F495221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1654 | 593 | 1617 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300050490|nmdc:mga03n38_42252_c1|nmdc:mga03n38_42252_c1_103_1023 |
| Length | 306 |
| Sequence | MLFVLQNGFLEKEVPQFVRQLIDERRLLRKRTLSLFPGGAGKSEAEAEQLPGTMGRQRLVAVLELTNISKHFGAIQAVNDVSLSIEPGQVVGLMGDNGAGKSTLVKMIAGNFHPSHGTMQMDGKELILNKPVEARQHGIEIVHQDLALCNNLTAAANVYLGRELRRGVGPFRILDYAAMYKRAGQIFAELKSETRPRDLVKQMSGGQRQAVAIARTMLSQAKIVLMDEPTAAISVRQVAEVLNLIRHLRDQGIAVVLISHRMPDVFDVADRVIVMRRGRKVADKTIASSSPEEVTGLITGAIEQVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 2 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 3 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 4 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 5 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 6 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 7 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 8 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 9 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 10 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 11 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 12 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 13 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 14 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 15 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 16 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 17 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 18 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 19 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 20 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 21 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 22 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 23 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 24 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 25 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 26 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 27 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 28 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 29 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 30 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 31 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 32 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 33 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 34 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 35 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 36 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 42 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 53 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 55 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 62 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 105 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 108 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 109 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 111 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 112 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 113 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 114 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 115 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 116 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 117 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 118 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 119 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 120 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 121 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 122 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 123 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 124 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 125 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 127 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 128 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 129 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 130 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 131 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 134 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 135 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 136 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 137 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 139 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 140 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 141 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 142 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 143 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 144 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 145 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 146 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 147 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 149 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 150 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 163 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 164 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 167 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 178 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 182 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 183 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 184 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 186 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 187 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 188 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 189 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 190 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 191 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 192 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 280 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 284 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 285 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 286 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 287 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 288 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 289 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 290 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 291 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 292 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 293 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 294 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 295 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 296 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 297 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 298 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 299 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 300 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 301 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 302 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 303 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 304 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 305 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 306 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 307 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 308 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 309 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 310 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 311 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 312 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 313 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 314 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 315 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 316 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 317 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 318 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 319 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 322 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 323 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 325 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 326 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 327 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 328 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 329 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 330 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 331 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 332 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 333 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 334 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 335 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 336 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 338 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 339 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 340 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 341 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 342 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 343 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 344 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 345 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 346 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 347 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 348 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 349 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 350 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 351 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 352 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 353 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 354 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 355 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 356 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 357 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 358 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 359 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 360 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 361 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 362 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 363 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 364 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 365 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 366 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 367 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 368 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 369 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 370 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 371 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 372 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 453 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 455 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 456 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 457 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 458 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 459 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 460 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 461 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 462 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 463 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 464 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 465 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 466 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 467 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 468 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 469 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 470 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 471 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 472 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 473 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 474 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 475 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 476 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 477 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 479 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 506 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 514 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 515 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 516 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 517 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 518 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 519 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 520 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 529 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 532 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 536 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 537 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 539 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 540 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 541 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 542 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 543 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 544 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 545 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 546 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 547 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 548 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 549 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 550 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 551 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 552 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 553 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 554 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 555 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 556 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 557 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 558 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 559 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 560 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 561 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 562 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 563 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 564 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 565 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 566 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 567 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 568 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 569 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 570 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 571 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 572 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 573 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 574 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 575 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 576 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 577 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 578 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 579 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 580 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 582 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 583 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 585 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 586 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 587 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 588 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 589 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 590 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 591 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 592 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 593 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.76 |
| Metatranscriptomes | 0 |
| Isolates | 2.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.6 |
| Nodule | 2 |
| Rhizoplane | 2.54 |
| Rhizosphere | 72.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10040824 | 3300001979 | Bacteria | 1403 |
| 2 | JGI25158J39367_1000548 | 3300002739 | Bacteria | 7548 |
| 3 | JGI25157J39369_1001276 | 3300002741 | Bacteria | 10204 |
| 4 | JGI25152J39213_1005130 | 3300002773 | Bacteria | 3929 |
| 5 | JGI25152J39213_1006776 | 3300002773 | Bacteria | 3047 |
| 6 | JGI25150J39212_1007959 | 3300002774 | Bacteria | 2100 |
| 7 | JGI25159J45721_1000012 | 3300002987 | Bacteria | 149808 |
| 8 | JGI25159J45721_1001972 | 3300002987 | Bacteria | 8179 |
| 9 | JGI25151J46595_10005842 | 3300003187 | Bacteria | 6295 |
| 10 | JGI25406J46586_10005327 | 3300003203 | Bacteria | 5968 |
| 11 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 12 | JGI25165J46597_1002828 | 3300003214 | Bacteria | 4982 |
| 13 | JGI25153J46596_10000033 | 3300003215 | Bacteria | 194912 |
| 14 | JGI25153J46596_10000047 | 3300003215 | Bacteria | 146400 |
| 15 | JGI25153J46596_10024486 | 3300003215 | Bacteria | 2176 |
| 16 | rootH2_10079132 | 3300003320 | Bacteria | 7066 |
| 17 | JGI25160J50197_1000042 | 3300003354 | Bacteria | 149808 |
| 18 | JGI25160J50197_1000068 | 3300003354 | Bacteria | 112790 |
| 19 | JGI25160J50197_1006678 | 3300003354 | Bacteria | 4637 |
| 20 | JGI25161J50226_1000048 | 3300003374 | Bacteria | 112790 |
| 21 | JGI25161J50226_1000254 | 3300003374 | Bacteria | 31906 |
| 22 | JGI25161J50226_1002172 | 3300003374 | Bacteria | 5231 |
| 23 | Ga0055542_1000406 | 3300003762 | Bacteria | 42163 |
| 24 | Ga0055526_1003068 | 3300003771 | Bacteria | 10857 |
| 25 | Ga0055526_1003780 | 3300003771 | Bacteria | 9437 |
| 26 | Ga0055526_1005774 | 3300003771 | Bacteria | 6976 |
| 27 | Ga0055524_1022164 | 3300003775 | Bacteria | 2084 |
| 28 | Ga0055536_1007787 | 3300003781 | Bacteria | 4729 |
| 29 | Ga0055536_1009742 | 3300003781 | Bacteria | 3925 |
| 30 | Ga0055534_1002995 | 3300003784 | Bacteria | 5557 |
| 31 | Ga0055528_1000081 | 3300003790 | Bacteria | 75261 |
| 32 | Ga0055528_1002961 | 3300003790 | Bacteria | 8807 |
| 33 | Ga0055528_1010205 | 3300003790 | Bacteria | 3843 |
| 34 | Ga0055530_10023412 | 3300003791 | Bacteria | 1775 |
| 35 | Ga0055540_1005863 | 3300003792 | Bacteria | 5031 |
| 36 | Ga0055540_1007063 | 3300003792 | Bacteria | 4318 |
| 37 | Ga0055531_10000775 | 3300003794 | Bacteria | 26585 |
| 38 | Ga0055531_10020004 | 3300003794 | Bacteria | 2671 |
| 39 | Ga0055543_1000031 | 3300004625 | Bacteria | 130583 |
| 40 | Ga0055543_1000046 | 3300004625 | Bacteria | 113628 |
| 41 | Ga0055543_1000452 | 3300004625 | Bacteria | 24678 |
| 42 | Ga0065165_1000174 | 3300005262 | Bacteria | 113769 |
| 43 | Ga0065165_1000175 | 3300005262 | Bacteria | 113628 |
| 44 | Ga0065165_1016574 | 3300005262 | Bacteria | 2751 |
| 45 | Ga0065704_10243647 | 3300005289 | Bacteria | 993 |
| 46 | Ga0065712_10084375 | 3300005290 | Bacteria | 2768 |
| 47 | Ga0065715_10005719 | 3300005293 | Bacteria | 4176 |
| 48 | Ga0070658_10072794 | 3300005327 | Bacteria | 2817 |
| 49 | Ga0070658_10121171 | 3300005327 | Bacteria | 2173 |
| 50 | Ga0070676_10001690 | 3300005328 | Bacteria | 11215 |
| 51 | Ga0070676_10032420 | 3300005328 | Bacteria | 2993 |
| 52 | Ga0070690_100000104 | 3300005330 | Bacteria | 43588 |
| 53 | Ga0070690_100006691 | 3300005330 | Bacteria | 6547 |
| 54 | Ga0070690_100093173 | 3300005330 | Bacteria | 1987 |
| 55 | Ga0070690_100115124 | 3300005330 | Bacteria | 1799 |
| 56 | Ga0070670_100234182 | 3300005331 | Bacteria | 1598 |
| 57 | Ga0070677_10006920 | 3300005333 | Bacteria | 3768 |
| 58 | Ga0070677_10087821 | 3300005333 | Bacteria | 1346 |
| 59 | Ga0068869_100006830 | 3300005334 | Bacteria | 7259 |
| 60 | Ga0068869_100010468 | 3300005334 | Bacteria | 6049 |
| 61 | Ga0068869_100013291 | 3300005334 | Bacteria | 5471 |
| 62 | Ga0068869_100037678 | 3300005334 | Bacteria | 3439 |
| 63 | Ga0068869_100045381 | 3300005334 | Bacteria | 3164 |
| 64 | Ga0068869_100195193 | 3300005334 | Bacteria | 1594 |
| 65 | Ga0070666_10003654 | 3300005335 | Bacteria | 9323 |
| 66 | Ga0070666_10266559 | 3300005335 | Bacteria | 1215 |
| 67 | Ga0070666_10374691 | 3300005335 | Bacteria | 1021 |
| 68 | Ga0070680_100106467 | 3300005336 | Bacteria | 2332 |
| 69 | Ga0070680_100140641 | 3300005336 | Bacteria | 2024 |
| 70 | Ga0068868_100001028 | 3300005338 | Bacteria | 19079 |
| 71 | Ga0068868_100002870 | 3300005338 | Bacteria | 11952 |
| 72 | Ga0068868_100020673 | 3300005338 | Bacteria | 4951 |
| 73 | Ga0068868_100028159 | 3300005338 | Bacteria | 4293 |
| 74 | Ga0068868_100101056 | 3300005338 | Bacteria | 2334 |
| 75 | Ga0070660_100021992 | 3300005339 | Bacteria | 4711 |
| 76 | Ga0070660_100027337 | 3300005339 | Bacteria | 4256 |
| 77 | Ga0070660_100160073 | 3300005339 | Bacteria | 1814 |
| 78 | Ga0070689_100002051 | 3300005340 | Bacteria | 13079 |
| 79 | Ga0070689_100039569 | 3300005340 | Bacteria | 3611 |
| 80 | Ga0070689_100262363 | 3300005340 | Bacteria | 1428 |
| 81 | Ga0070691_10032040 | 3300005341 | Bacteria | 2468 |
| 82 | Ga0070687_100375729 | 3300005343 | Bacteria | 925 |
| 83 | Ga0070661_100003782 | 3300005344 | Bacteria | 10428 |
| 84 | Ga0070661_100135355 | 3300005344 | Bacteria | 1854 |
| 85 | Ga0070668_100004957 | 3300005347 | Bacteria | 9855 |
| 86 | Ga0070668_100021056 | 3300005347 | Bacteria | 4928 |
| 87 | Ga0070668_100060860 | 3300005347 | Bacteria | 2925 |
| 88 | Ga0070668_100423111 | 3300005347 | Bacteria | 1141 |
| 89 | Ga0070669_100007652 | 3300005353 | Bacteria | 7722 |
| 90 | Ga0070669_100047893 | 3300005353 | Bacteria | 3119 |
| 91 | Ga0070669_100058280 | 3300005353 | Bacteria | 2834 |
| 92 | Ga0070669_100107389 | 3300005353 | Bacteria | 2114 |
| 93 | Ga0070669_100124903 | 3300005353 | Bacteria | 1968 |
| 94 | Ga0070669_100232146 | 3300005353 | Bacteria | 1463 |
| 95 | Ga0070675_100002408 | 3300005354 | Bacteria | 13959 |
| 96 | Ga0070675_100011906 | 3300005354 | Bacteria | 6816 |
| 97 | Ga0070675_100174674 | 3300005354 | Bacteria | 1854 |
| 98 | Ga0070671_100009046 | 3300005355 | Bacteria | 7993 |
| 99 | Ga0070671_100012205 | 3300005355 | Bacteria | 6913 |
| 100 | Ga0070671_100022921 | 3300005355 | Bacteria | 5103 |
| 101 | Ga0070671_100050547 | 3300005355 | Bacteria | 3457 |
| 102 | Ga0070671_100420339 | 3300005355 | Bacteria | 1145 |
| 103 | Ga0070674_100014204 | 3300005356 | Bacteria | 4945 |
| 104 | Ga0070674_100017014 | 3300005356 | Bacteria | 4564 |
| 105 | Ga0070674_100018973 | 3300005356 | Bacteria | 4361 |
| 106 | Ga0070674_100060883 | 3300005356 | Bacteria | 2633 |
| 107 | Ga0070674_100283065 | 3300005356 | Bacteria | 1315 |
| 108 | Ga0070674_100326663 | 3300005356 | Bacteria | 1231 |
| 109 | Ga0070674_100353166 | 3300005356 | Bacteria | 1188 |
| 110 | Ga0070674_100422101 | 3300005356 | Bacteria | 1094 |
| 111 | Ga0070673_100008458 | 3300005364 | Bacteria | 6843 |
| 112 | Ga0070673_100028973 | 3300005364 | Bacteria | 4124 |
| 113 | Ga0070673_100338482 | 3300005364 | Bacteria | 1333 |
| 114 | Ga0070688_100160781 | 3300005365 | Bacteria | 1543 |
| 115 | Ga0070688_100422618 | 3300005365 | Bacteria | 991 |
| 116 | Ga0070659_100040241 | 3300005366 | Bacteria | 3652 |
| 117 | Ga0070659_100056900 | 3300005366 | Bacteria | 3083 |
| 118 | Ga0070659_100181776 | 3300005366 | Bacteria | 1726 |
| 119 | Ga0070659_100573082 | 3300005366 | Bacteria | 968 |
| 120 | Ga0070667_100010392 | 3300005367 | Bacteria | 7684 |
| 121 | Ga0070667_100040888 | 3300005367 | Bacteria | 3888 |
| 122 | Ga0070667_100136027 | 3300005367 | Bacteria | 2149 |
| 123 | Ga0070667_100429243 | 3300005367 | Bacteria | 1205 |
| 124 | Ga0070709_10012841 | 3300005434 | Bacteria | 4696 |
| 125 | Ga0070714_100005358 | 3300005435 | Bacteria | 9786 |
| 126 | Ga0070713_100100618 | 3300005436 | Bacteria | 2503 |
| 127 | Ga0070713_100399502 | 3300005436 | Bacteria | 1283 |
| 128 | Ga0070710_10001811 | 3300005437 | Bacteria | 10101 |
| 129 | Ga0070701_10000723 | 3300005438 | Bacteria | 11685 |
| 130 | Ga0070711_100000775 | 3300005439 | Bacteria | 16660 |
| 131 | Ga0070711_100215371 | 3300005439 | Bacteria | 1490 |
| 132 | Ga0070700_100043222 | 3300005441 | Bacteria | 2771 |
| 133 | Ga0070700_100453120 | 3300005441 | Bacteria | 977 |
| 134 | Ga0070694_100049626 | 3300005444 | Bacteria | 2827 |
| 135 | Ga0070663_100256134 | 3300005455 | Bacteria | 1387 |
| 136 | Ga0070663_100299082 | 3300005455 | Bacteria | 1287 |
| 137 | Ga0070663_100416249 | 3300005455 | Bacteria | 1101 |
| 138 | Ga0070678_100003442 | 3300005456 | Bacteria | 8830 |
| 139 | Ga0070678_100030637 | 3300005456 | Bacteria | 3701 |
| 140 | Ga0070678_100032986 | 3300005456 | Bacteria | 3590 |
| 141 | Ga0070678_100036530 | 3300005456 | Bacteria | 3440 |
| 142 | Ga0070678_100124938 | 3300005456 | Bacteria | 2035 |
| 143 | Ga0070662_100072730 | 3300005457 | Bacteria | 2539 |
| 144 | Ga0070662_100124422 | 3300005457 | Bacteria | 1980 |
| 145 | Ga0070662_100128016 | 3300005457 | Bacteria | 1954 |
| 146 | Ga0070681_10673650 | 3300005458 | Bacteria | 949 |
| 147 | Ga0068867_100000091 | 3300005459 | Bacteria | 57689 |
| 148 | Ga0068867_100010378 | 3300005459 | Bacteria | 6572 |
| 149 | Ga0068867_100035822 | 3300005459 | Bacteria | 3600 |
| 150 | Ga0068867_100039441 | 3300005459 | Bacteria | 3443 |
| 151 | Ga0068867_100040970 | 3300005459 | Bacteria | 3384 |
| 152 | Ga0068867_100056274 | 3300005459 | Bacteria | 2909 |
| 153 | Ga0068867_100104180 | 3300005459 | Bacteria | 2171 |
| 154 | Ga0068867_100213062 | 3300005459 | Bacteria | 1552 |
