_1006337 Ga0436364_1006337_890_1636 246
980 3300037853 Ga0436364_1104972 Ga0436364_1104972_1204_1944 246
981 3300037853 Ga0436364_1224731 Ga0436364_1224731_396_1136 246
982 3300037853 Ga0436364_1463980 Ga0436364_1463980_5461_6201 246
983 3300038443 Ga0395901_0068908 Ga0395901_0068908_2067_2807 246
984 3300038443 Ga0395901_0119894 Ga0395901_0119894_1216_2094 246
985 3300039062 Ga0400483_085697 Ga0400483_085697_1925_2665 246
986 3300039062 Ga0400483_125610 Ga0400483_125610_1198_1938 246
987 3300039062 Ga0400483_202169 Ga0400483_202169_5739_6479 246
988 3300039437 Ga0436365_0080604 Ga0436365_0080604_32958_33698 246
989 3300039437 Ga0436365_0095350 Ga0436365_0095350_1081_1821 246
990 3300039437 Ga0436365_0291258 Ga0436365_0291258_27647_28387 246
991 3300039437 Ga0436365_0484605 Ga0436365_0484605_284_1024 246
992 3300039437 Ga0436365_0528920 Ga0436365_0528920_269_1009 246
993 3300039437 Ga0436365_0709674 Ga0436365_0709674_4951_5691 246
994 3300039437 Ga0436365_1106760 Ga0436365_1106760_1380_2120 246
995 3300039437 Ga0436365_1107580 Ga0436365_1107580_717_1457 246
996 3300039437 Ga0436365_1113050 Ga0436365_1113050_831_1571 246
997 3300039438 Ga0436360_0806014 Ga0436360_0806014_182_931 246
998 3300039438 Ga0436360_1247364 Ga0436360_1247364_1148_1888 246
999 3300039447 Ga0436361_0316835 Ga0436361_0316835_633_1373 246
1000 3300039447 Ga0436361_0438285 Ga0436361_0438285_10_750 246
1001 3300039447 Ga0436361_0655965 Ga0436361_0655965_1034_1774 246
1002 3300039450 Ga0436363_0250085 Ga0436363_0250085_24983_25723 246
1003 3300039450 Ga0436363_0470149 Ga0436363_0470149_318_1058 246
1004 3300039450 Ga0436363_0691653 Ga0436363_0691653_1567_2307 246
1005 3300039450 Ga0436363_0706677 Ga0436363_0706677_2126_2878 246
1006 3300039453 Ga0436362_0039268 Ga0436362_0039268_2720_3460 246
1007 3300039453 Ga0436362_1130295 Ga0436362_1130295_7779_8519 246
1008 3300041404 Ga0439436_0007480 Ga0439436_0007480_2029_2769 246
1009 3300041406 Ga0439439_0029003 Ga0439439_0029003_121_972 246
1010 3300041408 Ga0439453_0000158 Ga0439453_0000158_4128_4871 246
1011 3300041413 Ga0439465_0001656 Ga0439465_0001656_5904_6755 246
1012 3300041413 Ga0439465_0005428 Ga0439465_0005428_2604_3344 246
1013 3300041413 Ga0439465_0040068 Ga0439465_0040068_225_968 246
1014 3300041458 Ga0451798_0384754 Ga0451798_0384754_91_876 246
1015 3300041511 Ga0451855_1802886 Ga0451855_1802886_159_899 246
1016 3300042003 Ga0439443_008804 Ga0439443_008804_303_1046 246
1017 3300042007 Ga0439449_0037385 Ga0439449_0037385_310_1050 246
1018 3300042007 Ga0439449_0063712 Ga0439449_0063712_418_1269 246
1019 3300042012 Ga0439455_0022404 Ga0439455_0022404_312_1052 246
1020 3300042122 Ga0450920_003262 Ga0450920_003262_1916_2656 246
1021 3300042157 Ga0439458_0011139 Ga0439458_0011139_1166_1906 246
1022 3300042435 Ga0439434_0017132 Ga0439434_0017132_1381_2121 246
1023 3300042436 Ga0439435_0001732 Ga0439435_0001732_2898_3641 246
1024 3300042436 Ga0439435_0036134 Ga0439435_0036134_549_1289 246
1025 3300042461 Ga0439460_0014937 Ga0439460_0014937_617_1360 246
1026 3300042531 Ga0450918_001827 Ga0450918_001827_219_959 246
1027 3300044656 Ga0466969_0003525 Ga0466969_0003525_2699_3439 246
1028 3300044684 Ga0466966_0010452 Ga0466966_0010452_4747_5487 246
1029 3300044693 Ga0466961_0005081 Ga0466961_0005081_1663_2403 246
1030 3300044712 Ga0453684_0015661 Ga0453684_0015661_10061_10801 246
1031 3300044712 Ga0453684_0418952 Ga0453684_0418952_93_833 246
1032 3300045049 Ga0466959_0012816 Ga0466959_0012816_4341_5081 246
1033 3300045051 Ga0451576_0294890 Ga0451576_0294890_200_940 246
1034 3300045051 Ga0451576_0350453 Ga0451576_0350453_10_750 246
1035 3300045976 Ga0466967_0096052 Ga0466967_0096052_1305_2057 246
1036 3300045976 Ga0466967_0416290 Ga0466967_0416290_267_1028 246
1037 3300046452 Ga0495617_056816 Ga0495617_056816_141_881 246
1038 3300046454 Ga0495592_0057749 Ga0495592_0057749_1485_2231 246
1039 3300046454 Ga0495592_0118533 Ga0495592_0118533_466_1266 246
1040 3300046454 Ga0495592_0216459 Ga0495592_0216459_460_1206 246
1041 3300046455 Ga0495603_0051016 Ga0495603_0051016_1407_2147 246
1042 3300046455 Ga0495603_0130629 Ga0495603_0130629_448_1209 246
1043 3300046455 Ga0495603_0214800 Ga0495603_0214800_28_768 246
1044 3300046457 Ga0495590_0007845 Ga0495590_0007845_1177_1917 246
1045 3300046457 Ga0495590_0014862 Ga0495590_0014862_1854_2594 246
1046 3300046459 Ga0495629_0089881 Ga0495629_0089881_1049_1789 246
1047 3300046460 Ga0495638_0010023 Ga0495638_0010023_396_1136 246
1048 3300046460 Ga0495638_0019892 Ga0495638_0019892_63_803 246
1049 3300046460 Ga0495638_0023502 Ga0495638_0023502_1243_1983 246
1050 3300046460 Ga0495638_0052267 Ga0495638_0052267_982_1722 246
1051 3300046460 Ga0495638_0078706 Ga0495638_0078706_1129_1869 246
1052 3300046462 Ga0495651_0099829 Ga0495651_0099829_1398_2144 246
1053 3300046462 Ga0495651_0298201 Ga0495651_0298201_311_1057 246
1054 3300046472 Ga0495580_0044247 Ga0495580_0044247_709_1509 246
1055 3300046474 Ga0495605_0009156 Ga0495605_0009156_2224_2964 246
1056 3300046475 Ga0495639_0009873 Ga0495639_0009873_607_1347 246
1057 3300046475 Ga0495639_0093753 Ga0495639_0093753_58_843 246
1058 3300046475 Ga0495639_0128881 Ga0495639_0128881_17_757 246
1059 3300046476 Ga0495662_0123159 Ga0495662_0123159_203_943 246
1060 3300046477 Ga0495664_0001193 Ga0495664_0001193_2606_3406 246
1061 3300046477 Ga0495664_0006956 Ga0495664_0006956_4520_5266 246
1062 3300046477 Ga0495664_0046765 Ga0495664_0046765_1706_2446 246
1063 3300046491 Ga0495584_0040470 Ga0495584_0040470_656_1396 246
1064 3300046491 Ga0495584_0131277 Ga0495584_0131277_72_812 246
1065 3300046492 Ga0495585_0023268 Ga0495585_0023268_1561_2301 246