| 155 | Ga0070685_10147600 | 3300005466 | Bacteria | 1487 |
| 156 | Ga0070685_10356336 | 3300005466 | Bacteria | 1002 |
| 157 | Ga0070706_100154516 | 3300005467 | Bacteria | 2142 |
| 158 | Ga0070706_100239790 | 3300005467 | Bacteria | 1693 |
| 159 | Ga0070707_100251578 | 3300005468 | Bacteria | 1720 |
| 160 | Ga0070679_100515053 | 3300005530 | Bacteria | 1140 |
| 161 | Ga0070684_100214762 | 3300005535 | Bacteria | 1754 |
| 162 | Ga0068853_100000533 | 3300005539 | Bacteria | 25847 |
| 163 | Ga0068853_100008721 | 3300005539 | Bacteria | 8155 |
| 164 | Ga0068853_100062492 | 3300005539 | Bacteria | 3223 |
| 165 | Ga0068853_100392547 | 3300005539 | Bacteria | 1297 |
| 166 | Ga0070672_100004518 | 3300005543 | Bacteria | 9106 |
| 167 | Ga0070672_100006066 | 3300005543 | Bacteria | 8076 |
| 168 | Ga0070672_100091402 | 3300005543 | Bacteria | 2455 |
| 169 | Ga0070672_100133529 | 3300005543 | Bacteria | 2042 |
| 170 | Ga0070672_100194448 | 3300005543 | Bacteria | 1695 |
| 171 | Ga0070686_100001185 | 3300005544 | Bacteria | 14822 |
| 172 | Ga0070695_100012848 | 3300005545 | Bacteria | 5027 |
| 173 | Ga0070695_100567310 | 3300005545 | Bacteria | 887 |
| 174 | Ga0070696_100003912 | 3300005546 | Bacteria | 9951 |
| 175 | Ga0070665_100011966 | 3300005548 | Bacteria | 8759 |
| 176 | Ga0070665_100021983 | 3300005548 | Bacteria | 6416 |
| 177 | Ga0070665_100026315 | 3300005548 | Bacteria | 5859 |
| 178 | Ga0070665_100228629 | 3300005548 | Bacteria | 1860 |
| 179 | Ga0070665_100284493 | 3300005548 | Bacteria | 1655 |
| 180 | Ga0070665_100408231 | 3300005548 | Bacteria | 1366 |
| 181 | Ga0070665_100834977 | 3300005548 | Bacteria | 934 |
| 182 | Ga0070704_100130432 | 3300005549 | Bacteria | 1947 |
| 183 | Ga0068855_100059452 | 3300005563 | Bacteria | 4472 |
| 184 | Ga0068855_100138782 | 3300005563 | Bacteria | 2773 |
| 185 | Ga0070664_100035788 | 3300005564 | Bacteria | 4169 |
| 186 | Ga0068857_100007296 | 3300005577 | Bacteria | 9520 |
| 187 | Ga0068857_100049797 | 3300005577 | Bacteria | 3717 |
| 188 | Ga0068854_100006614 | 3300005578 | Bacteria | 7384 |
| 189 | Ga0068854_100111128 | 3300005578 | Bacteria | 2067 |
| 190 | Ga0068854_100367257 | 3300005578 | Bacteria | 1182 |
| 191 | Ga0068854_100448352 | 3300005578 | Bacteria | 1077 |
| 192 | Ga0068856_100030869 | 3300005614 | Bacteria | 5240 |
| 193 | Ga0068856_100105689 | 3300005614 | Bacteria | 2809 |
| 194 | Ga0068856_100170805 | 3300005614 | Bacteria | 2186 |
| 195 | Ga0068856_100209837 | 3300005614 | Bacteria | 1963 |
| 196 | Ga0068856_100252995 | 3300005614 | Bacteria | 1777 |
| 197 | Ga0068856_100320316 | 3300005614 | Bacteria | 1568 |
| 198 | Ga0068856_100528222 | 3300005614 | Bacteria | 1201 |
| 199 | Ga0070702_100000465 | 3300005615 | Bacteria | 14450 |
| 200 | Ga0070702_100181716 | 3300005615 | Bacteria | 1377 |
| 201 | Ga0070702_100187663 | 3300005615 | Bacteria | 1358 |
| 202 | Ga0068852_100004682 | 3300005616 | Bacteria | 9691 |
| 203 | Ga0068852_100018895 | 3300005616 | Bacteria | 5442 |
| 204 | Ga0068852_100038314 | 3300005616 | Bacteria | 4028 |
| 205 | Ga0068852_100518076 | 3300005616 | Bacteria | 1189 |
| 206 | Ga0068852_100523866 | 3300005616 | Bacteria | 1183 |
| 207 | Ga0068852_100898063 | 3300005616 | Bacteria | 903 |
| 208 | Ga0068859_100004139 | 3300005617 | Bacteria | 14808 |
| 209 | Ga0068859_100024768 | 3300005617 | Bacteria | 6022 |
| 210 | Ga0068859_100066366 | 3300005617 | Bacteria | 3643 |
| 211 | Ga0068859_100258096 | 3300005617 | Bacteria | 1834 |
| 212 | Ga0068859_100281564 | 3300005617 | Bacteria | 1756 |
| 213 | Ga0068859_100407028 | 3300005617 | Bacteria | 1456 |
| 214 | Ga0068864_100017958 | 3300005618 | Bacteria | 5902 |
| 215 | Ga0068864_100124212 | 3300005618 | Bacteria | 2311 |
| 216 | Ga0068864_100180333 | 3300005618 | Bacteria | 1930 |
| 217 | Ga0068864_100270219 | 3300005618 | Bacteria | 1584 |
| 218 | Ga0068864_100350494 | 3300005618 | Bacteria | 1393 |
| 219 | Ga0068866_10002429 | 3300005718 | Bacteria | 7686 |
| 220 | Ga0068866_10042055 | 3300005718 | Bacteria | 2272 |
| 221 | Ga0068866_10052992 | 3300005718 | Bacteria | 2072 |
| 222 | Ga0068866_10105319 | 3300005718 | Bacteria | 1563 |
| 223 | Ga0068861_100002134 | 3300005719 | Bacteria | 12795 |
| 224 | Ga0068861_100004235 | 3300005719 | Bacteria | 9622 |
| 225 | Ga0068861_100015953 | 3300005719 | Bacteria | 5303 |
| 226 | Ga0068861_100067724 | 3300005719 | Bacteria | 2756 |
| 227 | Ga0068861_100077139 | 3300005719 | Bacteria | 2598 |
| 228 | Ga0068861_100188954 | 3300005719 | Bacteria | 1720 |
| 229 | Ga0068861_100413072 | 3300005719 | Bacteria | 1201 |
| 230 | Ga0068851_10158537 | 3300005834 | Bacteria | 1241 |
| 231 | Ga0068870_10121037 | 3300005840 | Bacteria | 1508 |
| 232 | Ga0068870_10170422 | 3300005840 | Bacteria | 1299 |
| 233 | Ga0068863_100057708 | 3300005841 | Bacteria | 3674 |
| 234 | Ga0068863_100156268 | 3300005841 | Bacteria | 2184 |
| 235 | Ga0068863_100192197 | 3300005841 | Bacteria | 1962 |
| 236 | Ga0068863_100218540 | 3300005841 | Bacteria | 1836 |
| 237 | Ga0068858_100000679 | 3300005842 | Bacteria | 35449 |
| 238 | Ga0068858_100000774 | 3300005842 | Bacteria | 33365 |
| 239 | Ga0068858_100039707 | 3300005842 | Bacteria | 4363 |
| 240 | Ga0068858_100062433 | 3300005842 | Bacteria | 3444 |
| 241 | Ga0068858_100113932 | 3300005842 | Bacteria | 2526 |
| 242 | Ga0068858_100208795 | 3300005842 | Bacteria | 1848 |
| 243 | Ga0068858_100257248 | 3300005842 | Bacteria | 1659 |
| 244 | Ga0068858_100294160 | 3300005842 | Bacteria | 1548 |
| 245 | Ga0068860_100005264 | 3300005843 | Bacteria | 13132 |
| 246 | Ga0068860_100021326 | 3300005843 | Bacteria | 6272 |
| 247 | Ga0068860_100114065 | 3300005843 | Bacteria | 2584 |
| 248 | Ga0068860_100398874 | 3300005843 | Bacteria | 1360 |
| 249 | Ga0068860_100473424 | 3300005843 | Bacteria | 1248 |
| 250 | Ga0068862_100004858 | 3300005844 | Bacteria | 11313 |
| 251 | Ga0068862_100037860 | 3300005844 | Bacteria | 4090 |
| 252 | Ga0068862_100039976 | 3300005844 | Bacteria | 3985 |
| 253 | Ga0068862_100053778 | 3300005844 | Bacteria | 3447 |
| 254 | Ga0068862_100155416 | 3300005844 | Bacteria | 2039 |
| 255 | Ga0068862_100204281 | 3300005844 | Bacteria | 1783 |
| 256 | Ga0068862_100470055 | 3300005844 | Bacteria | 1188 |
| 257 | Ga0068862_100644166 | 3300005844 | Bacteria | 1021 |
| 258 | Ga0081455_10033573 | 3300005937 | Bacteria | 4609 |
| 259 | Ga0081538_10037477 | 3300005981 | Bacteria | 3145 |
| 260 | Ga0081540_1007796 | 3300005983 | Bacteria | 7577 |
| 261 | Ga0081540_1018556 | 3300005983 | Bacteria | 4261 |
| 262 | Ga0081540_1028680 | 3300005983 | Bacteria | 3119 |
| 263 | Ga0081540_1034711 | 3300005983 | Bacteria | 2714 |
| 264 | Ga0081539_10001065 | 3300005985 | Bacteria | 50187 |
| 265 | Ga0081539_10002462 | 3300005985 | Bacteria | 26092 |
| 266 | Ga0070717_10049598 | 3300006028 | Bacteria | 3446 |
| 267 | Ga0070717_10060157 | 3300006028 | Bacteria | 3145 |
| 268 | Ga0070717_10174840 | 3300006028 | Bacteria | 1869 |
| 269 | Ga0070717_10521222 | 3300006028 | Bacteria | 1075 |
| 270 | Ga0075365_10001077 | 3300006038 | Bacteria | 11841 |
| 271 | Ga0075365_10005631 | 3300006038 | Bacteria | 6781 |
| 272 | Ga0075365_10015495 | 3300006038 | Bacteria | 4614 |
| 273 | Ga0075365_10028179 | 3300006038 | Bacteria | 3580 |
| 274 | Ga0075365_10033264 | 3300006038 | Bacteria | 3321 |
| 275 | Ga0075365_10051810 | 3300006038 | Bacteria | 2712 |
| 276 | Ga0075365_10057918 | 3300006038 | Bacteria | 2578 |
| 277 | Ga0075365_10077386 | 3300006038 | Bacteria | 2247 |
| 278 | Ga0075365_10086523 | 3300006038 | Bacteria | 2130 |
| 279 | Ga0075365_10162450 | 3300006038 | Bacteria | 1557 |
| 280 | Ga0075365_10187535 | 3300006038 | Bacteria | 1447 |
| 281 | Ga0075368_10000497 | 3300006042 | Bacteria | 11660 |
| 282 | Ga0075363_100019120 | 3300006048 | Bacteria | 3422 |
| 283 | Ga0075363_100034775 | 3300006048 | Bacteria | 2632 |
| 284 | Ga0075364_10043362 | 3300006051 | Bacteria | 2924 |
| 285 | Ga0075364_10053411 | 3300006051 | Bacteria | 2642 |
| 286 | Ga0075364_10093419 | 3300006051 | Bacteria | 1997 |
| 287 | Ga0075364_10126716 | 3300006051 | Bacteria | 1712 |
| 288 | Ga0075364_10145322 | 3300006051 | Bacteria | 1597 |
| 289 | Ga0075432_10161255 | 3300006058 | Bacteria | 867 |
| 290 | Ga0070715_10052960 | 3300006163 | Bacteria | 1752 |
| 291 | Ga0070716_100002789 | 3300006173 | Bacteria | 8121 |
| 292 | Ga0070716_100060583 | 3300006173 | Bacteria | 2187 |
| 293 | Ga0075362_10015521 | 3300006177 | Bacteria | 3099 |
| 294 | Ga0075362_10076585 | 3300006177 | Bacteria | 1536 |
| 295 | Ga0075367_10005545 | 3300006178 | Bacteria | 6285 |
| 296 | Ga0075367_10029428 | 3300006178 | Bacteria | 3141 |
| 297 | Ga0075367_10102443 | 3300006178 | Bacteria | 1751 |
| 298 | Ga0075367_10241541 | 3300006178 | Bacteria | 1132 |
| 299 | Ga0075369_10000668 | 3300006186 | Bacteria | 10918 |
| 300 | Ga0075369_10003981 | 3300006186 | Bacteria | 5421 |
| 301 | Ga0075369_10007492 | 3300006186 | Bacteria | 4158 |
| 302 | Ga0075369_10100272 | 3300006186 | Bacteria | 1299 |
| 303 | Ga0075369_10123852 | 3300006186 | Bacteria | 1171 |
| 304 | Ga0075366_10001925 | 3300006195 | Bacteria | 10502 |
| 305 | Ga0075366_10032269 | 3300006195 | Bacteria | 3083 |
| 306 | Ga0075366_10083112 | 3300006195 | Bacteria | 1914 |
| 307 | Ga0075366_10155636 | 3300006195 | Bacteria | 1384 |
| 308 | Ga0075366_10207258 | 3300006195 | Bacteria | 1193 |
| 309 | Ga0097621_100014601 | 3300006237 | Bacteria | 5884 |
| 310 | Ga0097621_100023403 | 3300006237 | Bacteria | 4811 |
| 311 | Ga0097621_100027531 | 3300006237 | Bacteria | 4471 |
| 312 | Ga0097621_100141217 | 3300006237 | Bacteria | 2058 |
| 313 | Ga0097621_100182239 | 3300006237 | Bacteria | 1815 |
| 314 | Ga0097621_100585443 | 3300006237 | Bacteria | 1019 |
| 315 | Ga0075370_10003750 | 3300006353 | Bacteria | 7273 |
| 316 | Ga0075370_10012857 | 3300006353 | Bacteria | 4435 |
| 317 | Ga0075370_10014816 | 3300006353 | Bacteria | 4163 |
| 318 | Ga0075370_10076779 | 3300006353 | Bacteria | 1916 |
| 319 | Ga0068871_100072151 | 3300006358 | Bacteria | 2842 |
| 320 | Ga0068871_100117432 | 3300006358 | Bacteria | 2244 |
| 321 | Ga0075428_100297821 | 3300006844 | Bacteria | 1734 |
| 322 | Ga0075428_100385730 | 3300006844 | Bacteria | 1502 |
| 323 | Ga0075430_100056046 | 3300006846 | Bacteria | 3314 |
| 324 | Ga0075430_100289627 | 3300006846 | Bacteria | 1355 |
| 325 | Ga0075431_100008686 | 3300006847 | Bacteria | 10180 |
| 326 | Ga0075431_100014607 | 3300006847 | Bacteria | 7944 |
| 327 | Ga0075431_100802983 | 3300006847 | Bacteria | 914 |
| 328 | Ga0075433_10004359 | 3300006852 | Bacteria | 10998 |
| 329 | Ga0075433_10111317 | 3300006852 | Bacteria | 2429 |
| 330 | Ga0075433_10246146 | 3300006852 | Bacteria | 1587 |
| 331 | Ga0075434_100001107 | 3300006871 | Bacteria | 22100 |
| 332 | Ga0075434_100080113 | 3300006871 | Bacteria | 3262 |
| 333 | Ga0075434_100716813 | 3300006871 | Bacteria | 1017 |
| 334 | Ga0075429_100162181 | 3300006880 | Bacteria | 1958 |
| 335 | Ga0075429_100315527 | 3300006880 | Bacteria | 1368 |
| 336 | Ga0068865_100002181 | 3300006881 | Bacteria | 11531 |
| 337 | Ga0068865_100005350 | 3300006881 | Bacteria | 7775 |
| 338 | Ga0068865_100006891 | 3300006881 | Bacteria | 6962 |
| 339 | Ga0068865_100043120 | 3300006881 | Bacteria | 3080 |
| 340 | Ga0068865_100057693 | 3300006881 | Bacteria | 2709 |
| 341 | Ga0097620_100004139 | 3300006931 | Bacteria | 14808 |
| 342 | Ga0097620_100024768 | 3300006931 | Bacteria | 6022 |
| 343 | Ga0097620_100066364 | 3300006931 | Bacteria | 3643 |
| 344 | Ga0097620_100239842 | 3300006931 | Bacteria | 1902 |
| 345 | Ga0097620_100258095 | 3300006931 | Bacteria | 1834 |
| 346 | Ga0097620_100281543 | 3300006931 | Bacteria | 1756 |
| 347 | Ga0097620_100407008 | 3300006931 | Bacteria | 1456 |
| 348 | Ga0075435_100084847 | 3300007076 | Bacteria | 2607 |
| 349 | Ga0075435_100096110 | 3300007076 | Bacteria | 2451 |
| 350 | Ga0099795_10197466 | 3300007788 | Bacteria | 847 |
| 351 | Ga0105240_10030702 | 3300009093 | Bacteria | 6980 |
| 352 | Ga0105240_10188585 | 3300009093 | Bacteria | 2426 |
| 353 | Ga0105240_10193464 | 3300009093 | Bacteria | 2390 |
| 354 | Ga0105240_10317039 | 3300009093 | Bacteria | 1778 |
| 355 | Ga0105240_10445115 | 3300009093 | Bacteria | 1451 |
| 356 | Ga0105240_10470161 | 3300009093 | Bacteria | 1403 |
| 357 | Ga0111539_10000090 | 3300009094 | Bacteria | 94888 |
| 358 | Ga0111539_10095317 | 3300009094 | Bacteria | 3495 |
| 359 | Ga0111539_10106388 | 3300009094 | Bacteria | 3291 |
| 360 | Ga0111539_10228537 | 3300009094 | Bacteria | 2167 |
| 361 | Ga0111539_10594395 | 3300009094 | Bacteria | 1289 |
| 362 | Ga0111539_10741676 | 3300009094 | Bacteria | 1143 |
| 363 | Ga0111539_11228693 | 3300009094 | Bacteria | 870 |
| 364 | Ga0105245_10008017 | 3300009098 | Bacteria | 9237 |
| 365 | Ga0105245_10063580 | 3300009098 | Bacteria | 3333 |
| 366 | Ga0105245_10091787 | 3300009098 | Bacteria | 2795 |
| 367 | Ga0105245_10413657 | 3300009098 | Bacteria | 1350 |
| 368 | Ga0105245_10444206 | 3300009098 | Bacteria | 1304 |
| 369 | Ga0105245_10470834 | 3300009098 | Bacteria | 1268 |
| 370 | Ga0105245_10577174 | 3300009098 | Bacteria | 1149 |
| 371 | Ga0105247_10006831 | 3300009101 | Bacteria | 7031 |
| 372 | Ga0105247_10146901 | 3300009101 | Bacteria | 1550 |
| 373 | Ga0105247_10398480 | 3300009101 | Bacteria | 980 |
| 374 | Ga0114129_10179262 | 3300009147 | Bacteria | 2884 |
| 375 | Ga0114129_10271647 | 3300009147 | Bacteria | 2268 |
| 376 | Ga0114129_10286300 | 3300009147 | Bacteria | 2200 |
| 377 | Ga0105243_10000959 | 3300009148 | Bacteria | 26971 |
| 378 | Ga0105243_10015761 | 3300009148 | Bacteria | 5716 |
| 379 | Ga0105243_10105952 | 3300009148 | Bacteria | 2342 |
| 380 | Ga0105243_10155973 | 3300009148 | Bacteria | 1963 |
| 381 | Ga0105243_10182807 | 3300009148 | Bacteria | 1825 |
| 382 | Ga0105243_10292051 | 3300009148 | Bacteria | 1473 |
| 383 | Ga0105243_10616879 | 3300009148 | Bacteria | 1046 |
| 384 | Ga0105241_10002442 | 3300009174 | Bacteria | 13945 |
| 385 | Ga0105241_10113365 | 3300009174 | Bacteria | 2173 |
| 386 | Ga0105241_10292450 | 3300009174 | Bacteria | 1395 |
| 387 | Ga0105242_10002489 | 3300009176 | Bacteria | 14439 |
| 388 | Ga0105242_10193932 | 3300009176 | Bacteria | 1800 |
| 389 | Ga0105248_10000901 | 3300009177 | Bacteria | 33234 |
| 390 | Ga0105248_10013900 | 3300009177 | Bacteria | 8858 |
| 391 | Ga0105248_10015246 | 3300009177 | Bacteria | 8470 |
| 392 | Ga0105248_10019917 | 3300009177 | Bacteria | 7426 |
| 393 | Ga0105248_10060349 | 3300009177 | Bacteria | 4257 |
| 394 | Ga0105248_10479903 | 3300009177 | Bacteria | 1401 |
| 395 | Ga0105237_10000174 | 3300009545 | Bacteria | 90431 |
| 396 | Ga0105237_10009955 | 3300009545 | Bacteria | 10142 |
| 397 | Ga0105237_10018733 | 3300009545 | Bacteria | 7158 |
| 398 | Ga0105237_10034874 | 3300009545 | Bacteria | 5092 |
| 399 | Ga0105237_10035664 | 3300009545 | Bacteria | 5032 |
| 400 | Ga0105237_10043232 | 3300009545 | Bacteria | 4540 |
| 401 | Ga0105237_10049540 | 3300009545 | Bacteria | 4221 |
| 402 | Ga0105237_10186456 | 3300009545 | Bacteria | 2074 |
| 403 | Ga0105237_10364295 | 3300009545 | Bacteria | 1450 |
| 404 | Ga0105237_10403976 | 3300009545 | Bacteria | 1371 |
| 405 | Ga0105237_10673565 | 3300009545 | Bacteria | 1041 |
| 406 | Ga0105238_10010957 | 3300009551 | Bacteria | 9118 |
| 407 | Ga0105238_10029974 | 3300009551 | Bacteria | 5538 |
| 408 | Ga0105238_10033358 | 3300009551 | Bacteria | 5241 |
| 409 | Ga0105238_10045923 | 3300009551 | Bacteria | 4411 |
| 410 | Ga0105238_10487166 | 3300009551 | Bacteria | 1233 |
| 411 | Ga0105249_10049194 | 3300009553 | Bacteria | 3845 |
| 412 | Ga0105249_10185849 | 3300009553 | Bacteria | 2025 |
| 413 | Ga0105249_10247261 | 3300009553 | Bacteria | 1766 |
| 414 | Ga0105249_10400273 | 3300009553 | Bacteria | 1403 |
| 415 | Ga0105249_10444825 | 3300009553 | Bacteria | 1334 |
| 416 | Ga0105249_10504884 | 3300009553 | Bacteria | 1255 |
| 417 | Ga0123340_1040575 | 3300009763 | Bacteria | 2182 |
| 418 | Ga0123342_1032370 | 3300009766 | Bacteria | 2456 |
| 419 | Ga0105239_10002107 | 3300010375 | Bacteria | 25697 |
| 420 | Ga0105239_10007703 | 3300010375 | Bacteria | 12329 |
| 421 | Ga0105239_10039185 | 3300010375 | Bacteria | 5191 |
| 422 | Ga0105239_10122143 | 3300010375 | Bacteria | 2893 |
| 423 | Ga0105239_10243808 | 3300010375 | Bacteria | 2017 |
| 424 | Ga0105239_10301175 | 3300010375 | Bacteria | 1805 |
| 425 | Ga0105239_10307747 | 3300010375 | Bacteria | 1785 |
| 426 | Ga0105239_10343654 | 3300010375 | Bacteria | 1684 |
| 427 | Ga0105239_10374542 | 3300010375 | Bacteria | 1609 |
| 428 | Ga0105239_11306396 | 3300010375 | Bacteria | 837 |
| 429 | Ga0105246_10021121 | 3300011119 | Bacteria | 4186 |
| 430 | Ga0105246_10103356 | 3300011119 | Bacteria | 2079 |
| 431 | Ga0105246_10183024 | 3300011119 | Bacteria | 1615 |
| 432 | Ga0105246_10211017 | 3300011119 | Bacteria | 1516 |
| 433 | Ga0105246_10322074 | 3300011119 | Bacteria | 1256 |
| 434 | Ga0157338_1002466 | 3300012515 | Bacteria | 1454 |
| 435 | Ga0157371_10047155 | 3300013102 | Bacteria | 3063 |
| 436 | Ga0157370_10056251 | 3300013104 | Bacteria | 3744 |
| 437 | Ga0157370_10134148 | 3300013104 | Bacteria | 2308 |
| 438 | Ga0157369_10035139 | 3300013105 | Bacteria | 5497 |
| 439 | Ga0157369_10181288 | 3300013105 | Bacteria | 2215 |
| 440 | Ga0157369_10229048 | 3300013105 | Bacteria | 1943 |
| 441 | Ga0157374_10100093 | 3300013296 | Bacteria | 2778 |
| 442 | Ga0157374_10640703 | 3300013296 | Bacteria | 1074 |
| 443 | Ga0157378_10004511 | 3300013297 | Bacteria | 12212 |
| 444 | Ga0157378_10006489 | 3300013297 | Bacteria | 10226 |
| 445 | Ga0157378_10053222 | 3300013297 | Bacteria | 3604 |
| 446 | Ga0157378_10212835 | 3300013297 | Bacteria | 1833 |
| 447 | Ga0157378_10390105 | 3300013297 | Bacteria | 1369 |
| 448 | Ga0157378_10792357 | 3300013297 | Bacteria | 973 |
| 449 | Ga0163162_10000204 | 3300013306 | Bacteria | 54853 |
| 450 | Ga0163162_10004677 | 3300013306 | Bacteria | 13200 |
| 451 | Ga0163162_10049112 | 3300013306 | Bacteria | 4229 |
| 452 | Ga0163162_10118334 | 3300013306 | Bacteria | 2751 |
| 453 | Ga0163162_10544590 | 3300013306 | Bacteria | 1289 |
| 454 | Ga0157372_10514203 | 3300013307 | Bacteria | 1396 |
| 455 | Ga0157375_10006400 | 3300013308 | Bacteria | 10263 |
| 456 | Ga0157375_10024647 | 3300013308 | Bacteria | 5572 |
| 457 | Ga0157375_10041032 | 3300013308 | Bacteria | 4466 |
| 458 | Ga0157375_10057714 | 3300013308 | Bacteria | 3838 |
| 459 | Ga0157375_10794743 | 3300013308 | Bacteria | 1095 |
| 460 | Ga0163163_10828742 | 3300014325 | Bacteria | 988 |
| 461 | Ga0157380_10002708 | 3300014326 | Bacteria | 12017 |
| 462 | Ga0157380_10004478 | 3300014326 | Bacteria | 9681 |
| 463 | Ga0157380_10012997 | 3300014326 | Bacteria | 6053 |
| 464 | Ga0157380_10041949 | 3300014326 | Bacteria | 3574 |
| 465 | Ga0157380_10319433 | 3300014326 | Bacteria | 1439 |
| 466 | Ga0157380_10721693 | 3300014326 | Bacteria | 1004 |
| 467 | Ga0182008_10000774 | 3300014497 | Bacteria | 22409 |
| 468 | Ga0182008_10013499 | 3300014497 | Bacteria | 4295 |
| 469 | Ga0157377_10000107 | 3300014745 | Bacteria | 57351 |
| 470 | Ga0157377_10241541 | 3300014745 | Bacteria | 1166 |
| 471 | Ga0157379_10002672 | 3300014968 | Bacteria | 15018 |
| 472 | Ga0157379_10035395 | 3300014968 | Bacteria | 4452 |
| 473 | Ga0157379_10091786 | 3300014968 | Bacteria | 2724 |
| 474 | Ga0157379_10171246 | 3300014968 | Bacteria | 1960 |
| 475 | Ga0157379_10201941 | 3300014968 | Bacteria | 1798 |
| 476 | Ga0157379_10350293 | 3300014968 | Bacteria | 1352 |
| 477 | Ga0157379_10396532 | 3300014968 | Bacteria | 1268 |
| 478 | Ga0157379_10553319 | 3300014968 | Bacteria | 1071 |
| 479 | Ga0157379_10841194 | 3300014968 | Bacteria | 868 |
| 480 | Ga0157376_10093303 | 3300014969 | Bacteria | 2613 |
| 481 | Ga0157376_10232454 | 3300014969 | Bacteria | 1713 |
| 482 | Ga0157376_10389772 | 3300014969 | Bacteria | 1344 |
| 483 | Ga0157376_10402833 | 3300014969 | Bacteria | 1323 |
| 484 | Ga0182007_10004305 | 3300015262 | Bacteria | 6480 |
| 485 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 486 | Ga0183363_1026 | 3300015690 | Bacteria | 53052 |
| 487 | Ga0163161_10020746 | 3300017792 | Bacteria | 4613 |
| 488 | Ga0163161_10105260 | 3300017792 | Bacteria | 2104 |
| 489 | Ga0163161_10201719 | 3300017792 | Bacteria | 1533 |
| 490 | Ga0163161_10366484 | 3300017792 | Bacteria | 1149 |
| 491 | Ga0163161_10387294 | 3300017792 | Bacteria | 1118 |
| 492 | Ga0214544_1007335 | 3300021320 | Bacteria | 19472 |
| 493 | Ga0214542_1000027 | 3300021321 | Bacteria | 175107 |
| 494 | Ga0214543_1000047 | 3300021327 | Bacteria | 150894 |
| 495 | Ga0213873_10001600 | 3300021358 | Bacteria | 3780 |
| 496 | Ga0213873_10006410 | 3300021358 | Bacteria | 2314 |
| 497 | Ga0213874_10011559 | 3300021377 | Bacteria | 2240 |
| 498 | Ga0213874_10060082 | 3300021377 | Bacteria | 1188 |
| 499 | Ga0213876_10001084 | 3300021384 | Bacteria | 17452 |
| 500 | Ga0213876_10006877 | 3300021384 | Bacteria | 6200 |
| 501 | Ga0213876_10010546 | 3300021384 | Bacteria | 4952 |
| 502 | Ga0213875_10001310 | 3300021388 | Bacteria | 16493 |
| 503 | Ga0213875_10121679 | 3300021388 | Bacteria | 1220 |
| 504 | Ga0213875_10219999 | 3300021388 | Bacteria | 894 |
| 505 | Ga0209436_100043 | 3300025208 | Bacteria | 71870 |
| 506 | Ga0209436_100252 | 3300025208 | Bacteria | 24622 |
| 507 | Ga0209563_101905 | 3300025230 | Bacteria | 5047 |
| 508 | Ga0207427_101361 | 3300025231 | Bacteria | 9016 |
| 509 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 510 | Ga0209148_1000181 | 3300025254 | Bacteria | 124691 |
| 511 | Ga0209759_1000226 | 3300025256 | Bacteria | 84383 |
| 512 | Ga0209129_1001447 | 3300025258 | Bacteria | 13241 |
| 513 | Ga0209129_1001476 | 3300025258 | Bacteria | 13078 |
| 514 | Ga0209129_1001744 | 3300025258 | Bacteria | 11677 |
| 515 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 516 | Ga0209233_1000208 | 3300025261 | Bacteria | 115633 |
| 517 | Ga0209233_1007445 | 3300025261 | Bacteria | 3467 |
| 518 | Ga0209233_1011692 | 3300025261 | Bacteria | 2579 |
| 519 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 520 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 521 | Ga0209673_1000550 | 3300025273 | Bacteria | 60329 |
| 522 | Ga0209673_1002222 | 3300025273 | Bacteria | 14107 |
| 523 | Ga0209673_1012262 | 3300025273 | Bacteria | 3465 |
| 524 | Ga0209673_1015978 | 3300025273 | Bacteria | 2826 |
| 525 | Ga0209673_1058556 | 3300025273 | Bacteria | 974 |
| 526 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 527 | Ga0209130_1000075 | 3300025284 | Bacteria | 171698 |
| 528 | Ga0209130_1000144 | 3300025284 | Bacteria | 114000 |
| 529 | Ga0209130_1001459 | 3300025284 | Bacteria | 15538 |
| 530 | Ga0209130_1014845 | 3300025284 | Bacteria | 1940 |
| 531 | Ga0209130_1022823 | 3300025284 | Bacteria | 1389 |
| 532 | Ga0209675_1000577 | 3300025291 | Bacteria | 26469 |
| 533 | Ga0209675_1016073 | 3300025291 | Bacteria | 2194 |
| 534 | Ga0209676_1002745 | 3300025292 | Bacteria | 11797 |
| 535 | Ga0209676_1011940 | 3300025292 | Bacteria | 3458 |
| 536 | Ga0209025_1000747 | 3300025294 | Bacteria | 54721 |
| 537 | Ga0209025_1019972 | 3300025294 | Bacteria | 3692 |
| 538 | Ga0209025_1034575 | 3300025294 | Bacteria | 2303 |
| 539 | Ga0209025_1037564 | 3300025294 | Bacteria | 2146 |
| 540 | Ga0209025_1047418 | 3300025294 | Bacteria | 1754 |
| 541 | Ga0209564_1000278 | 3300025295 | Bacteria | 105405 |
| 542 | Ga0209564_1000365 | 3300025295 | Bacteria | 84031 |
| 543 | Ga0209564_1000558 | 3300025295 | Bacteria | 59623 |
| 544 | Ga0209564_1033341 | 3300025295 | Bacteria | 1533 |
| 545 | Ga0209758_1000070 | 3300025297 | Bacteria | 284093 |
| 546 | Ga0209758_1000706 | 3300025297 | Bacteria | 49585 |
| 547 | Ga0209758_1003235 | 3300025297 | Bacteria | 15130 |
| 548 | Ga0209758_1014914 | 3300025297 | Bacteria | 4078 |
| 549 | Ga0209758_1021677 | 3300025297 | Bacteria | 2986 |
| 550 | Ga0209758_1027676 | 3300025297 | Bacteria | 2416 |
| 551 | Ga0209050_1018895 | 3300025298 | Bacteria | 2651 |
| 552 | Ga0209256_1000315 | 3300025299 | Bacteria | 84048 |
| 553 | Ga0209256_1000411 | 3300025299 | Bacteria | 67351 |
| 554 | Ga0209256_1000718 | 3300025299 | Bacteria | 43876 |
| 555 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 556 | Ga0207426_1000126 | 3300025302 | Bacteria | 213341 |
| 557 | Ga0207426_1000163 | 3300025302 | Bacteria | 171698 |
| 558 | Ga0207426_1002369 | 3300025302 | Bacteria | 12212 |
| 559 | Ga0209051_1000176 | 3300025303 | Bacteria | 115875 |
| 560 | Ga0209051_1000241 | 3300025303 | Bacteria | 91816 |
| 561 | Ga0209051_1001845 | 3300025303 | Bacteria | 16708 |
| 562 | Ga0209051_1005280 | 3300025303 | Bacteria | 7613 |
| 563 | Ga0209051_1009714 | 3300025303 | Bacteria | 4930 |
| 564 | Ga0209051_1010914 | 3300025303 | Bacteria | 4535 |
| 565 | Ga0209051_1018933 | 3300025303 | Bacteria | 3026 |
| 566 | Ga0209051_1027372 | 3300025303 | Bacteria | 2274 |
| 567 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 568 | Ga0209257_1000296 | 3300025304 | Bacteria | 109517 |
| 569 | Ga0209257_1001085 | 3300025304 | Bacteria | 35621 |
| 570 | Ga0209257_1010756 | 3300025304 | Bacteria | 4555 |
| 571 | Ga0209257_1018952 | 3300025304 | Bacteria | 2616 |
| 572 | Ga0209257_1019528 | 3300025304 | Bacteria | 2547 |
| 573 | Ga0207697_10010156 | 3300025315 | Bacteria | 4037 |
| 574 | Ga0207682_10003824 | 3300025893 | Bacteria | 6462 |
| 575 | Ga0207692_10002105 | 3300025898 | Bacteria | 7597 |
| 576 | Ga0207642_10006968 | 3300025899 | Bacteria | 3789 |
| 577 | Ga0207642_10062734 | 3300025899 | Bacteria | 1735 |
| 578 | Ga0207642_10262657 | 3300025899 | Bacteria | 985 |
| 579 | Ga0207710_10016400 | 3300025900 | Bacteria | 3133 |
| 580 | Ga0207688_10014947 | 3300025901 | Bacteria | 4212 |
| 581 | Ga0207688_10021443 | 3300025901 | Bacteria | 3529 |
| 582 | Ga0207688_10066618 | 3300025901 | Bacteria | 2037 |
| 583 | Ga0207688_10107200 | 3300025901 | Bacteria | 1619 |
| 584 | Ga0207680_10000693 | 3300025903 | Bacteria | 15837 |
| 585 | Ga0207680_10275558 | 3300025903 | Bacteria | 1168 |
| 586 | Ga0207647_10043242 | 3300025904 | Bacteria | 2819 |
| 587 | Ga0207685_10034520 | 3300025905 | Bacteria | 1838 |
| 588 | Ga0207699_10017480 | 3300025906 | Bacteria | 3776 |
| 589 | Ga0207645_10001681 | 3300025907 | Bacteria | 18001 |
| 590 | Ga0207645_10012052 | 3300025907 | Bacteria | 5879 |
| 591 | Ga0207645_10149681 | 3300025907 | Bacteria | 1523 |
| 592 | Ga0207645_10259896 | 3300025907 | Bacteria | 1150 |
| 593 | Ga0207645_10366974 | 3300025907 | Bacteria | 965 |
| 594 | Ga0207643_10012550 | 3300025908 | Bacteria | 4577 |
| 595 | Ga0207643_10021802 | 3300025908 | Bacteria | 3524 |
| 596 | Ga0207705_10007543 | 3300025909 | Bacteria | 7994 |
| 597 | Ga0207705_10038277 | 3300025909 | Bacteria | 3433 |
| 598 | Ga0207705_10102103 | 3300025909 | Bacteria | 2111 |
| 599 | Ga0207705_10421710 | 3300025909 | Bacteria | 1033 |
| 600 | Ga0207654_10005276 | 3300025911 | Bacteria | 6526 |
| 601 | Ga0207654_10010388 | 3300025911 | Bacteria | 4739 |
| 602 | Ga0207654_10206933 | 3300025911 | Bacteria | 1295 |
| 603 | Ga0207707_10016219 | 3300025912 | Bacteria | 6500 |
| 604 | Ga0207695_10123128 | 3300025913 | Bacteria | 2559 |
| 605 | Ga0207695_10199422 | 3300025913 | Bacteria | 1916 |
| 606 | Ga0207671_10000098 | 3300025914 | Bacteria | 133010 |
| 607 | Ga0207671_10016385 | 3300025914 | Bacteria | 5761 |
| 608 | Ga0207671_10027171 | 3300025914 | Bacteria | 4279 |
| 609 | Ga0207671_10036385 | 3300025914 | Bacteria | 3651 |
| 610 | Ga0207671_10038267 | 3300025914 | Bacteria | 3555 |
| 611 | Ga0207671_10065373 | 3300025914 | Bacteria | 2705 |
| 612 | Ga0207671_10214649 | 3300025914 | Bacteria | 1506 |
| 613 | Ga0207671_10328979 | 3300025914 | Bacteria | 1210 |
| 614 | Ga0207693_10015759 | 3300025915 | Bacteria | 6057 |
| 615 | Ga0207663_10002594 | 3300025916 | Bacteria | 8693 |
| 616 | Ga0207660_10150888 | 3300025917 | Bacteria | 1785 |
| 617 | Ga0207662_10062892 | 3300025918 | Bacteria | 2231 |
| 618 | Ga0207657_10032176 | 3300025919 | Bacteria | 4742 |
| 619 | Ga0207657_10042901 | 3300025919 | Bacteria | 3988 |
| 620 | Ga0207657_10046890 | 3300025919 | Bacteria | 3783 |
| 621 | Ga0207657_10067886 | 3300025919 | Bacteria | 3031 |
| 622 | Ga0207649_10004269 | 3300025920 | Bacteria | 7778 |
| 623 | Ga0207652_10082409 | 3300025921 | Bacteria | 2815 |
| 624 | Ga0207652_10452232 | 3300025921 | Bacteria | 1158 |
| 625 | Ga0207681_10018257 | 3300025923 | Bacteria | 4418 |
| 626 | Ga0207681_10039810 | 3300025923 | Bacteria | 3123 |
| 627 | Ga0207681_10068503 | 3300025923 | Bacteria | 2465 |
| 628 | Ga0207681_10122552 | 3300025923 | Bacteria | 1909 |
| 629 | Ga0207681_10136522 | 3300025923 | Bacteria | 1821 |
| 630 | Ga0207681_10389484 | 3300025923 | Bacteria | 1123 |
| 631 | Ga0207681_10616992 | 3300025923 | Bacteria | 897 |
| 632 | Ga0207694_10069851 | 3300025924 | Bacteria | 2744 |
| 633 | Ga0207694_10100132 | 3300025924 | Bacteria | 2296 |
| 634 | Ga0207694_10275218 | 3300025924 | Bacteria | 1382 |
| 635 | Ga0207694_10383931 | 3300025924 | Bacteria | 1166 |
| 636 | Ga0207650_10017853 | 3300025925 | Bacteria | 4971 |
| 637 | Ga0207659_10002593 | 3300025926 | Bacteria | 10766 |
| 638 | Ga0207659_10071354 | 3300025926 | Bacteria | 2536 |
| 639 | Ga0207659_10085589 | 3300025926 | Bacteria | 2342 |
| 640 | Ga0207659_10178576 | 3300025926 | Bacteria | 1680 |
| 641 | Ga0207687_10003093 | 3300025927 | Bacteria | 11287 |
| 642 | Ga0207687_10007241 | 3300025927 | Bacteria | 7319 |
| 643 | Ga0207687_10050899 | 3300025927 | Bacteria | 2886 |
| 644 | Ga0207687_10265131 | 3300025927 | Bacteria | 1371 |
| 645 | Ga0207700_10031915 | 3300025928 | Bacteria | 3749 |
| 646 | Ga0207700_10038178 | 3300025928 | Bacteria | 3484 |
| 647 | Ga0207664_10006954 | 3300025929 | Bacteria | 7827 |
| 648 | Ga0207664_10132657 | 3300025929 | Bacteria | 2098 |
| 649 | Ga0207644_10006260 | 3300025931 | Bacteria | 7754 |
| 650 | Ga0207644_10018313 | 3300025931 | Bacteria | 4736 |
| 651 | Ga0207644_10045368 | 3300025931 | Bacteria | 3127 |
| 652 | Ga0207690_10016088 | 3300025932 | Bacteria | 4547 |
| 653 | Ga0207690_10139221 | 3300025932 | Bacteria | 1786 |
| 654 | Ga0207690_10474299 | 3300025932 | Bacteria | 1009 |
| 655 | Ga0207706_10003308 | 3300025933 | Bacteria | 15436 |
| 656 | Ga0207706_10022986 | 3300025933 | Bacteria | 5599 |
| 657 | Ga0207706_10184051 | 3300025933 | Bacteria | 1834 |
| 658 | Ga0207706_10193365 | 3300025933 | Bacteria | 1785 |
| 659 | Ga0207686_10002718 | 3300025934 | Bacteria | 9599 |
| 660 | Ga0207686_10015735 | 3300025934 | Bacteria | 4236 |
| 661 | Ga0207709_10001119 | 3300025935 | Bacteria | 19668 |
| 662 | Ga0207709_10005283 | 3300025935 | Bacteria | 7347 |
| 663 | Ga0207709_10024912 | 3300025935 | Bacteria | 3421 |
| 664 | Ga0207709_10059177 | 3300025935 | Bacteria | 2384 |
| 665 | Ga0207709_10113242 | 3300025935 | Bacteria | 1818 |
| 666 | Ga0207709_10119585 | 3300025935 | Bacteria | 1776 |
| 667 | Ga0207709_10145283 | 3300025935 | Bacteria | 1636 |
| 668 | Ga0207709_10309967 | 3300025935 | Bacteria | 1177 |
| 669 | Ga0207670_10005570 | 3300025936 | Bacteria | 6921 |
| 670 | Ga0207670_10009557 | 3300025936 | Bacteria | 5539 |
| 671 | Ga0207670_10292173 | 3300025936 | Bacteria | 1273 |
| 672 | Ga0207669_10024389 | 3300025937 | Bacteria | 3250 |
| 673 | Ga0207669_10024588 | 3300025937 | Bacteria | 3240 |
| 674 | Ga0207669_10025755 | 3300025937 | Bacteria | 3186 |
| 675 | Ga0207669_10029638 | 3300025937 | Bacteria | 3029 |
| 676 | Ga0207669_10062917 | 3300025937 | Bacteria | 2288 |
| 677 | Ga0207669_10174879 | 3300025937 | Bacteria | 1532 |
| 678 | Ga0207704_10001177 | 3300025938 | Bacteria | 11657 |
| 679 | Ga0207704_10009761 | 3300025938 | Bacteria | 4648 |
| 680 | Ga0207704_10044084 | 3300025938 | Bacteria | 2640 |
| 681 | Ga0207704_10209565 | 3300025938 | Bacteria | 1433 |
| 682 | Ga0207704_10344545 | 3300025938 | Bacteria | 1158 |
| 683 | Ga0207665_10005896 | 3300025939 | Bacteria | 8151 |
| 684 | Ga0207665_10112843 | 3300025939 | Bacteria | 1911 |
| 685 | Ga0207691_10003792 | 3300025940 | Bacteria | 14671 |
| 686 | Ga0207691_10035477 | 3300025940 | Bacteria | 4628 |
| 687 | Ga0207691_10099364 | 3300025940 | Bacteria | 2598 |
| 688 | Ga0207691_10208710 | 3300025940 | Bacteria | 1698 |
| 689 | Ga0207691_10216614 | 3300025940 | Bacteria | 1661 |
| 690 | Ga0207691_10239163 | 3300025940 | Bacteria | 1570 |
| 691 | Ga0207691_10655160 | 3300025940 | Bacteria | 887 |
| 692 | Ga0207711_10001117 | 3300025941 | Bacteria | 25666 |
| 693 | Ga0207711_10073953 | 3300025941 | Bacteria | 2963 |
| 694 | Ga0207711_10141307 | 3300025941 | Bacteria | 2166 |
| 695 | Ga0207689_10003529 | 3300025942 | Bacteria | 14293 |
| 696 | Ga0207689_10004524 | 3300025942 | Bacteria | 12591 |
| 697 | Ga0207689_10016932 | 3300025942 | Bacteria | 6166 |
| 698 | Ga0207689_10026403 | 3300025942 | Bacteria | 4862 |
| 699 | Ga0207689_10071557 | 3300025942 | Bacteria | 2848 |
| 700 | Ga0207689_10213752 | 3300025942 | Bacteria | 1593 |
| 701 | Ga0207661_10155033 | 3300025944 | Bacteria | 1983 |
| 702 | Ga0207679_10579823 | 3300025945 | Bacteria | 1009 |
| 703 | Ga0207667_10002257 | 3300025949 | Bacteria | 24224 |
| 704 | Ga0207667_10019765 | 3300025949 | Bacteria | 7508 |
| 705 | Ga0207667_10432121 | 3300025949 | Bacteria | 1339 |
| 706 | Ga0207651_10330865 | 3300025960 | Bacteria | 1277 |
| 707 | Ga0207651_10413170 | 3300025960 | Bacteria | 1150 |
| 708 | Ga0207712_10093622 | 3300025961 | Bacteria | 2218 |
| 709 | Ga0207712_10132278 | 3300025961 | Bacteria | 1903 |
| 710 | Ga0207712_10452389 | 3300025961 | Bacteria | 1089 |
| 711 | Ga0207712_10794292 | 3300025961 | Bacteria | 832 |
| 712 | Ga0207668_10004719 | 3300025972 | Bacteria | 8016 |
| 713 | Ga0207668_10007648 | 3300025972 | Bacteria | 6430 |
| 714 | Ga0207668_10022961 | 3300025972 | Bacteria | 4000 |
| 715 | Ga0207668_10054878 | 3300025972 | Bacteria | 2767 |
| 716 | Ga0207668_10091056 | 3300025972 | Bacteria | 2240 |
| 717 | Ga0207668_10107072 | 3300025972 | Bacteria | 2090 |
| 718 | Ga0207668_10148672 | 3300025972 | Bacteria | 1811 |
| 719 | Ga0207668_10252672 | 3300025972 | Bacteria | 1432 |
| 720 | Ga0207668_10325583 | 3300025972 | Bacteria | 1277 |
| 721 | Ga0207640_10004957 | 3300025981 | Bacteria | 7236 |
| 722 | Ga0207640_10163554 | 3300025981 | Bacteria | 1650 |
| 723 | Ga0207640_10218584 | 3300025981 | Bacteria | 1457 |
| 724 | Ga0207658_10001163 | 3300025986 | Bacteria | 21016 |
| 725 | Ga0207658_10002997 | 3300025986 | Bacteria | 12076 |
| 726 | Ga0207658_10154102 | 3300025986 | Bacteria | 1876 |
| 727 | Ga0207658_10471536 | 3300025986 | Bacteria | 1114 |
| 728 | Ga0207677_10000686 | 3300026023 | Bacteria | 20040 |
| 729 | Ga0207677_10081529 | 3300026023 | Bacteria | 2322 |
| 730 | Ga0207677_10148763 | 3300026023 | Bacteria | 1803 |
| 731 | Ga0207703_10000702 | 3300026035 | Bacteria | 33148 |
| 732 | Ga0207703_10148135 | 3300026035 | Bacteria | 2044 |
| 733 | Ga0207703_10322585 | 3300026035 | Bacteria | 1415 |
| 734 | Ga0207639_10004702 | 3300026041 | Bacteria | 9189 |
| 735 | Ga0207639_10017059 | 3300026041 | Bacteria | 5144 |
| 736 | Ga0207639_10043662 | 3300026041 | Bacteria | 3367 |
| 737 | Ga0207639_10197789 | 3300026041 | Bacteria | 1722 |
| 738 | Ga0207639_10228345 | 3300026041 | Bacteria | 1612 |
| 739 | Ga0207678_10055733 | 3300026067 | Bacteria | 3405 |
| 740 | Ga0207678_10139218 | 3300026067 | Bacteria | 2071 |
| 741 | Ga0207678_10239799 | 3300026067 | Bacteria | 1553 |
| 742 | Ga0207678_10368317 | 3300026067 | Bacteria | 1241 |
| 743 | Ga0207708_10023248 | 3300026075 | Bacteria | 4683 |
| 744 | Ga0207708_10063677 | 3300026075 | Bacteria | 2817 |
| 745 | Ga0207708_10174109 | 3300026075 | Bacteria | 1706 |
| 746 | Ga0207702_10020818 | 3300026078 | Bacteria | 5425 |
| 747 | Ga0207702_10021279 | 3300026078 | Bacteria | 5368 |
| 748 | Ga0207702_10080204 | 3300026078 | Bacteria | 2831 |
| 749 | Ga0207702_10085088 | 3300026078 | Bacteria | 2755 |
| 750 | Ga0207702_10091452 | 3300026078 | Bacteria | 2664 |
| 751 | Ga0207702_10258663 | 3300026078 | Bacteria | 1638 |
| 752 | Ga0207641_10000926 | 3300026088 | Bacteria | 30280 |
| 753 | Ga0207641_10135643 | 3300026088 | Bacteria | 2215 |
| 754 | Ga0207641_10167392 | 3300026088 | Bacteria | 2003 |
| 755 | Ga0207641_10330977 | 3300026088 | Bacteria | 1447 |
| 756 | Ga0207648_10000227 | 3300026089 | Bacteria | 60175 |
| 757 | Ga0207648_10001863 | 3300026089 | Bacteria | 23045 |
| 758 | Ga0207648_10004241 | 3300026089 | Bacteria | 14815 |
| 759 | Ga0207648_10027604 | 3300026089 | Bacteria | 5039 |
| 760 | Ga0207648_10052018 | 3300026089 | Bacteria | 3581 |
| 761 | Ga0207648_10077381 | 3300026089 | Bacteria | 2900 |
| 762 | Ga0207648_10137674 | 3300026089 | Bacteria | 2151 |
| 763 | Ga0207648_10152176 | 3300026089 | Bacteria | 2041 |
| 764 | Ga0207648_10182587 | 3300026089 | Bacteria | 1857 |
| 765 | Ga0207648_10209896 | 3300026089 | Bacteria | 1728 |
| 766 | Ga0207676_10000656 | 3300026095 | Bacteria | 27723 |
| 767 | Ga0207676_10055756 | 3300026095 | Bacteria | 3104 |
| 768 | Ga0207676_10171438 | 3300026095 | Bacteria | 1891 |
| 769 | Ga0207676_10220263 | 3300026095 | Bacteria | 1689 |
| 770 | Ga0207676_10406427 | 3300026095 | Bacteria | 1274 |
| 771 | Ga0207674_10026564 | 3300026116 | Bacteria | 6144 |
| 772 | Ga0207674_10196987 | 3300026116 | Bacteria | 1964 |
| 773 | Ga0207675_100001409 | 3300026118 | Bacteria | 24039 |
| 774 | Ga0207675_100003635 | 3300026118 | Bacteria | 15040 |
| 775 | Ga0207675_100004839 | 3300026118 | Bacteria | 12970 |
| 776 | Ga0207675_100005359 | 3300026118 | Bacteria | 12311 |
| 777 | Ga0207675_100025107 | 3300026118 | Bacteria | 5547 |
| 778 | Ga0207675_100040984 | 3300026118 | Bacteria | 4325 |
| 779 | Ga0207675_100063281 | 3300026118 | Bacteria | 3456 |
| 780 | Ga0207675_100131377 | 3300026118 | Bacteria | 2375 |
| 781 | Ga0207683_10000463 | 3300026121 | Bacteria | 37729 |
| 782 | Ga0207683_10028847 | 3300026121 | Bacteria | 4801 |
| 783 | Ga0207683_10041326 | 3300026121 | Bacteria | 4026 |
| 784 | Ga0207683_10049390 | 3300026121 | Bacteria | 3683 |
| 785 | Ga0207683_10059609 | 3300026121 | Bacteria | 3353 |
| 786 | Ga0207683_10116269 | 3300026121 | Bacteria | 2398 |
| 787 | Ga0207683_10360331 | 3300026121 | Bacteria | 1335 |
| 788 | Ga0207698_10008240 | 3300026142 | Bacteria | 6578 |
| 789 | Ga0207698_10015130 | 3300026142 | Bacteria | 5157 |
| 790 | Ga0207698_10139450 | 3300026142 | Bacteria | 2086 |
| 791 | Ga0207698_10210576 | 3300026142 | Bacteria | 1749 |
| 792 | Ga0207698_10216552 | 3300026142 | Bacteria | 1727 |
| 793 | Ga0207698_10412347 | 3300026142 | Bacteria | 1294 |
| 794 | Ga0209588_1024000 | 3300027671 | Bacteria | 1925 |
| 795 | Ga0209974_10014701 | 3300027876 | Bacteria | 2601 |
| 796 | Ga0207428_10000055 | 3300027907 | Bacteria | 166460 |
| 797 | Ga0207428_10198334 | 3300027907 | Bacteria | 1511 |
| 798 | Ga0207428_10373913 | 3300027907 | Bacteria | 1046 |
| 799 | Ga0268266_10001688 | 3300028379 | Bacteria | 25375 |
| 800 | Ga0268266_10004161 | 3300028379 | Bacteria | 13950 |
| 801 | Ga0268266_10013435 | 3300028379 | Bacteria | 7050 |
| 802 | Ga0268266_10014245 | 3300028379 | Bacteria | 6838 |
| 803 | Ga0268266_10022514 | 3300028379 | Bacteria | 5369 |
| 804 | Ga0268266_10268317 | 3300028379 | Bacteria | 1584 |
| 805 | Ga0268265_10019073 | 3300028380 | Bacteria | 4762 |
| 806 | Ga0268265_10020317 | 3300028380 | Bacteria | 4634 |
| 807 | Ga0268265_10031758 | 3300028380 | Bacteria | 3816 |
| 808 | Ga0268265_10036898 | 3300028380 | Bacteria | 3583 |
| 809 | Ga0268265_10045858 | 3300028380 | Bacteria | 3265 |
| 810 | Ga0268265_10060622 | 3300028380 | Bacteria | 2900 |
| 811 | Ga0268265_10120812 | 3300028380 | Bacteria | 2158 |
| 812 | Ga0268265_10487658 | 3300028380 | Bacteria | 1159 |
| 813 | Ga0268264_10027008 | 3300028381 | Bacteria | 4689 |
| 814 | Ga0268264_10031040 | 3300028381 | Bacteria | 4381 |
| 815 | Ga0268264_10050132 | 3300028381 | Bacteria | 3475 |
| 816 | Ga0268264_10102078 | 3300028381 | Bacteria | 2495 |
| 817 | Ga0268264_10146821 | 3300028381 | Bacteria | 2110 |
| 818 | Ga0268264_10245924 | 3300028381 | Bacteria | 1659 |
| 819 | Ga0268264_10359369 | 3300028381 | Bacteria | 1388 |
| 820 | Ga0268264_10395543 | 3300028381 | Bacteria | 1327 |
| 821 | Ga0307517_10000102 | 3300028786 | Bacteria | 123775 |
| 822 | Ga0307517_10091558 | 3300028786 | Bacteria | 2482 |
| 823 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 824 | Ga0307515_10000130 | 3300028794 | Bacteria | 179263 |
| 825 | Ga0307515_10005868 | 3300028794 | Bacteria | 24773 |
| 826 | Ga0307511_10062115 | 3300030521 | Bacteria | 2839 |
| 827 | Ga0307511_10105332 | 3300030521 | Bacteria | 1826 |
| 828 | Ga0307512_10066553 | 3300030522 | Bacteria | 2721 |
| 829 | Ga0265332_10044610 | 3300031238 | Bacteria | 1912 |
| 830 | Ga0265328_10075366 | 3300031239 | Bacteria | 1241 |
| 831 | Ga0265325_10033572 | 3300031241 | Bacteria | 2735 |
| 832 | Ga0265325_10090164 | 3300031241 | Bacteria | 1513 |
| 833 | Ga0265339_10001056 | 3300031249 | Bacteria | 20966 |
| 834 | Ga0265331_10024029 | 3300031250 | Bacteria | 3089 |
| 835 | Ga0265331_10027234 | 3300031250 | Bacteria | 2867 |
| 836 | Ga0265316_10102464 | 3300031344 | Bacteria | 2174 |
| 837 | Ga0307513_10004550 | 3300031456 | Bacteria | 18498 |
| 838 | Ga0307513_10006865 | 3300031456 | Bacteria | 14820 |
| 839 | Ga0307513_10011752 | 3300031456 | Bacteria | 10858 |
| 840 | Ga0307513_10161071 | 3300031456 | Bacteria | 2137 |
| 841 | Ga0307513_10207476 | 3300031456 | Bacteria | 1794 |
| 842 | Ga0307513_10237260 | 3300031456 | Bacteria | 1632 |
| 843 | Ga0307513_10412727 | 3300031456 | Bacteria | 1082 |
| 844 | Ga0307509_10020922 | 3300031507 | Bacteria | 7415 |
| 845 | Ga0307509_10077468 | 3300031507 | Bacteria | 3448 |
| 846 | Ga0307509_10382066 | 3300031507 | Bacteria | 1121 |
| 847 | Ga0307509_10434821 | 3300031507 | Bacteria | 1009 |
| 848 | Ga0307408_100009454 | 3300031548 | Bacteria | 6431 |
| 849 | Ga0307408_100190984 | 3300031548 | Bacteria | 1650 |
| 850 | Ga0307408_100223010 | 3300031548 | Bacteria | 1539 |
| 851 | Ga0307408_100306894 | 3300031548 | Bacteria | 1332 |
| 852 | Ga0307408_100589190 | 3300031548 | Bacteria | 986 |
| 853 | Ga0265313_10000044 | 3300031595 | Bacteria | 117063 |
| 854 | Ga0265313_10040982 | 3300031595 | Bacteria | 2285 |
| 855 | Ga0265313_10123276 | 3300031595 | Bacteria | 1128 |
| 856 | Ga0307508_10066442 | 3300031616 | Bacteria | 3175 |
| 857 | Ga0307508_10141035 | 3300031616 | Bacteria | 2014 |
| 858 | Ga0307508_10206694 | 3300031616 | Bacteria | 1564 |
| 859 | Ga0307508_10286396 | 3300031616 | Bacteria | 1241 |
| 860 | Ga0307508_10387937 | 3300031616 | Bacteria | 987 |
| 861 | Ga0265314_10060748 | 3300031711 | Bacteria | 2578 |
| 862 | Ga0265314_10072215 | 3300031711 | Bacteria | 2306 |
| 863 | Ga0265342_10037361 | 3300031712 | Bacteria | 2962 |
| 864 | Ga0307516_10002286 | 3300031730 | Bacteria | 25850 |
| 865 | Ga0307516_10003926 | 3300031730 | Bacteria | 18739 |
| 866 | Ga0307516_10020911 | 3300031730 | Bacteria | 6753 |
| 867 | Ga0307516_10042688 | 3300031730 | Bacteria | 4497 |
| 868 | Ga0307516_10047076 | 3300031730 | Bacteria | 4252 |
| 869 | Ga0307516_10130828 | 3300031730 | Bacteria | 2289 |
| 870 | Ga0307516_10155104 | 3300031730 | Bacteria | 2046 |
| 871 | Ga0307516_10345991 | 3300031730 | Bacteria | 1153 |
| 872 | Ga0307516_10349497 | 3300031730 | Bacteria | 1144 |
| 873 | Ga0307516_10421155 | 3300031730 | Bacteria | 993 |
| 874 | Ga0307405_10179969 | 3300031731 | Bacteria | 1517 |
| 875 | Ga0307410_10019322 | 3300031852 | Bacteria | 4142 |
| 876 | Ga0307410_10041221 | 3300031852 | Bacteria | 3044 |
| 877 | Ga0307410_10083488 | 3300031852 | Bacteria | 2250 |
| 878 | Ga0307410_10203151 | 3300031852 | Bacteria | 1514 |
| 879 | Ga0307410_10407633 | 3300031852 | Bacteria | 1100 |
| 880 | Ga0307406_10061645 | 3300031901 | Bacteria | 2423 |
| 881 | Ga0307406_10458268 | 3300031901 | Bacteria | 1025 |
| 882 | Ga0307406_10537513 | 3300031901 | Bacteria | 954 |
| 883 | Ga0307406_10613626 | 3300031901 | Bacteria | 898 |
| 884 | Ga0307412_10152043 | 3300031911 | Bacteria | 1709 |
| 885 | Ga0307412_10200185 | 3300031911 | Bacteria | 1516 |
| 886 | Ga0307412_10303683 | 3300031911 | Bacteria | 1263 |
| 887 | Ga0307412_10415584 | 3300031911 | Bacteria | 1099 |
| 888 | Ga0307409_100018544 | 3300031995 | Bacteria | 4682 |
| 889 | Ga0307409_100039177 | 3300031995 | Bacteria | 3514 |
| 890 | Ga0307409_100043282 | 3300031995 | Bacteria | 3380 |
| 891 | Ga0307416_100007618 | 3300032002 | Bacteria | 6907 |
| 892 | Ga0307416_100037447 | 3300032002 | Bacteria | 3733 |
| 893 | Ga0307416_100056078 | 3300032002 | Bacteria | 3177 |
| 894 | Ga0307416_100615651 | 3300032002 | Bacteria | 1167 |
| 895 | Ga0307416_100628839 | 3300032002 | Bacteria | 1156 |
| 896 | Ga0307414_10024513 | 3300032004 | Bacteria | 3849 |
| 897 | Ga0307414_10049458 | 3300032004 | Bacteria | 2907 |
| 898 | Ga0307414_10114087 | 3300032004 | Bacteria | 2064 |
| 899 | Ga0307414_10410036 | 3300032004 | Bacteria | 1179 |
| 900 | Ga0307411_10074874 | 3300032005 | Bacteria | 2309 |
| 901 | Ga0307411_10132876 | 3300032005 | Bacteria | 1822 |
| 902 | Ga0307415_100068726 | 3300032126 | Bacteria | 2481 |
| 903 | Ga0307507_10009514 | 3300033179 | Bacteria | 12901 |
| 904 | Ga0307510_10000403 | 3300033180 | Bacteria | 41043 |
| 905 | Ga0307510_10159973 | 3300033180 | Bacteria | 1851 |
| 906 | Ga0373930_0002314 | 3300034816 | Bacteria | 2940 |
| 907 | Ga0373958_0010594 | 3300034819 | Bacteria | 1541 |
| 908 | Ga0373959_0059970 | 3300034820 | Bacteria | 840 |
| 909 | Ga0373938_0021680 | 3300034957 | Bacteria | 1305 |
| 910 | Ga0373928_0025870 | 3300035084 | Bacteria | 1268 |
| 911 | Ga0373940_0001803 | 3300035088 | Bacteria | 3999 |
| 912 | Ga0373940_0013447 | 3300035088 | Bacteria | 1981 |
| 913 | Ga0373949_0035880 | 3300035090 | Bacteria | 1201 |
| 914 | Ga0373932_0065455 | 3300035112 | Bacteria | 1115 |
| 915 | Ga0373936_0058868 | 3300035113 | Bacteria | 1565 |
| 916 | Ga0373945_0075361 | 3300035116 | Bacteria | 1284 |
| 917 | Ga0373954_0065142 | 3300035118 | Bacteria | 1724 |
| 918 | Ga0373956_0088068 | 3300035119 | Bacteria | 1430 |
| 919 | Ga0373960_0108071 | 3300035121 | Bacteria | 909 |
| 920 | Ga0373943_0183297 | 3300035170 | Bacteria | 1152 |
| 921 | Ga0373943_0218080 | 3300035170 | Bacteria | 1062 |
| 922 | Ga0373943_0238149 | 3300035170 | Bacteria | 1019 |
| 923 | Ga0373946_0043305 | 3300035171 | Bacteria | 1854 |
| 924 | Ga0373955_0031994 | 3300035172 | Bacteria | 2758 |
| 925 | Ga0373955_0036165 | 3300035172 | Bacteria | 2619 |
| 926 | Ga0373942_0013968 | 3300035207 | Bacteria | 1937 |
| 927 | Ga0373962_0007243 | 3300035242 | Bacteria | 2715 |
| 928 | Ga0373924_0013697 | 3300035410 | Bacteria | 3051 |
| 929 | Ga0373931_0000221 | 3300035691 | Bacteria | 24293 |
| 930 | Ga0373931_0144426 | 3300035691 | Bacteria | 1382 |
| 931 | Ga0373931_0361801 | 3300035691 | Bacteria | 910 |
| 932 | Ga0373935_0001741 | 3300035692 | Bacteria | 12210 |
| 933 | Ga0373935_0029145 | 3300035692 | Bacteria | 3416 |
| 934 | Ga0373935_0059489 | 3300035692 | Bacteria | 2442 |
| 935 | Ga0373927_0000139 | 3300035695 | Bacteria | 56397 |
| 936 | Ga0373927_0001969 | 3300035695 | Bacteria | 15149 |
| 937 | Ga0373927_0021434 | 3300035695 | Bacteria | 4236 |
| 938 | Ga0373927_0021765 | 3300035695 | Bacteria | 4202 |
| 939 | Ga0373927_0028636 | 3300035695 | Bacteria | 3634 |
| 940 | Ga0373927_0151088 | 3300035695 | Bacteria | 1520 |
| 941 | Ga0373933_0007649 | 3300035724 | Bacteria | 5900 |
| 942 | Ga0373933_0041090 | 3300035724 | Bacteria | 2728 |
| 943 | Ga0373947_0001689 | 3300035725 | Bacteria | 13524 |
| 944 | Ga0373947_0023523 | 3300035725 | Bacteria | 3585 |
| 945 | Ga0373937_0009205 | 3300036401 | Bacteria | 8573 |
| 946 | Ga0373937_0039005 | 3300036401 | Bacteria | 4328 |
| 947 | Ga0373937_0050691 | 3300036401 | Bacteria | 3802 |
| 948 | Ga0373937_0061257 | 3300036401 | Bacteria | 3459 |
| 949 | Ga0373937_0177910 | 3300036401 | Bacteria | 1997 |
| 950 | Ga0373937_0689912 | 3300036401 | Bacteria | 967 |
| 951 | Ga0373925_0002233 | 3300037068 | Bacteria | 15725 |
| 952 | Ga0373925_0014218 | 3300037068 | Bacteria | 5759 |
| 953 | Ga0373925_0186614 | 3300037068 | Bacteria | 1644 |
| 954 | Ga0373925_0336393 | 3300037068 | Bacteria | 1224 |
| 955 | Ga0373925_0487456 | 3300037068 | Bacteria | 1011 |
| 956 | Ga0373925_0770095 | 3300037068 | Bacteria | 793 |
| 957 | Ga0395899_0027674 | 3300037312 | Bacteria | 4272 |
| 958 | Ga0395899_0116590 | 3300037312 | Bacteria | 1916 |
| 959 | Ga0395900_0029660 | 3300037418 | Bacteria | 5612 |
| 960 | Ga0395900_0091357 | 3300037418 | Bacteria | 3129 |
| 961 | Ga0395900_0095506 | 3300037418 | Bacteria | 3054 |
| 962 | Ga0395900_0217555 | 3300037418 | Bacteria | 1927 |
| 963 | Ga0395900_0376925 | 3300037418 | Bacteria | 1387 |
| 964 | Ga0395898_0088943 | 3300037466 | Bacteria | 2972 |
| 965 | Ga0395905_0000972 | 3300037471 | Bacteria | 36749 |
| 966 | Ga0395905_0001399 | 3300037471 | Bacteria | 29219 |
| 967 | Ga0395905_0021902 | 3300037471 | Bacteria | 6044 |
| 968 | Ga0395905_0079268 | 3300037471 | Bacteria | 3078 |
| 969 | Ga0395905_0083018 | 3300037471 | Bacteria | 3002 |
| 970 | Ga0395905_0169130 | 3300037471 | Bacteria | 2053 |
| 971 | Ga0395905_0888678 | 3300037471 | Bacteria | 794 |
| 972 | Ga0436364_0432791 | 3300037853 | Bacteria | 1460 |
| 973 | Ga0436364_1006337 | 3300037853 | Bacteria | 2505 |
| 974 | Ga0436364_1104972 | 3300037853 | Bacteria | 3261 |
| 975 | Ga0436364_1224731 | 3300037853 | Bacteria | 1368 |
| 976 | Ga0436364_1463980 | 3300037853 | Bacteria | 6279 |
| 977 | Ga0395901_0068908 | 3300038443 | Bacteria | 3684 |
| 978 | Ga0395901_0119894 | 3300038443 | Bacteria | 2764 |
| 979 | Ga0400483_085697 | 3300039062 | Bacteria | 5242 |
| 980 | Ga0400483_125610 | 3300039062 | Bacteria | 3336 |
| 981 | Ga0400483_202169 | 3300039062 | Bacteria | 8497 |
| 982 | Ga0436365_0080604 | 3300039437 | Bacteria | 50922 |
| 983 | Ga0436365_0095350 | 3300039437 | Bacteria | 3081 |
| 984 | Ga0436365_0291258 | 3300039437 | Bacteria | 51712 |
| 985 | Ga0436365_0484605 | 3300039437 | Bacteria | 1957 |
| 986 | Ga0436365_0528920 | 3300039437 | Bacteria | 1726 |
| 987 | Ga0436365_0709674 | 3300039437 | Bacteria | 6817 |
| 988 | Ga0436365_1106760 | 3300039437 | Bacteria | 2716 |
| 989 | Ga0436365_1107580 | 3300039437 | Bacteria | 3937 |
| 990 | Ga0436365_1113050 | 3300039437 | Bacteria | 4531 |
| 991 | Ga0436360_0806014 | 3300039438 | Bacteria | 1369 |
| 992 | Ga0436360_1247364 | 3300039438 | Bacteria | 2145 |
| 993 | Ga0436361_0316835 | 3300039447 | Bacteria | 2244 |
| 994 | Ga0436361_0438285 | 3300039447 | Bacteria | 2408 |
| 995 | Ga0436361_0655965 | 3300039447 | Bacteria | 2076 |
| 996 | Ga0436363_0250085 | 3300039450 | Bacteria | 26739 |
| 997 | Ga0436363_0470149 | 3300039450 | Bacteria | 2009 |
| 998 | Ga0436363_0691653 | 3300039450 | Bacteria | 2687 |
| 999 | Ga0436363_0706677 | 3300039450 | Bacteria | 4790 |
| 1000 | Ga0436362_0039268 | 3300039453 | Bacteria | 3827 |
| 1001 | Ga0436362_1130295 | 3300039453 | Bacteria | 10966 |
| 1002 | Ga0439436_0007480 | 3300041404 | Bacteria | 3360 |
| 1003 | Ga0439439_0029003 | 3300041406 | Bacteria | 1404 |