1066 3300046492 Ga0495585_0031741 Ga0495585_0031741_1258_1998 246
1067 3300046492 Ga0495585_0057444 Ga0495585_0057444_31_771 246
1068 3300046499 Ga0495594_0117183 Ga0495594_0117183_528_1268 246
1069 3300046500 Ga0495596_0018291 Ga0495596_0018291_260_1000 246
1070 3300046501 Ga0495607_0106584 Ga0495607_0106584_429_1214 246
1071 3300046506 Ga0495583_0073517 Ga0495583_0073517_620_1360 246
1072 3300046507 Ga0495606_0002308 Ga0495606_0002308_21262_22002 246
1073 3300046507 Ga0495606_0242604 Ga0495606_0242604_147_887 246
1074 3300046511 Ga0495608_0013378 Ga0495608_0013378_3664_4410 246
1075 3300046511 Ga0495608_0091303 Ga0495608_0091303_1021_1767 246
1076 3300046512 Ga0495610_0016205 Ga0495610_0016205_448_1188 246
1077 3300046512 Ga0495610_0021848 Ga0495610_0021848_227_967 246
1078 3300046512 Ga0495610_0167975 Ga0495610_0167975_140_880 246
1079 3300046513 Ga0495616_0020982 Ga0495616_0020982_1803_2543 246
1080 3300046514 Ga0495618_0087433 Ga0495618_0087433_459_1259 246
1081 3300046515 Ga0495620_0019783 Ga0495620_0019783_1752_2492 246
1082 3300046515 Ga0495620_0027127 Ga0495620_0027127_385_1125 246
1083 3300046515 Ga0495620_0084744 Ga0495620_0084744_151_891 246
1084 3300046516 Ga0495628_0040093 Ga0495628_0040093_275_1075 246
1085 3300046516 Ga0495628_0206249 Ga0495628_0206249_421_1167 246
1086 3300046517 Ga0495630_0002691 Ga0495630_0002691_7611_8411 246
1087 3300046517 Ga0495630_0179043 Ga0495630_0179043_403_1143 246
1088 3300046518 Ga0495631_0027363 Ga0495631_0027363_1241_1981 246
1089 3300046518 Ga0495631_0161637 Ga0495631_0161637_153_893 246
1090 3300046520 Ga0495637_0048020 Ga0495637_0048020_909_1649 246
1091 3300046522 Ga0495643_0016345 Ga0495643_0016345_888_1628 246
1092 3300046522 Ga0495643_0016823 Ga0495643_0016823_379_1119 246
1093 3300046522 Ga0495643_0031187 Ga0495643_0031187_141_881 246
1094 3300046523 Ga0495644_0031331 Ga0495644_0031331_410_1150 246
1095 3300046523 Ga0495644_0056906 Ga0495644_0056906_347_1087 246
1096 3300046524 Ga0495648_0019848 Ga0495648_0019848_1967_2749 246
1097 3300046524 Ga0495648_0033917 Ga0495648_0033917_800_1540 246
1098 3300046524 Ga0495648_0165670 Ga0495648_0165670_329_1072 246
1099 3300046526 Ga0495666_0016302 Ga0495666_0016302_2330_3070 246
1100 3300046528 Ga0495642_0021749 Ga0495642_0021749_312_1052 246
1101 3300046528 Ga0495642_0024106 Ga0495642_0024106_1322_2062 246
1102 3300046528 Ga0495642_0036830 Ga0495642_0036830_913_1653 246
1103 3300046530 Ga0495654_0027025 Ga0495654_0027025_411_1151 246
1104 3300046531 Ga0495665_0010250 Ga0495665_0010250_1658_2458 246
1105 3300046531 Ga0495665_0050823 Ga0495665_0050823_1005_1745 246
1106 3300046533 Ga0495640_0139113 Ga0495640_0139113_799_1545 246
1107 3300046536 Ga0495587_0054018 Ga0495587_0054018_1253_1999 246
1108 3300046537 Ga0495598_0001316 Ga0495598_0001316_2720_3460 246
1109 3300046539 Ga0495621_0028212 Ga0495621_0028212_751_1491 246
1110 3300046539 Ga0495621_0073041 Ga0495621_0073041_31_816 246
1111 3300046542 Ga0495597_0011373 Ga0495597_0011373_341_1081 246
1112 3300046542 Ga0495597_0013824 Ga0495597_0013824_2307_3047 246
1113 3300046542 Ga0495597_0060331 Ga0495597_0060331_854_1594 246
1114 3300046543 Ga0495645_0002601 Ga0495645_0002601_1993_2739 246
1115 3300046559 Ga0495667_0012733 Ga0495667_0012733_3954_4700 246
1116 3300046559 Ga0495667_0013502 Ga0495667_0013502_2409_3155 246
1117 3300046559 Ga0495667_0186767 Ga0495667_0186767_492_1238 246
1118 3300046615 Ga0495656_0000201 Ga0495656_0000201_8316_9056 246
1119 3300046615 Ga0495656_0001707 Ga0495656_0001707_3191_3931 246
1120 3300046615 Ga0495656_0038424 Ga0495656_0038424_32_817 246
1121 3300046615 Ga0495656_0069385 Ga0495656_0069385_32_859 246
1122 3300046616 Ga0495668_0093858 Ga0495668_0093858_658_1398 246
1123 3300046642 Ga0495634_0032374 Ga0495634_0032374_2053_2853 246
1124 3300046648 Ga0495611_0125277 Ga0495611_0125277_342_1082 246
1125 3300046660 Ga0495625_0003440 Ga0495625_0003440_11915_12655 246
1126 3300046660 Ga0495625_0157101 Ga0495625_0157101_733_1473 246
1127 3300046660 Ga0495625_0209204 Ga0495625_0209204_213_953 246
1128 3300046663 Ga0495635_0315518 Ga0495635_0315518_47_787 246
1129 3300046665 Ga0495661_0111480 Ga0495661_0111480_193_933 246
1130 3300046674 Ga0495588_0066318 Ga0495588_0066318_549_1334 246
1131 3300046674 Ga0495588_0218852 Ga0495588_0218852_230_970 246
1132 3300046675 Ga0495657_0127373 Ga0495657_0127373_135_881 246
1133 3300046678 Ga0495599_0014021 Ga0495599_0014021_4125_4871 246
1134 3300046679 Ga0495623_0140356 Ga0495623_0140356_465_1211 246
1135 3300046680 Ga0495646_0034557 Ga0495646_0034557_1984_2730 246
1136 3300046680 Ga0495646_0049579 Ga0495646_0049579_1195_1995 246
1137 3300046683 Ga0495658_0152836 Ga0495658_0152836_435_1175 246
1138 3300046683 Ga0495658_0169234 Ga0495658_0169234_232_993 246
1139 3300046684 Ga0495669_0014685 Ga0495669_0014685_1363_2103 246
1140 3300046684 Ga0495669_0068550 Ga0495669_0068550_656_1396 246
1141 3300046689 Ga0495613_0165200 Ga0495613_0165200_683_1483 246
1142 3300046690 Ga0495624_0084998 Ga0495624_0084998_781_1521 246
1143 3300046691 Ga0495670_0077621 Ga0495670_0077621_733_1518 246
1144 3300046692 Ga0495671_0013120 Ga0495671_0013120_2666_3406 246
1145 3300046694 Ga0495649_0073721 Ga0495649_0073721_1065_1805 246
1146 3300046809 Ga0495600_0014445 Ga0495600_0014445_4143_4889 246
1147 3300046809 Ga0495600_0121970 Ga0495600_0121970_102_860 246
1148 3300046810 Ga0495660_0068273 Ga0495660_0068273_65_805 246
1149 3300047315 Ga0495581_0183313 Ga0495581_0183313_174_914 246
1150 3300047315 Ga0495581_0358551 Ga0495581_0358551_63_809 246
1151 3300047317 Ga0495604_0017364 Ga0495604_0017364_2762_3508 246
1152 3300047317 Ga0495604_0050776 Ga0495604_0050776_710_1456 246