| 1004 | Ga0439453_0000158 | 3300041408 | Bacteria | 6141 |
| 1005 | Ga0439465_0001656 | 3300041413 | Bacteria | 7272 |
| 1006 | Ga0439465_0005428 | 3300041413 | Bacteria | 4068 |
| 1007 | Ga0439465_0040068 | 3300041413 | Bacteria | 1513 |
| 1008 | Ga0451798_0384754 | 3300041458 | Bacteria | 1400 |
| 1009 | Ga0451855_1802886 | 3300041511 | Bacteria | 1509 |
| 1010 | Ga0439443_008804 | 3300042003 | Bacteria | 1433 |
| 1011 | Ga0439449_0037385 | 3300042007 | Bacteria | 1806 |
| 1012 | Ga0439449_0063712 | 3300042007 | Bacteria | 1360 |
| 1013 | Ga0439455_0022404 | 3300042012 | Bacteria | 1514 |
| 1014 | Ga0450920_003262 | 3300042122 | Bacteria | 2801 |
| 1015 | Ga0439458_0011139 | 3300042157 | Bacteria | 2009 |
| 1016 | Ga0439434_0017132 | 3300042435 | Bacteria | 2167 |
| 1017 | Ga0439435_0001732 | 3300042436 | Bacteria | 4136 |
| 1018 | Ga0439435_0036134 | 3300042436 | Bacteria | 1364 |
| 1019 | Ga0439460_0014937 | 3300042461 | Bacteria | 2048 |
| 1020 | Ga0450918_001827 | 3300042531 | Bacteria | 4141 |
| 1021 | Ga0466969_0003525 | 3300044656 | Bacteria | 8316 |
| 1022 | Ga0466966_0010452 | 3300044684 | Bacteria | 6165 |
| 1023 | Ga0466961_0005081 | 3300044693 | Bacteria | 8279 |
| 1024 | Ga0453684_0015661 | 3300044712 | Bacteria | 11951 |
| 1025 | Ga0453684_0418952 | 3300044712 | Bacteria | 1496 |
| 1026 | Ga0466959_0012816 | 3300045049 | Bacteria | 6066 |
| 1027 | Ga0451576_0294890 | 3300045051 | Bacteria | 1695 |
| 1028 | Ga0451576_0350453 | 3300045051 | Bacteria | 1546 |
| 1029 | Ga0466967_0096052 | 3300045976 | Bacteria | 2703 |
| 1030 | Ga0466967_0416290 | 3300045976 | Bacteria | 1309 |
| 1031 | Ga0495617_056816 | 3300046452 | Bacteria | 1297 |
| 1032 | Ga0495592_0057749 | 3300046454 | Bacteria | 2864 |
| 1033 | Ga0495592_0118533 | 3300046454 | Bacteria | 1865 |
| 1034 | Ga0495592_0216459 | 3300046454 | Bacteria | 1283 |
| 1035 | Ga0495603_0051016 | 3300046455 | Bacteria | 2459 |
| 1036 | Ga0495603_0130629 | 3300046455 | Bacteria | 1463 |
| 1037 | Ga0495603_0214800 | 3300046455 | Bacteria | 1110 |
| 1038 | Ga0495590_0007845 | 3300046457 | Bacteria | 4097 |
| 1039 | Ga0495590_0014862 | 3300046457 | Bacteria | 2837 |
| 1040 | Ga0495629_0089881 | 3300046459 | Bacteria | 2142 |
| 1041 | Ga0495638_0010023 | 3300046460 | Bacteria | 6606 |
| 1042 | Ga0495638_0019892 | 3300046460 | Bacteria | 4439 |
| 1043 | Ga0495638_0023502 | 3300046460 | Bacteria | 4030 |
| 1044 | Ga0495638_0052267 | 3300046460 | Bacteria | 2545 |
| 1045 | Ga0495638_0078706 | 3300046460 | Bacteria | 2005 |
| 1046 | Ga0495651_0099829 | 3300046462 | Bacteria | 2164 |
| 1047 | Ga0495651_0298201 | 3300046462 | Bacteria | 1082 |
| 1048 | Ga0495580_0044247 | 3300046472 | Bacteria | 3167 |
| 1049 | Ga0495605_0009156 | 3300046474 | Bacteria | 5570 |
| 1050 | Ga0495639_0009873 | 3300046475 | Bacteria | 4099 |
| 1051 | Ga0495639_0093753 | 3300046475 | Bacteria | 1411 |
| 1052 | Ga0495639_0128881 | 3300046475 | Bacteria | 1210 |
| 1053 | Ga0495662_0123159 | 3300046476 | Bacteria | 1273 |
| 1054 | Ga0495664_0001193 | 3300046477 | Bacteria | 13561 |
| 1055 | Ga0495664_0006956 | 3300046477 | Bacteria | 6264 |
| 1056 | Ga0495664_0010170 | 3300046477 | Bacteria | 5280 |
| 1057 | Ga0495664_0046765 | 3300046477 | Bacteria | 2568 |
| 1058 | Ga0495584_0040470 | 3300046491 | Bacteria | 2353 |
| 1059 | Ga0495584_0131277 | 3300046491 | Bacteria | 1271 |
| 1060 | Ga0495585_0023268 | 3300046492 | Bacteria | 3556 |
| 1061 | Ga0495585_0031741 | 3300046492 | Bacteria | 2997 |
| 1062 | Ga0495585_0057444 | 3300046492 | Bacteria | 2147 |
| 1063 | Ga0495594_0117183 | 3300046499 | Bacteria | 1504 |
| 1064 | Ga0495596_0018291 | 3300046500 | Bacteria | 2889 |
| 1065 | Ga0495607_0106584 | 3300046501 | Bacteria | 1492 |
| 1066 | Ga0495583_0073517 | 3300046506 | Bacteria | 1498 |
| 1067 | Ga0495606_0002308 | 3300046507 | Bacteria | 22483 |
| 1068 | Ga0495606_0242604 | 3300046507 | Bacteria | 1004 |
| 1069 | Ga0495608_0013378 | 3300046511 | Bacteria | 5691 |
| 1070 | Ga0495608_0091303 | 3300046511 | Bacteria | 1970 |
| 1071 | Ga0495610_0016205 | 3300046512 | Bacteria | 4302 |
| 1072 | Ga0495610_0021848 | 3300046512 | Bacteria | 3511 |
| 1073 | Ga0495610_0167975 | 3300046512 | Bacteria | 922 |
| 1074 | Ga0495616_0020982 | 3300046513 | Bacteria | 3546 |
| 1075 | Ga0495618_0087433 | 3300046514 | Bacteria | 1993 |
| 1076 | Ga0495620_0019783 | 3300046515 | Bacteria | 3301 |
| 1077 | Ga0495620_0027127 | 3300046515 | Bacteria | 2685 |
| 1078 | Ga0495620_0084744 | 3300046515 | Bacteria | 1278 |
| 1079 | Ga0495628_0040093 | 3300046516 | Bacteria | 3744 |
| 1080 | Ga0495628_0206249 | 3300046516 | Bacteria | 1480 |
| 1081 | Ga0495630_0002691 | 3300046517 | Bacteria | 12335 |
| 1082 | Ga0495630_0009681 | 3300046517 | Bacteria | 6932 |
| 1083 | Ga0495630_0179043 | 3300046517 | Bacteria | 1616 |
| 1084 | Ga0495631_0027363 | 3300046518 | Bacteria | 2610 |
| 1085 | Ga0495631_0161637 | 3300046518 | Bacteria | 961 |
| 1086 | Ga0495637_0048020 | 3300046520 | Bacteria | 1800 |
| 1087 | Ga0495643_0016345 | 3300046522 | Bacteria | 4358 |
| 1088 | Ga0495643_0016823 | 3300046522 | Bacteria | 4291 |
| 1089 | Ga0495643_0031187 | 3300046522 | Bacteria | 2968 |
| 1090 | Ga0495644_0031331 | 3300046523 | Bacteria | 2009 |
| 1091 | Ga0495644_0056906 | 3300046523 | Bacteria | 1469 |
| 1092 | Ga0495648_0019848 | 3300046524 | Bacteria | 4706 |
| 1093 | Ga0495648_0033917 | 3300046524 | Bacteria | 3329 |
| 1094 | Ga0495648_0165670 | 3300046524 | Bacteria | 1138 |
| 1095 | Ga0495666_0016302 | 3300046526 | Bacteria | 3701 |
| 1096 | Ga0495642_0021749 | 3300046528 | Bacteria | 2524 |
| 1097 | Ga0495642_0024106 | 3300046528 | Bacteria | 2406 |
| 1098 | Ga0495642_0036830 | 3300046528 | Bacteria | 1978 |
| 1099 | Ga0495654_0027025 | 3300046530 | Bacteria | 2945 |
| 1100 | Ga0495665_0010250 | 3300046531 | Bacteria | 5072 |
| 1101 | Ga0495665_0050823 | 3300046531 | Bacteria | 2197 |
| 1102 | Ga0495640_0030810 | 3300046533 | Bacteria | 3836 |
| 1103 | Ga0495640_0139113 | 3300046533 | Bacteria | 1566 |
| 1104 | Ga0495587_0054018 | 3300046536 | Bacteria | 2368 |
| 1105 | Ga0495598_0001316 | 3300046537 | Bacteria | 4867 |
| 1106 | Ga0495621_0028212 | 3300046539 | Bacteria | 1907 |
| 1107 | Ga0495621_0073041 | 3300046539 | Bacteria | 1267 |
| 1108 | Ga0495597_0011373 | 3300046542 | Bacteria | 4316 |
| 1109 | Ga0495597_0013824 | 3300046542 | Bacteria | 3858 |
| 1110 | Ga0495597_0060331 | 3300046542 | Bacteria | 1655 |
| 1111 | Ga0495645_0002601 | 3300046543 | Bacteria | 12270 |
| 1112 | Ga0495667_0012733 | 3300046559 | Bacteria | 5701 |
| 1113 | Ga0495667_0013502 | 3300046559 | Bacteria | 5526 |
| 1114 | Ga0495667_0186767 | 3300046559 | Bacteria | 1329 |
| 1115 | Ga0495656_0000201 | 3300046615 | Bacteria | 21369 |
| 1116 | Ga0495656_0001707 | 3300046615 | Bacteria | 7194 |
| 1117 | Ga0495656_0038424 | 3300046615 | Bacteria | 1982 |
| 1118 | Ga0495656_0069385 | 3300046615 | Bacteria | 1561 |
| 1119 | Ga0495668_0093858 | 3300046616 | Bacteria | 1643 |
| 1120 | Ga0495634_0032374 | 3300046642 | Bacteria | 3596 |
| 1121 | Ga0495611_0125277 | 3300046648 | Bacteria | 1198 |
| 1122 | Ga0495625_0003440 | 3300046660 | Bacteria | 15790 |
| 1123 | Ga0495625_0157101 | 3300046660 | Bacteria | 1525 |
| 1124 | Ga0495625_0209204 | 3300046660 | Bacteria | 1283 |
| 1125 | Ga0495635_0315518 | 3300046663 | Bacteria | 1047 |
| 1126 | Ga0495661_0111480 | 3300046665 | Bacteria | 1524 |
| 1127 | Ga0495588_0066318 | 3300046674 | Bacteria | 1873 |
| 1128 | Ga0495588_0218852 | 3300046674 | Bacteria | 1005 |
| 1129 | Ga0495657_0127373 | 3300046675 | Bacteria | 1598 |
| 1130 | Ga0495599_0014021 | 3300046678 | Bacteria | 4961 |
| 1131 | Ga0495623_0140356 | 3300046679 | Bacteria | 1438 |
| 1132 | Ga0495646_0034557 | 3300046680 | Bacteria | 3139 |
| 1133 | Ga0495646_0049579 | 3300046680 | Bacteria | 2548 |
| 1134 | Ga0495658_0086519 | 3300046683 | Bacteria | 1849 |
| 1135 | Ga0495658_0152836 | 3300046683 | Bacteria | 1419 |
| 1136 | Ga0495658_0169234 | 3300046683 | Bacteria | 1351 |
| 1137 | Ga0495669_0014685 | 3300046684 | Bacteria | 3348 |
| 1138 | Ga0495669_0068550 | 3300046684 | Bacteria | 1614 |
| 1139 | Ga0495613_0165200 | 3300046689 | Bacteria | 1573 |
| 1140 | Ga0495624_0084998 | 3300046690 | Bacteria | 1955 |
| 1141 | Ga0495670_0077621 | 3300046691 | Bacteria | 1688 |
| 1142 | Ga0495671_0013120 | 3300046692 | Bacteria | 4501 |
| 1143 | Ga0495649_0073721 | 3300046694 | Bacteria | 1829 |
| 1144 | Ga0495600_0014445 | 3300046809 | Bacteria | 4977 |
| 1145 | Ga0495600_0121970 | 3300046809 | Bacteria | 1695 |
| 1146 | Ga0495660_0068273 | 3300046810 | Bacteria | 1892 |
| 1147 | Ga0495581_0183313 | 3300047315 | Bacteria | 1224 |
| 1148 | Ga0495581_0358551 | 3300047315 | Bacteria | 851 |
| 1149 | Ga0495604_0017364 | 3300047317 | Bacteria | 5760 |
| 1150 | Ga0495604_0050776 | 3300047317 | Bacteria | 3219 |
| 1151 | Ga0495674_0003734 | 3300047319 | Bacteria | 14802 |
| 1152 | Ga0495674_0019590 | 3300047319 | Bacteria | 6277 |
| 1153 | Ga0495674_0066087 | 3300047319 | Bacteria | 3139 |
| 1154 | Ga0495674_0075206 | 3300047319 | Bacteria | 2907 |
| 1155 | Ga0495674_0635030 | 3300047319 | Bacteria | 843 |
| 1156 | Ga0495672_0120073 | 3300047320 | Bacteria | 1398 |
| 1157 | Ga0495676_0252845 | 3300047321 | Bacteria | 1201 |
| 1158 | Ga0495680_0318562 | 3300047322 | Bacteria | 1089 |
| 1159 | Ga0495687_000636 | 3300047443 | Bacteria | 40190 |
| 1160 | Ga0495687_053901 | 3300047443 | Bacteria | 1691 |
| 1161 | Ga0495675_0016558 | 3300047444 | Bacteria | 4664 |
| 1162 | Ga0495675_0243056 | 3300047444 | Bacteria | 1083 |
| 1163 | Ga0495677_0039577 | 3300047445 | Bacteria | 1723 |
| 1164 | Ga0495673_0019819 | 3300047469 | Bacteria | 3363 |
| 1165 | Ga0495684_0260261 | 3300047471 | Bacteria | 1259 |
| 1166 | Ga0495686_0001513 | 3300047472 | Bacteria | 25024 |
| 1167 | Ga0495686_0044699 | 3300047472 | Bacteria | 2803 |
| 1168 | Ga0495686_0050724 | 3300047472 | Bacteria | 2607 |
| 1169 | Ga0495686_0092606 | 3300047472 | Bacteria | 1833 |
| 1170 | Ga0495686_0122347 | 3300047472 | Bacteria | 1549 |
| 1171 | Ga0495593_0120701 | 3300047673 | Bacteria | 1334 |
| 1172 | Ga0495602_0004753 | 3300048088 | Bacteria | 14201 |
| 1173 | Ga0495602_0125217 | 3300048088 | Bacteria | 2060 |
| 1174 | Ga0495614_0138734 | 3300048089 | Bacteria | 1080 |
| 1175 | Ga0495614_0176856 | 3300048089 | Bacteria | 959 |
| 1176 | Ga0495615_0008681 | 3300048090 | Bacteria | 1974 |
| 1177 | Ga0495626_0028174 | 3300048091 | Bacteria | 2725 |
| 1178 | Ga0495626_0159647 | 3300048091 | Bacteria | 946 |
| 1179 | Ga0496100_0029263 | 3300048903 | Bacteria | 3405 |
| 1180 | Ga0496101_0088114 | 3300048904 | Bacteria | 2305 |
| 1181 | Ga0496101_0159819 | 3300048904 | Bacteria | 1728 |
| 1182 | Ga0496102_0003637 | 3300048905 | Bacteria | 13037 |
| 1183 | Ga0496102_0269043 | 3300048905 | Bacteria | 1607 |
| 1184 | Ga0496102_0371850 | 3300048905 | Bacteria | 1345 |
| 1185 | Ga0496102_0633484 | 3300048905 | Bacteria | 992 |
| 1186 | Ga0496104_0167233 | 3300048907 | Bacteria | 2108 |
| 1187 | Ga0496105_0003045 | 3300048908 | Bacteria | 12322 |
| 1188 | Ga0496105_0004996 | 3300048908 | Bacteria | 10039 |
| 1189 | Ga0496105_0377778 | 3300048908 | Bacteria | 1128 |
| 1190 | Ga0496106_0000089 | 3300048909 | Bacteria | 72356 |
| 1191 | Ga0496106_0000244 | 3300048909 | Bacteria | 37887 |
| 1192 | Ga0496106_0006866 | 3300048909 | Bacteria | 8425 |
| 1193 | Ga0496106_0070480 | 3300048909 | Bacteria | 2670 |
| 1194 | Ga0496106_0530957 | 3300048909 | Bacteria | 945 |
| 1195 | Ga0496106_0610108 | 3300048909 | Bacteria | 874 |
| 1196 | Ga0496107_0016369 | 3300048910 | Bacteria | 5204 |
| 1197 | Ga0496107_0458134 | 3300048910 | Bacteria | 947 |
| 1198 | Ga0496108_0035648 | 3300048911 | Bacteria | 4136 |
| 1199 | Ga0496108_0287346 | 3300048911 | Bacteria | 1432 |
| 1200 | Ga0496108_0661789 | 3300048911 | Bacteria | 907 |
| 1201 | Ga0496108_0698079 | 3300048911 | Bacteria | 880 |
| 1202 | Ga0496109_0006604 | 3300048912 | Bacteria | 9767 |
| 1203 | Ga0496109_0145378 | 3300048912 | Bacteria | 2218 |
| 1204 | Ga0496109_0456873 | 3300048912 | Bacteria | 1206 |
| 1205 | Ga0496109_0511747 | 3300048912 | Bacteria | 1133 |
| 1206 | Ga0496110_0001819 | 3300048913 | Bacteria | 15723 |
| 1207 | Ga0496110_0050345 | 3300048913 | Bacteria | 3657 |
| 1208 | Ga0496110_0085247 | 3300048913 | Bacteria | 2820 |
| 1209 | Ga0496110_0248324 | 3300048913 | Bacteria | 1619 |
| 1210 | Ga0496111_0143633 | 3300048914 | Bacteria | 1769 |
| 1211 | Ga0496112_0003238 | 3300048915 | Bacteria | 13412 |
| 1212 | Ga0496112_0012529 | 3300048915 | Bacteria | 7790 |
| 1213 | Ga0496112_0138882 | 3300048915 | Bacteria | 2400 |
| 1214 | Ga0496112_0145815 | 3300048915 | Bacteria | 2336 |
| 1215 | Ga0496113_0012993 | 3300048916 | Bacteria | 5618 |
| 1216 | Ga0496113_0140626 | 3300048916 | Bacteria | 1899 |
| 1217 | Ga0496114_0287786 | 3300048917 | Bacteria | 1449 |
| 1218 | Ga0496115_0033571 | 3300048918 | Bacteria | 4052 |
| 1219 | Ga0496115_0167400 | 3300048918 | Bacteria | 1818 |
| 1220 | Ga0496117_0051502 | 3300048920 | Bacteria | 2910 |
| 1221 | Ga0496117_0079523 | 3300048920 | Bacteria | 2160 |
| 1222 | Ga0496118_0004232 | 3300048921 | Bacteria | 17221 |
| 1223 | Ga0496118_0021785 | 3300048921 | Bacteria | 5627 |
| 1224 | Ga0496118_0027353 | 3300048921 | Bacteria | 4829 |
| 1225 | Ga0496118_0039503 | 3300048921 | Bacteria | 3764 |
| 1226 | Ga0496118_0049073 | 3300048921 | Bacteria | 3253 |
| 1227 | Ga0496118_0054398 | 3300048921 | Bacteria | 3032 |
| 1228 | Ga0496118_0146758 | 3300048921 | Bacteria | 1484 |
| 1229 | Ga0496118_0157581 | 3300048921 | Bacteria | 1410 |
| 1230 | Ga0496119_0030275 | 3300048922 | Bacteria | 3654 |
| 1231 | Ga0496119_0038482 | 3300048922 | Bacteria | 3090 |
| 1232 | Ga0496119_0075543 | 3300048922 | Bacteria | 1958 |
| 1233 | Ga0496120_0004296 | 3300048923 | Bacteria | 12080 |
| 1234 | Ga0496120_0060488 | 3300048923 | Bacteria | 2119 |
| 1235 | Ga0496121_0009702 | 3300048924 | Bacteria | 11021 |
| 1236 | Ga0496121_0012571 | 3300048924 | Bacteria | 9209 |
| 1237 | Ga0496121_0013490 | 3300048924 | Bacteria | 8771 |
| 1238 | Ga0496121_0016499 | 3300048924 | Bacteria | 7621 |
| 1239 | Ga0496121_0024781 | 3300048924 | Bacteria | 5722 |
| 1240 | Ga0496121_0035975 | 3300048924 | Bacteria | 4423 |
| 1241 | Ga0496121_0056807 | 3300048924 | Bacteria | 3248 |
| 1242 | Ga0496121_0059968 | 3300048924 | Bacteria | 3134 |
| 1243 | Ga0496121_0095041 | 3300048924 | Bacteria | 2317 |
| 1244 | Ga0496121_0095365 | 3300048924 | Bacteria | 2312 |
| 1245 | Ga0496121_0098369 | 3300048924 | Bacteria | 2264 |
| 1246 | Ga0496122_0116596 | 3300048925 | Bacteria | 1736 |
| 1247 | Ga0496123_0215154 | 3300048926 | Bacteria | 973 |
| 1248 | Ga0496124_0004856 | 3300048927 | Bacteria | 15458 |
| 1249 | Ga0496124_0016982 | 3300048927 | Bacteria | 6889 |
| 1250 | Ga0496124_0056724 | 3300048927 | Bacteria | 3302 |
| 1251 | Ga0496124_0187153 | 3300048927 | Bacteria | 1588 |
| 1252 | Ga0496124_0243589 | 3300048927 | Bacteria | 1335 |
| 1253 | Ga0496125_0002684 | 3300048928 | Bacteria | 22676 |
| 1254 | Ga0496125_0014515 | 3300048928 | Bacteria | 7668 |
| 1255 | Ga0496125_0040917 | 3300048928 | Bacteria | 3968 |
| 1256 | Ga0496125_0147210 | 3300048928 | Bacteria | 1625 |
| 1257 | Ga0496126_0001193 | 3300048929 | Bacteria | 42367 |
| 1258 | Ga0496126_0015119 | 3300048929 | Bacteria | 7773 |
| 1259 | Ga0496126_0019399 | 3300048929 | Bacteria | 6697 |
| 1260 | Ga0496126_0066929 | 3300048929 | Bacteria | 3211 |
| 1261 | Ga0496126_0148270 | 3300048929 | Bacteria | 2013 |
| 1262 | Ga0496126_0236359 | 3300048929 | Bacteria | 1528 |
| 1263 | Ga0496126_0339699 | 3300048929 | Bacteria | 1230 |
| 1264 | Ga0496126_0369161 | 3300048929 | Bacteria | 1170 |
| 1265 | Ga0495678_020140 | 3300049459 | Bacteria | 2960 |
| 1266 | Ga0501298_001895 | 3300049521 | Bacteria | 3113 |
| 1267 | Ga0501031_0000009 | 3300049568 | Bacteria | 155116 |
| 1268 | Ga0501031_0014617 | 3300049568 | Bacteria | 5103 |
| 1269 | Ga0501031_0018659 | 3300049568 | Bacteria | 4517 |
| 1270 | Ga0501032_0000017 | 3300049569 | Bacteria | 158303 |
| 1271 | Ga0501032_0042254 | 3300049569 | Bacteria | 3092 |
| 1272 | Ga0501032_0042410 | 3300049569 | Bacteria | 3086 |
| 1273 | Ga0501032_0055957 | 3300049569 | Bacteria | 2653 |
| 1274 | Ga0501032_0077697 | 3300049569 | Bacteria | 2210 |
| 1275 | Ga0501032_0116702 | 3300049569 | Bacteria | 1765 |
| 1276 | Ga0501032_0375624 | 3300049569 | Bacteria | 914 |
| 1277 | Ga0501033_0000029 | 3300049570 | Bacteria | 158294 |
| 1278 | Ga0501033_0000210 | 3300049570 | Bacteria | 55950 |
| 1279 | Ga0501033_0014151 | 3300049570 | Bacteria | 6065 |
| 1280 | Ga0501033_0029259 | 3300049570 | Bacteria | 4140 |
| 1281 | Ga0501033_0040867 | 3300049570 | Bacteria | 3462 |
| 1282 | Ga0501033_0050293 | 3300049570 | Bacteria | 3092 |
| 1283 | Ga0501033_0142089 | 3300049570 | Bacteria | 1735 |
| 1284 | Ga0501033_0226633 | 3300049570 | Bacteria | 1329 |
| 1285 | Ga0501034_0000102 | 3300049571 | Bacteria | 158302 |
| 1286 | Ga0501034_0010066 | 3300049571 | Bacteria | 9869 |
| 1287 | Ga0501034_0022378 | 3300049571 | Bacteria | 6443 |
| 1288 | Ga0501034_0058070 | 3300049571 | Bacteria | 3889 |
| 1289 | Ga0501034_0080355 | 3300049571 | Bacteria | 3263 |
| 1290 | Ga0501034_0111704 | 3300049571 | Bacteria | 2723 |
| 1291 | Ga0501034_0131166 | 3300049571 | Bacteria | 2489 |
| 1292 | Ga0501034_0138098 | 3300049571 | Bacteria | 2418 |
| 1293 | Ga0501034_0154056 | 3300049571 | Bacteria | 2273 |
| 1294 | Ga0501034_0185301 | 3300049571 | Bacteria | 2045 |
| 1295 | Ga0501036_0000011 | 3300049572 | Bacteria | 158302 |
| 1296 | Ga0501036_0028446 | 3300049572 | Bacteria | 4723 |
| 1297 | Ga0501036_0029066 | 3300049572 | Bacteria | 4672 |
| 1298 | Ga0501036_0112113 | 3300049572 | Bacteria | 2305 |
| 1299 | Ga0501036_0151100 | 3300049572 | Bacteria | 1959 |
| 1300 | Ga0501036_0167560 | 3300049572 | Bacteria | 1851 |
| 1301 | Ga0501036_0270847 | 3300049572 | Bacteria | 1422 |
| 1302 | Ga0501036_0308729 | 3300049572 | Bacteria | 1323 |
| 1303 | Ga0501036_0505528 | 3300049572 | Bacteria | 1005 |
| 1304 | Ga0501036_0580523 | 3300049572 | Bacteria | 931 |
| 1305 | Ga0501036_0754375 | 3300049572 | Bacteria | 803 |
| 1306 | Ga0501037_0000015 | 3300049573 | Bacteria | 161311 |
| 1307 | Ga0501037_0015564 | 3300049573 | Bacteria | 5597 |
| 1308 | Ga0501037_0036508 | 3300049573 | Bacteria | 3621 |
| 1309 | Ga0501037_0140858 | 3300049573 | Bacteria | 1726 |
| 1310 | Ga0501037_0154317 | 3300049573 | Bacteria | 1640 |
| 1311 | Ga0501037_0220141 | 3300049573 | Bacteria | 1336 |
| 1312 | Ga0501037_0226416 | 3300049573 | Bacteria | 1314 |
| 1313 | Ga0501038_0000016 | 3300049574 | Bacteria | 159150 |
| 1314 | Ga0501038_0016141 | 3300049574 | Bacteria | 6777 |
| 1315 | Ga0501038_0017713 | 3300049574 | Bacteria | 6438 |
| 1316 | Ga0501038_0043422 | 3300049574 | Bacteria | 3909 |
| 1317 | Ga0501038_0064206 | 3300049574 | Bacteria | 3132 |
| 1318 | Ga0501038_0071775 | 3300049574 | Bacteria | 2936 |
| 1319 | Ga0501038_0089947 | 3300049574 | Bacteria | 2574 |
| 1320 | Ga0501038_0093812 | 3300049574 | Bacteria | 2510 |
| 1321 | Ga0501038_0345032 | 3300049574 | Bacteria | 1161 |
| 1322 | Ga0501039_0000023 | 3300049575 | Bacteria | 158026 |
| 1323 | Ga0501039_0004433 | 3300049575 | Bacteria | 10598 |
| 1324 | Ga0501039_0028219 | 3300049575 | Bacteria | 4319 |
| 1325 | Ga0501039_0031181 | 3300049575 | Bacteria | 4109 |
| 1326 | Ga0501039_0119894 | 3300049575 | Bacteria | 2061 |
| 1327 | Ga0501039_0133599 | 3300049575 | Bacteria | 1948 |
| 1328 | Ga0501039_0325715 | 3300049575 | Bacteria | 1208 |
| 1329 | Ga0501039_0417542 | 3300049575 | Bacteria | 1054 |
| 1330 | Ga0501040_0008206 | 3300049576 | Bacteria | 6790 |
| 1331 | Ga0501040_0019932 | 3300049576 | Bacteria | 4465 |
| 1332 | Ga0501040_0026385 | 3300049576 | Bacteria | 3907 |
| 1333 | Ga0501040_0026743 | 3300049576 | Bacteria | 3881 |
| 1334 | Ga0501040_0148247 | 3300049576 | Bacteria | 1654 |
| 1335 | Ga0501040_0181154 | 3300049576 | Bacteria | 1494 |
| 1336 | Ga0501041_0025799 | 3300049577 | Bacteria | 3533 |
| 1337 | Ga0501041_0408741 | 3300049577 | Bacteria | 860 |
| 1338 | Ga0501042_0013408 | 3300049578 | Bacteria | 5577 |
| 1339 | Ga0501042_0013841 | 3300049578 | Bacteria | 5495 |
| 1340 | Ga0501043_0023532 | 3300049579 | Bacteria | 4832 |
| 1341 | Ga0501043_0032719 | 3300049579 | Bacteria | 4089 |
| 1342 | Ga0501043_0033981 | 3300049579 | Bacteria | 4011 |
| 1343 | Ga0501043_0035819 | 3300049579 | Bacteria | 3904 |
| 1344 | Ga0501043_0062648 | 3300049579 | Bacteria | 2920 |
| 1345 | Ga0501043_0098517 | 3300049579 | Bacteria | 2298 |
| 1346 | Ga0501043_0157612 | 3300049579 | Bacteria | 1775 |
| 1347 | Ga0501046_0025041 | 3300049580 | Bacteria | 4888 |
| 1348 | Ga0501046_0059780 | 3300049580 | Bacteria | 2984 |
| 1349 | Ga0501046_0174005 | 3300049580 | Bacteria | 1614 |
| 1350 | Ga0501047_0003203 | 3300049581 | Bacteria | 15516 |
| 1351 | Ga0501047_0026623 | 3300049581 | Bacteria | 5565 |
| 1352 | Ga0501047_0047340 | 3300049581 | Bacteria | 4155 |
| 1353 | Ga0501047_0048280 | 3300049581 | Bacteria | 4110 |
| 1354 | Ga0501047_0068877 | 3300049581 | Bacteria | 3408 |
| 1355 | Ga0501047_0075275 | 3300049581 | Bacteria | 3248 |
| 1356 | Ga0501047_0172479 | 3300049581 | Bacteria | 2031 |
| 1357 | Ga0501047_0396161 | 3300049581 | Bacteria | 1214 |
| 1358 | Ga0501048_0001620 | 3300049582 | Bacteria | 17135 |
| 1359 | Ga0501067_0058783 | 3300049583 | Bacteria | 2128 |
| 1360 | Ga0501067_0070588 | 3300049583 | Bacteria | 1934 |
| 1361 | Ga0501067_0257412 | 3300049583 | Bacteria | 972 |
| 1362 | Ga0501068_0009831 | 3300049584 | Bacteria | 5357 |
| 1363 | Ga0501068_0015059 | 3300049584 | Bacteria | 4434 |
| 1364 | Ga0501068_0016664 | 3300049584 | Bacteria | 4238 |
| 1365 | Ga0501068_0225359 | 3300049584 | Bacteria | 1192 |
| 1366 | Ga0501068_0251236 | 3300049584 | Bacteria | 1127 |
| 1367 | Ga0501069_0084739 | 3300049585 | Bacteria | 1788 |
| 1368 | Ga0501070_0018522 | 3300049586 | Bacteria | 5841 |
| 1369 | Ga0501070_0018945 | 3300049586 | Bacteria | 5773 |
| 1370 | Ga0501070_0020275 | 3300049586 | Bacteria | 5576 |
| 1371 | Ga0501070_0025557 | 3300049586 | Bacteria | 4953 |
| 1372 | Ga0501070_0037015 | 3300049586 | Bacteria | 4074 |
| 1373 | Ga0501070_0068629 | 3300049586 | Bacteria | 2935 |
| 1374 | Ga0501070_0133287 | 3300049586 | Bacteria | 2052 |
| 1375 | Ga0501070_0209466 | 3300049586 | Bacteria | 1600 |
| 1376 | Ga0501071_0017388 | 3300049587 | Bacteria | 4959 |
| 1377 | Ga0501071_0039620 | 3300049587 | Bacteria | 3371 |
| 1378 | Ga0501071_0050093 | 3300049587 | Bacteria | 3008 |
| 1379 | Ga0501071_0184284 | 3300049587 | Bacteria | 1565 |
| 1380 | Ga0501071_0205630 | 3300049587 | Bacteria | 1480 |
| 1381 | Ga0501071_0217406 | 3300049587 | Bacteria | 1438 |
| 1382 | Ga0501071_0315002 | 3300049587 | Bacteria | 1187 |
| 1383 | Ga0501072_0037641 | 3300049588 | Bacteria | 3794 |
| 1384 | Ga0501072_0049250 | 3300049588 | Bacteria | 3316 |
| 1385 | Ga0501072_0083812 | 3300049588 | Bacteria | 2527 |
| 1386 | Ga0501073_0005813 | 3300049589 | Bacteria | 9217 |
| 1387 | Ga0501073_0008806 | 3300049589 | Bacteria | 7463 |
| 1388 | Ga0501073_0019992 | 3300049589 | Bacteria | 4829 |
| 1389 | Ga0501073_0042901 | 3300049589 | Bacteria | 3191 |
| 1390 | Ga0501073_0066141 | 3300049589 | Bacteria | 2520 |
| 1391 | Ga0501073_0073408 | 3300049589 | Bacteria | 2382 |
| 1392 | Ga0501073_0077498 | 3300049589 | Bacteria | 2313 |
| 1393 | Ga0501073_0138474 | 3300049589 | Bacteria | 1687 |
| 1394 | Ga0501074_0047062 | 3300049590 | Bacteria | 3118 |
| 1395 | Ga0501074_0060169 | 3300049590 | Bacteria | 2736 |
| 1396 | Ga0501074_0065331 | 3300049590 | Bacteria | 2619 |
| 1397 | Ga0501074_0155968 | 3300049590 | Bacteria | 1631 |
| 1398 | Ga0501074_0165729 | 3300049590 | Bacteria | 1578 |
| 1399 | Ga0501074_0385325 | 3300049590 | Bacteria | 994 |
| 1400 | Ga0501075_0000163 | 3300049591 | Bacteria | 34323 |
| 1401 | Ga0501075_0020817 | 3300049591 | Bacteria | 4775 |
| 1402 | Ga0501075_0087012 | 3300049591 | Bacteria | 2368 |
| 1403 | Ga0501076_0000053 | 3300049592 | Bacteria | 56853 |
| 1404 | Ga0501076_0011116 | 3300049592 | Bacteria | 6697 |
| 1405 | Ga0501076_0025466 | 3300049592 | Bacteria | 4578 |
| 1406 | Ga0501076_0152505 | 3300049592 | Bacteria | 1880 |
| 1407 | Ga0501076_0227431 | 3300049592 | Bacteria | 1525 |
| 1408 | Ga0501076_0322436 | 3300049592 | Bacteria | 1267 |
| 1409 | Ga0501077_0015654 | 3300049593 | Bacteria | 4777 |
| 1410 | Ga0501077_0039624 | 3300049593 | Bacteria | 3002 |
| 1411 | Ga0501077_0137745 | 3300049593 | Bacteria | 1548 |
| 1412 | Ga0501077_0399241 | 3300049593 | Bacteria | 879 |
| 1413 | Ga0501257_006345 | 3300049686 | Bacteria | 2624 |
| 1414 | Ga0501079_0014659 | 3300049741 | Bacteria | 5977 |
| 1415 | Ga0501079_0035053 | 3300049741 | Bacteria | 3861 |
| 1416 | Ga0501079_0045986 | 3300049741 | Bacteria | 3368 |
| 1417 | Ga0501079_0305361 | 3300049741 | Bacteria | 1245 |
| 1418 | Ga0501079_0394709 | 3300049741 | Bacteria | 1085 |
| 1419 | Ga0501079_0406008 | 3300049741 | Bacteria | 1069 |
| 1420 | Ga0501080_0021292 | 3300049742 | Bacteria | 6001 |
| 1421 | Ga0501080_0033395 | 3300049742 | Bacteria | 4802 |
| 1422 | Ga0501080_0034299 | 3300049742 | Bacteria | 4737 |
| 1423 | Ga0501080_0036427 | 3300049742 | Bacteria | 4592 |
| 1424 | Ga0501080_0044767 | 3300049742 | Bacteria | 4119 |
| 1425 | Ga0501080_0053973 | 3300049742 | Bacteria | 3742 |
| 1426 | Ga0501080_0073436 | 3300049742 | Bacteria | 3182 |
| 1427 | Ga0501080_0212505 | 3300049742 | Bacteria | 1773 |
| 1428 | Ga0501081_0005369 | 3300049743 | Bacteria | 8270 |
| 1429 | Ga0501081_0074096 | 3300049743 | Bacteria | 2375 |
| 1430 | Ga0501081_0102062 | 3300049743 | Bacteria | 2029 |
| 1431 | Ga0501081_0326101 | 3300049743 | Bacteria | 1129 |
| 1432 | Ga0501083_0031312 | 3300049744 | Bacteria | 3651 |
| 1433 | Ga0501083_0057902 | 3300049744 | Bacteria | 2594 |
| 1434 | Ga0501083_0072113 | 3300049744 | Bacteria | 2296 |
| 1435 | Ga0501083_0137946 | 3300049744 | Bacteria | 1597 |
| 1436 | Ga0501083_0374056 | 3300049744 | Bacteria | 926 |
| 1437 | Ga0501035_0000038 | 3300049822 | Bacteria | 158818 |
| 1438 | Ga0501035_0003069 | 3300049822 | Bacteria | 16026 |
| 1439 | Ga0501035_0025834 | 3300049822 | Bacteria | 5381 |
| 1440 | Ga0501035_0076163 | 3300049822 | Bacteria | 2967 |
| 1441 | Ga0501035_0105264 | 3300049822 | Bacteria | 2473 |
| 1442 | Ga0501035_0194557 | 3300049822 | Bacteria | 1742 |
| 1443 | Ga0501035_0198470 | 3300049822 | Bacteria | 1722 |
| 1444 | Ga0501035_0259307 | 3300049822 | Bacteria | 1474 |
| 1445 | Ga0501035_0500299 | 3300049822 | Bacteria | 1000 |
| 1446 | Ga0501035_0518539 | 3300049822 | Bacteria | 979 |
| 1447 | Ga0501044_0000046 | 3300049823 | Bacteria | 146812 |
| 1448 | Ga0501044_0028299 | 3300049823 | Bacteria | 5915 |
| 1449 | Ga0501044_0060853 | 3300049823 | Bacteria | 3864 |
| 1450 | Ga0501044_0085509 | 3300049823 | Bacteria | 3187 |
| 1451 | Ga0501044_0155718 | 3300049823 | Bacteria | 2264 |
| 1452 | Ga0501044_0165843 | 3300049823 | Bacteria | 2183 |
| 1453 | Ga0501044_0223045 | 3300049823 | Bacteria | 1835 |
| 1454 | Ga0501044_0574492 | 3300049823 | Bacteria | 1022 |
| 1455 | Ga0501045_0026735 | 3300049824 | Bacteria | 4153 |
| 1456 | Ga0501045_0033596 | 3300049824 | Bacteria | 3719 |
| 1457 | Ga0501045_0126575 | 3300049824 | Bacteria | 1898 |
| 1458 | Ga0501045_0195777 | 3300049824 | Bacteria | 1506 |
| 1459 | Ga0501045_0243791 | 3300049824 | Bacteria | 1338 |
| 1460 | Ga0501045_0530819 | 3300049824 | Bacteria | 873 |
| 1461 | nmdc:mga03n38_24270_c1 | 3300050490 | Bacteria | 2477 |
| 1462 | nmdc:mga03n38_299517_c1 | 3300050490 | Bacteria | 863 |
| 1463 | nmdc:mga03n38_42252_c1 | 3300050490 | Bacteria | 1992 |
| 1464 | nmdc:mga00v17_46612_c1 | 3300050491 | Bacteria | 2623 |
| 1465 | nmdc:mga00v17_68047_c1 | 3300050491 | Bacteria | 2201 |
| 1466 | nmdc:mga00v17_78770_c1 | 3300050491 | Bacteria | 2054 |
| 1467 | nmdc:mga0yw44_104110_c1 | 3300050492 | Bacteria | 1811 |
| 1468 | nmdc:mga0yw44_114611_c1 | 3300050492 | Bacteria | 1730 |
| 1469 | nmdc:mga0yw44_17726_c1 | 3300050492 | Bacteria | 3883 |
| 1470 | nmdc:mga0yw44_5085_c1 | 3300050492 | Bacteria | 6149 |
| 1471 | nmdc:mga0yw44_71757_c1 | 3300050492 | Bacteria | 2151 |
| 1472 | nmdc:mga0yw44_7481_c1 | 3300050492 | Bacteria | 5379 |
| 1473 | nmdc:mga0yw44_8283_c1 | 3300050492 | Bacteria | 5167 |
| 1474 | nmdc:mga0k408_137152_c1 | 3300050493 | Bacteria | 1454 |
| 1475 | nmdc:mga0k408_1436_c1 | 3300050493 | Bacteria | 12900 |
| 1476 | nmdc:mga0k408_37877_c1 | 3300050493 | Bacteria | 2769 |
| 1477 | nmdc:mga0k408_4087_c1 | 3300050493 | Bacteria | 7746 |
| 1478 | nmdc:mga06z11_10062_c1 | 3300050494 | Bacteria | 4013 |
| 1479 | nmdc:mga06z11_18996_c1 | 3300050494 | Bacteria | 3151 |
| 1480 | nmdc:mga06z11_96099_c1 | 3300050494 | Bacteria | 1618 |
| 1481 | nmdc:mga04h51_141771_c1 | 3300050495 | Bacteria | 912 |
| 1482 | nmdc:mga04h51_3374_c1 | 3300050495 | Bacteria | 3879 |
| 1483 | nmdc:mga07m45_15562_c1 | 3300050496 | Bacteria | 4062 |
| 1484 | nmdc:mga07m45_38336_c1 | 3300050496 | Bacteria | 2674 |
| 1485 | nmdc:mga05p37_155007_c1 | 3300050507 | Bacteria | 2800 |
| 1486 | nmdc:mga05p37_233069_c1 | 3300050507 | Bacteria | 2217 |
| 1487 | nmdc:mga09592_244179_c1 | 3300050508 | Bacteria | 1556 |
| 1488 | nmdc:mga0qj67_49363_c1 | 3300050509 | Bacteria | 3327 |
| 1489 | nmdc:mga06r32_3096_c1 | 3300050510 | Bacteria | 14894 |
| 1490 | nmdc:mga06r32_76935_c1 | 3300050510 | Bacteria | 3241 |
| 1491 | nmdc:mga08y16_212436_c1 | 3300050511 | Bacteria | 2004 |
| 1492 | nmdc:mga08y16_473803_c1 | 3300050511 | Bacteria | 1274 |
| 1493 | nmdc:mga08y16_595_c1 | 3300050511 | Bacteria | 33721 |
| 1494 | nmdc:mga08y16_955572_c1 | 3300050511 | Bacteria | 840 |
| 1495 | nmdc:mga0n895_71252_c1 | 3300050512 | Bacteria | 3446 |
| 1496 | nmdc:mga0n895_782_c1 | 3300050512 | Bacteria | 22642 |
| 1497 | nmdc:mga0rr50_24139_c1 | 3300050513 | Bacteria | 4207 |
| 1498 | nmdc:mga0a205_216920_c1 | 3300050515 | Bacteria | 1800 |
| 1499 | nmdc:mga0a205_377503_c1 | 3300050515 | Bacteria | 1283 |
| 1500 | nmdc:mga0a205_6389_c1 | 3300050515 | Bacteria | 10647 |
| 1501 | nmdc:mga0sz30_2709_c1 | 3300050516 | Bacteria | 6320 |
| 1502 | nmdc:mga0sz30_42656_c1 | 3300050516 | Bacteria | 1909 |
| 1503 | nmdc:mga0sz30_51037_c1 | 3300050516 | Bacteria | 1754 |
| 1504 | Ga0495601_0000401 | 3300053077 | Bacteria | 22929 |
| 1505 | Ga0495601_0041759 | 3300053077 | Bacteria | 2876 |
| 1506 | Ga0495612_0004593 | 3300053078 | Bacteria | 5724 |
| 1507 | Ga0500635_0001263 | 3300053080 | Bacteria | 6038 |
| 1508 | Ga0495655_0006637 | 3300053083 | Bacteria | 2115 |
| 1509 | Ga0495595_0028715 | 3300053084 | Bacteria | 2486 |
| 1510 | Ga0495619_0021683 | 3300053085 | Bacteria | 4104 |
| 1511 | Ga0495619_0065107 | 3300053085 | Bacteria | 2431 |
| 1512 | Ga0495619_0086737 | 3300053085 | Bacteria | 2116 |
| 1513 | Ga0495619_0119100 | 3300053085 | Bacteria | 1809 |
| 1514 | Ga0500578_0039666 | 3300053086 | Bacteria | 3026 |
| 1515 | Ga0500643_051840 | 3300053087 | Bacteria | 1171 |
| 1516 | Ga0500644_0034129 | 3300053088 | Bacteria | 1639 |
| 1517 | Ga0500646_0017535 | 3300053090 | Bacteria | 1878 |
| 1518 | Ga0500647_0006028 | 3300053091 | Bacteria | 5097 |
| 1519 | Ga0500647_0106100 | 3300053091 | Bacteria | 1339 |
| 1520 | Ga0500583_0016915 | 3300053092 | Bacteria | 2923 |
| 1521 | Ga0500651_0048095 | 3300053093 | Bacteria | 2680 |
| 1522 | Ga0500566_0007888 | 3300053094 | Bacteria | 6303 |
| 1523 | Ga0500566_0031098 | 3300053094 | Bacteria | 3113 |
| 1524 | Ga0500566_0158317 | 3300053094 | Bacteria | 1183 |
| 1525 | Ga0500641_0152109 | 3300053096 | Bacteria | 999 |
| 1526 | Ga0500650_0033296 | 3300053098 | Bacteria | 2350 |
| 1527 | Ga0500555_003111 | 3300053103 | Bacteria | 4735 |
| 1528 | Ga0500555_012168 | 3300053103 | Bacteria | 2474 |
| 1529 | Ga0500556_0024413 | 3300053104 | Bacteria | 1986 |
| 1530 | Ga0500562_006674 | 3300053108 | Bacteria | 2908 |
| 1531 | Ga0500562_079513 | 3300053108 | Bacteria | 887 |
| 1532 | Ga0500572_024060 | 3300053111 | Bacteria | 1640 |
| 1533 | Ga0500592_008699 | 3300053116 | Bacteria | 1612 |
| 1534 | Ga0500594_0004484 | 3300053118 | Bacteria | 3078 |
| 1535 | Ga0500594_0047780 | 3300053118 | Bacteria | 1195 |
| 1536 | Ga0500595_000266 | 3300053119 | Bacteria | 34654 |
| 1537 | Ga0500595_001200 | 3300053119 | Bacteria | 14322 |
| 1538 | Ga0500595_015995 | 3300053119 | Bacteria | 2802 |
| 1539 | Ga0500595_020314 | 3300053119 | Bacteria | 2393 |
| 1540 | Ga0500595_028672 | 3300053119 | Bacteria | 1896 |
| 1541 | Ga0500608_063462 | 3300053122 | Bacteria | 1763 |
| 1542 | Ga0500608_117175 | 3300053122 | Bacteria | 1213 |
| 1543 | Ga0500614_043074 | 3300053123 | Bacteria | 1155 |
| 1544 | Ga0500642_0000900 | 3300053130 | Bacteria | 8630 |
| 1545 | Ga0500642_0065334 | 3300053130 | Bacteria | 1643 |
| 1546 | Ga0500642_0129993 | 3300053130 | Bacteria | 1180 |
| 1547 | Ga0500658_0007094 | 3300053134 | Bacteria | 4146 |
| 1548 | Ga0500658_0016918 | 3300053134 | Bacteria | 2719 |
| 1549 | Ga0500658_0113384 | 3300053134 | Bacteria | 1195 |
| 1550 | Ga0500561_0044642 | 3300053137 | Bacteria | 1185 |
| 1551 | Ga0500568_0000415 | 3300053139 | Bacteria | 32506 |
| 1552 | Ga0500568_0001174 | 3300053139 | Bacteria | 17524 |
| 1553 | Ga0500573_0060387 | 3300053140 | Bacteria | 2171 |
| 1554 | Ga0500577_0068019 | 3300053142 | Bacteria | 1389 |
| 1555 | Ga0500577_0105596 | 3300053142 | Bacteria | 1156 |
| 1556 | Ga0500588_0001609 | 3300053146 | Bacteria | 4352 |
| 1557 | Ga0500588_0007470 | 3300053146 | Bacteria | 2520 |
| 1558 | Ga0500603_021372 | 3300053150 | Bacteria | 1591 |
| 1559 | Ga0500604_0009878 | 3300053151 | Bacteria | 2545 |
| 1560 | Ga0500604_0019145 | 3300053151 | Bacteria | 1914 |
| 1561 | Ga0500616_0002694 | 3300053153 | Bacteria | 14436 |
| 1562 | Ga0500616_0055477 | 3300053153 | Bacteria | 2072 |
| 1563 | Ga0500616_0088404 | 3300053153 | Bacteria | 1540 |
| 1564 | Ga0500616_0208982 | 3300053153 | Bacteria | 859 |
| 1565 | Ga0500619_122099 | 3300053154 | Bacteria | 888 |
| 1566 | Ga0500620_000234 | 3300053155 | Bacteria | 11002 |
| 1567 | Ga0500622_0000646 | 3300053156 | Bacteria | 31129 |
| 1568 | Ga0500622_0000772 | 3300053156 | Bacteria | 27803 |
| 1569 | Ga0500622_0059991 | 3300053156 | Bacteria | 1942 |
| 1570 | Ga0500622_0084763 | 3300053156 | Bacteria | 1582 |
| 1571 | Ga0500627_0006268 | 3300053158 | Bacteria | 4036 |
| 1572 | Ga0500627_0032262 | 3300053158 | Bacteria | 2206 |
| 1573 | Ga0500627_0073122 | 3300053158 | Bacteria | 1520 |
| 1574 | Ga0500627_0079467 | 3300053158 | Bacteria | 1460 |
| 1575 | Ga0500627_0099687 | 3300053158 | Bacteria | 1303 |
| 1576 | Ga0500627_0236847 | 3300053158 | Bacteria | 811 |
| 1577 | Ga0500630_121514 | 3300053159 | Bacteria | 1156 |
| 1578 | Ga0500633_0030142 | 3300053160 | Bacteria | 1741 |
| 1579 | Ga0500634_0037402 | 3300053161 | Bacteria | 2639 |
| 1580 | Ga0500634_0062976 | 3300053161 | Bacteria | 1963 |
| 1581 | Ga0500638_158005 | 3300053162 | Bacteria | 1001 |
| 1582 | Ga0500639_004632 | 3300053163 | Bacteria | 6991 |
| 1583 | Ga0500639_089488 | 3300053163 | Bacteria | 1536 |
| 1584 | Ga0500636_0011613 | 3300053177 | Bacteria | 5156 |
| 1585 | Ga0500636_0044811 | 3300053177 | Bacteria | 2608 |
| 1586 | Ga0500636_0050905 | 3300053177 | Bacteria | 2435 |
| 1587 | Ga0500636_0121702 | 3300053177 | Bacteria | 1463 |
| 1588 | Ga0500636_0166768 | 3300053177 | Bacteria | 1195 |
| 1589 | Ga0500636_0237738 | 3300053177 | Bacteria | 938 |
| 1590 | Ga0500637_0060181 | 3300053178 | Bacteria | 2174 |
| 1591 | Ga0500611_003636 | 3300053727 | Bacteria | 1999 |
| 1592 | Ga0500645_030897 | 3300053730 | Bacteria | 1610 |
| 1593 | Ga0500609_004076 | 3300053731 | Bacteria | 2032 |
| 1594 | Ga0500609_012380 | 3300053731 | Bacteria | 1153 |
| 1595 | Ga0500609_027406 | 3300053731 | Bacteria | 781 |
| 1596 | Ga0500596_015532 | 3300053735 | Bacteria | 1143 |
| 1597 | Ga0500587_000428 | 3300053739 | Bacteria | 4934 |
| 1598 | Ga0501084_0007550 | 3300054114 | Bacteria | 8968 |
| 1599 | Ga0501084_0018918 | 3300054114 | Bacteria | 5734 |
| 1600 | Ga0501084_0074772 | 3300054114 | Bacteria | 2838 |
| 1601 | Ga0501084_0144096 | 3300054114 | Bacteria | 2006 |
| 1602 | Ga0501084_0189154 | 3300054114 | Bacteria | 1737 |
| 1603 | Ga0501084_0724310 | 3300054114 | Bacteria | 838 |
| 1604 | Ga0500661_008047 | 3300055283 | Bacteria | 1942 |
| 1605 | Ga0590075_003951 | 3300059424 | Bacteria | 3512 |
| 1606 | Ga0501082_0032387 | 3300060353 | Bacteria | 4508 |
| 1607 | Ga0501082_0060048 | 3300060353 | Bacteria | 3275 |
| 1608 | Ga0501082_0062878 | 3300060353 | Bacteria | 3196 |
| 1609 | Ga0501082_0097519 | 3300060353 | Bacteria | 2541 |
| 1610 | Ga0501082_0108271 | 3300060353 | Bacteria | 2405 |
| 1611 | Ga0501082_0403043 | 3300060353 | Bacteria | 1194 |
| 1612 | Ga0501082_0538073 | 3300060353 | Bacteria | 1021 |
| 1613 | Ga0530510_0000093 | 3300061734 | Bacteria | 48352 |
| 1614 | Ga0530510_0013400 | 3300061734 | Bacteria | 5765 |
| 1615 | Ga0530510_0040966 | 3300061734 | Bacteria | 3344 |
| 1616 | Ga0530510_0047637 | 3300061734 | Bacteria | 3097 |
| 1617 | Ga0530510_0182661 | 3300061734 | Bacteria | 1555 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046477 | Ga0495664_0010170 | Ga0495664_0010170_3817_4548 | 243 |
| 2 | 3300005334 | Ga0068869_100045381 | Ga0068869_1000453815 | 244 |
| 3 | 3300005436 | Ga0070713_100399502 | Ga0070713_1003995022 | 244 |
| 4 | 3300013297 | Ga0157378_10792357 | Ga0157378_107923571 | 244 |
| 5 | 3300025924 | Ga0207694_10383931 | Ga0207694_103839312 | 244 |
| 6 | 3300002987 | JGI25159J45721_1000012 | JGI25159J45721_100001271 | 245 |
| 7 | 3300003187 | JGI25151J46595_10005842 | JGI25151J46595_100058424 | 245 |
| 8 | 3300003354 | JGI25160J50197_1000042 | JGI25160J50197_100004282 | 245 |
| 9 | 3300003374 | JGI25161J50226_1000254 | JGI25161J50226_100025425 | 245 |
| 10 | 3300003771 | Ga0055526_1003780 | Ga0055526_10037804 | 245 |
| 11 | 3300003781 | Ga0055536_1007787 | Ga0055536_10077876 | 245 |
| 12 | 3300003791 | Ga0055530_10023412 | Ga0055530_100234122 | 245 |
| 13 | 3300003794 | Ga0055531_10020004 | Ga0055531_100200042 | 245 |
| 14 | 3300004625 | Ga0055543_1000452 | Ga0055543_100045213 | 245 |
| 15 | 3300005262 | Ga0065165_1000174 | Ga0065165_100017471 | 245 |
| 16 | 3300015690 | Ga0183363_1026 | Ga0183363_102644 | 245 |
| 17 | 3300025208 | Ga0209436_100252 | Ga0209436_10025216 | 245 |
| 18 | 3300025284 | Ga0209130_1000075 | Ga0209130_100007584 | 245 |
| 19 | 3300025292 | Ga0209676_1002745 | Ga0209676_10027452 | 245 |
| 20 | 3300025294 | Ga0209025_1000747 | Ga0209025_100074726 | 245 |
| 21 | 3300025295 | Ga0209564_1000278 | Ga0209564_100027818 | 245 |
| 22 | 3300025299 | Ga0209256_1000411 | Ga0209256_100041154 | 245 |
| 23 | 3300025302 | Ga0207426_1000163 | Ga0207426_100016384 | 245 |
| 24 | 3300025303 | Ga0209051_1018933 | Ga0209051_10189332 | 245 |
| 25 | 3300028794 | Ga0307515_10000026 | Ga0307515_10000026124 | 245 |
| 26 | 3300046517 | Ga0495630_0009681 | Ga0495630_0009681_3660_4397 | 245 |
| 27 | 3300046533 | Ga0495640_0030810 | Ga0495640_0030810_672_1409 | 245 |
| 28 | 3300046683 | Ga0495658_0086519 | Ga0495658_0086519_488_1225 | 245 |
| 29 | 3300047319 | Ga0495674_0019590 | Ga0495674_0019590_461_1198 | 245 |
| 30 | 3300049575 | Ga0501039_0417542 | Ga0501039_0417542_217_954 | 245 |
| 31 | 3300001979 | JGI24740J21852_10040824 | JGI24740J21852_100408243 | 246 |
| 32 | 3300002739 | JGI25158J39367_1000548 | JGI25158J39367_10005482 | 246 |
| 33 | 3300002741 | JGI25157J39369_1001276 | JGI25157J39369_10012769 | 246 |
| 34 | 3300002773 | JGI25152J39213_1005130 | JGI25152J39213_10051304 | 246 |
| 35 | 3300002773 | JGI25152J39213_1006776 | JGI25152J39213_10067762 | 246 |
| 36 | 3300002774 | JGI25150J39212_1007959 | JGI25150J39212_10079591 | 246 |
| 37 | 3300002987 | JGI25159J45721_1001972 | JGI25159J45721_10019726 | 246 |
| 38 | 3300003203 | JGI25406J46586_10005327 | JGI25406J46586_100053275 | 246 |
| 39 | 3300003214 | JGI25165J46597_1000015 | JGI25165J46597_1000015243 | 246 |
| 40 | 3300003214 | JGI25165J46597_1002828 | JGI25165J46597_10028283 | 246 |
| 41 | 3300003215 | JGI25153J46596_10000033 | JGI25153J46596_1000003326 | 246 |
| 42 | 3300003215 | JGI25153J46596_10000047 | JGI25153J46596_10000047106 | 246 |
| 43 | 3300003215 | JGI25153J46596_10024486 | JGI25153J46596_100244862 | 246 |
| 44 | 3300003320 | rootH2_10079132 | rootH2_100791328 | 246 |
| 45 | 3300003354 | JGI25160J50197_1000068 | JGI25160J50197_100006832 | 246 |
| 46 | 3300003354 | JGI25160J50197_1006678 | JGI25160J50197_10066783 | 246 |
| 47 | 3300003374 | JGI25161J50226_1000048 | JGI25161J50226_100004832 | 246 |
| 48 | 3300003374 | JGI25161J50226_1002172 | JGI25161J50226_10021725 | 246 |
| 49 | 3300003762 | Ga0055542_1000406 | Ga0055542_100040626 | 246 |
| 50 | 3300003771 | Ga0055526_1003068 | Ga0055526_10030686 | 246 |
| 51 | 3300003771 | Ga0055526_1005774 | Ga0055526_10057744 | 246 |
| 52 | 3300003775 | Ga0055524_1022164 | Ga0055524_10221642 | 246 |
| 53 | 3300003781 | Ga0055536_1009742 | Ga0055536_10097422 | 246 |
| 54 | 3300003784 | Ga0055534_1002995 | Ga0055534_10029953 | 246 |
| 55 | 3300003790 | Ga0055528_1000081 | Ga0055528_100008128 | 246 |
| 56 | 3300003790 | Ga0055528_1002961 | Ga0055528_10029611 | 246 |
| 57 | 3300003790 | Ga0055528_1010205 | Ga0055528_10102052 | 246 |
| 58 | 3300003792 | Ga0055540_1005863 | Ga0055540_10058635 | 246 |
| 59 | 3300003792 | Ga0055540_1007063 | Ga0055540_10070634 | 246 |
| 60 | 3300003794 | Ga0055531_10000775 | Ga0055531_1000077518 | 246 |
| 61 | 3300004625 | Ga0055543_1000031 | Ga0055543_1000031121 | 246 |
| 62 | 3300004625 | Ga0055543_1000046 | Ga0055543_100004673 | 246 |
| 63 | 3300005262 | Ga0065165_1000175 | Ga0065165_100017532 | 246 |
| 64 | 3300005262 | Ga0065165_1016574 | Ga0065165_10165743 | 246 |
| 65 | 3300005289 | Ga0065704_10243647 | Ga0065704_102436471 | 246 |
| 66 | 3300005290 | Ga0065712_10084375 | Ga0065712_100843752 | 246 |
| 67 | 3300005293 | Ga0065715_10005719 | Ga0065715_100057192 | 246 |
| 68 | 3300005327 | Ga0070658_10072794 | Ga0070658_100727942 | 246 |
| 69 | 3300005327 | Ga0070658_10121171 | Ga0070658_101211712 | 246 |
| 70 | 3300005328 | Ga0070676_10001690 | Ga0070676_100016906 | 246 |
| 71 | 3300005328 | Ga0070676_10032420 | Ga0070676_100324203 | 246 |
| 72 | 3300005330 | Ga0070690_100000104 | Ga0070690_10000010436 | 246 |
| 73 | 3300005330 | Ga0070690_100006691 | Ga0070690_1000066913 | 246 |
| 74 | 3300005330 | Ga0070690_100093173 | Ga0070690_1000931731 | 246 |
| 75 | 3300005330 | Ga0070690_100115124 | Ga0070690_1001151243 | 246 |
| 76 | 3300005331 | Ga0070670_100234182 | Ga0070670_1002341822 | 246 |
| 77 | 3300005333 | Ga0070677_10006920 | Ga0070677_100069204 | 246 |
| 78 | 3300005333 | Ga0070677_10087821 | Ga0070677_100878212 | 246 |
| 79 | 3300005334 | Ga0068869_100006830 | Ga0068869_1000068305 | 246 |
| 80 | 3300005334 | Ga0068869_100010468 | Ga0068869_1000104685 | 246 |
| 81 | 3300005334 | Ga0068869_100013291 | Ga0068869_1000132915 | 246 |
| 82 | 3300005334 | Ga0068869_100037678 | Ga0068869_1000376784 | 246 |
| 83 | 3300005334 | Ga0068869_100195193 | Ga0068869_1001951932 | 246 |
| 84 | 3300005335 | Ga0070666_10003654 | Ga0070666_100036548 | 246 |
| 85 | 3300005335 | Ga0070666_10266559 | Ga0070666_102665592 | 246 |
| 86 | 3300005335 | Ga0070666_10374691 | Ga0070666_103746911 | 246 |
| 87 | 3300005336 | Ga0070680_100106467 | Ga0070680_1001064672 | 246 |
| 88 | 3300005336 | Ga0070680_100140641 | Ga0070680_1001406411 | 246 |
| 89 | 3300005338 | Ga0068868_100001028 | Ga0068868_1000010289 | 246 |
| 90 | 3300005338 | Ga0068868_100002870 | Ga0068868_1000028704 | 246 |
| 91 | 3300005338 | Ga0068868_100020673 | Ga0068868_1000206735 | 246 |
| 92 | 3300005338 | Ga0068868_100028159 | Ga0068868_1000281594 | 246 |
| 93 | 3300005338 | Ga0068868_100101056 | Ga0068868_1001010561 | 246 |
| 94 | 3300005339 | Ga0070660_100021992 | Ga0070660_1000219923 | 246 |
| 95 | 3300005339 | Ga0070660_100027337 | Ga0070660_1000273374 | 246 |
| 96 | 3300005339 | Ga0070660_100160073 | Ga0070660_1001600731 | 246 |
| 97 | 3300005340 | Ga0070689_100002051 | Ga0070689_10000205113 | 246 |
| 98 | 3300005340 | Ga0070689_100039569 | Ga0070689_1000395693 | 246 |
| 99 | 3300005340 | Ga0070689_100262363 | Ga0070689_1002623631 | 246 |
| 100 | 3300005341 | Ga0070691_10032040 | Ga0070691_100320403 | 246 |
| 101 | 3300005343 | Ga0070687_100375729 | Ga0070687_1003757291 | 246 |
| 102 | 3300005344 | Ga0070661_100003782 | Ga0070661_1000037825 | 246 |
| 103 | 3300005344 | Ga0070661_100135355 | Ga0070661_1001353552 | 246 |
| 104 | 3300005347 | Ga0070668_100004957 | Ga0070668_1000049578 | 246 |
| 105 | 3300005347 | Ga0070668_100021056 | Ga0070668_1000210565 | 246 |
| 106 | 3300005347 | Ga0070668_100060860 | Ga0070668_1000608602 | 246 |
| 107 | 3300005347 | Ga0070668_100423111 | Ga0070668_1004231112 | 246 |
| 108 | 3300005353 | Ga0070669_100007652 | Ga0070669_1000076523 | 246 |
| 109 | 3300005353 | Ga0070669_100047893 | Ga0070669_1000478935 | 246 |
| 110 | 3300005353 | Ga0070669_100058280 | Ga0070669_1000582804 | 246 |
| 111 | 3300005353 | Ga0070669_100107389 | Ga0070669_1001073892 | 246 |
| 112 | 3300005353 | Ga0070669_100124903 | Ga0070669_1001249032 | 246 |
| 113 | 3300005353 | Ga0070669_100232146 | Ga0070669_1002321462 | 246 |
| 114 | 3300005354 | Ga0070675_100002408 | Ga0070675_1000024087 | 246 |
| 115 | 3300005354 | Ga0070675_100011906 | Ga0070675_1000119068 | 246 |
| 116 | 3300005354 | Ga0070675_100174674 | Ga0070675_1001746742 | 246 |
| 117 | 3300005355 | Ga0070671_100009046 | Ga0070671_1000090463 | 246 |
| 118 | 3300005355 | Ga0070671_100012205 | Ga0070671_1000122059 | 246 |
| 119 | 3300005355 | Ga0070671_100022921 | Ga0070671_1000229214 | 246 |
| 120 | 3300005355 | Ga0070671_100050547 | Ga0070671_1000505474 | 246 |
| 121 | 3300005355 | Ga0070671_100420339 | Ga0070671_1004203392 | 246 |
| 122 | 3300005356 | Ga0070674_100014204 | Ga0070674_1000142044 | 246 |
| 123 | 3300005356 | Ga0070674_100017014 | Ga0070674_1000170144 | 246 |
| 124 | 3300005356 | Ga0070674_100018973 | Ga0070674_1000189735 | 246 |
| 125 | 3300005356 | Ga0070674_100060883 | Ga0070674_1000608832 | 246 |
| 126 | 3300005356 | Ga0070674_100283065 | Ga0070674_1002830651 | 246 |
| 127 | 3300005356 | Ga0070674_100326663 | Ga0070674_1003266632 | 246 |
| 128 | 3300005356 | Ga0070674_100353166 | Ga0070674_1003531662 | 246 |
| 129 | 3300005356 | Ga0070674_100422101 | Ga0070674_1004221011 | 246 |
| 130 | 3300005364 | Ga0070673_100008458 | Ga0070673_1000084588 | 246 |
| 131 | 3300005364 | Ga0070673_100028973 | Ga0070673_1000289732 | 246 |
| 132 | 3300005364 | Ga0070673_100338482 | Ga0070673_1003384822 | 246 |
| 133 | 3300005365 | Ga0070688_100160781 | Ga0070688_1001607812 | 246 |
| 134 | 3300005365 | Ga0070688_100422618 | Ga0070688_1004226182 | 246 |
| 135 | 3300005366 | Ga0070659_100040241 | Ga0070659_1000402413 | 246 |
| 136 | 3300005366 | Ga0070659_100056900 | Ga0070659_1000569002 | 246 |
| 137 | 3300005366 | Ga0070659_100181776 | Ga0070659_1001817761 | 246 |
| 138 | 3300005366 | Ga0070659_100573082 | Ga0070659_1005730822 | 246 |
| 139 | 3300005367 | Ga0070667_100010392 | Ga0070667_1000103922 | 246 |
| 140 | 3300005367 | Ga0070667_100040888 | Ga0070667_1000408883 | 246 |
| 141 | 3300005367 | Ga0070667_100136027 | Ga0070667_1001360272 | 246 |
| 142 | 3300005367 | Ga0070667_100429243 | Ga0070667_1004292432 | 246 |
| 143 | 3300005434 | Ga0070709_10012841 | Ga0070709_100128413 | 246 |
| 144 | 3300005435 | Ga0070714_100005358 | Ga0070714_1000053587 | 246 |
| 145 | 3300005436 | Ga0070713_100100618 | Ga0070713_1001006182 | 246 |
| 146 | 3300005437 | Ga0070710_10001811 | Ga0070710_100018117 | 246 |
| 147 | 3300005438 | Ga0070701_10000723 | Ga0070701_1000072315 | 246 |
| 148 | 3300005439 | Ga0070711_100000775 | Ga0070711_1000007753 | 246 |
| 149 | 3300005439 | Ga0070711_100215371 | Ga0070711_1002153712 | 246 |
| 150 | 3300005441 | Ga0070700_100043222 | Ga0070700_1000432221 | 246 |
| 151 | 3300005441 | Ga0070700_100453120 | Ga0070700_1004531201 | 246 |
| 152 | 3300005444 | Ga0070694_100049626 | Ga0070694_1000496263 | 246 |
| 153 | 3300005455 | Ga0070663_100256134 | Ga0070663_1002561342 | 246 |
| 154 | 3300005455 | Ga0070663_100299082 | Ga0070663_1002990822 | 246 |
| 155 | 3300005455 | Ga0070663_100416249 | Ga0070663_1004162491 | 246 |
| 156 | 3300005456 | Ga0070678_100003442 | Ga0070678_1000034425 | 246 |
| 157 | 3300005456 | Ga0070678_100030637 | Ga0070678_1000306374 | 246 |
| 158 | 3300005456 | Ga0070678_100032986 | Ga0070678_1000329864 | 246 |
| 159 | 3300005456 | Ga0070678_100036530 | Ga0070678_1000365303 | 246 |
| 160 | 3300005456 | Ga0070678_100124938 | Ga0070678_1001249382 | 246 |
| 161 | 3300005457 | Ga0070662_100072730 | Ga0070662_1000727302 | 246 |
| 162 | 3300005457 | Ga0070662_100124422 | Ga0070662_1001244222 | 246 |
| 163 | 3300005457 | Ga0070662_100128016 | Ga0070662_1001280162 | 246 |
| 164 | 3300005458 | Ga0070681_10673650 | Ga0070681_106736501 | 246 |
| 165 | 3300005459 | Ga0068867_100000091 | Ga0068867_10000009119 | 246 |
| 166 | 3300005459 | Ga0068867_100010378 | Ga0068867_1000103781 | 246 |
| 167 | 3300005459 | Ga0068867_100035822 | Ga0068867_1000358222 | 246 |
| 168 | 3300005459 | Ga0068867_100039441 | Ga0068867_1000394412 | 246 |
| 169 | 3300005459 | Ga0068867_100040970 | Ga0068867_1000409704 | 246 |
| 170 | 3300005459 | Ga0068867_100056274 | Ga0068867_1000562742 | 246 |
| 171 | 3300005459 | Ga0068867_100104180 | Ga0068867_1001041801 | 246 |
| 172 | 3300005459 | Ga0068867_100213062 | Ga0068867_1002130622 | 246 |
| 173 | 3300005466 | Ga0070685_10147600 | Ga0070685_101476001 | 246 |
| 174 | 3300005466 | Ga0070685_10356336 | Ga0070685_103563361 | 246 |
| 175 | 3300005467 | Ga0070706_100154516 | Ga0070706_1001545163 | 246 |
| 176 | 3300005467 | Ga0070706_100239790 | Ga0070706_1002397902 | 246 |
| 177 | 3300005468 | Ga0070707_100251578 | Ga0070707_1002515782 | 246 |
| 178 | 3300005530 | Ga0070679_100515053 | Ga0070679_1005150531 | 246 |
| 179 | 3300005535 | Ga0070684_100214762 | Ga0070684_1002147622 | 246 |
| 180 | 3300005539 | Ga0068853_100000533 | Ga0068853_1000005336 | 246 |
| 181 | 3300005539 | Ga0068853_100008721 | Ga0068853_1000087216 | 246 |
| 182 | 3300005539 | Ga0068853_100062492 | Ga0068853_1000624923 | 246 |
| 183 | 3300005539 | Ga0068853_100392547 | Ga0068853_1003925471 | 246 |
| 184 | 3300005543 | Ga0070672_100004518 | Ga0070672_1000045186 | 246 |
| 185 | 3300005543 | Ga0070672_100006066 | Ga0070672_1000060662 | 246 |
| 186 | 3300005543 | Ga0070672_100091402 | Ga0070672_1000914023 | 246 |
| 187 | 3300005543 | Ga0070672_100133529 | Ga0070672_1001335292 | 246 |
| 188 | 3300005543 | Ga0070672_100194448 | Ga0070672_1001944482 | 246 |
| 189 | 3300005544 | Ga0070686_100001185 | Ga0070686_10000118513 | 246 |
| 190 | 3300005545 | Ga0070695_100012848 | Ga0070695_1000128484 | 246 |
| 191 | 3300005545 | Ga0070695_100567310 | Ga0070695_1005673101 | 246 |
| 192 | 3300005546 | Ga0070696_100003912 | Ga0070696_1000039124 | 246 |
| 193 | 3300005548 | Ga0070665_100011966 | Ga0070665_1000119665 | 246 |
| 194 | 3300005548 | Ga0070665_100021983 | Ga0070665_1000219833 | 246 |
| 195 | 3300005548 | Ga0070665_100026315 | Ga0070665_1000263153 | 246 |