1153 3300047319 Ga0495674_0003734 Ga0495674_0003734_11414_12214 246
1154 3300047319 Ga0495674_0066087 Ga0495674_0066087_1662_2408 246
1155 3300047319 Ga0495674_0075206 Ga0495674_0075206_1092_1835 246
1156 3300047319 Ga0495674_0635030 Ga0495674_0635030_41_823 246
1157 3300047320 Ga0495672_0120073 Ga0495672_0120073_142_882 246
1158 3300047321 Ga0495676_0252845 Ga0495676_0252845_27_767 246
1159 3300047322 Ga0495680_0318562 Ga0495680_0318562_164_904 246
1160 3300047443 Ga0495687_000636 Ga0495687_000636_8748_9488 246
1161 3300047443 Ga0495687_053901 Ga0495687_053901_142_882 246
1162 3300047444 Ga0495675_0016558 Ga0495675_0016558_3109_3855 246
1163 3300047444 Ga0495675_0243056 Ga0495675_0243056_26_766 246
1164 3300047445 Ga0495677_0039577 Ga0495677_0039577_891_1631 246
1165 3300047469 Ga0495673_0019819 Ga0495673_0019819_1888_2628 246
1166 3300047471 Ga0495684_0260261 Ga0495684_0260261_210_974 246
1167 3300047472 Ga0495686_0001513 Ga0495686_0001513_18189_18956 246
1168 3300047472 Ga0495686_0044699 Ga0495686_0044699_1764_2504 246
1169 3300047472 Ga0495686_0050724 Ga0495686_0050724_733_1473 246
1170 3300047472 Ga0495686_0092606 Ga0495686_0092606_143_883 246
1171 3300047472 Ga0495686_0122347 Ga0495686_0122347_172_912 246
1172 3300047673 Ga0495593_0120701 Ga0495593_0120701_457_1197 246
1173 3300048088 Ga0495602_0004753 Ga0495602_0004753_9940_10686 246
1174 3300048088 Ga0495602_0125217 Ga0495602_0125217_135_881 246
1175 3300048089 Ga0495614_0138734 Ga0495614_0138734_308_1048 246
1176 3300048089 Ga0495614_0176856 Ga0495614_0176856_58_798 246
1177 3300048090 Ga0495615_0008681 Ga0495615_0008681_1142_1882 246
1178 3300048091 Ga0495626_0028174 Ga0495626_0028174_653_1393 246
1179 3300048091 Ga0495626_0159647 Ga0495626_0159647_41_781 246
1180 3300048903 Ga0496100_0029263 Ga0496100_0029263_2354_3094 246
1181 3300048904 Ga0496101_0088114 Ga0496101_0088114_356_1096 246
1182 3300048904 Ga0496101_0159819 Ga0496101_0159819_525_1271 246
1183 3300048905 Ga0496102_0003637 Ga0496102_0003637_6956_7696 246
1184 3300048905 Ga0496102_0269043 Ga0496102_0269043_401_1141 246
1185 3300048905 Ga0496102_0371850 Ga0496102_0371850_319_1062 246
1186 3300048905 Ga0496102_0633484 Ga0496102_0633484_117_857 246
1187 3300048907 Ga0496104_0167233 Ga0496104_0167233_1345_2091 246
1188 3300048908 Ga0496105_0003045 Ga0496105_0003045_5460_6200 246
1189 3300048908 Ga0496105_0004996 Ga0496105_0004996_5943_6689 246
1190 3300048908 Ga0496105_0377778 Ga0496105_0377778_210_950 246
1191 3300048909 Ga0496106_0000089 Ga0496106_0000089_5333_6073 246
1192 3300048909 Ga0496106_0000244 Ga0496106_0000244_2502_3242 246
1193 3300048909 Ga0496106_0006866 Ga0496106_0006866_2097_2837 246
1194 3300048909 Ga0496106_0070480 Ga0496106_0070480_1677_2417 246
1195 3300048909 Ga0496106_0530957 Ga0496106_0530957_165_905 246
1196 3300048909 Ga0496106_0610108 Ga0496106_0610108_97_837 246
1197 3300048910 Ga0496107_0016369 Ga0496107_0016369_82_822 246
1198 3300048910 Ga0496107_0458134 Ga0496107_0458134_77_817 246
1199 3300048911 Ga0496108_0035648 Ga0496108_0035648_382_1122 246
1200 3300048911 Ga0496108_0287346 Ga0496108_0287346_180_920 246
1201 3300048911 Ga0496108_0661789 Ga0496108_0661789_156_896 246
1202 3300048911 Ga0496108_0698079 Ga0496108_0698079_19_816 246
1203 3300048912 Ga0496109_0006604 Ga0496109_0006604_3048_3788 246
1204 3300048912 Ga0496109_0145378 Ga0496109_0145378_168_908 246
1205 3300048912 Ga0496109_0456873 Ga0496109_0456873_393_1133 246
1206 3300048912 Ga0496109_0511747 Ga0496109_0511747_102_842 246
1207 3300048913 Ga0496110_0001819 Ga0496110_0001819_10220_10960 246
1208 3300048913 Ga0496110_0050345 Ga0496110_0050345_48_788 246
1209 3300048913 Ga0496110_0085247 Ga0496110_0085247_1305_2045 246
1210 3300048913 Ga0496110_0248324 Ga0496110_0248324_665_1405 246
1211 3300048914 Ga0496111_0143633 Ga0496111_0143633_1014_1754 246
1212 3300048915 Ga0496112_0003238 Ga0496112_0003238_3400_4140 246
1213 3300048915 Ga0496112_0012529 Ga0496112_0012529_4705_5448 246
1214 3300048915 Ga0496112_0138882 Ga0496112_0138882_1591_2331 246
1215 3300048915 Ga0496112_0145815 Ga0496112_0145815_59_799 246
1216 3300048916 Ga0496113_0012993 Ga0496113_0012993_3156_3896 246
1217 3300048916 Ga0496113_0140626 Ga0496113_0140626_757_1497 246
1218 3300048917 Ga0496114_0287786 Ga0496114_0287786_381_1121 246
1219 3300048918 Ga0496115_0033571 Ga0496115_0033571_2072_2815 246
1220 3300048918 Ga0496115_0167400 Ga0496115_0167400_730_1470 246
1221 3300048920 Ga0496117_0051502 Ga0496117_0051502_921_1661 246
1222 3300048920 Ga0496117_0079523 Ga0496117_0079523_229_1104 246
1223 3300048921 Ga0496118_0004232 Ga0496118_0004232_2792_3667 246
1224 3300048921 Ga0496118_0021785 Ga0496118_0021785_3461_4201 246
1225 3300048921 Ga0496118_0027353 Ga0496118_0027353_3109_3888 246
1226 3300048921 Ga0496118_0039503 Ga0496118_0039503_2302_3042 246
1227 3300048921 Ga0496118_0049073 Ga0496118_0049073_2211_2951 246
1228 3300048921 Ga0496118_0054398 Ga0496118_0054398_1928_2668 246
1229 3300048921 Ga0496118_0146758 Ga0496118_0146758_652_1392 246
1230 3300048921 Ga0496118_0157581 Ga0496118_0157581_266_1006 246
1231 3300048922 Ga0496119_0030275 Ga0496119_0030275_1630_2466 246
1232 3300048922 Ga0496119_0038482 Ga0496119_0038482_243_983 246
1233 3300048922 Ga0496119_0075543 Ga0496119_0075543_977_1756 246
1234 3300048923 Ga0496120_0004296 Ga0496120_0004296_3227_4063 246
1235 3300048923 Ga0496120_0060488 Ga0496120_0060488_212_952 246
1236 3300048924 Ga0496121_0009702 Ga0496121_0009702_7046_7786 246
1237 3300048924 Ga0496121_0012571 Ga0496121_0012571_3020_3760 246
1238 3300048924 Ga0496121_0013490 Ga0496121_0013490_3133_3912 246
1239 3300048924 Ga0496121_0016499 Ga0496121_0016499_2044_2784 246
1240 3300048924 Ga0496121_0024781 Ga0496121_0024781_1951_2691 246
1241 3300048924 Ga0496121_0035975 Ga0496121_0035975_806_1546 246
1242 3300048924 Ga0496121_0056807 Ga0496121_0056807_1429_2169 246
1243 3300048924 Ga0496121_0059968 Ga0496121_0059968_1325_2131 246
1244 3300048924 Ga0496121_0095041 Ga0496121_0095041_1453_2193 246
1245 3300048924 Ga0496121_0095365 Ga0496121_0095365_348_1088 246
1246 3300048924 Ga0496121_0098369 Ga0496121_0098369_1296_2036 246
1247 3300048925 Ga0496122_0116596 Ga0496122_0116596_141_881 246
1248 3300048926 Ga0496123_0215154 Ga0496123_0215154_94_834 246
1249 3300048927 Ga0496124_0004856 Ga0496124_0004856_1547_2287 246
1250 3300048927 Ga0496124_0016982 Ga0496124_0016982_216_956 246
1251 3300048927 Ga0496124_0056724 Ga0496124_0056724_1292_2032 246
1252 3300048927 Ga0496124_0187153 Ga0496124_0187153_730_1470 246
1253 3300048927 Ga0496124_0243589 Ga0496124_0243589_168_908 246
1254 3300048928 Ga0496125_0002684 Ga0496125_0002684_8427_9167 246
1255 3300048928 Ga0496125_0014515 Ga0496125_0014515_5868_6608 246
1256 3300048928 Ga0496125_0040917 Ga0496125_0040917_3021_3761 246
1257 3300048928 Ga0496125_0147210 Ga0496125_0147210_658_1398 246
1258 3300048929 Ga0496126_0001193 Ga0496126_0001193_17298_18038 246
1259 3300048929 Ga0496126_0015119 Ga0496126_0015119_2341_3081 246
1260 3300048929 Ga0496126_0019399 Ga0496126_0019399_816_1556 246
1261 3300048929 Ga0496126_0066929 Ga0496126_0066929_1223_2002 246
1262 3300048929 Ga0496126_0148270 Ga0496126_0148270_66_806 246
1263 3300048929 Ga0496126_0236359 Ga0496126_0236359_525_1265 246
1264 3300048929 Ga0496126_0339699 Ga0496126_0339699_25_768 246
1265 3300048929 Ga0496126_0369161 Ga0496126_0369161_399_1139 246
1266 3300049459 Ga0495678_020140 Ga0495678_020140_453_1193 246
1267 3300049521 Ga0501298_001895 Ga0501298_001895_81_821 246
1268 3300049568 Ga0501031_0000009 Ga0501031_0000009_114034_114780 246
1269 3300049568 Ga0501031_0014617 Ga0501031_0014617_409_1149 246
1270 3300049568 Ga0501031_0018659 Ga0501031_0018659_2346_3086 246
1271 3300049569 Ga0501032_0000017 Ga0501032_0000017_114035_114781 246
1272 3300049569 Ga0501032_0042254 Ga0501032_0042254_135_875 246
1273 3300049569 Ga0501032_0042410 Ga0501032_0042410_514_1254 246
1274 3300049569 Ga0501032_0055957 Ga0501032_0055957_1163_1903 246
1275 3300049569 Ga0501032_0077697 Ga0501032_0077697_940_1692 246
1276 3300049569 Ga0501032_0116702 Ga0501032_0116702_48_788 246
1277 3300049569 Ga0501032_0375624 Ga0501032_0375624_63_803 246
1278 3300049570 Ga0501033_0000029 Ga0501033_0000029_114026_114772 246
1279 3300049570 Ga0501033_0000210 Ga0501033_0000210_39232_39972 246
1280 3300049570 Ga0501033_0014151 Ga0501033_0014151_3103_3843 246
1281 3300049570 Ga0501033_0029259 Ga0501033_0029259_749_1495 246
1282 3300049570 Ga0501033_0040867 Ga0501033_0040867_753_1556 246
1283 3300049570 Ga0501033_0050293 Ga0501033_0050293_135_875 246
1284 3300049570 Ga0501033_0142089 Ga0501033_0142089_12_752 246
1285 3300049570 Ga0501033_0226633 Ga0501033_0226633_391_1143 246
1286 3300049571 Ga0501034_0000102 Ga0501034_0000102_114034_114780 246
1287 3300049571 Ga0501034_0010066 Ga0501034_0010066_3705_4445 246
1288 3300049571 Ga0501034_0022378 Ga0501034_0022378_4861_5670 246
1289 3300049571 Ga0501034_0058070 Ga0501034_0058070_1835_2581 246
1290 3300049571 Ga0501034_0080355 Ga0501034_0080355_1949_2689 246
1291 3300049571 Ga0501034_0111704 Ga0501034_0111704_135_875 246
1292 3300049571 Ga0501034_0131166 Ga0501034_0131166_677_1429 246
1293 3300049571 Ga0501034_0138098 Ga0501034_0138098_297_1037 246
1294 3300049571 Ga0501034_0154056 Ga0501034_0154056_888_1637 246
1295 3300049571 Ga0501034_0185301 Ga0501034_0185301_1064_1816 246
1296 3300049572 Ga0501036_0000011 Ga0501036_0000011_43523_44269 246
1297 3300049572 Ga0501036_0028446 Ga0501036_0028446_2994_3734 246
1298 3300049572 Ga0501036_0029066 Ga0501036_0029066_1233_1973 246
1299 3300049572 Ga0501036_0112113 Ga0501036_0112113_1535_2278 246
1300 3300049572 Ga0501036_0151100 Ga0501036_0151100_726_1469 246
1301 3300049572 Ga0501036_0167560 Ga0501036_0167560_975_1715 246
1302 3300049572 Ga0501036_0270847 Ga0501036_0270847_98_838 246
1303 3300049572 Ga0501036_0308729 Ga0501036_0308729_27_767 246
1304 3300049572 Ga0501036_0505528 Ga0501036_0505528_170_910 246
1305 3300049572 Ga0501036_0580523 Ga0501036_0580523_13_765 246
1306 3300049572 Ga0501036_0754375 Ga0501036_0754375_14_754 246
1307 3300049573 Ga0501037_0000015 Ga0501037_0000015_46532_47278 246
1308 3300049573 Ga0501037_0015564 Ga0501037_0015564_2665_3405 246
1309 3300049573 Ga0501037_0036508 Ga0501037_0036508_990_1730 246
1310 3300049573 Ga0501037_0140858 Ga0501037_0140858_442_1188 246
1311 3300049573 Ga0501037_0154317 Ga0501037_0154317_598_1386 246
1312 3300049573 Ga0501037_0220141 Ga0501037_0220141_307_1059 246
1313 3300049573 Ga0501037_0226416 Ga0501037_0226416_326_1066 246
1314 3300049574 Ga0501038_0000016 Ga0501038_0000016_114034_114780 246
1315 3300049574 Ga0501038_0016141 Ga0501038_0016141_2107_2898 246
1316 3300049574 Ga0501038_0017713 Ga0501038_0017713_3936_4676 246
1317 3300049574 Ga0501038_0043422 Ga0501038_0043422_1679_2419 246
1318 3300049574 Ga0501038_0064206 Ga0501038_0064206_135_875 246
1319 3300049574 Ga0501038_0071775 Ga0501038_0071775_791_1531 246
1320 3300049574 Ga0501038_0089947 Ga0501038_0089947_1459_2211 246
1321 3300049574 Ga0501038_0093812 Ga0501038_0093812_254_1003 246
1322 3300049574 Ga0501038_0345032 Ga0501038_0345032_346_1098 246
1323 3300049575 Ga0501039_0000023 Ga0501039_0000023_114034_114780 246
1324 3300049575 Ga0501039_0004433 Ga0501039_0004433_9803_10543 246