| 196 | 3300005548 | Ga0070665_100228629 | Ga0070665_1002286291 | 246 |
| 197 | 3300005548 | Ga0070665_100284493 | Ga0070665_1002844932 | 246 |
| 198 | 3300005548 | Ga0070665_100408231 | Ga0070665_1004082311 | 246 |
| 199 | 3300005548 | Ga0070665_100834977 | Ga0070665_1008349771 | 246 |
| 200 | 3300005549 | Ga0070704_100130432 | Ga0070704_1001304322 | 246 |
| 201 | 3300005563 | Ga0068855_100059452 | Ga0068855_1000594522 | 246 |
| 202 | 3300005563 | Ga0068855_100138782 | Ga0068855_1001387821 | 246 |
| 203 | 3300005564 | Ga0070664_100035788 | Ga0070664_1000357884 | 246 |
| 204 | 3300005577 | Ga0068857_100007296 | Ga0068857_10000729610 | 246 |
| 205 | 3300005577 | Ga0068857_100049797 | Ga0068857_1000497973 | 246 |
| 206 | 3300005578 | Ga0068854_100006614 | Ga0068854_1000066142 | 246 |
| 207 | 3300005578 | Ga0068854_100111128 | Ga0068854_1001111282 | 246 |
| 208 | 3300005578 | Ga0068854_100367257 | Ga0068854_1003672572 | 246 |
| 209 | 3300005578 | Ga0068854_100448352 | Ga0068854_1004483522 | 246 |
| 210 | 3300005614 | Ga0068856_100030869 | Ga0068856_1000308693 | 246 |
| 211 | 3300005614 | Ga0068856_100105689 | Ga0068856_1001056894 | 246 |
| 212 | 3300005614 | Ga0068856_100170805 | Ga0068856_1001708051 | 246 |
| 213 | 3300005614 | Ga0068856_100209837 | Ga0068856_1002098372 | 246 |
| 214 | 3300005614 | Ga0068856_100252995 | Ga0068856_1002529952 | 246 |
| 215 | 3300005614 | Ga0068856_100320316 | Ga0068856_1003203162 | 246 |
| 216 | 3300005614 | Ga0068856_100528222 | Ga0068856_1005282221 | 246 |
| 217 | 3300005615 | Ga0070702_100000465 | Ga0070702_1000004655 | 246 |
| 218 | 3300005615 | Ga0070702_100181716 | Ga0070702_1001817161 | 246 |
| 219 | 3300005615 | Ga0070702_100187663 | Ga0070702_1001876632 | 246 |
| 220 | 3300005616 | Ga0068852_100004682 | Ga0068852_1000046824 | 246 |
| 221 | 3300005616 | Ga0068852_100018895 | Ga0068852_1000188956 | 246 |
| 222 | 3300005616 | Ga0068852_100038314 | Ga0068852_1000383142 | 246 |
| 223 | 3300005616 | Ga0068852_100518076 | Ga0068852_1005180762 | 246 |
| 224 | 3300005616 | Ga0068852_100523866 | Ga0068852_1005238662 | 246 |
| 225 | 3300005616 | Ga0068852_100898063 | Ga0068852_1008980631 | 246 |
| 226 | 3300005617 | Ga0068859_100004139 | Ga0068859_1000041398 | 246 |
| 227 | 3300005617 | Ga0068859_100024768 | Ga0068859_1000247685 | 246 |
| 228 | 3300005617 | Ga0068859_100066366 | Ga0068859_1000663662 | 246 |
| 229 | 3300005617 | Ga0068859_100258096 | Ga0068859_1002580962 | 246 |
| 230 | 3300005617 | Ga0068859_100281564 | Ga0068859_1002815642 | 246 |
| 231 | 3300005617 | Ga0068859_100407028 | Ga0068859_1004070282 | 246 |
| 232 | 3300005618 | Ga0068864_100017958 | Ga0068864_1000179585 | 246 |
| 233 | 3300005618 | Ga0068864_100124212 | Ga0068864_1001242122 | 246 |
| 234 | 3300005618 | Ga0068864_100180333 | Ga0068864_1001803332 | 246 |
| 235 | 3300005618 | Ga0068864_100270219 | Ga0068864_1002702192 | 246 |
| 236 | 3300005618 | Ga0068864_100350494 | Ga0068864_1003504942 | 246 |
| 237 | 3300005718 | Ga0068866_10002429 | Ga0068866_100024297 | 246 |
| 238 | 3300005718 | Ga0068866_10042055 | Ga0068866_100420553 | 246 |
| 239 | 3300005718 | Ga0068866_10052992 | Ga0068866_100529923 | 246 |
| 240 | 3300005718 | Ga0068866_10105319 | Ga0068866_101053192 | 246 |
| 241 | 3300005719 | Ga0068861_100002134 | Ga0068861_1000021344 | 246 |
| 242 | 3300005719 | Ga0068861_100004235 | Ga0068861_1000042355 | 246 |
| 243 | 3300005719 | Ga0068861_100015953 | Ga0068861_1000159532 | 246 |
| 244 | 3300005719 | Ga0068861_100067724 | Ga0068861_1000677243 | 246 |
| 245 | 3300005719 | Ga0068861_100077139 | Ga0068861_1000771392 | 246 |
| 246 | 3300005719 | Ga0068861_100188954 | Ga0068861_1001889542 | 246 |
| 247 | 3300005719 | Ga0068861_100413072 | Ga0068861_1004130722 | 246 |
| 248 | 3300005834 | Ga0068851_10158537 | Ga0068851_101585372 | 246 |
| 249 | 3300005840 | Ga0068870_10121037 | Ga0068870_101210372 | 246 |
| 250 | 3300005840 | Ga0068870_10170422 | Ga0068870_101704221 | 246 |
| 251 | 3300005841 | Ga0068863_100057708 | Ga0068863_1000577084 | 246 |
| 252 | 3300005841 | Ga0068863_100156268 | Ga0068863_1001562682 | 246 |
| 253 | 3300005841 | Ga0068863_100192197 | Ga0068863_1001921971 | 246 |
| 254 | 3300005841 | Ga0068863_100218540 | Ga0068863_1002185402 | 246 |
| 255 | 3300005842 | Ga0068858_100000679 | Ga0068858_10000067927 | 246 |
| 256 | 3300005842 | Ga0068858_100000774 | Ga0068858_1000007747 | 246 |
| 257 | 3300005842 | Ga0068858_100039707 | Ga0068858_1000397072 | 246 |
| 258 | 3300005842 | Ga0068858_100062433 | Ga0068858_1000624333 | 246 |
| 259 | 3300005842 | Ga0068858_100113932 | Ga0068858_1001139323 | 246 |
| 260 | 3300005842 | Ga0068858_100208795 | Ga0068858_1002087952 | 246 |
| 261 | 3300005842 | Ga0068858_100257248 | Ga0068858_1002572482 | 246 |
| 262 | 3300005842 | Ga0068858_100294160 | Ga0068858_1002941602 | 246 |
| 263 | 3300005843 | Ga0068860_100005264 | Ga0068860_1000052648 | 246 |
| 264 | 3300005843 | Ga0068860_100021326 | Ga0068860_1000213265 | 246 |
| 265 | 3300005843 | Ga0068860_100114065 | Ga0068860_1001140652 | 246 |
| 266 | 3300005843 | Ga0068860_100398874 | Ga0068860_1003988742 | 246 |
| 267 | 3300005843 | Ga0068860_100473424 | Ga0068860_1004734242 | 246 |
| 268 | 3300005844 | Ga0068862_100004858 | Ga0068862_1000048585 | 246 |
| 269 | 3300005844 | Ga0068862_100037860 | Ga0068862_1000378602 | 246 |
| 270 | 3300005844 | Ga0068862_100039976 | Ga0068862_1000399763 | 246 |
| 271 | 3300005844 | Ga0068862_100053778 | Ga0068862_1000537782 | 246 |
| 272 | 3300005844 | Ga0068862_100155416 | Ga0068862_1001554162 | 246 |
| 273 | 3300005844 | Ga0068862_100204281 | Ga0068862_1002042812 | 246 |
| 274 | 3300005844 | Ga0068862_100470055 | Ga0068862_1004700552 | 246 |
| 275 | 3300005844 | Ga0068862_100644166 | Ga0068862_1006441661 | 246 |
| 276 | 3300005937 | Ga0081455_10033573 | Ga0081455_100335735 | 246 |
| 277 | 3300005981 | Ga0081538_10037477 | Ga0081538_100374773 | 246 |
| 278 | 3300005983 | Ga0081540_1007796 | Ga0081540_10077964 | 246 |
| 279 | 3300005983 | Ga0081540_1018556 | Ga0081540_10185563 | 246 |
| 280 | 3300005983 | Ga0081540_1028680 | Ga0081540_10286802 | 246 |
| 281 | 3300005983 | Ga0081540_1034711 | Ga0081540_10347113 | 246 |
| 282 | 3300005985 | Ga0081539_10001065 | Ga0081539_1000106544 | 246 |
| 283 | 3300005985 | Ga0081539_10002462 | Ga0081539_1000246220 | 246 |
| 284 | 3300006028 | Ga0070717_10049598 | Ga0070717_100495982 | 246 |
| 285 | 3300006028 | Ga0070717_10060157 | Ga0070717_100601572 | 246 |
| 286 | 3300006028 | Ga0070717_10174840 | Ga0070717_101748402 | 246 |
| 287 | 3300006028 | Ga0070717_10521222 | Ga0070717_105212222 | 246 |
| 288 | 3300006038 | Ga0075365_10001077 | Ga0075365_100010775 | 246 |
| 289 | 3300006038 | Ga0075365_10005631 | Ga0075365_100056312 | 246 |
| 290 | 3300006038 | Ga0075365_10015495 | Ga0075365_100154953 | 246 |
| 291 | 3300006038 | Ga0075365_10028179 | Ga0075365_100281792 | 246 |
| 292 | 3300006038 | Ga0075365_10033264 | Ga0075365_100332643 | 246 |
| 293 | 3300006038 | Ga0075365_10051810 | Ga0075365_100518102 | 246 |
| 294 | 3300006038 | Ga0075365_10057918 | Ga0075365_100579182 | 246 |
| 295 | 3300006038 | Ga0075365_10077386 | Ga0075365_100773862 | 246 |
| 296 | 3300006038 | Ga0075365_10086523 | Ga0075365_100865232 | 246 |
| 297 | 3300006038 | Ga0075365_10162450 | Ga0075365_101624501 | 246 |
| 298 | 3300006038 | Ga0075365_10187535 | Ga0075365_101875352 | 246 |
| 299 | 3300006042 | Ga0075368_10000497 | Ga0075368_100004978 | 246 |
| 300 | 3300006048 | Ga0075363_100019120 | Ga0075363_1000191202 | 246 |
| 301 | 3300006048 | Ga0075363_100034775 | Ga0075363_1000347752 | 246 |
| 302 | 3300006051 | Ga0075364_10043362 | Ga0075364_100433622 | 246 |
| 303 | 3300006051 | Ga0075364_10053411 | Ga0075364_100534113 | 246 |
| 304 | 3300006051 | Ga0075364_10093419 | Ga0075364_100934192 | 246 |
| 305 | 3300006051 | Ga0075364_10126716 | Ga0075364_101267162 | 246 |
| 306 | 3300006051 | Ga0075364_10145322 | Ga0075364_101453222 | 246 |
| 307 | 3300006058 | Ga0075432_10161255 | Ga0075432_101612551 | 246 |
| 308 | 3300006163 | Ga0070715_10052960 | Ga0070715_100529602 | 246 |
| 309 | 3300006173 | Ga0070716_100002789 | Ga0070716_1000027897 | 246 |
| 310 | 3300006173 | Ga0070716_100060583 | Ga0070716_1000605833 | 246 |
| 311 | 3300006177 | Ga0075362_10015521 | Ga0075362_100155213 | 246 |
| 312 | 3300006177 | Ga0075362_10076585 | Ga0075362_100765852 | 246 |
| 313 | 3300006178 | Ga0075367_10005545 | Ga0075367_100055454 | 246 |
| 314 | 3300006178 | Ga0075367_10029428 | Ga0075367_100294283 | 246 |
| 315 | 3300006178 | Ga0075367_10102443 | Ga0075367_101024432 | 246 |
| 316 | 3300006178 | Ga0075367_10241541 | Ga0075367_102415412 | 246 |
| 317 | 3300006186 | Ga0075369_10000668 | Ga0075369_100006686 | 246 |
| 318 | 3300006186 | Ga0075369_10003981 | Ga0075369_100039816 | 246 |
| 319 | 3300006186 | Ga0075369_10007492 | Ga0075369_100074926 | 246 |
| 320 | 3300006186 | Ga0075369_10100272 | Ga0075369_101002722 | 246 |
| 321 | 3300006186 | Ga0075369_10123852 | Ga0075369_101238522 | 246 |
| 322 | 3300006195 | Ga0075366_10001925 | Ga0075366_100019254 | 246 |
| 323 | 3300006195 | Ga0075366_10032269 | Ga0075366_100322692 | 246 |
| 324 | 3300006195 | Ga0075366_10083112 | Ga0075366_100831122 | 246 |
| 325 | 3300006195 | Ga0075366_10155636 | Ga0075366_101556362 | 246 |
| 326 | 3300006195 | Ga0075366_10207258 | Ga0075366_102072582 | 246 |
| 327 | 3300006237 | Ga0097621_100014601 | Ga0097621_1000146015 | 246 |
| 328 | 3300006237 | Ga0097621_100023403 | Ga0097621_1000234033 | 246 |
| 329 | 3300006237 | Ga0097621_100027531 | Ga0097621_1000275317 | 246 |
| 330 | 3300006237 | Ga0097621_100141217 | Ga0097621_1001412172 | 246 |
| 331 | 3300006237 | Ga0097621_100182239 | Ga0097621_1001822392 | 246 |
| 332 | 3300006237 | Ga0097621_100585443 | Ga0097621_1005854432 | 246 |
| 333 | 3300006353 | Ga0075370_10003750 | Ga0075370_100037504 | 246 |
| 334 | 3300006353 | Ga0075370_10012857 | Ga0075370_100128572 | 246 |
| 335 | 3300006353 | Ga0075370_10014816 | Ga0075370_100148164 | 246 |
| 336 | 3300006353 | Ga0075370_10076779 | Ga0075370_100767792 | 246 |
| 337 | 3300006358 | Ga0068871_100072151 | Ga0068871_1000721513 | 246 |
| 338 | 3300006358 | Ga0068871_100117432 | Ga0068871_1001174322 | 246 |
| 339 | 3300006844 | Ga0075428_100297821 | Ga0075428_1002978212 | 246 |
| 340 | 3300006844 | Ga0075428_100385730 | Ga0075428_1003857302 | 246 |
| 341 | 3300006846 | Ga0075430_100056046 | Ga0075430_1000560463 | 246 |
| 342 | 3300006846 | Ga0075430_100289627 | Ga0075430_1002896272 | 246 |
| 343 | 3300006847 | Ga0075431_100008686 | Ga0075431_1000086866 | 246 |
| 344 | 3300006847 | Ga0075431_100014607 | Ga0075431_10001460711 | 246 |
| 345 | 3300006847 | Ga0075431_100802983 | Ga0075431_1008029831 | 246 |
| 346 | 3300006852 | Ga0075433_10004359 | Ga0075433_100043599 | 246 |
| 347 | 3300006852 | Ga0075433_10111317 | Ga0075433_101113173 | 246 |
| 348 | 3300006852 | Ga0075433_10246146 | Ga0075433_102461462 | 246 |
| 349 | 3300006871 | Ga0075434_100001107 | Ga0075434_1000011076 | 246 |
| 350 | 3300006871 | Ga0075434_100080113 | Ga0075434_1000801133 | 246 |
| 351 | 3300006871 | Ga0075434_100716813 | Ga0075434_1007168132 | 246 |
| 352 | 3300006880 | Ga0075429_100162181 | Ga0075429_1001621812 | 246 |
| 353 | 3300006880 | Ga0075429_100315527 | Ga0075429_1003155272 | 246 |
| 354 | 3300006881 | Ga0068865_100002181 | Ga0068865_1000021815 | 246 |
| 355 | 3300006881 | Ga0068865_100005350 | Ga0068865_1000053506 | 246 |
| 356 | 3300006881 | Ga0068865_100006891 | Ga0068865_1000068918 | 246 |
| 357 | 3300006881 | Ga0068865_100043120 | Ga0068865_1000431202 | 246 |
| 358 | 3300006881 | Ga0068865_100057693 | Ga0068865_1000576932 | 246 |
| 359 | 3300006931 | Ga0097620_100004139 | Ga0097620_1000041398 | 246 |
| 360 | 3300006931 | Ga0097620_100024768 | Ga0097620_1000247682 | 246 |
| 361 | 3300006931 | Ga0097620_100066364 | Ga0097620_1000663642 | 246 |
| 362 | 3300006931 | Ga0097620_100239842 | Ga0097620_1002398422 | 246 |
| 363 | 3300006931 | Ga0097620_100258095 | Ga0097620_1002580952 | 246 |
| 364 | 3300006931 | Ga0097620_100281543 | Ga0097620_1002815432 | 246 |
| 365 | 3300006931 | Ga0097620_100407008 | Ga0097620_1004070082 | 246 |
| 366 | 3300007076 | Ga0075435_100084847 | Ga0075435_1000848472 | 246 |
| 367 | 3300007076 | Ga0075435_100096110 | Ga0075435_1000961102 | 246 |
| 368 | 3300007788 | Ga0099795_10197466 | Ga0099795_101974661 | 246 |
| 369 | 3300009093 | Ga0105240_10030702 | Ga0105240_100307021 | 246 |
| 370 | 3300009093 | Ga0105240_10188585 | Ga0105240_101885853 | 246 |
| 371 | 3300009093 | Ga0105240_10193464 | Ga0105240_101934642 | 246 |
| 372 | 3300009093 | Ga0105240_10317039 | Ga0105240_103170391 | 246 |
| 373 | 3300009093 | Ga0105240_10445115 | Ga0105240_104451152 | 246 |
| 374 | 3300009093 | Ga0105240_10470161 | Ga0105240_104701611 | 246 |
| 375 | 3300009094 | Ga0111539_10000090 | Ga0111539_1000009037 | 246 |
| 376 | 3300009094 | Ga0111539_10095317 | Ga0111539_100953173 | 246 |
| 377 | 3300009094 | Ga0111539_10106388 | Ga0111539_101063881 | 246 |
| 378 | 3300009094 | Ga0111539_10228537 | Ga0111539_102285372 | 246 |
| 379 | 3300009094 | Ga0111539_10594395 | Ga0111539_105943952 | 246 |
| 380 | 3300009094 | Ga0111539_10741676 | Ga0111539_107416762 | 246 |
| 381 | 3300009094 | Ga0111539_11228693 | Ga0111539_112286931 | 246 |
| 382 | 3300009098 | Ga0105245_10008017 | Ga0105245_100080175 | 246 |
| 383 | 3300009098 | Ga0105245_10063580 | Ga0105245_100635804 | 246 |
| 384 | 3300009098 | Ga0105245_10091787 | Ga0105245_100917872 | 246 |
| 385 | 3300009098 | Ga0105245_10413657 | Ga0105245_104136572 | 246 |
| 386 | 3300009098 | Ga0105245_10444206 | Ga0105245_104442061 | 246 |
| 387 | 3300009098 | Ga0105245_10470834 | Ga0105245_104708342 | 246 |
| 388 | 3300009098 | Ga0105245_10577174 | Ga0105245_105771742 | 246 |
| 389 | 3300009101 | Ga0105247_10006831 | Ga0105247_100068315 | 246 |
| 390 | 3300009101 | Ga0105247_10146901 | Ga0105247_101469012 | 246 |
| 391 | 3300009101 | Ga0105247_10398480 | Ga0105247_103984801 | 246 |
| 392 | 3300009147 | Ga0114129_10179262 | Ga0114129_101792621 | 246 |
| 393 | 3300009147 | Ga0114129_10271647 | Ga0114129_102716472 | 246 |
| 394 | 3300009147 | Ga0114129_10286300 | Ga0114129_102863002 | 246 |
| 395 | 3300009148 | Ga0105243_10000959 | Ga0105243_1000095911 | 246 |
| 396 | 3300009148 | Ga0105243_10015761 | Ga0105243_100157613 | 246 |
| 397 | 3300009148 | Ga0105243_10105952 | Ga0105243_101059522 | 246 |
| 398 | 3300009148 | Ga0105243_10155973 | Ga0105243_101559732 | 246 |
| 399 | 3300009148 | Ga0105243_10182807 | Ga0105243_101828072 | 246 |
| 400 | 3300009148 | Ga0105243_10292051 | Ga0105243_102920511 | 246 |
| 401 | 3300009148 | Ga0105243_10616879 | Ga0105243_106168792 | 246 |
| 402 | 3300009174 | Ga0105241_10002442 | Ga0105241_100024428 | 246 |
| 403 | 3300009174 | Ga0105241_10113365 | Ga0105241_101133652 | 246 |
| 404 | 3300009174 | Ga0105241_10292450 | Ga0105241_102924502 | 246 |
| 405 | 3300009176 | Ga0105242_10002489 | Ga0105242_100024898 | 246 |
| 406 | 3300009176 | Ga0105242_10193932 | Ga0105242_101939322 | 246 |
| 407 | 3300009177 | Ga0105248_10000901 | Ga0105248_100009015 | 246 |
| 408 | 3300009177 | Ga0105248_10013900 | Ga0105248_100139006 | 246 |
| 409 | 3300009177 | Ga0105248_10015246 | Ga0105248_100152466 | 246 |
| 410 | 3300009177 | Ga0105248_10019917 | Ga0105248_100199177 | 246 |
| 411 | 3300009177 | Ga0105248_10060349 | Ga0105248_100603494 | 246 |
| 412 | 3300009177 | Ga0105248_10479903 | Ga0105248_104799031 | 246 |
| 413 | 3300009545 | Ga0105237_10000174 | Ga0105237_1000017460 | 246 |
| 414 | 3300009545 | Ga0105237_10009955 | Ga0105237_100099552 | 246 |
| 415 | 3300009545 | Ga0105237_10018733 | Ga0105237_100187334 | 246 |
| 416 | 3300009545 | Ga0105237_10034874 | Ga0105237_100348745 | 246 |
| 417 | 3300009545 | Ga0105237_10035664 | Ga0105237_100356642 | 246 |
| 418 | 3300009545 | Ga0105237_10043232 | Ga0105237_100432323 | 246 |
| 419 | 3300009545 | Ga0105237_10049540 | Ga0105237_100495404 | 246 |
| 420 | 3300009545 | Ga0105237_10186456 | Ga0105237_101864562 | 246 |
| 421 | 3300009545 | Ga0105237_10364295 | Ga0105237_103642952 | 246 |
| 422 | 3300009545 | Ga0105237_10403976 | Ga0105237_104039762 | 246 |
| 423 | 3300009545 | Ga0105237_10673565 | Ga0105237_106735652 | 246 |
| 424 | 3300009551 | Ga0105238_10010957 | Ga0105238_100109575 | 246 |
| 425 | 3300009551 | Ga0105238_10029974 | Ga0105238_100299743 | 246 |
| 426 | 3300009551 | Ga0105238_10033358 | Ga0105238_100333582 | 246 |
| 427 | 3300009551 | Ga0105238_10045923 | Ga0105238_100459235 | 246 |
| 428 | 3300009551 | Ga0105238_10487166 | Ga0105238_104871662 | 246 |
| 429 | 3300009553 | Ga0105249_10049194 | Ga0105249_100491943 | 246 |
| 430 | 3300009553 | Ga0105249_10185849 | Ga0105249_101858492 | 246 |
| 431 | 3300009553 | Ga0105249_10247261 | Ga0105249_102472612 | 246 |
| 432 | 3300009553 | Ga0105249_10400273 | Ga0105249_104002731 | 246 |
| 433 | 3300009553 | Ga0105249_10444825 | Ga0105249_104448252 | 246 |
| 434 | 3300009553 | Ga0105249_10504884 | Ga0105249_105048842 | 246 |
| 435 | 3300009763 | Ga0123340_1040575 | Ga0123340_10405751 | 246 |
| 436 | 3300009766 | Ga0123342_1032370 | Ga0123342_10323702 | 246 |
| 437 | 3300010375 | Ga0105239_10002107 | Ga0105239_1000210719 | 246 |
| 438 | 3300010375 | Ga0105239_10007703 | Ga0105239_100077034 | 246 |
| 439 | 3300010375 | Ga0105239_10039185 | Ga0105239_100391853 | 246 |
| 440 | 3300010375 | Ga0105239_10122143 | Ga0105239_101221432 | 246 |
| 441 | 3300010375 | Ga0105239_10243808 | Ga0105239_102438082 | 246 |
| 442 | 3300010375 | Ga0105239_10301175 | Ga0105239_103011752 | 246 |
| 443 | 3300010375 | Ga0105239_10307747 | Ga0105239_103077472 | 246 |
| 444 | 3300010375 | Ga0105239_10343654 | Ga0105239_103436542 | 246 |
| 445 | 3300010375 | Ga0105239_10374542 | Ga0105239_103745422 | 246 |
| 446 | 3300010375 | Ga0105239_11306396 | Ga0105239_113063961 | 246 |
| 447 | 3300011119 | Ga0105246_10021121 | Ga0105246_100211214 | 246 |
| 448 | 3300011119 | Ga0105246_10103356 | Ga0105246_101033562 | 246 |
| 449 | 3300011119 | Ga0105246_10183024 | Ga0105246_101830242 | 246 |
| 450 | 3300011119 | Ga0105246_10211017 | Ga0105246_102110172 | 246 |
| 451 | 3300011119 | Ga0105246_10322074 | Ga0105246_103220741 | 246 |
| 452 | 3300012515 | Ga0157338_1002466 | Ga0157338_10024663 | 246 |
| 453 | 3300013102 | Ga0157371_10047155 | Ga0157371_100471552 | 246 |
| 454 | 3300013104 | Ga0157370_10056251 | Ga0157370_100562512 | 246 |
| 455 | 3300013104 | Ga0157370_10134148 | Ga0157370_101341482 | 246 |
| 456 | 3300013105 | Ga0157369_10035139 | Ga0157369_100351395 | 246 |
| 457 | 3300013105 | Ga0157369_10181288 | Ga0157369_101812882 | 246 |
| 458 | 3300013105 | Ga0157369_10229048 | Ga0157369_102290482 | 246 |
| 459 | 3300013296 | Ga0157374_10100093 | Ga0157374_101000933 | 246 |
| 460 | 3300013296 | Ga0157374_10640703 | Ga0157374_106407032 | 246 |
| 461 | 3300013297 | Ga0157378_10004511 | Ga0157378_1000451112 | 246 |
| 462 | 3300013297 | Ga0157378_10006489 | Ga0157378_100064896 | 246 |
| 463 | 3300013297 | Ga0157378_10053222 | Ga0157378_100532222 | 246 |
| 464 | 3300013297 | Ga0157378_10212835 | Ga0157378_102128352 | 246 |
| 465 | 3300013297 | Ga0157378_10390105 | Ga0157378_103901052 | 246 |
| 466 | 3300013306 | Ga0163162_10000204 | Ga0163162_1000020443 | 246 |
| 467 | 3300013306 | Ga0163162_10004677 | Ga0163162_100046776 | 246 |
| 468 | 3300013306 | Ga0163162_10049112 | Ga0163162_100491123 | 246 |
| 469 | 3300013306 | Ga0163162_10118334 | Ga0163162_101183343 | 246 |
| 470 | 3300013306 | Ga0163162_10544590 | Ga0163162_105445902 | 246 |
| 471 | 3300013307 | Ga0157372_10514203 | Ga0157372_105142032 | 246 |
| 472 | 3300013308 | Ga0157375_10006400 | Ga0157375_100064004 | 246 |
| 473 | 3300013308 | Ga0157375_10024647 | Ga0157375_100246472 | 246 |
| 474 | 3300013308 | Ga0157375_10041032 | Ga0157375_100410324 | 246 |
| 475 | 3300013308 | Ga0157375_10057714 | Ga0157375_100577144 | 246 |
| 476 | 3300013308 | Ga0157375_10794743 | Ga0157375_107947432 | 246 |
| 477 | 3300014325 | Ga0163163_10828742 | Ga0163163_108287421 | 246 |
| 478 | 3300014326 | Ga0157380_10002708 | Ga0157380_100027086 | 246 |
| 479 | 3300014326 | Ga0157380_10004478 | Ga0157380_100044782 | 246 |
| 480 | 3300014326 | Ga0157380_10012997 | Ga0157380_100129972 | 246 |
| 481 | 3300014326 | Ga0157380_10041949 | Ga0157380_100419492 | 246 |
| 482 | 3300014326 | Ga0157380_10319433 | Ga0157380_103194332 | 246 |
| 483 | 3300014326 | Ga0157380_10721693 | Ga0157380_107216931 | 246 |
| 484 | 3300014497 | Ga0182008_10000774 | Ga0182008_1000077417 | 246 |
| 485 | 3300014497 | Ga0182008_10013499 | Ga0182008_100134995 | 246 |
| 486 | 3300014745 | Ga0157377_10000107 | Ga0157377_1000010719 | 246 |
| 487 | 3300014745 | Ga0157377_10241541 | Ga0157377_102415412 | 246 |
| 488 | 3300014968 | Ga0157379_10002672 | Ga0157379_1000267214 | 246 |
| 489 | 3300014968 | Ga0157379_10035395 | Ga0157379_100353954 | 246 |
| 490 | 3300014968 | Ga0157379_10091786 | Ga0157379_100917862 | 246 |
| 491 | 3300014968 | Ga0157379_10171246 | Ga0157379_101712462 | 246 |
| 492 | 3300014968 | Ga0157379_10201941 | Ga0157379_102019412 | 246 |
| 493 | 3300014968 | Ga0157379_10350293 | Ga0157379_103502933 | 246 |
| 494 | 3300014968 | Ga0157379_10396532 | Ga0157379_103965322 | 246 |
| 495 | 3300014968 | Ga0157379_10553319 | Ga0157379_105533192 | 246 |
| 496 | 3300014968 | Ga0157379_10841194 | Ga0157379_108411941 | 246 |
| 497 | 3300014969 | Ga0157376_10093303 | Ga0157376_100933033 | 246 |
| 498 | 3300014969 | Ga0157376_10232454 | Ga0157376_102324542 | 246 |
| 499 | 3300014969 | Ga0157376_10389772 | Ga0157376_103897722 | 246 |
| 500 | 3300014969 | Ga0157376_10402833 | Ga0157376_104028332 | 246 |
| 501 | 3300015262 | Ga0182007_10004305 | Ga0182007_100043055 | 246 |
| 502 | 3300015683 | Ga0183362_10001 | Ga0183362_10001954 | 246 |
| 503 | 3300017792 | Ga0163161_10020746 | Ga0163161_100207462 | 246 |
| 504 | 3300017792 | Ga0163161_10105260 | Ga0163161_101052603 | 246 |
| 505 | 3300017792 | Ga0163161_10201719 | Ga0163161_102017191 | 246 |
| 506 | 3300017792 | Ga0163161_10366484 | Ga0163161_103664842 | 246 |
| 507 | 3300017792 | Ga0163161_10387294 | Ga0163161_103872942 | 246 |
| 508 | 3300021320 | Ga0214544_1007335 | Ga0214544_10073353 | 246 |
| 509 | 3300021321 | Ga0214542_1000027 | Ga0214542_1000027142 | 246 |
| 510 | 3300021327 | Ga0214543_1000047 | Ga0214543_1000047116 | 246 |
| 511 | 3300021358 | Ga0213873_10001600 | Ga0213873_100016003 | 246 |
| 512 | 3300021358 | Ga0213873_10006410 | Ga0213873_100064102 | 246 |
| 513 | 3300021377 | Ga0213874_10011559 | Ga0213874_100115592 | 246 |
| 514 | 3300021377 | Ga0213874_10060082 | Ga0213874_100600821 | 246 |
| 515 | 3300021384 | Ga0213876_10001084 | Ga0213876_1000108413 | 246 |
| 516 | 3300021384 | Ga0213876_10006877 | Ga0213876_100068773 | 246 |
| 517 | 3300021384 | Ga0213876_10010546 | Ga0213876_100105463 | 246 |
| 518 | 3300021388 | Ga0213875_10001310 | Ga0213875_100013104 | 246 |
| 519 | 3300021388 | Ga0213875_10121679 | Ga0213875_101216792 | 246 |
| 520 | 3300021388 | Ga0213875_10219999 | Ga0213875_102199991 | 246 |
| 521 | 3300025208 | Ga0209436_100043 | Ga0209436_10004366 | 246 |
| 522 | 3300025230 | Ga0209563_101905 | Ga0209563_1019053 | 246 |
| 523 | 3300025231 | Ga0207427_101361 | Ga0207427_1013619 | 246 |
| 524 | 3300025250 | Ga0209026_1000025 | Ga0209026_100002569 | 246 |
| 525 | 3300025254 | Ga0209148_1000181 | Ga0209148_100018127 | 246 |
| 526 | 3300025256 | Ga0209759_1000226 | Ga0209759_100022633 | 246 |
| 527 | 3300025258 | Ga0209129_1001447 | Ga0209129_10014473 | 246 |
| 528 | 3300025258 | Ga0209129_1001476 | Ga0209129_10014769 | 246 |
| 529 | 3300025258 | Ga0209129_1001744 | Ga0209129_10017447 | 246 |
| 530 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010341 | 246 |
| 531 | 3300025261 | Ga0209233_1000208 | Ga0209233_1000208120 | 246 |
| 532 | 3300025261 | Ga0209233_1007445 | Ga0209233_10074454 | 246 |
| 533 | 3300025261 | Ga0209233_1011692 | Ga0209233_10116922 | 246 |
| 534 | 3300025272 | Ga0209455_1000127 | Ga0209455_100012727 | 246 |
| 535 | 3300025273 | Ga0209673_1000025 | Ga0209673_100002592 | 246 |
| 536 | 3300025273 | Ga0209673_1000550 | Ga0209673_100055023 | 246 |
| 537 | 3300025273 | Ga0209673_1002222 | Ga0209673_100222211 | 246 |
| 538 | 3300025273 | Ga0209673_1012262 | Ga0209673_10122622 | 246 |
| 539 | 3300025273 | Ga0209673_1015978 | Ga0209673_10159782 | 246 |
| 540 | 3300025273 | Ga0209673_1058556 | Ga0209673_10585561 | 246 |
| 541 | 3300025284 | Ga0209130_1000023 | Ga0209130_1000023356 | 246 |
| 542 | 3300025284 | Ga0209130_1000144 | Ga0209130_100014434 | 246 |
| 543 | 3300025284 | Ga0209130_1001459 | Ga0209130_10014597 | 246 |
| 544 | 3300025284 | Ga0209130_1014845 | Ga0209130_10148452 | 246 |
| 545 | 3300025284 | Ga0209130_1022823 | Ga0209130_10228232 | 246 |
| 546 | 3300025291 | Ga0209675_1000577 | Ga0209675_10005779 | 246 |
| 547 | 3300025291 | Ga0209675_1016073 | Ga0209675_10160732 | 246 |
| 548 | 3300025292 | Ga0209676_1011940 | Ga0209676_10119402 | 246 |
| 549 | 3300025294 | Ga0209025_1019972 | Ga0209025_10199723 | 246 |
| 550 | 3300025294 | Ga0209025_1034575 | Ga0209025_10345752 | 246 |
| 551 | 3300025294 | Ga0209025_1037564 | Ga0209025_10375641 | 246 |
| 552 | 3300025294 | Ga0209025_1047418 | Ga0209025_10474182 | 246 |
| 553 | 3300025295 | Ga0209564_1000365 | Ga0209564_100036541 | 246 |
| 554 | 3300025295 | Ga0209564_1000558 | Ga0209564_10005583 | 246 |
| 555 | 3300025295 | Ga0209564_1033341 | Ga0209564_10333412 | 246 |
| 556 | 3300025297 | Ga0209758_1000070 | Ga0209758_1000070108 | 246 |
| 557 | 3300025297 | Ga0209758_1000706 | Ga0209758_10007065 | 246 |