1325 3300049575 Ga0501039_0028219 Ga0501039_0028219_1232_2023 246
1326 3300049575 Ga0501039_0031181 Ga0501039_0031181_990_1730 246
1327 3300049575 Ga0501039_0119894 Ga0501039_0119894_1117_1857 246
1328 3300049575 Ga0501039_0133599 Ga0501039_0133599_641_1381 246
1329 3300049575 Ga0501039_0325715 Ga0501039_0325715_281_1021 246
1330 3300049576 Ga0501040_0008206 Ga0501040_0008206_4251_5054 246
1331 3300049576 Ga0501040_0019932 Ga0501040_0019932_3691_4437 246
1332 3300049576 Ga0501040_0026385 Ga0501040_0026385_2344_3084 246
1333 3300049576 Ga0501040_0026743 Ga0501040_0026743_1299_2090 246
1334 3300049576 Ga0501040_0148247 Ga0501040_0148247_614_1354 246
1335 3300049576 Ga0501040_0181154 Ga0501040_0181154_600_1340 246
1336 3300049577 Ga0501041_0025799 Ga0501041_0025799_2029_2769 246
1337 3300049577 Ga0501041_0408741 Ga0501041_0408741_45_785 246
1338 3300049578 Ga0501042_0013408 Ga0501042_0013408_1611_2351 246
1339 3300049578 Ga0501042_0013841 Ga0501042_0013841_709_1500 246
1340 3300049579 Ga0501043_0023532 Ga0501043_0023532_1538_2278 246
1341 3300049579 Ga0501043_0032719 Ga0501043_0032719_912_1652 246
1342 3300049579 Ga0501043_0033981 Ga0501043_0033981_135_875 246
1343 3300049579 Ga0501043_0035819 Ga0501043_0035819_2213_2953 246
1344 3300049579 Ga0501043_0062648 Ga0501043_0062648_1508_2248 246
1345 3300049579 Ga0501043_0098517 Ga0501043_0098517_1015_1755 246
1346 3300049579 Ga0501043_0157612 Ga0501043_0157612_134_874 246
1347 3300049580 Ga0501046_0025041 Ga0501046_0025041_2870_3673 246
1348 3300049580 Ga0501046_0059780 Ga0501046_0059780_1343_2134 246
1349 3300049580 Ga0501046_0174005 Ga0501046_0174005_224_976 246
1350 3300049581 Ga0501047_0003203 Ga0501047_0003203_13616_14362 246
1351 3300049581 Ga0501047_0026623 Ga0501047_0026623_1259_1999 246
1352 3300049581 Ga0501047_0047340 Ga0501047_0047340_2190_2942 246
1353 3300049581 Ga0501047_0048280 Ga0501047_0048280_2381_3121 246
1354 3300049581 Ga0501047_0068877 Ga0501047_0068877_2103_2855 246
1355 3300049581 Ga0501047_0075275 Ga0501047_0075275_2254_2994 246
1356 3300049581 Ga0501047_0172479 Ga0501047_0172479_1167_1907 246
1357 3300049581 Ga0501047_0396161 Ga0501047_0396161_105_845 246
1358 3300049582 Ga0501048_0001620 Ga0501048_0001620_13143_13883 246
1359 3300049583 Ga0501067_0058783 Ga0501067_0058783_376_1116 246
1360 3300049583 Ga0501067_0070588 Ga0501067_0070588_878_1618 246
1361 3300049583 Ga0501067_0257412 Ga0501067_0257412_69_809 246
1362 3300049584 Ga0501068_0009831 Ga0501068_0009831_357_1097 246
1363 3300049584 Ga0501068_0015059 Ga0501068_0015059_263_1003 246
1364 3300049584 Ga0501068_0016664 Ga0501068_0016664_3439_4191 246
1365 3300049584 Ga0501068_0225359 Ga0501068_0225359_439_1179 246
1366 3300049584 Ga0501068_0251236 Ga0501068_0251236_76_816 246
1367 3300049585 Ga0501069_0084739 Ga0501069_0084739_569_1309 246
1368 3300049586 Ga0501070_0018522 Ga0501070_0018522_2847_3593 246
1369 3300049586 Ga0501070_0018945 Ga0501070_0018945_1485_2231 246
1370 3300049586 Ga0501070_0020275 Ga0501070_0020275_989_1729 246
1371 3300049586 Ga0501070_0025557 Ga0501070_0025557_1935_2675 246
1372 3300049586 Ga0501070_0037015 Ga0501070_0037015_2620_3360 246
1373 3300049586 Ga0501070_0068629 Ga0501070_0068629_2135_2875 246
1374 3300049586 Ga0501070_0133287 Ga0501070_0133287_818_1558 246
1375 3300049586 Ga0501070_0209466 Ga0501070_0209466_158_898 246
1376 3300049587 Ga0501071_0017388 Ga0501071_0017388_132_872 246
1377 3300049587 Ga0501071_0039620 Ga0501071_0039620_2016_2819 246
1378 3300049587 Ga0501071_0050093 Ga0501071_0050093_1930_2670 246
1379 3300049587 Ga0501071_0184284 Ga0501071_0184284_169_972 246
1380 3300049587 Ga0501071_0205630 Ga0501071_0205630_252_1004 246
1381 3300049587 Ga0501071_0217406 Ga0501071_0217406_50_790 246
1382 3300049587 Ga0501071_0315002 Ga0501071_0315002_422_1162 246
1383 3300049588 Ga0501072_0037641 Ga0501072_0037641_2195_2935 246
1384 3300049588 Ga0501072_0049250 Ga0501072_0049250_1247_2038 246
1385 3300049588 Ga0501072_0083812 Ga0501072_0083812_1155_1895 246
1386 3300049589 Ga0501073_0005813 Ga0501073_0005813_387_1223 246
1387 3300049589 Ga0501073_0008806 Ga0501073_0008806_3605_4345 246
1388 3300049589 Ga0501073_0019992 Ga0501073_0019992_190_930 246
1389 3300049589 Ga0501073_0042901 Ga0501073_0042901_1948_2688 246
1390 3300049589 Ga0501073_0066141 Ga0501073_0066141_1408_2148 246
1391 3300049589 Ga0501073_0073408 Ga0501073_0073408_290_1030 246
1392 3300049589 Ga0501073_0077498 Ga0501073_0077498_1194_1934 246
1393 3300049589 Ga0501073_0138474 Ga0501073_0138474_883_1623 246
1394 3300049590 Ga0501074_0047062 Ga0501074_0047062_1405_2151 246
1395 3300049590 Ga0501074_0060169 Ga0501074_0060169_1820_2560 246
1396 3300049590 Ga0501074_0065331 Ga0501074_0065331_1086_1877 246
1397 3300049590 Ga0501074_0155968 Ga0501074_0155968_751_1503 246
1398 3300049590 Ga0501074_0165729 Ga0501074_0165729_536_1276 246
1399 3300049590 Ga0501074_0385325 Ga0501074_0385325_11_814 246
1400 3300049591 Ga0501075_0000163 Ga0501075_0000163_1306_2097 246
1401 3300049591 Ga0501075_0020817 Ga0501075_0020817_253_1056 246
1402 3300049591 Ga0501075_0087012 Ga0501075_0087012_1308_2096 246
1403 3300049592 Ga0501076_0000053 Ga0501076_0000053_13735_14526 246
1404 3300049592 Ga0501076_0011116 Ga0501076_0011116_5467_6270 246
1405 3300049592 Ga0501076_0025466 Ga0501076_0025466_2086_2826 246
1406 3300049592 Ga0501076_0152505 Ga0501076_0152505_506_1249 246
1407 3300049592 Ga0501076_0227431 Ga0501076_0227431_28_768 246
1408 3300049592 Ga0501076_0322436 Ga0501076_0322436_34_774 246
1409 3300049593 Ga0501077_0015654 Ga0501077_0015654_2083_2823 246
1410 3300049593 Ga0501077_0039624 Ga0501077_0039624_419_1210 246
1411 3300049593 Ga0501077_0137745 Ga0501077_0137745_135_875 246
1412 3300049593 Ga0501077_0399241 Ga0501077_0399241_71_811 246
1413 3300049686 Ga0501257_006345 Ga0501257_006345_1797_2537 246
1414 3300049741 Ga0501079_0014659 Ga0501079_0014659_1299_2090 246
1415 3300049741 Ga0501079_0035053 Ga0501079_0035053_386_1189 246
1416 3300049741 Ga0501079_0045986 Ga0501079_0045986_1058_1798 246
1417 3300049741 Ga0501079_0305361 Ga0501079_0305361_422_1162 246
1418 3300049741 Ga0501079_0394709 Ga0501079_0394709_202_942 246
1419 3300049741 Ga0501079_0406008 Ga0501079_0406008_47_787 246
1420 3300049742 Ga0501080_0021292 Ga0501080_0021292_2901_3662 246
1421 3300049742 Ga0501080_0033395 Ga0501080_0033395_2077_2817 246
1422 3300049742 Ga0501080_0034299 Ga0501080_0034299_3465_4256 246
1423 3300049742 Ga0501080_0036427 Ga0501080_0036427_2426_3166 246
1424 3300049742 Ga0501080_0044767 Ga0501080_0044767_2512_3252 246
1425 3300049742 Ga0501080_0053973 Ga0501080_0053973_1885_2637 246
1426 3300049742 Ga0501080_0073436 Ga0501080_0073436_1348_2088 246
1427 3300049742 Ga0501080_0212505 Ga0501080_0212505_497_1237 246
1428 3300049743 Ga0501081_0005369 Ga0501081_0005369_7520_8260 246
1429 3300049743 Ga0501081_0074096 Ga0501081_0074096_263_1003 246
1430 3300049743 Ga0501081_0102062 Ga0501081_0102062_859_1599 246
1431 3300049743 Ga0501081_0326101 Ga0501081_0326101_304_1044 246
1432 3300049744 Ga0501083_0031312 Ga0501083_0031312_2052_2792 246
1433 3300049744 Ga0501083_0057902 Ga0501083_0057902_279_1070 246
1434 3300049744 Ga0501083_0072113 Ga0501083_0072113_1312_2058 246
1435 3300049744 Ga0501083_0137946 Ga0501083_0137946_107_847 246
1436 3300049744 Ga0501083_0374056 Ga0501083_0374056_63_803 246
1437 3300049822 Ga0501035_0000038 Ga0501035_0000038_44039_44785 246
1438 3300049822 Ga0501035_0003069 Ga0501035_0003069_2957_3697 246
1439 3300049822 Ga0501035_0025834 Ga0501035_0025834_2931_3671 246
1440 3300049822 Ga0501035_0076163 Ga0501035_0076163_518_1258 246
1441 3300049822 Ga0501035_0105264 Ga0501035_0105264_135_875 246
1442 3300049822 Ga0501035_0194557 Ga0501035_0194557_424_1176 246
1443 3300049822 Ga0501035_0198470 Ga0501035_0198470_345_1085 246
1444 3300049822 Ga0501035_0259307 Ga0501035_0259307_333_1085 246
1445 3300049822 Ga0501035_0500299 Ga0501035_0500299_16_762 246
1446 3300049822 Ga0501035_0518539 Ga0501035_0518539_131_880 246
1447 3300049823 Ga0501044_0000046 Ga0501044_0000046_32033_32779 246
1448 3300049823 Ga0501044_0028299 Ga0501044_0028299_2141_2881 246
1449 3300049823 Ga0501044_0060853 Ga0501044_0060853_2990_3730 246
1450 3300049823 Ga0501044_0085509 Ga0501044_0085509_1789_2541 246
1451 3300049823 Ga0501044_0155718 Ga0501044_0155718_763_1503 246
1452 3300049823 Ga0501044_0165843 Ga0501044_0165843_879_1619 246
1453 3300049823 Ga0501044_0223045 Ga0501044_0223045_804_1544 246
1454 3300049823 Ga0501044_0574492 Ga0501044_0574492_191_940 246
1455 3300049824 Ga0501045_0026735 Ga0501045_0026735_1271_2074 246
1456 3300049824 Ga0501045_0033596 Ga0501045_0033596_1892_2632 246
1457 3300049824 Ga0501045_0126575 Ga0501045_0126575_902_1693 246
1458 3300049824 Ga0501045_0195777 Ga0501045_0195777_632_1372 246
1459 3300049824 Ga0501045_0243791 Ga0501045_0243791_72_812 246
1460 3300049824 Ga0501045_0530819 Ga0501045_0530819_113_853 246
1461 3300050490 nmdc:mga03n38_24270_c1 nmdc:mga03n38_24270_c1_435_1175 246
1462 3300050490 nmdc:mga03n38_299517_c1 nmdc:mga03n38_299517_c1_20_760 246
1463 3300050490 nmdc:mga03n38_42252_c1 nmdc:mga03n38_42252_c1_103_1023 246
1464 3300050491 nmdc:mga00v17_46612_c1 nmdc:mga00v17_46612_c1_252_1025 246
1465 3300050491 nmdc:mga00v17_68047_c1 nmdc:mga00v17_68047_c1_917_1657 246
1466 3300050491 nmdc:mga00v17_78770_c1 nmdc:mga00v17_78770_c1_678_1418 246
1467 3300050492 nmdc:mga0yw44_104110_c1 nmdc:mga0yw44_104110_c1_378_1118 246
1468 3300050492 nmdc:mga0yw44_114611_c1 nmdc:mga0yw44_114611_c1_461_1204 246
1469 3300050492 nmdc:mga0yw44_17726_c1 nmdc:mga0yw44_17726_c1_1445_2185 246
1470 3300050492 nmdc:mga0yw44_5085_c1 nmdc:mga0yw44_5085_c1_2530_3270 246
1471 3300050492 nmdc:mga0yw44_71757_c1 nmdc:mga0yw44_71757_c1_518_1261 246
1472 3300050492 nmdc:mga0yw44_7481_c1 nmdc:mga0yw44_7481_c1_4560_5303 246
1473 3300050492 nmdc:mga0yw44_8283_c1 nmdc:mga0yw44_8283_c1_3382_4155 246
1474 3300050493 nmdc:mga0k408_137152_c1 nmdc:mga0k408_137152_c1_636_1376 246
1475 3300050493 nmdc:mga0k408_1436_c1 nmdc:mga0k408_1436_c1_2935_3675 246
1476 3300050493 nmdc:mga0k408_37877_c1 nmdc:mga0k408_37877_c1_1012_1752 246
1477 3300050493 nmdc:mga0k408_4087_c1 nmdc:mga0k408_4087_c1_2592_3332 246
1478 3300050494 nmdc:mga06z11_10062_c1 nmdc:mga06z11_10062_c1_1304_2044 246
1479 3300050494 nmdc:mga06z11_18996_c1 nmdc:mga06z11_18996_c1_975_1748 246
1480 3300050494 nmdc:mga06z11_96099_c1 nmdc:mga06z11_96099_c1_601_1521 246
1481 3300050495 nmdc:mga04h51_141771_c1 nmdc:mga04h51_141771_c1_42_815 246
1482 3300050495 nmdc:mga04h51_3374_c1 nmdc:mga04h51_3374_c1_2611_3351 246
1483 3300050496 nmdc:mga07m45_15562_c1 nmdc:mga07m45_15562_c1_3214_3954 246
1484 3300050496 nmdc:mga07m45_38336_c1 nmdc:mga07m45_38336_c1_907_1647 246
1485 3300050507 nmdc:mga05p37_155007_c1 nmdc:mga05p37_155007_c1_957_1820 246
1486 3300050507 nmdc:mga05p37_233069_c1 nmdc:mga05p37_233069_c1_314_1054 246
1487 3300050508 nmdc:mga09592_244179_c1 nmdc:mga09592_244179_c1_223_963 246
1488 3300050509 nmdc:mga0qj67_49363_c1 nmdc:mga0qj67_49363_c1_1488_2228 246
1489 3300050510 nmdc:mga06r32_3096_c1 nmdc:mga06r32_3096_c1_10111_10851 246
1490 3300050510 nmdc:mga06r32_76935_c1 nmdc:mga06r32_76935_c1_1628_2368 246
1491 3300050511 nmdc:mga08y16_212436_c1 nmdc:mga08y16_212436_c1_648_1388 246
1492 3300050511 nmdc:mga08y16_473803_c1 nmdc:mga08y16_473803_c1_194_934 246