| 558 | 3300025297 | Ga0209758_1003235 | Ga0209758_10032352 | 246 |
| 559 | 3300025297 | Ga0209758_1014914 | Ga0209758_10149144 | 246 |
| 560 | 3300025297 | Ga0209758_1021677 | Ga0209758_10216773 | 246 |
| 561 | 3300025297 | Ga0209758_1027676 | Ga0209758_10276762 | 246 |
| 562 | 3300025298 | Ga0209050_1018895 | Ga0209050_10188952 | 246 |
| 563 | 3300025299 | Ga0209256_1000315 | Ga0209256_100031534 | 246 |
| 564 | 3300025299 | Ga0209256_1000718 | Ga0209256_100071823 | 246 |
| 565 | 3300025302 | Ga0207426_1000087 | Ga0207426_10000876 | 246 |
| 566 | 3300025302 | Ga0207426_1000126 | Ga0207426_100012633 | 246 |
| 567 | 3300025302 | Ga0207426_1002369 | Ga0207426_10023698 | 246 |
| 568 | 3300025303 | Ga0209051_1000176 | Ga0209051_100017640 | 246 |
| 569 | 3300025303 | Ga0209051_1000241 | Ga0209051_100024136 | 246 |
| 570 | 3300025303 | Ga0209051_1001845 | Ga0209051_10018456 | 246 |
| 571 | 3300025303 | Ga0209051_1005280 | Ga0209051_10052802 | 246 |
| 572 | 3300025303 | Ga0209051_1009714 | Ga0209051_10097147 | 246 |
| 573 | 3300025303 | Ga0209051_1010914 | Ga0209051_10109143 | 246 |
| 574 | 3300025303 | Ga0209051_1027372 | Ga0209051_10273722 | 246 |
| 575 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015176 | 246 |
| 576 | 3300025304 | Ga0209257_1000296 | Ga0209257_100029673 | 246 |
| 577 | 3300025304 | Ga0209257_1001085 | Ga0209257_100108535 | 246 |
| 578 | 3300025304 | Ga0209257_1010756 | Ga0209257_10107565 | 246 |
| 579 | 3300025304 | Ga0209257_1018952 | Ga0209257_10189523 | 246 |
| 580 | 3300025304 | Ga0209257_1019528 | Ga0209257_10195282 | 246 |
| 581 | 3300025315 | Ga0207697_10010156 | Ga0207697_100101562 | 246 |
| 582 | 3300025893 | Ga0207682_10003824 | Ga0207682_100038244 | 246 |
| 583 | 3300025898 | Ga0207692_10002105 | Ga0207692_100021057 | 246 |
| 584 | 3300025899 | Ga0207642_10006968 | Ga0207642_100069683 | 246 |
| 585 | 3300025899 | Ga0207642_10062734 | Ga0207642_100627342 | 246 |
| 586 | 3300025899 | Ga0207642_10262657 | Ga0207642_102626572 | 246 |
| 587 | 3300025900 | Ga0207710_10016400 | Ga0207710_100164003 | 246 |
| 588 | 3300025901 | Ga0207688_10014947 | Ga0207688_100149472 | 246 |
| 589 | 3300025901 | Ga0207688_10021443 | Ga0207688_100214432 | 246 |
| 590 | 3300025901 | Ga0207688_10066618 | Ga0207688_100666182 | 246 |
| 591 | 3300025901 | Ga0207688_10107200 | Ga0207688_101072001 | 246 |
| 592 | 3300025903 | Ga0207680_10000693 | Ga0207680_1000069310 | 246 |
| 593 | 3300025903 | Ga0207680_10275558 | Ga0207680_102755582 | 246 |
| 594 | 3300025904 | Ga0207647_10043242 | Ga0207647_100432422 | 246 |
| 595 | 3300025905 | Ga0207685_10034520 | Ga0207685_100345202 | 246 |
| 596 | 3300025906 | Ga0207699_10017480 | Ga0207699_100174802 | 246 |
| 597 | 3300025907 | Ga0207645_10001681 | Ga0207645_100016812 | 246 |
| 598 | 3300025907 | Ga0207645_10012052 | Ga0207645_100120524 | 246 |
| 599 | 3300025907 | Ga0207645_10149681 | Ga0207645_101496812 | 246 |
| 600 | 3300025907 | Ga0207645_10259896 | Ga0207645_102598962 | 246 |
| 601 | 3300025907 | Ga0207645_10366974 | Ga0207645_103669741 | 246 |
| 602 | 3300025908 | Ga0207643_10012550 | Ga0207643_100125503 | 246 |
| 603 | 3300025908 | Ga0207643_10021802 | Ga0207643_100218023 | 246 |
| 604 | 3300025909 | Ga0207705_10007543 | Ga0207705_100075437 | 246 |
| 605 | 3300025909 | Ga0207705_10038277 | Ga0207705_100382772 | 246 |
| 606 | 3300025909 | Ga0207705_10102103 | Ga0207705_101021032 | 246 |
| 607 | 3300025909 | Ga0207705_10421710 | Ga0207705_104217101 | 246 |
| 608 | 3300025911 | Ga0207654_10005276 | Ga0207654_100052768 | 246 |
| 609 | 3300025911 | Ga0207654_10010388 | Ga0207654_100103882 | 246 |
| 610 | 3300025911 | Ga0207654_10206933 | Ga0207654_102069332 | 246 |
| 611 | 3300025912 | Ga0207707_10016219 | Ga0207707_100162194 | 246 |
| 612 | 3300025913 | Ga0207695_10123128 | Ga0207695_101231282 | 246 |
| 613 | 3300025913 | Ga0207695_10199422 | Ga0207695_101994222 | 246 |
| 614 | 3300025914 | Ga0207671_10000098 | Ga0207671_1000009840 | 246 |
| 615 | 3300025914 | Ga0207671_10016385 | Ga0207671_100163852 | 246 |
| 616 | 3300025914 | Ga0207671_10027171 | Ga0207671_100271714 | 246 |
| 617 | 3300025914 | Ga0207671_10036385 | Ga0207671_100363852 | 246 |
| 618 | 3300025914 | Ga0207671_10038267 | Ga0207671_100382672 | 246 |
| 619 | 3300025914 | Ga0207671_10065373 | Ga0207671_100653732 | 246 |
| 620 | 3300025914 | Ga0207671_10214649 | Ga0207671_102146491 | 246 |
| 621 | 3300025914 | Ga0207671_10328979 | Ga0207671_103289792 | 246 |
| 622 | 3300025915 | Ga0207693_10015759 | Ga0207693_100157591 | 246 |
| 623 | 3300025916 | Ga0207663_10002594 | Ga0207663_100025948 | 246 |
| 624 | 3300025917 | Ga0207660_10150888 | Ga0207660_101508882 | 246 |
| 625 | 3300025918 | Ga0207662_10062892 | Ga0207662_100628922 | 246 |
| 626 | 3300025919 | Ga0207657_10032176 | Ga0207657_100321763 | 246 |
| 627 | 3300025919 | Ga0207657_10042901 | Ga0207657_100429013 | 246 |
| 628 | 3300025919 | Ga0207657_10046890 | Ga0207657_100468905 | 246 |
| 629 | 3300025919 | Ga0207657_10067886 | Ga0207657_100678862 | 246 |
| 630 | 3300025920 | Ga0207649_10004269 | Ga0207649_100042694 | 246 |
| 631 | 3300025921 | Ga0207652_10082409 | Ga0207652_100824092 | 246 |
| 632 | 3300025921 | Ga0207652_10452232 | Ga0207652_104522322 | 246 |
| 633 | 3300025923 | Ga0207681_10018257 | Ga0207681_100182573 | 246 |
| 634 | 3300025923 | Ga0207681_10039810 | Ga0207681_100398102 | 246 |
| 635 | 3300025923 | Ga0207681_10068503 | Ga0207681_100685032 | 246 |
| 636 | 3300025923 | Ga0207681_10122552 | Ga0207681_101225522 | 246 |
| 637 | 3300025923 | Ga0207681_10136522 | Ga0207681_101365222 | 246 |
| 638 | 3300025923 | Ga0207681_10389484 | Ga0207681_103894841 | 246 |
| 639 | 3300025923 | Ga0207681_10616992 | Ga0207681_106169922 | 246 |
| 640 | 3300025924 | Ga0207694_10069851 | Ga0207694_100698511 | 246 |
| 641 | 3300025924 | Ga0207694_10100132 | Ga0207694_101001322 | 246 |
| 642 | 3300025924 | Ga0207694_10275218 | Ga0207694_102752182 | 246 |
| 643 | 3300025925 | Ga0207650_10017853 | Ga0207650_100178532 | 246 |
| 644 | 3300025926 | Ga0207659_10002593 | Ga0207659_100025937 | 246 |
| 645 | 3300025926 | Ga0207659_10071354 | Ga0207659_100713543 | 246 |
| 646 | 3300025926 | Ga0207659_10085589 | Ga0207659_100855892 | 246 |
| 647 | 3300025926 | Ga0207659_10178576 | Ga0207659_101785762 | 246 |
| 648 | 3300025927 | Ga0207687_10003093 | Ga0207687_100030933 | 246 |
| 649 | 3300025927 | Ga0207687_10007241 | Ga0207687_100072415 | 246 |
| 650 | 3300025927 | Ga0207687_10050899 | Ga0207687_100508992 | 246 |
| 651 | 3300025927 | Ga0207687_10265131 | Ga0207687_102651312 | 246 |
| 652 | 3300025928 | Ga0207700_10031915 | Ga0207700_100319152 | 246 |
| 653 | 3300025928 | Ga0207700_10038178 | Ga0207700_100381783 | 246 |
| 654 | 3300025929 | Ga0207664_10006954 | Ga0207664_100069543 | 246 |
| 655 | 3300025929 | Ga0207664_10132657 | Ga0207664_101326573 | 246 |
| 656 | 3300025931 | Ga0207644_10006260 | Ga0207644_100062608 | 246 |
| 657 | 3300025931 | Ga0207644_10018313 | Ga0207644_100183134 | 246 |
| 658 | 3300025931 | Ga0207644_10045368 | Ga0207644_100453683 | 246 |
| 659 | 3300025932 | Ga0207690_10016088 | Ga0207690_100160883 | 246 |
| 660 | 3300025932 | Ga0207690_10139221 | Ga0207690_101392212 | 246 |
| 661 | 3300025932 | Ga0207690_10474299 | Ga0207690_104742992 | 246 |
| 662 | 3300025933 | Ga0207706_10003308 | Ga0207706_100033085 | 246 |
| 663 | 3300025933 | Ga0207706_10022986 | Ga0207706_100229867 | 246 |
| 664 | 3300025933 | Ga0207706_10184051 | Ga0207706_101840512 | 246 |
| 665 | 3300025933 | Ga0207706_10193365 | Ga0207706_101933652 | 246 |
| 666 | 3300025934 | Ga0207686_10002718 | Ga0207686_100027186 | 246 |
| 667 | 3300025934 | Ga0207686_10015735 | Ga0207686_100157352 | 246 |
| 668 | 3300025935 | Ga0207709_10001119 | Ga0207709_100011196 | 246 |
| 669 | 3300025935 | Ga0207709_10005283 | Ga0207709_100052833 | 246 |
| 670 | 3300025935 | Ga0207709_10024912 | Ga0207709_100249123 | 246 |
| 671 | 3300025935 | Ga0207709_10059177 | Ga0207709_100591772 | 246 |
| 672 | 3300025935 | Ga0207709_10113242 | Ga0207709_101132422 | 246 |
| 673 | 3300025935 | Ga0207709_10119585 | Ga0207709_101195852 | 246 |
| 674 | 3300025935 | Ga0207709_10145283 | Ga0207709_101452832 | 246 |
| 675 | 3300025935 | Ga0207709_10309967 | Ga0207709_103099672 | 246 |
| 676 | 3300025936 | Ga0207670_10005570 | Ga0207670_100055707 | 246 |
| 677 | 3300025936 | Ga0207670_10009557 | Ga0207670_100095575 | 246 |
| 678 | 3300025936 | Ga0207670_10292173 | Ga0207670_102921732 | 246 |
| 679 | 3300025937 | Ga0207669_10024389 | Ga0207669_100243894 | 246 |
| 680 | 3300025937 | Ga0207669_10024588 | Ga0207669_100245883 | 246 |
| 681 | 3300025937 | Ga0207669_10025755 | Ga0207669_100257553 | 246 |
| 682 | 3300025937 | Ga0207669_10029638 | Ga0207669_100296385 | 246 |
| 683 | 3300025937 | Ga0207669_10062917 | Ga0207669_100629172 | 246 |
| 684 | 3300025937 | Ga0207669_10174879 | Ga0207669_101748792 | 246 |
| 685 | 3300025938 | Ga0207704_10001177 | Ga0207704_100011778 | 246 |
| 686 | 3300025938 | Ga0207704_10009761 | Ga0207704_100097612 | 246 |
| 687 | 3300025938 | Ga0207704_10044084 | Ga0207704_100440842 | 246 |
| 688 | 3300025938 | Ga0207704_10209565 | Ga0207704_102095652 | 246 |
| 689 | 3300025938 | Ga0207704_10344545 | Ga0207704_103445451 | 246 |
| 690 | 3300025939 | Ga0207665_10005896 | Ga0207665_100058963 | 246 |
| 691 | 3300025939 | Ga0207665_10112843 | Ga0207665_101128432 | 246 |
| 692 | 3300025940 | Ga0207691_10003792 | Ga0207691_100037929 | 246 |
| 693 | 3300025940 | Ga0207691_10035477 | Ga0207691_100354774 | 246 |
| 694 | 3300025940 | Ga0207691_10099364 | Ga0207691_100993643 | 246 |
| 695 | 3300025940 | Ga0207691_10208710 | Ga0207691_102087102 | 246 |
| 696 | 3300025940 | Ga0207691_10216614 | Ga0207691_102166142 | 246 |
| 697 | 3300025940 | Ga0207691_10239163 | Ga0207691_102391632 | 246 |
| 698 | 3300025940 | Ga0207691_10655160 | Ga0207691_106551601 | 246 |
| 699 | 3300025941 | Ga0207711_10001117 | Ga0207711_1000111724 | 246 |
| 700 | 3300025941 | Ga0207711_10073953 | Ga0207711_100739533 | 246 |
| 701 | 3300025941 | Ga0207711_10141307 | Ga0207711_101413072 | 246 |
| 702 | 3300025942 | Ga0207689_10003529 | Ga0207689_1000352913 | 246 |
| 703 | 3300025942 | Ga0207689_10004524 | Ga0207689_100045249 | 246 |
| 704 | 3300025942 | Ga0207689_10016932 | Ga0207689_100169325 | 246 |
| 705 | 3300025942 | Ga0207689_10026403 | Ga0207689_100264033 | 246 |
| 706 | 3300025942 | Ga0207689_10071557 | Ga0207689_100715573 | 246 |
| 707 | 3300025942 | Ga0207689_10213752 | Ga0207689_102137522 | 246 |
| 708 | 3300025944 | Ga0207661_10155033 | Ga0207661_101550332 | 246 |
| 709 | 3300025945 | Ga0207679_10579823 | Ga0207679_105798231 | 246 |
| 710 | 3300025949 | Ga0207667_10002257 | Ga0207667_100022577 | 246 |
| 711 | 3300025949 | Ga0207667_10019765 | Ga0207667_100197657 | 246 |
| 712 | 3300025949 | Ga0207667_10432121 | Ga0207667_104321211 | 246 |
| 713 | 3300025960 | Ga0207651_10330865 | Ga0207651_103308652 | 246 |
| 714 | 3300025960 | Ga0207651_10413170 | Ga0207651_104131702 | 246 |
| 715 | 3300025961 | Ga0207712_10093622 | Ga0207712_100936223 | 246 |
| 716 | 3300025961 | Ga0207712_10132278 | Ga0207712_101322782 | 246 |
| 717 | 3300025961 | Ga0207712_10452389 | Ga0207712_104523892 | 246 |
| 718 | 3300025961 | Ga0207712_10794292 | Ga0207712_107942921 | 246 |
| 719 | 3300025972 | Ga0207668_10004719 | Ga0207668_100047196 | 246 |
| 720 | 3300025972 | Ga0207668_10007648 | Ga0207668_100076486 | 246 |
| 721 | 3300025972 | Ga0207668_10022961 | Ga0207668_100229612 | 246 |
| 722 | 3300025972 | Ga0207668_10054878 | Ga0207668_100548782 | 246 |
| 723 | 3300025972 | Ga0207668_10091056 | Ga0207668_100910562 | 246 |
| 724 | 3300025972 | Ga0207668_10107072 | Ga0207668_101070722 | 246 |
| 725 | 3300025972 | Ga0207668_10148672 | Ga0207668_101486722 | 246 |
| 726 | 3300025972 | Ga0207668_10252672 | Ga0207668_102526722 | 246 |
| 727 | 3300025972 | Ga0207668_10325583 | Ga0207668_103255831 | 246 |
| 728 | 3300025981 | Ga0207640_10004957 | Ga0207640_100049576 | 246 |
| 729 | 3300025981 | Ga0207640_10163554 | Ga0207640_101635542 | 246 |
| 730 | 3300025981 | Ga0207640_10218584 | Ga0207640_102185841 | 246 |
| 731 | 3300025986 | Ga0207658_10001163 | Ga0207658_1000116318 | 246 |
| 732 | 3300025986 | Ga0207658_10002997 | Ga0207658_100029977 | 246 |
| 733 | 3300025986 | Ga0207658_10154102 | Ga0207658_101541021 | 246 |
| 734 | 3300025986 | Ga0207658_10471536 | Ga0207658_104715361 | 246 |
| 735 | 3300026023 | Ga0207677_10000686 | Ga0207677_100006868 | 246 |
| 736 | 3300026023 | Ga0207677_10081529 | Ga0207677_100815292 | 246 |
| 737 | 3300026023 | Ga0207677_10148763 | Ga0207677_101487632 | 246 |
| 738 | 3300026035 | Ga0207703_10000702 | Ga0207703_1000070227 | 246 |
| 739 | 3300026035 | Ga0207703_10148135 | Ga0207703_101481352 | 246 |
| 740 | 3300026035 | Ga0207703_10322585 | Ga0207703_103225852 | 246 |
| 741 | 3300026041 | Ga0207639_10004702 | Ga0207639_100047026 | 246 |
| 742 | 3300026041 | Ga0207639_10017059 | Ga0207639_100170593 | 246 |
| 743 | 3300026041 | Ga0207639_10043662 | Ga0207639_100436622 | 246 |
| 744 | 3300026041 | Ga0207639_10197789 | Ga0207639_101977892 | 246 |
| 745 | 3300026041 | Ga0207639_10228345 | Ga0207639_102283452 | 246 |
| 746 | 3300026067 | Ga0207678_10055733 | Ga0207678_100557333 | 246 |
| 747 | 3300026067 | Ga0207678_10139218 | Ga0207678_101392182 | 246 |
| 748 | 3300026067 | Ga0207678_10239799 | Ga0207678_102397992 | 246 |
| 749 | 3300026067 | Ga0207678_10368317 | Ga0207678_103683172 | 246 |
| 750 | 3300026075 | Ga0207708_10023248 | Ga0207708_100232483 | 246 |
| 751 | 3300026075 | Ga0207708_10063677 | Ga0207708_100636772 | 246 |
| 752 | 3300026075 | Ga0207708_10174109 | Ga0207708_101741092 | 246 |
| 753 | 3300026078 | Ga0207702_10020818 | Ga0207702_100208184 | 246 |
| 754 | 3300026078 | Ga0207702_10021279 | Ga0207702_100212792 | 246 |
| 755 | 3300026078 | Ga0207702_10080204 | Ga0207702_100802042 | 246 |
| 756 | 3300026078 | Ga0207702_10085088 | Ga0207702_100850883 | 246 |
| 757 | 3300026078 | Ga0207702_10091452 | Ga0207702_100914523 | 246 |
| 758 | 3300026078 | Ga0207702_10258663 | Ga0207702_102586632 | 246 |
| 759 | 3300026088 | Ga0207641_10000926 | Ga0207641_100009268 | 246 |
| 760 | 3300026088 | Ga0207641_10135643 | Ga0207641_101356433 | 246 |
| 761 | 3300026088 | Ga0207641_10167392 | Ga0207641_101673922 | 246 |
| 762 | 3300026088 | Ga0207641_10330977 | Ga0207641_103309772 | 246 |
| 763 | 3300026089 | Ga0207648_10000227 | Ga0207648_1000022721 | 246 |
| 764 | 3300026089 | Ga0207648_10001863 | Ga0207648_100018638 | 246 |
| 765 | 3300026089 | Ga0207648_10004241 | Ga0207648_1000424113 | 246 |
| 766 | 3300026089 | Ga0207648_10027604 | Ga0207648_100276043 | 246 |
| 767 | 3300026089 | Ga0207648_10052018 | Ga0207648_100520183 | 246 |
| 768 | 3300026089 | Ga0207648_10077381 | Ga0207648_100773813 | 246 |
| 769 | 3300026089 | Ga0207648_10137674 | Ga0207648_101376741 | 246 |
| 770 | 3300026089 | Ga0207648_10152176 | Ga0207648_101521762 | 246 |
| 771 | 3300026089 | Ga0207648_10182587 | Ga0207648_101825872 | 246 |
| 772 | 3300026089 | Ga0207648_10209896 | Ga0207648_102098961 | 246 |
| 773 | 3300026095 | Ga0207676_10000656 | Ga0207676_1000065615 | 246 |
| 774 | 3300026095 | Ga0207676_10055756 | Ga0207676_100557562 | 246 |
| 775 | 3300026095 | Ga0207676_10171438 | Ga0207676_101714382 | 246 |
| 776 | 3300026095 | Ga0207676_10220263 | Ga0207676_102202632 | 246 |
| 777 | 3300026095 | Ga0207676_10406427 | Ga0207676_104064271 | 246 |
| 778 | 3300026116 | Ga0207674_10026564 | Ga0207674_100265646 | 246 |
| 779 | 3300026116 | Ga0207674_10196987 | Ga0207674_101969872 | 246 |
| 780 | 3300026118 | Ga0207675_100001409 | Ga0207675_10000140910 | 246 |
| 781 | 3300026118 | Ga0207675_100003635 | Ga0207675_10000363514 | 246 |
| 782 | 3300026118 | Ga0207675_100004839 | Ga0207675_1000048399 | 246 |
| 783 | 3300026118 | Ga0207675_100005359 | Ga0207675_10000535912 | 246 |
| 784 | 3300026118 | Ga0207675_100025107 | Ga0207675_1000251072 | 246 |
| 785 | 3300026118 | Ga0207675_100040984 | Ga0207675_1000409842 | 246 |
| 786 | 3300026118 | Ga0207675_100063281 | Ga0207675_1000632812 | 246 |
| 787 | 3300026118 | Ga0207675_100131377 | Ga0207675_1001313773 | 246 |
| 788 | 3300026121 | Ga0207683_10000463 | Ga0207683_1000046334 | 246 |
| 789 | 3300026121 | Ga0207683_10028847 | Ga0207683_100288473 | 246 |
| 790 | 3300026121 | Ga0207683_10041326 | Ga0207683_100413264 | 246 |
| 791 | 3300026121 | Ga0207683_10049390 | Ga0207683_100493902 | 246 |
| 792 | 3300026121 | Ga0207683_10059609 | Ga0207683_100596092 | 246 |
| 793 | 3300026121 | Ga0207683_10116269 | Ga0207683_101162692 | 246 |
| 794 | 3300026121 | Ga0207683_10360331 | Ga0207683_103603312 | 246 |
| 795 | 3300026142 | Ga0207698_10008240 | Ga0207698_100082401 | 246 |
| 796 | 3300026142 | Ga0207698_10015130 | Ga0207698_100151304 | 246 |
| 797 | 3300026142 | Ga0207698_10139450 | Ga0207698_101394502 | 246 |
| 798 | 3300026142 | Ga0207698_10210576 | Ga0207698_102105762 | 246 |
| 799 | 3300026142 | Ga0207698_10216552 | Ga0207698_102165522 | 246 |
| 800 | 3300026142 | Ga0207698_10412347 | Ga0207698_104123472 | 246 |
| 801 | 3300027671 | Ga0209588_1024000 | Ga0209588_10240002 | 246 |
| 802 | 3300027876 | Ga0209974_10014701 | Ga0209974_100147012 | 246 |
| 803 | 3300027907 | Ga0207428_10000055 | Ga0207428_1000005513 | 246 |
| 804 | 3300027907 | Ga0207428_10198334 | Ga0207428_101983342 | 246 |
| 805 | 3300027907 | Ga0207428_10373913 | Ga0207428_103739131 | 246 |
| 806 | 3300028379 | Ga0268266_10001688 | Ga0268266_1000168824 | 246 |
| 807 | 3300028379 | Ga0268266_10004161 | Ga0268266_100041612 | 246 |
| 808 | 3300028379 | Ga0268266_10013435 | Ga0268266_100134357 | 246 |
| 809 | 3300028379 | Ga0268266_10014245 | Ga0268266_100142457 | 246 |
| 810 | 3300028379 | Ga0268266_10022514 | Ga0268266_100225143 | 246 |
| 811 | 3300028379 | Ga0268266_10268317 | Ga0268266_102683172 | 246 |
| 812 | 3300028380 | Ga0268265_10019073 | Ga0268265_100190736 | 246 |
| 813 | 3300028380 | Ga0268265_10020317 | Ga0268265_100203173 | 246 |
| 814 | 3300028380 | Ga0268265_10031758 | Ga0268265_100317582 | 246 |
| 815 | 3300028380 | Ga0268265_10036898 | Ga0268265_100368983 | 246 |
| 816 | 3300028380 | Ga0268265_10045858 | Ga0268265_100458583 | 246 |
| 817 | 3300028380 | Ga0268265_10060622 | Ga0268265_100606222 | 246 |
| 818 | 3300028380 | Ga0268265_10120812 | Ga0268265_101208122 | 246 |
| 819 | 3300028380 | Ga0268265_10487658 | Ga0268265_104876581 | 246 |
| 820 | 3300028381 | Ga0268264_10027008 | Ga0268264_100270081 | 246 |
| 821 | 3300028381 | Ga0268264_10031040 | Ga0268264_100310403 | 246 |
| 822 | 3300028381 | Ga0268264_10050132 | Ga0268264_100501325 | 246 |
| 823 | 3300028381 | Ga0268264_10102078 | Ga0268264_101020782 | 246 |
| 824 | 3300028381 | Ga0268264_10146821 | Ga0268264_101468212 | 246 |
| 825 | 3300028381 | Ga0268264_10245924 | Ga0268264_102459242 | 246 |
| 826 | 3300028381 | Ga0268264_10359369 | Ga0268264_103593692 | 246 |
| 827 | 3300028381 | Ga0268264_10395543 | Ga0268264_103955431 | 246 |
| 828 | 3300028786 | Ga0307517_10000102 | Ga0307517_1000010264 | 246 |
| 829 | 3300028786 | Ga0307517_10091558 | Ga0307517_100915583 | 246 |
| 830 | 3300028794 | Ga0307515_10000130 | Ga0307515_1000013089 | 246 |
| 831 | 3300028794 | Ga0307515_10005868 | Ga0307515_1000586814 | 246 |
| 832 | 3300030521 | Ga0307511_10062115 | Ga0307511_100621152 | 246 |
| 833 | 3300030521 | Ga0307511_10105332 | Ga0307511_101053322 | 246 |
| 834 | 3300030522 | Ga0307512_10066553 | Ga0307512_100665532 | 246 |
| 835 | 3300031238 | Ga0265332_10044610 | Ga0265332_100446102 | 246 |
| 836 | 3300031239 | Ga0265328_10075366 | Ga0265328_100753661 | 246 |
| 837 | 3300031241 | Ga0265325_10033572 | Ga0265325_100335723 | 246 |
| 838 | 3300031241 | Ga0265325_10090164 | Ga0265325_100901642 | 246 |
| 839 | 3300031249 | Ga0265339_10001056 | Ga0265339_1000105616 | 246 |
| 840 | 3300031250 | Ga0265331_10024029 | Ga0265331_100240292 | 246 |
| 841 | 3300031250 | Ga0265331_10027234 | Ga0265331_100272342 | 246 |
| 842 | 3300031344 | Ga0265316_10102464 | Ga0265316_101024642 | 246 |
| 843 | 3300031456 | Ga0307513_10004550 | Ga0307513_1000455012 | 246 |
| 844 | 3300031456 | Ga0307513_10006865 | Ga0307513_100068654 | 246 |
| 845 | 3300031456 | Ga0307513_10011752 | Ga0307513_100117529 | 246 |
| 846 | 3300031456 | Ga0307513_10161071 | Ga0307513_101610712 | 246 |
| 847 | 3300031456 | Ga0307513_10207476 | Ga0307513_102074762 | 246 |
| 848 | 3300031456 | Ga0307513_10237260 | Ga0307513_102372601 | 246 |
| 849 | 3300031456 | Ga0307513_10412727 | Ga0307513_104127271 | 246 |
| 850 | 3300031507 | Ga0307509_10020922 | Ga0307509_100209224 | 246 |
| 851 | 3300031507 | Ga0307509_10077468 | Ga0307509_100774682 | 246 |
| 852 | 3300031507 | Ga0307509_10382066 | Ga0307509_103820662 | 246 |
| 853 | 3300031507 | Ga0307509_10434821 | Ga0307509_104348211 | 246 |
| 854 | 3300031548 | Ga0307408_100009454 | Ga0307408_1000094544 | 246 |
| 855 | 3300031548 | Ga0307408_100190984 | Ga0307408_1001909842 | 246 |
| 856 | 3300031548 | Ga0307408_100223010 | Ga0307408_1002230102 | 246 |
| 857 | 3300031548 | Ga0307408_100306894 | Ga0307408_1003068941 | 246 |
| 858 | 3300031548 | Ga0307408_100589190 | Ga0307408_1005891901 | 246 |
| 859 | 3300031595 | Ga0265313_10000044 | Ga0265313_1000004415 | 246 |
| 860 | 3300031595 | Ga0265313_10040982 | Ga0265313_100409821 | 246 |
| 861 | 3300031595 | Ga0265313_10123276 | Ga0265313_101232762 | 246 |
| 862 | 3300031616 | Ga0307508_10066442 | Ga0307508_100664422 | 246 |
| 863 | 3300031616 | Ga0307508_10141035 | Ga0307508_101410352 | 246 |
| 864 | 3300031616 | Ga0307508_10206694 | Ga0307508_102066942 | 246 |
| 865 | 3300031616 | Ga0307508_10286396 | Ga0307508_102863962 | 246 |
| 866 | 3300031616 | Ga0307508_10387937 | Ga0307508_103879372 | 246 |
| 867 | 3300031711 | Ga0265314_10060748 | Ga0265314_100607482 | 246 |
| 868 | 3300031711 | Ga0265314_10072215 | Ga0265314_100722152 | 246 |
| 869 | 3300031712 | Ga0265342_10037361 | Ga0265342_100373612 | 246 |
| 870 | 3300031730 | Ga0307516_10002286 | Ga0307516_100022869 | 246 |
| 871 | 3300031730 | Ga0307516_10003926 | Ga0307516_1000392616 | 246 |
| 872 | 3300031730 | Ga0307516_10020911 | Ga0307516_100209113 | 246 |
| 873 | 3300031730 | Ga0307516_10042688 | Ga0307516_100426882 | 246 |
| 874 | 3300031730 | Ga0307516_10047076 | Ga0307516_100470762 | 246 |
| 875 | 3300031730 | Ga0307516_10130828 | Ga0307516_101308283 | 246 |
| 876 | 3300031730 | Ga0307516_10155104 | Ga0307516_101551042 | 246 |
| 877 | 3300031730 | Ga0307516_10345991 | Ga0307516_103459912 | 246 |
| 878 | 3300031730 | Ga0307516_10349497 | Ga0307516_103494972 | 246 |
| 879 | 3300031730 | Ga0307516_10421155 | Ga0307516_104211551 | 246 |
| 880 | 3300031731 | Ga0307405_10179969 | Ga0307405_101799692 | 246 |
| 881 | 3300031852 | Ga0307410_10019322 | Ga0307410_100193222 | 246 |
| 882 | 3300031852 | Ga0307410_10041221 | Ga0307410_100412213 | 246 |
| 883 | 3300031852 | Ga0307410_10083488 | Ga0307410_100834883 | 246 |
| 884 | 3300031852 | Ga0307410_10203151 | Ga0307410_102031512 | 246 |
| 885 | 3300031852 | Ga0307410_10407633 | Ga0307410_104076332 | 246 |
| 886 | 3300031901 | Ga0307406_10061645 | Ga0307406_100616453 | 246 |
| 887 | 3300031901 | Ga0307406_10458268 | Ga0307406_104582682 | 246 |
| 888 | 3300031901 | Ga0307406_10537513 | Ga0307406_105375131 | 246 |
| 889 | 3300031901 | Ga0307406_10613626 | Ga0307406_106136261 | 246 |
| 890 | 3300031911 | Ga0307412_10152043 | Ga0307412_101520432 | 246 |
| 891 | 3300031911 | Ga0307412_10200185 | Ga0307412_102001851 | 246 |
| 892 | 3300031911 | Ga0307412_10303683 | Ga0307412_103036832 | 246 |
| 893 | 3300031911 | Ga0307412_10415584 | Ga0307412_104155842 | 246 |
| 894 | 3300031995 | Ga0307409_100018544 | Ga0307409_1000185443 | 246 |
| 895 | 3300031995 | Ga0307409_100039177 | Ga0307409_1000391772 | 246 |
| 896 | 3300031995 | Ga0307409_100043282 | Ga0307409_1000432823 | 246 |
| 897 | 3300032002 | Ga0307416_100007618 | Ga0307416_1000076182 | 246 |
| 898 | 3300032002 | Ga0307416_100037447 | Ga0307416_1000374472 | 246 |
| 899 | 3300032002 | Ga0307416_100056078 | Ga0307416_1000560783 | 246 |
| 900 | 3300032002 | Ga0307416_100615651 | Ga0307416_1006156512 | 246 |
| 901 | 3300032002 | Ga0307416_100628839 | Ga0307416_1006288392 | 246 |
| 902 | 3300032004 | Ga0307414_10024513 | Ga0307414_100245133 | 246 |
| 903 | 3300032004 | Ga0307414_10049458 | Ga0307414_100494582 | 246 |
| 904 | 3300032004 | Ga0307414_10114087 | Ga0307414_101140872 | 246 |
| 905 | 3300032004 | Ga0307414_10410036 | Ga0307414_104100361 | 246 |
| 906 | 3300032005 | Ga0307411_10074874 | Ga0307411_100748741 | 246 |
| 907 | 3300032005 | Ga0307411_10132876 | Ga0307411_101328762 | 246 |
| 908 | 3300032126 | Ga0307415_100068726 | Ga0307415_1000687263 | 246 |
| 909 | 3300033179 | Ga0307507_10009514 | Ga0307507_100095144 | 246 |
| 910 | 3300033180 | Ga0307510_10000403 | Ga0307510_1000040329 | 246 |
| 911 | 3300033180 | Ga0307510_10159973 | Ga0307510_101599732 | 246 |
| 912 | 3300034816 | Ga0373930_0002314 | Ga0373930_0002314_287_1027 | 246 |
| 913 | 3300034819 | Ga0373958_0010594 | Ga0373958_0010594_584_1324 | 246 |
| 914 | 3300034820 | Ga0373959_0059970 | Ga0373959_0059970_19_759 | 246 |
| 915 | 3300034957 | Ga0373938_0021680 | Ga0373938_0021680_297_1037 | 246 |
| 916 | 3300035084 | Ga0373928_0025870 | Ga0373928_0025870_339_1079 | 246 |
| 917 | 3300035088 | Ga0373940_0001803 | Ga0373940_0001803_1808_2548 | 246 |
| 918 | 3300035088 | Ga0373940_0013447 | Ga0373940_0013447_1030_1770 | 246 |
| 919 | 3300035090 | Ga0373949_0035880 | Ga0373949_0035880_217_957 | 246 |
| 920 | 3300035112 | Ga0373932_0065455 | Ga0373932_0065455_28_768 | 246 |
| 921 | 3300035113 | Ga0373936_0058868 | Ga0373936_0058868_506_1246 | 246 |