1493 3300050511 nmdc:mga08y16_595_c1 nmdc:mga08y16_595_c1_2388_3128 246
1494 3300050511 nmdc:mga08y16_955572_c1 nmdc:mga08y16_955572_c1_43_783 246
1495 3300050512 nmdc:mga0n895_71252_c1 nmdc:mga0n895_71252_c1_648_1388 246
1496 3300050512 nmdc:mga0n895_782_c1 nmdc:mga0n895_782_c1_16762_17502 246
1497 3300050513 nmdc:mga0rr50_24139_c1 nmdc:mga0rr50_24139_c1_1637_2377 246
1498 3300050515 nmdc:mga0a205_216920_c1 nmdc:mga0a205_216920_c1_736_1476 246
1499 3300050515 nmdc:mga0a205_377503_c1 nmdc:mga0a205_377503_c1_188_928 246
1500 3300050515 nmdc:mga0a205_6389_c1 nmdc:mga0a205_6389_c1_856_1596 246
1501 3300050516 nmdc:mga0sz30_2709_c1 nmdc:mga0sz30_2709_c1_2195_2935 246
1502 3300050516 nmdc:mga0sz30_42656_c1 nmdc:mga0sz30_42656_c1_793_1533 246
1503 3300050516 nmdc:mga0sz30_51037_c1 nmdc:mga0sz30_51037_c1_912_1652 246
1504 3300053077 Ga0495601_0000401 Ga0495601_0000401_18350_19096 246
1505 3300053077 Ga0495601_0041759 Ga0495601_0041759_1772_2572 246
1506 3300053078 Ga0495612_0004593 Ga0495612_0004593_476_1222 246
1507 3300053080 Ga0500635_0001263 Ga0500635_0001263_3522_4265 246
1508 3300053083 Ga0495655_0006637 Ga0495655_0006637_738_1478 246
1509 3300053084 Ga0495595_0028715 Ga0495595_0028715_1565_2359 246
1510 3300053085 Ga0495619_0021683 Ga0495619_0021683_2009_2755 246
1511 3300053085 Ga0495619_0065107 Ga0495619_0065107_842_1588 246
1512 3300053085 Ga0495619_0086737 Ga0495619_0086737_203_949 246
1513 3300053085 Ga0495619_0119100 Ga0495619_0119100_659_1453 246
1514 3300053086 Ga0500578_0039666 Ga0500578_0039666_1439_2179 246
1515 3300053087 Ga0500643_051840 Ga0500643_051840_71_811 246
1516 3300053088 Ga0500644_0034129 Ga0500644_0034129_236_976 246
1517 3300053090 Ga0500646_0017535 Ga0500646_0017535_633_1373 246
1518 3300053091 Ga0500647_0006028 Ga0500647_0006028_1745_2488 246
1519 3300053091 Ga0500647_0106100 Ga0500647_0106100_376_1116 246
1520 3300053092 Ga0500583_0016915 Ga0500583_0016915_460_1200 246
1521 3300053093 Ga0500651_0048095 Ga0500651_0048095_1177_1917 246
1522 3300053094 Ga0500566_0007888 Ga0500566_0007888_4044_4787 246
1523 3300053094 Ga0500566_0031098 Ga0500566_0031098_310_1050 246
1524 3300053094 Ga0500566_0158317 Ga0500566_0158317_106_846 246
1525 3300053096 Ga0500641_0152109 Ga0500641_0152109_142_885 246
1526 3300053098 Ga0500650_0033296 Ga0500650_0033296_1269_2009 246
1527 3300053103 Ga0500555_003111 Ga0500555_003111_2165_2905 246
1528 3300053103 Ga0500555_012168 Ga0500555_012168_947_1687 246
1529 3300053104 Ga0500556_0024413 Ga0500556_0024413_290_1030 246
1530 3300053108 Ga0500562_006674 Ga0500562_006674_1781_2521 246
1531 3300053108 Ga0500562_079513 Ga0500562_079513_67_807 246
1532 3300053111 Ga0500572_024060 Ga0500572_024060_342_1085 246
1533 3300053116 Ga0500592_008699 Ga0500592_008699_304_1044 246
1534 3300053118 Ga0500594_0004484 Ga0500594_0004484_330_1070 246
1535 3300053118 Ga0500594_0047780 Ga0500594_0047780_85_894 246
1536 3300053119 Ga0500595_000266 Ga0500595_000266_28683_29462 246
1537 3300053119 Ga0500595_001200 Ga0500595_001200_7525_8265 246
1538 3300053119 Ga0500595_015995 Ga0500595_015995_833_1573 246
1539 3300053119 Ga0500595_020314 Ga0500595_020314_1513_2292 246
1540 3300053119 Ga0500595_028672 Ga0500595_028672_464_1207 246
1541 3300053122 Ga0500608_063462 Ga0500608_063462_778_1518 246
1542 3300053122 Ga0500608_117175 Ga0500608_117175_96_839 246
1543 3300053123 Ga0500614_043074 Ga0500614_043074_38_781 246
1544 3300053130 Ga0500642_0000900 Ga0500642_0000900_6005_6745 246
1545 3300053130 Ga0500642_0065334 Ga0500642_0065334_732_1472 246
1546 3300053130 Ga0500642_0129993 Ga0500642_0129993_319_1128 246
1547 3300053134 Ga0500658_0007094 Ga0500658_0007094_2865_3605 246
1548 3300053134 Ga0500658_0016918 Ga0500658_0016918_399_1139 246
1549 3300053134 Ga0500658_0113384 Ga0500658_0113384_340_1080 246
1550 3300053137 Ga0500561_0044642 Ga0500561_0044642_383_1123 246
1551 3300053139 Ga0500568_0000415 Ga0500568_0000415_4178_4918 246
1552 3300053139 Ga0500568_0001174 Ga0500568_0001174_2477_3217 246
1553 3300053140 Ga0500573_0060387 Ga0500573_0060387_157_897 246
1554 3300053142 Ga0500577_0068019 Ga0500577_0068019_624_1364 246
1555 3300053142 Ga0500577_0105596 Ga0500577_0105596_377_1117 246
1556 3300053146 Ga0500588_0001609 Ga0500588_0001609_128_868 246
1557 3300053146 Ga0500588_0007470 Ga0500588_0007470_732_1472 246
1558 3300053150 Ga0500603_021372 Ga0500603_021372_587_1327 246
1559 3300053151 Ga0500604_0009878 Ga0500604_0009878_1281_2021 246
1560 3300053151 Ga0500604_0019145 Ga0500604_0019145_827_1567 246
1561 3300053153 Ga0500616_0002694 Ga0500616_0002694_7533_8273 246
1562 3300053153 Ga0500616_0055477 Ga0500616_0055477_222_965 246
1563 3300053153 Ga0500616_0088404 Ga0500616_0088404_349_1089 246
1564 3300053153 Ga0500616_0208982 Ga0500616_0208982_26_766 246
1565 3300053154 Ga0500619_122099 Ga0500619_122099_32_814 246
1566 3300053155 Ga0500620_000234 Ga0500620_000234_356_1099 246
1567 3300053156 Ga0500622_0000646 Ga0500622_0000646_17335_18075 246
1568 3300053156 Ga0500622_0000772 Ga0500622_0000772_5567_6307 246
1569 3300053156 Ga0500622_0059991 Ga0500622_0059991_1044_1787 246
1570 3300053156 Ga0500622_0084763 Ga0500622_0084763_796_1536 246
1571 3300053158 Ga0500627_0006268 Ga0500627_0006268_186_926 246
1572 3300053158 Ga0500627_0032262 Ga0500627_0032262_990_1733 246
1573 3300053158 Ga0500627_0073122 Ga0500627_0073122_656_1396 246
1574 3300053158 Ga0500627_0079467 Ga0500627_0079467_63_803 246
1575 3300053158 Ga0500627_0099687 Ga0500627_0099687_334_1074 246
1576 3300053158 Ga0500627_0236847 Ga0500627_0236847_12_752 246
1577 3300053159 Ga0500630_121514 Ga0500630_121514_233_976 246
1578 3300053160 Ga0500633_0030142 Ga0500633_0030142_748_1488 246
1579 3300053161 Ga0500634_0037402 Ga0500634_0037402_97_837 246
1580 3300053161 Ga0500634_0062976 Ga0500634_0062976_169_930 246
1581 3300053162 Ga0500638_158005 Ga0500638_158005_188_928 246
1582 3300053163 Ga0500639_004632 Ga0500639_004632_3096_3839 246
1583 3300053163 Ga0500639_089488 Ga0500639_089488_263_1003 246
1584 3300053177 Ga0500636_0011613 Ga0500636_0011613_1464_2243 246
1585 3300053177 Ga0500636_0044811 Ga0500636_0044811_1521_2261 246
1586 3300053177 Ga0500636_0050905 Ga0500636_0050905_1450_2190 246
1587 3300053177 Ga0500636_0121702 Ga0500636_0121702_284_1024 246
1588 3300053177 Ga0500636_0166768 Ga0500636_0166768_395_1135 246
1589 3300053177 Ga0500636_0237738 Ga0500636_0237738_118_858 246
1590 3300053178 Ga0500637_0060181 Ga0500637_0060181_351_1091 246
1591 3300053727 Ga0500611_003636 Ga0500611_003636_1004_1813 246
1592 3300053730 Ga0500645_030897 Ga0500645_030897_139_879 246
1593 3300053731 Ga0500609_004076 Ga0500609_004076_65_805 246
1594 3300053731 Ga0500609_012380 Ga0500609_012380_61_801 246
1595 3300053731 Ga0500609_027406 Ga0500609_027406_29_769 246
1596 3300053735 Ga0500596_015532 Ga0500596_015532_162_902 246
1597 3300053739 Ga0500587_000428 Ga0500587_000428_73_813 246
1598 3300054114 Ga0501084_0007550 Ga0501084_0007550_2250_3053 246
1599 3300054114 Ga0501084_0018918 Ga0501084_0018918_3930_4721 246
1600 3300054114 Ga0501084_0074772 Ga0501084_0074772_1833_2573 246
1601 3300054114 Ga0501084_0144096 Ga0501084_0144096_614_1354 246
1602 3300054114 Ga0501084_0189154 Ga0501084_0189154_202_990 246
1603 3300054114 Ga0501084_0724310 Ga0501084_0724310_87_827 246
1604 3300055283 Ga0500661_008047 Ga0500661_008047_323_1063 246
1605 3300059424 Ga0590075_003951 Ga0590075_003951_748_1488 246
1606 3300060353 Ga0501082_0032387 Ga0501082_0032387_98_838 246
1607 3300060353 Ga0501082_0060048 Ga0501082_0060048_225_965 246
1608 3300060353 Ga0501082_0062878 Ga0501082_0062878_1323_2114 246
1609 3300060353 Ga0501082_0097519 Ga0501082_0097519_108_848 246
1610 3300060353 Ga0501082_0108271 Ga0501082_0108271_1599_2339 246
1611 3300060353 Ga0501082_0403043 Ga0501082_0403043_67_807 246
1612 3300060353 Ga0501082_0538073 Ga0501082_0538073_30_770 246
1613 3300061734 Ga0530510_0000093 Ga0530510_0000093_32184_32975 246
1614 3300061734 Ga0530510_0013400 Ga0530510_0013400_3135_3938 246
1615 3300061734 Ga0530510_0040966 Ga0530510_0040966_1196_1936 246
1616 3300061734 Ga0530510_0047637 Ga0530510_0047637_1714_2454 246
1617 3300061734 Ga0530510_0182661 Ga0530510_0182661_360_1100 246
1618 iso_pu_bacteria 2509276021 2509390254 246
1619 iso_pu_bacteria 2513237146 2513927193 246
1620 iso_pu_bacteria 2588253730 2588517406 246
1621 iso_pu_bacteria 2599185170 2599415368 246
1622 iso_pu_bacteria 2802429605 2805926745 246
1623 iso_pu_bacteria 2838668709 2838671678 246
1624 iso_pu_bacteria 2838701080 2838704357 246
1625 iso_pu_bacteria 2842146304 2842149576 246
1626 iso_pu_bacteria 2842250916 2842254259 246
1627 iso_pu_bacteria 2842285085 2842285276 246
1628 iso_pu_bacteria 2842402390 2842402635 246
1629 iso_pu_bacteria 2842409023 2842409993 246
1630 iso_pu_bacteria 2842415677 2842416642 246
1631 iso_pu_bacteria 2842434925 2842436806 246
1632 iso_pu_bacteria 2904578770 2904581789 246
1633 iso_pu_bacteria 2919119836 2919123456 246
1634 iso_pu_bacteria 2932794094 2932795588 246
1635 iso_pu_bacteria 2932801729 2932807816 246
1636 iso_pu_bacteria 2935883170 2935885993 246
1637 iso_pu_bacteria 2937848649 2937854458 246
1638 iso_pu_bacteria 2970540015 2970540791 246
1639 iso_pu_bacteria 2977922695 2977924153 246
1640 iso_pu_bacteria 2977986579 2977991745 246
1641 iso_pu_bacteria 2996887358 2996891769 246
1642 iso_pu_bacteria 2996893221 2996897971 246
1643 iso_pu_bacteria 3000135777 3000140742 246
1644 iso_pu_bacteria 3004211236 3004215888 246
1645 iso_pu_bacteria 3004218560 3004221946 246
1646 iso_pu_bacteria 8005258706 8005263099 246
1647 iso_pu_bacteria 8005289223 8005289733 246
1648 iso_pu_bacteria 8005321885 8005326296 246
1649 iso_pu_bacteria 8005430974 8005433375 246
1650 iso_pu_bacteria 8005626139 8005630117 246
1651 iso_pu_bacteria 8016583857 8016589698 246
1652 iso_pu_bacteria 8024501048 8024501281 246
1653 iso_pu_bacteria 8049293176 8049298039 246
1654 iso_pu_bacteria 8057575449 8057579364 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

78

231

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9186 4 228
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9087 3 228
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8861 1 226
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8827 2 228
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.8814 1 240
ID Description Score Start End Superfamily
af_Q6BEX0_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9759 1 241 3.40.50.300
af_P77509_7_245_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9503 2 238 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9494 1 241 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9455 1 241 3.40.50.300
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9372 2 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1M3AXL3-F1-model_v4 deleted 0.9934 1 246
AF-A0A0Q6QFP7-F1-model_v4 ABC transporter ATP-binding protein 0.993 2 246 GO:0005524
GO:0016887
AF-A0A0Q6QFP7-F1-model_v4 ABC transporter ATP-binding protein 0.985 2 246 GO:0005524
GO:0016887
AF-A0A3R7AWQ6-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9789 2 242 GO:0005524
GO:0016887
AF-A0A2P7BRZ9-F1-model_v4 ABC transporter ATP-binding protein 0.9757 2 242 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.06 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map