| 922 | 3300035116 | Ga0373945_0075361 | Ga0373945_0075361_42_782 | 246 |
| 923 | 3300035118 | Ga0373954_0065142 | Ga0373954_0065142_582_1382 | 246 |
| 924 | 3300035119 | Ga0373956_0088068 | Ga0373956_0088068_566_1312 | 246 |
| 925 | 3300035121 | Ga0373960_0108071 | Ga0373960_0108071_132_872 | 246 |
| 926 | 3300035170 | Ga0373943_0183297 | Ga0373943_0183297_12_794 | 246 |
| 927 | 3300035170 | Ga0373943_0218080 | Ga0373943_0218080_303_1043 | 246 |
| 928 | 3300035170 | Ga0373943_0238149 | Ga0373943_0238149_115_879 | 246 |
| 929 | 3300035171 | Ga0373946_0043305 | Ga0373946_0043305_1037_1837 | 246 |
| 930 | 3300035172 | Ga0373955_0031994 | Ga0373955_0031994_1427_2173 | 246 |
| 931 | 3300035172 | Ga0373955_0036165 | Ga0373955_0036165_511_1311 | 246 |
| 932 | 3300035207 | Ga0373942_0013968 | Ga0373942_0013968_50_790 | 246 |
| 933 | 3300035242 | Ga0373962_0007243 | Ga0373962_0007243_1820_2560 | 246 |
| 934 | 3300035410 | Ga0373924_0013697 | Ga0373924_0013697_947_1693 | 246 |
| 935 | 3300035691 | Ga0373931_0000221 | Ga0373931_0000221_5501_6241 | 246 |
| 936 | 3300035691 | Ga0373931_0144426 | Ga0373931_0144426_522_1262 | 246 |
| 937 | 3300035691 | Ga0373931_0361801 | Ga0373931_0361801_117_857 | 246 |
| 938 | 3300035692 | Ga0373935_0001741 | Ga0373935_0001741_4280_5080 | 246 |
| 939 | 3300035692 | Ga0373935_0029145 | Ga0373935_0029145_2024_2764 | 246 |
| 940 | 3300035692 | Ga0373935_0059489 | Ga0373935_0059489_1574_2314 | 246 |
| 941 | 3300035695 | Ga0373927_0000139 | Ga0373927_0000139_19356_20096 | 246 |
| 942 | 3300035695 | Ga0373927_0001969 | Ga0373927_0001969_11742_12542 | 246 |
| 943 | 3300035695 | Ga0373927_0021434 | Ga0373927_0021434_224_988 | 246 |
| 944 | 3300035695 | Ga0373927_0021765 | Ga0373927_0021765_607_1347 | 246 |
| 945 | 3300035695 | Ga0373927_0028636 | Ga0373927_0028636_2387_3127 | 246 |
| 946 | 3300035695 | Ga0373927_0151088 | Ga0373927_0151088_466_1206 | 246 |
| 947 | 3300035724 | Ga0373933_0007649 | Ga0373933_0007649_1860_2606 | 246 |
| 948 | 3300035724 | Ga0373933_0041090 | Ga0373933_0041090_1260_2006 | 246 |
| 949 | 3300035725 | Ga0373947_0001689 | Ga0373947_0001689_10135_10935 | 246 |
| 950 | 3300035725 | Ga0373947_0023523 | Ga0373947_0023523_2676_3440 | 246 |
| 951 | 3300036401 | Ga0373937_0009205 | Ga0373937_0009205_924_1670 | 246 |
| 952 | 3300036401 | Ga0373937_0039005 | Ga0373937_0039005_2608_3408 | 246 |
| 953 | 3300036401 | Ga0373937_0050691 | Ga0373937_0050691_1053_1799 | 246 |
| 954 | 3300036401 | Ga0373937_0061257 | Ga0373937_0061257_2145_2909 | 246 |
| 955 | 3300036401 | Ga0373937_0177910 | Ga0373937_0177910_94_840 | 246 |
| 956 | 3300036401 | Ga0373937_0689912 | Ga0373937_0689912_153_893 | 246 |
| 957 | 3300037068 | Ga0373925_0002233 | Ga0373925_0002233_2051_2791 | 246 |
| 958 | 3300037068 | Ga0373925_0014218 | Ga0373925_0014218_2726_3526 | 246 |
| 959 | 3300037068 | Ga0373925_0186614 | Ga0373925_0186614_857_1597 | 246 |
| 960 | 3300037068 | Ga0373925_0336393 | Ga0373925_0336393_309_1049 | 246 |
| 961 | 3300037068 | Ga0373925_0487456 | Ga0373925_0487456_82_822 | 246 |
| 962 | 3300037068 | Ga0373925_0770095 | Ga0373925_0770095_34_774 | 246 |
| 963 | 3300037312 | Ga0395899_0027674 | Ga0395899_0027674_2528_3268 | 246 |
| 964 | 3300037312 | Ga0395899_0116590 | Ga0395899_0116590_163_936 | 246 |
| 965 | 3300037418 | Ga0395900_0029660 | Ga0395900_0029660_4447_5187 | 246 |
| 966 | 3300037418 | Ga0395900_0091357 | Ga0395900_0091357_532_1272 | 246 |
| 967 | 3300037418 | Ga0395900_0095506 | Ga0395900_0095506_1882_2625 | 246 |
| 968 | 3300037418 | Ga0395900_0217555 | Ga0395900_0217555_159_902 | 246 |
| 969 | 3300037418 | Ga0395900_0376925 | Ga0395900_0376925_283_1023 | 246 |
| 970 | 3300037466 | Ga0395898_0088943 | Ga0395898_0088943_2195_2935 | 246 |
| 971 | 3300037471 | Ga0395905_0000972 | Ga0395905_0000972_17311_18087 | 246 |
| 972 | 3300037471 | Ga0395905_0001399 | Ga0395905_0001399_19448_20188 | 246 |
| 973 | 3300037471 | Ga0395905_0021902 | Ga0395905_0021902_2184_2927 | 246 |
| 974 | 3300037471 | Ga0395905_0079268 | Ga0395905_0079268_499_1239 | 246 |
| 975 | 3300037471 | Ga0395905_0083018 | Ga0395905_0083018_684_1457 | 246 |
| 976 | 3300037471 | Ga0395905_0169130 | Ga0395905_0169130_45_788 | 246 |
| 977 | 3300037471 | Ga0395905_0888678 | Ga0395905_0888678_35_775 | 246 |
| 978 | 3300037853 | Ga0436364_0432791 | Ga0436364_0432791_413_1153 | 246 |
| 979 | 3300037853 | Ga0436364_1006337 | Ga0436364_1006337_890_1636 | 246 |
| 980 | 3300037853 | Ga0436364_1104972 | Ga0436364_1104972_1204_1944 | 246 |
| 981 | 3300037853 | Ga0436364_1224731 | Ga0436364_1224731_396_1136 | 246 |
| 982 | 3300037853 | Ga0436364_1463980 | Ga0436364_1463980_5461_6201 | 246 |
| 983 | 3300038443 | Ga0395901_0068908 | Ga0395901_0068908_2067_2807 | 246 |
| 984 | 3300038443 | Ga0395901_0119894 | Ga0395901_0119894_1216_2094 | 246 |
| 985 | 3300039062 | Ga0400483_085697 | Ga0400483_085697_1925_2665 | 246 |
| 986 | 3300039062 | Ga0400483_125610 | Ga0400483_125610_1198_1938 | 246 |
| 987 | 3300039062 | Ga0400483_202169 | Ga0400483_202169_5739_6479 | 246 |
| 988 | 3300039437 | Ga0436365_0080604 | Ga0436365_0080604_32958_33698 | 246 |
| 989 | 3300039437 | Ga0436365_0095350 | Ga0436365_0095350_1081_1821 | 246 |
| 990 | 3300039437 | Ga0436365_0291258 | Ga0436365_0291258_27647_28387 | 246 |
| 991 | 3300039437 | Ga0436365_0484605 | Ga0436365_0484605_284_1024 | 246 |
| 992 | 3300039437 | Ga0436365_0528920 | Ga0436365_0528920_269_1009 | 246 |
| 993 | 3300039437 | Ga0436365_0709674 | Ga0436365_0709674_4951_5691 | 246 |
| 994 | 3300039437 | Ga0436365_1106760 | Ga0436365_1106760_1380_2120 | 246 |
| 995 | 3300039437 | Ga0436365_1107580 | Ga0436365_1107580_717_1457 | 246 |
| 996 | 3300039437 | Ga0436365_1113050 | Ga0436365_1113050_831_1571 | 246 |
| 997 | 3300039438 | Ga0436360_0806014 | Ga0436360_0806014_182_931 | 246 |
| 998 | 3300039438 | Ga0436360_1247364 | Ga0436360_1247364_1148_1888 | 246 |
| 999 | 3300039447 | Ga0436361_0316835 | Ga0436361_0316835_633_1373 | 246 |
| 1000 | 3300039447 | Ga0436361_0438285 | Ga0436361_0438285_10_750 | 246 |
| 1001 | 3300039447 | Ga0436361_0655965 | Ga0436361_0655965_1034_1774 | 246 |
| 1002 | 3300039450 | Ga0436363_0250085 | Ga0436363_0250085_24983_25723 | 246 |
| 1003 | 3300039450 | Ga0436363_0470149 | Ga0436363_0470149_318_1058 | 246 |
| 1004 | 3300039450 | Ga0436363_0691653 | Ga0436363_0691653_1567_2307 | 246 |
| 1005 | 3300039450 | Ga0436363_0706677 | Ga0436363_0706677_2126_2878 | 246 |
| 1006 | 3300039453 | Ga0436362_0039268 | Ga0436362_0039268_2720_3460 | 246 |
| 1007 | 3300039453 | Ga0436362_1130295 | Ga0436362_1130295_7779_8519 | 246 |
| 1008 | 3300041404 | Ga0439436_0007480 | Ga0439436_0007480_2029_2769 | 246 |
| 1009 | 3300041406 | Ga0439439_0029003 | Ga0439439_0029003_121_972 | 246 |
| 1010 | 3300041408 | Ga0439453_0000158 | Ga0439453_0000158_4128_4871 | 246 |
| 1011 | 3300041413 | Ga0439465_0001656 | Ga0439465_0001656_5904_6755 | 246 |
| 1012 | 3300041413 | Ga0439465_0005428 | Ga0439465_0005428_2604_3344 | 246 |
| 1013 | 3300041413 | Ga0439465_0040068 | Ga0439465_0040068_225_968 | 246 |
| 1014 | 3300041458 | Ga0451798_0384754 | Ga0451798_0384754_91_876 | 246 |
| 1015 | 3300041511 | Ga0451855_1802886 | Ga0451855_1802886_159_899 | 246 |
| 1016 | 3300042003 | Ga0439443_008804 | Ga0439443_008804_303_1046 | 246 |
| 1017 | 3300042007 | Ga0439449_0037385 | Ga0439449_0037385_310_1050 | 246 |
| 1018 | 3300042007 | Ga0439449_0063712 | Ga0439449_0063712_418_1269 | 246 |
| 1019 | 3300042012 | Ga0439455_0022404 | Ga0439455_0022404_312_1052 | 246 |
| 1020 | 3300042122 | Ga0450920_003262 | Ga0450920_003262_1916_2656 | 246 |
| 1021 | 3300042157 | Ga0439458_0011139 | Ga0439458_0011139_1166_1906 | 246 |
| 1022 | 3300042435 | Ga0439434_0017132 | Ga0439434_0017132_1381_2121 | 246 |
| 1023 | 3300042436 | Ga0439435_0001732 | Ga0439435_0001732_2898_3641 | 246 |
| 1024 | 3300042436 | Ga0439435_0036134 | Ga0439435_0036134_549_1289 | 246 |
| 1025 | 3300042461 | Ga0439460_0014937 | Ga0439460_0014937_617_1360 | 246 |
| 1026 | 3300042531 | Ga0450918_001827 | Ga0450918_001827_219_959 | 246 |
| 1027 | 3300044656 | Ga0466969_0003525 | Ga0466969_0003525_2699_3439 | 246 |
| 1028 | 3300044684 | Ga0466966_0010452 | Ga0466966_0010452_4747_5487 | 246 |
| 1029 | 3300044693 | Ga0466961_0005081 | Ga0466961_0005081_1663_2403 | 246 |
| 1030 | 3300044712 | Ga0453684_0015661 | Ga0453684_0015661_10061_10801 | 246 |
| 1031 | 3300044712 | Ga0453684_0418952 | Ga0453684_0418952_93_833 | 246 |
| 1032 | 3300045049 | Ga0466959_0012816 | Ga0466959_0012816_4341_5081 | 246 |
| 1033 | 3300045051 | Ga0451576_0294890 | Ga0451576_0294890_200_940 | 246 |
| 1034 | 3300045051 | Ga0451576_0350453 | Ga0451576_0350453_10_750 | 246 |
| 1035 | 3300045976 | Ga0466967_0096052 | Ga0466967_0096052_1305_2057 | 246 |
| 1036 | 3300045976 | Ga0466967_0416290 | Ga0466967_0416290_267_1028 | 246 |
| 1037 | 3300046452 | Ga0495617_056816 | Ga0495617_056816_141_881 | 246 |
| 1038 | 3300046454 | Ga0495592_0057749 | Ga0495592_0057749_1485_2231 | 246 |
| 1039 | 3300046454 | Ga0495592_0118533 | Ga0495592_0118533_466_1266 | 246 |
| 1040 | 3300046454 | Ga0495592_0216459 | Ga0495592_0216459_460_1206 | 246 |
| 1041 | 3300046455 | Ga0495603_0051016 | Ga0495603_0051016_1407_2147 | 246 |
| 1042 | 3300046455 | Ga0495603_0130629 | Ga0495603_0130629_448_1209 | 246 |
| 1043 | 3300046455 | Ga0495603_0214800 | Ga0495603_0214800_28_768 | 246 |
| 1044 | 3300046457 | Ga0495590_0007845 | Ga0495590_0007845_1177_1917 | 246 |
| 1045 | 3300046457 | Ga0495590_0014862 | Ga0495590_0014862_1854_2594 | 246 |
| 1046 | 3300046459 | Ga0495629_0089881 | Ga0495629_0089881_1049_1789 | 246 |
| 1047 | 3300046460 | Ga0495638_0010023 | Ga0495638_0010023_396_1136 | 246 |
| 1048 | 3300046460 | Ga0495638_0019892 | Ga0495638_0019892_63_803 | 246 |
| 1049 | 3300046460 | Ga0495638_0023502 | Ga0495638_0023502_1243_1983 | 246 |
| 1050 | 3300046460 | Ga0495638_0052267 | Ga0495638_0052267_982_1722 | 246 |
| 1051 | 3300046460 | Ga0495638_0078706 | Ga0495638_0078706_1129_1869 | 246 |
| 1052 | 3300046462 | Ga0495651_0099829 | Ga0495651_0099829_1398_2144 | 246 |
| 1053 | 3300046462 | Ga0495651_0298201 | Ga0495651_0298201_311_1057 | 246 |
| 1054 | 3300046472 | Ga0495580_0044247 | Ga0495580_0044247_709_1509 | 246 |
| 1055 | 3300046474 | Ga0495605_0009156 | Ga0495605_0009156_2224_2964 | 246 |
| 1056 | 3300046475 | Ga0495639_0009873 | Ga0495639_0009873_607_1347 | 246 |
| 1057 | 3300046475 | Ga0495639_0093753 | Ga0495639_0093753_58_843 | 246 |
| 1058 | 3300046475 | Ga0495639_0128881 | Ga0495639_0128881_17_757 | 246 |
| 1059 | 3300046476 | Ga0495662_0123159 | Ga0495662_0123159_203_943 | 246 |
| 1060 | 3300046477 | Ga0495664_0001193 | Ga0495664_0001193_2606_3406 | 246 |
| 1061 | 3300046477 | Ga0495664_0006956 | Ga0495664_0006956_4520_5266 | 246 |
| 1062 | 3300046477 | Ga0495664_0046765 | Ga0495664_0046765_1706_2446 | 246 |
| 1063 | 3300046491 | Ga0495584_0040470 | Ga0495584_0040470_656_1396 | 246 |
| 1064 | 3300046491 | Ga0495584_0131277 | Ga0495584_0131277_72_812 | 246 |
| 1065 | 3300046492 | Ga0495585_0023268 | Ga0495585_0023268_1561_2301 | 246 |
| 1066 | 3300046492 | Ga0495585_0031741 | Ga0495585_0031741_1258_1998 | 246 |
| 1067 | 3300046492 | Ga0495585_0057444 | Ga0495585_0057444_31_771 | 246 |
| 1068 | 3300046499 | Ga0495594_0117183 | Ga0495594_0117183_528_1268 | 246 |
| 1069 | 3300046500 | Ga0495596_0018291 | Ga0495596_0018291_260_1000 | 246 |
| 1070 | 3300046501 | Ga0495607_0106584 | Ga0495607_0106584_429_1214 | 246 |
| 1071 | 3300046506 | Ga0495583_0073517 | Ga0495583_0073517_620_1360 | 246 |
| 1072 | 3300046507 | Ga0495606_0002308 | Ga0495606_0002308_21262_22002 | 246 |
| 1073 | 3300046507 | Ga0495606_0242604 | Ga0495606_0242604_147_887 | 246 |
| 1074 | 3300046511 | Ga0495608_0013378 | Ga0495608_0013378_3664_4410 | 246 |
| 1075 | 3300046511 | Ga0495608_0091303 | Ga0495608_0091303_1021_1767 | 246 |
| 1076 | 3300046512 | Ga0495610_0016205 | Ga0495610_0016205_448_1188 | 246 |
| 1077 | 3300046512 | Ga0495610_0021848 | Ga0495610_0021848_227_967 | 246 |
| 1078 | 3300046512 | Ga0495610_0167975 | Ga0495610_0167975_140_880 | 246 |
| 1079 | 3300046513 | Ga0495616_0020982 | Ga0495616_0020982_1803_2543 | 246 |
| 1080 | 3300046514 | Ga0495618_0087433 | Ga0495618_0087433_459_1259 | 246 |
| 1081 | 3300046515 | Ga0495620_0019783 | Ga0495620_0019783_1752_2492 | 246 |
| 1082 | 3300046515 | Ga0495620_0027127 | Ga0495620_0027127_385_1125 | 246 |
| 1083 | 3300046515 | Ga0495620_0084744 | Ga0495620_0084744_151_891 | 246 |
| 1084 | 3300046516 | Ga0495628_0040093 | Ga0495628_0040093_275_1075 | 246 |
| 1085 | 3300046516 | Ga0495628_0206249 | Ga0495628_0206249_421_1167 | 246 |
| 1086 | 3300046517 | Ga0495630_0002691 | Ga0495630_0002691_7611_8411 | 246 |
| 1087 | 3300046517 | Ga0495630_0179043 | Ga0495630_0179043_403_1143 | 246 |
| 1088 | 3300046518 | Ga0495631_0027363 | Ga0495631_0027363_1241_1981 | 246 |
| 1089 | 3300046518 | Ga0495631_0161637 | Ga0495631_0161637_153_893 | 246 |
| 1090 | 3300046520 | Ga0495637_0048020 | Ga0495637_0048020_909_1649 | 246 |
| 1091 | 3300046522 | Ga0495643_0016345 | Ga0495643_0016345_888_1628 | 246 |
| 1092 | 3300046522 | Ga0495643_0016823 | Ga0495643_0016823_379_1119 | 246 |
| 1093 | 3300046522 | Ga0495643_0031187 | Ga0495643_0031187_141_881 | 246 |
| 1094 | 3300046523 | Ga0495644_0031331 | Ga0495644_0031331_410_1150 | 246 |
| 1095 | 3300046523 | Ga0495644_0056906 | Ga0495644_0056906_347_1087 | 246 |
| 1096 | 3300046524 | Ga0495648_0019848 | Ga0495648_0019848_1967_2749 | 246 |
| 1097 | 3300046524 | Ga0495648_0033917 | Ga0495648_0033917_800_1540 | 246 |
| 1098 | 3300046524 | Ga0495648_0165670 | Ga0495648_0165670_329_1072 | 246 |
| 1099 | 3300046526 | Ga0495666_0016302 | Ga0495666_0016302_2330_3070 | 246 |
| 1100 | 3300046528 | Ga0495642_0021749 | Ga0495642_0021749_312_1052 | 246 |
| 1101 | 3300046528 | Ga0495642_0024106 | Ga0495642_0024106_1322_2062 | 246 |
| 1102 | 3300046528 | Ga0495642_0036830 | Ga0495642_0036830_913_1653 | 246 |
| 1103 | 3300046530 | Ga0495654_0027025 | Ga0495654_0027025_411_1151 | 246 |
| 1104 | 3300046531 | Ga0495665_0010250 | Ga0495665_0010250_1658_2458 | 246 |
| 1105 | 3300046531 | Ga0495665_0050823 | Ga0495665_0050823_1005_1745 | 246 |
| 1106 | 3300046533 | Ga0495640_0139113 | Ga0495640_0139113_799_1545 | 246 |
| 1107 | 3300046536 | Ga0495587_0054018 | Ga0495587_0054018_1253_1999 | 246 |
| 1108 | 3300046537 | Ga0495598_0001316 | Ga0495598_0001316_2720_3460 | 246 |
| 1109 | 3300046539 | Ga0495621_0028212 | Ga0495621_0028212_751_1491 | 246 |
| 1110 | 3300046539 | Ga0495621_0073041 | Ga0495621_0073041_31_816 | 246 |
| 1111 | 3300046542 | Ga0495597_0011373 | Ga0495597_0011373_341_1081 | 246 |
| 1112 | 3300046542 | Ga0495597_0013824 | Ga0495597_0013824_2307_3047 | 246 |
| 1113 | 3300046542 | Ga0495597_0060331 | Ga0495597_0060331_854_1594 | 246 |
| 1114 | 3300046543 | Ga0495645_0002601 | Ga0495645_0002601_1993_2739 | 246 |
| 1115 | 3300046559 | Ga0495667_0012733 | Ga0495667_0012733_3954_4700 | 246 |
| 1116 | 3300046559 | Ga0495667_0013502 | Ga0495667_0013502_2409_3155 | 246 |
| 1117 | 3300046559 | Ga0495667_0186767 | Ga0495667_0186767_492_1238 | 246 |
| 1118 | 3300046615 | Ga0495656_0000201 | Ga0495656_0000201_8316_9056 | 246 |
| 1119 | 3300046615 | Ga0495656_0001707 | Ga0495656_0001707_3191_3931 | 246 |
| 1120 | 3300046615 | Ga0495656_0038424 | Ga0495656_0038424_32_817 | 246 |
| 1121 | 3300046615 | Ga0495656_0069385 | Ga0495656_0069385_32_859 | 246 |
| 1122 | 3300046616 | Ga0495668_0093858 | Ga0495668_0093858_658_1398 | 246 |
| 1123 | 3300046642 | Ga0495634_0032374 | Ga0495634_0032374_2053_2853 | 246 |
| 1124 | 3300046648 | Ga0495611_0125277 | Ga0495611_0125277_342_1082 | 246 |
| 1125 | 3300046660 | Ga0495625_0003440 | Ga0495625_0003440_11915_12655 | 246 |
| 1126 | 3300046660 | Ga0495625_0157101 | Ga0495625_0157101_733_1473 | 246 |
| 1127 | 3300046660 | Ga0495625_0209204 | Ga0495625_0209204_213_953 | 246 |
| 1128 | 3300046663 | Ga0495635_0315518 | Ga0495635_0315518_47_787 | 246 |
| 1129 | 3300046665 | Ga0495661_0111480 | Ga0495661_0111480_193_933 | 246 |
| 1130 | 3300046674 | Ga0495588_0066318 | Ga0495588_0066318_549_1334 | 246 |
| 1131 | 3300046674 | Ga0495588_0218852 | Ga0495588_0218852_230_970 | 246 |
| 1132 | 3300046675 | Ga0495657_0127373 | Ga0495657_0127373_135_881 | 246 |
| 1133 | 3300046678 | Ga0495599_0014021 | Ga0495599_0014021_4125_4871 | 246 |
| 1134 | 3300046679 | Ga0495623_0140356 | Ga0495623_0140356_465_1211 | 246 |
| 1135 | 3300046680 | Ga0495646_0034557 | Ga0495646_0034557_1984_2730 | 246 |
| 1136 | 3300046680 | Ga0495646_0049579 | Ga0495646_0049579_1195_1995 | 246 |
| 1137 | 3300046683 | Ga0495658_0152836 | Ga0495658_0152836_435_1175 | 246 |
| 1138 | 3300046683 | Ga0495658_0169234 | Ga0495658_0169234_232_993 | 246 |
| 1139 | 3300046684 | Ga0495669_0014685 | Ga0495669_0014685_1363_2103 | 246 |
| 1140 | 3300046684 | Ga0495669_0068550 | Ga0495669_0068550_656_1396 | 246 |
| 1141 | 3300046689 | Ga0495613_0165200 | Ga0495613_0165200_683_1483 | 246 |
| 1142 | 3300046690 | Ga0495624_0084998 | Ga0495624_0084998_781_1521 | 246 |
| 1143 | 3300046691 | Ga0495670_0077621 | Ga0495670_0077621_733_1518 | 246 |
| 1144 | 3300046692 | Ga0495671_0013120 | Ga0495671_0013120_2666_3406 | 246 |
| 1145 | 3300046694 | Ga0495649_0073721 | Ga0495649_0073721_1065_1805 | 246 |
| 1146 | 3300046809 | Ga0495600_0014445 | Ga0495600_0014445_4143_4889 | 246 |
| 1147 | 3300046809 | Ga0495600_0121970 | Ga0495600_0121970_102_860 | 246 |
| 1148 | 3300046810 | Ga0495660_0068273 | Ga0495660_0068273_65_805 | 246 |
| 1149 | 3300047315 | Ga0495581_0183313 | Ga0495581_0183313_174_914 | 246 |
| 1150 | 3300047315 | Ga0495581_0358551 | Ga0495581_0358551_63_809 | 246 |
| 1151 | 3300047317 | Ga0495604_0017364 | Ga0495604_0017364_2762_3508 | 246 |
| 1152 | 3300047317 | Ga0495604_0050776 | Ga0495604_0050776_710_1456 | 246 |
| 1153 | 3300047319 | Ga0495674_0003734 | Ga0495674_0003734_11414_12214 | 246 |
| 1154 | 3300047319 | Ga0495674_0066087 | Ga0495674_0066087_1662_2408 | 246 |
| 1155 | 3300047319 | Ga0495674_0075206 | Ga0495674_0075206_1092_1835 | 246 |
| 1156 | 3300047319 | Ga0495674_0635030 | Ga0495674_0635030_41_823 | 246 |
| 1157 | 3300047320 | Ga0495672_0120073 | Ga0495672_0120073_142_882 | 246 |
| 1158 | 3300047321 | Ga0495676_0252845 | Ga0495676_0252845_27_767 | 246 |
| 1159 | 3300047322 | Ga0495680_0318562 | Ga0495680_0318562_164_904 | 246 |
| 1160 | 3300047443 | Ga0495687_000636 | Ga0495687_000636_8748_9488 | 246 |
| 1161 | 3300047443 | Ga0495687_053901 | Ga0495687_053901_142_882 | 246 |
| 1162 | 3300047444 | Ga0495675_0016558 | Ga0495675_0016558_3109_3855 | 246 |
| 1163 | 3300047444 | Ga0495675_0243056 | Ga0495675_0243056_26_766 | 246 |
| 1164 | 3300047445 | Ga0495677_0039577 | Ga0495677_0039577_891_1631 | 246 |
| 1165 | 3300047469 | Ga0495673_0019819 | Ga0495673_0019819_1888_2628 | 246 |
| 1166 | 3300047471 | Ga0495684_0260261 | Ga0495684_0260261_210_974 | 246 |
| 1167 | 3300047472 | Ga0495686_0001513 | Ga0495686_0001513_18189_18956 | 246 |
| 1168 | 3300047472 | Ga0495686_0044699 | Ga0495686_0044699_1764_2504 | 246 |
| 1169 | 3300047472 | Ga0495686_0050724 | Ga0495686_0050724_733_1473 | 246 |
| 1170 | 3300047472 | Ga0495686_0092606 | Ga0495686_0092606_143_883 | 246 |
| 1171 | 3300047472 | Ga0495686_0122347 | Ga0495686_0122347_172_912 | 246 |
| 1172 | 3300047673 | Ga0495593_0120701 | Ga0495593_0120701_457_1197 | 246 |
| 1173 | 3300048088 | Ga0495602_0004753 | Ga0495602_0004753_9940_10686 | 246 |
| 1174 | 3300048088 | Ga0495602_0125217 | Ga0495602_0125217_135_881 | 246 |
| 1175 | 3300048089 | Ga0495614_0138734 | Ga0495614_0138734_308_1048 | 246 |
| 1176 | 3300048089 | Ga0495614_0176856 | Ga0495614_0176856_58_798 | 246 |
| 1177 | 3300048090 | Ga0495615_0008681 | Ga0495615_0008681_1142_1882 | 246 |
| 1178 | 3300048091 | Ga0495626_0028174 | Ga0495626_0028174_653_1393 | 246 |
| 1179 | 3300048091 | Ga0495626_0159647 | Ga0495626_0159647_41_781 | 246 |
| 1180 | 3300048903 | Ga0496100_0029263 | Ga0496100_0029263_2354_3094 | 246 |
| 1181 | 3300048904 | Ga0496101_0088114 | Ga0496101_0088114_356_1096 | 246 |
| 1182 | 3300048904 | Ga0496101_0159819 | Ga0496101_0159819_525_1271 | 246 |
| 1183 | 3300048905 | Ga0496102_0003637 | Ga0496102_0003637_6956_7696 | 246 |
| 1184 | 3300048905 | Ga0496102_0269043 | Ga0496102_0269043_401_1141 | 246 |
| 1185 | 3300048905 | Ga0496102_0371850 | Ga0496102_0371850_319_1062 | 246 |
| 1186 | 3300048905 | Ga0496102_0633484 | Ga0496102_0633484_117_857 | 246 |
| 1187 | 3300048907 | Ga0496104_0167233 | Ga0496104_0167233_1345_2091 | 246 |
| 1188 | 3300048908 | Ga0496105_0003045 | Ga0496105_0003045_5460_6200 | 246 |
| 1189 | 3300048908 | Ga0496105_0004996 | Ga0496105_0004996_5943_6689 | 246 |
| 1190 | 3300048908 | Ga0496105_0377778 | Ga0496105_0377778_210_950 | 246 |
| 1191 | 3300048909 | Ga0496106_0000089 | Ga0496106_0000089_5333_6073 | 246 |
| 1192 | 3300048909 | Ga0496106_0000244 | Ga0496106_0000244_2502_3242 | 246 |
| 1193 | 3300048909 | Ga0496106_0006866 | Ga0496106_0006866_2097_2837 | 246 |
| 1194 | 3300048909 | Ga0496106_0070480 | Ga0496106_0070480_1677_2417 | 246 |
| 1195 | 3300048909 | Ga0496106_0530957 | Ga0496106_0530957_165_905 | 246 |
| 1196 | 3300048909 | Ga0496106_0610108 | Ga0496106_0610108_97_837 | 246 |
| 1197 | 3300048910 | Ga0496107_0016369 | Ga0496107_0016369_82_822 | 246 |
| 1198 | 3300048910 | Ga0496107_0458134 | Ga0496107_0458134_77_817 | 246 |
| 1199 | 3300048911 | Ga0496108_0035648 | Ga0496108_0035648_382_1122 | 246 |
| 1200 | 3300048911 | Ga0496108_0287346 | Ga0496108_0287346_180_920 | 246 |
| 1201 | 3300048911 | Ga0496108_0661789 | Ga0496108_0661789_156_896 | 246 |
| 1202 | 3300048911 | Ga0496108_0698079 | Ga0496108_0698079_19_816 | 246 |
| 1203 | 3300048912 | Ga0496109_0006604 | Ga0496109_0006604_3048_3788 | 246 |
| 1204 | 3300048912 | Ga0496109_0145378 | Ga0496109_0145378_168_908 | 246 |
| 1205 | 3300048912 | Ga0496109_0456873 | Ga0496109_0456873_393_1133 | 246 |
| 1206 | 3300048912 | Ga0496109_0511747 | Ga0496109_0511747_102_842 | 246 |
| 1207 | 3300048913 | Ga0496110_0001819 | Ga0496110_0001819_10220_10960 | 246 |
| 1208 | 3300048913 | Ga0496110_0050345 | Ga0496110_0050345_48_788 | 246 |
| 1209 | 3300048913 | Ga0496110_0085247 | Ga0496110_0085247_1305_2045 | 246 |
| 1210 | 3300048913 | Ga0496110_0248324 | Ga0496110_0248324_665_1405 | 246 |
| 1211 | 3300048914 | Ga0496111_0143633 | Ga0496111_0143633_1014_1754 | 246 |
| 1212 | 3300048915 | Ga0496112_0003238 | Ga0496112_0003238_3400_4140 | 246 |
| 1213 | 3300048915 | Ga0496112_0012529 | Ga0496112_0012529_4705_5448 | 246 |
| 1214 | 3300048915 | Ga0496112_0138882 | Ga0496112_0138882_1591_2331 | 246 |
| 1215 | 3300048915 | Ga0496112_0145815 | Ga0496112_0145815_59_799 | 246 |
| 1216 | 3300048916 | Ga0496113_0012993 | Ga0496113_0012993_3156_3896 | 246 |
| 1217 | 3300048916 | Ga0496113_0140626 | Ga0496113_0140626_757_1497 | 246 |
| 1218 | 3300048917 | Ga0496114_0287786 | Ga0496114_0287786_381_1121 | 246 |
| 1219 | 3300048918 | Ga0496115_0033571 | Ga0496115_0033571_2072_2815 | 246 |
| 1220 | 3300048918 | Ga0496115_0167400 | Ga0496115_0167400_730_1470 | 246 |
| 1221 | 3300048920 | Ga0496117_0051502 | Ga0496117_0051502_921_1661 | 246 |
| 1222 | 3300048920 | Ga0496117_0079523 | Ga0496117_0079523_229_1104 | 246 |
| 1223 | 3300048921 | Ga0496118_0004232 | Ga0496118_0004232_2792_3667 | 246 |
| 1224 | 3300048921 | Ga0496118_0021785 | Ga0496118_0021785_3461_4201 | 246 |
| 1225 | 3300048921 | Ga0496118_0027353 | Ga0496118_0027353_3109_3888 | 246 |
| 1226 | 3300048921 | Ga0496118_0039503 | Ga0496118_0039503_2302_3042 | 246 |
| 1227 | 3300048921 | Ga0496118_0049073 | Ga0496118_0049073_2211_2951 | 246 |
| 1228 | 3300048921 | Ga0496118_0054398 | Ga0496118_0054398_1928_2668 | 246 |
| 1229 | 3300048921 | Ga0496118_0146758 | Ga0496118_0146758_652_1392 | 246 |
| 1230 | 3300048921 | Ga0496118_0157581 | Ga0496118_0157581_266_1006 | 246 |
| 1231 | 3300048922 | Ga0496119_0030275 | Ga0496119_0030275_1630_2466 | 246 |
| 1232 | 3300048922 | Ga0496119_0038482 | Ga0496119_0038482_243_983 | 246 |
| 1233 | 3300048922 | Ga0496119_0075543 | Ga0496119_0075543_977_1756 | 246 |
| 1234 | 3300048923 | Ga0496120_0004296 | Ga0496120_0004296_3227_4063 | 246 |
| 1235 | 3300048923 | Ga0496120_0060488 | Ga0496120_0060488_212_952 | 246 |
| 1236 | 3300048924 | Ga0496121_0009702 | Ga0496121_0009702_7046_7786 | 246 |
| 1237 | 3300048924 | Ga0496121_0012571 | Ga0496121_0012571_3020_3760 | 246 |
| 1238 | 3300048924 | Ga0496121_0013490 | Ga0496121_0013490_3133_3912 | 246 |
| 1239 | 3300048924 | Ga0496121_0016499 | Ga0496121_0016499_2044_2784 | 246 |
| 1240 | 3300048924 | Ga0496121_0024781 | Ga0496121_0024781_1951_2691 | 246 |
| 1241 | 3300048924 | Ga0496121_0035975 | Ga0496121_0035975_806_1546 | 246 |
| 1242 | 3300048924 | Ga0496121_0056807 | Ga0496121_0056807_1429_2169 | 246 |
| 1243 | 3300048924 | Ga0496121_0059968 | Ga0496121_0059968_1325_2131 | 246 |
| 1244 | 3300048924 | Ga0496121_0095041 | Ga0496121_0095041_1453_2193 | 246 |
| 1245 | 3300048924 | Ga0496121_0095365 | Ga0496121_0095365_348_1088 | 246 |
| 1246 | 3300048924 | Ga0496121_0098369 | Ga0496121_0098369_1296_2036 | 246 |
| 1247 | 3300048925 | Ga0496122_0116596 | Ga0496122_0116596_141_881 | 246 |
| 1248 | 3300048926 | Ga0496123_0215154 | Ga0496123_0215154_94_834 | 246 |
| 1249 | 3300048927 | Ga0496124_0004856 | Ga0496124_0004856_1547_2287 | 246 |
| 1250 | 3300048927 | Ga0496124_0016982 | Ga0496124_0016982_216_956 | 246 |
| 1251 | 3300048927 | Ga0496124_0056724 | Ga0496124_0056724_1292_2032 | 246 |
| 1252 | 3300048927 | Ga0496124_0187153 | Ga0496124_0187153_730_1470 | 246 |
| 1253 | 3300048927 | Ga0496124_0243589 | Ga0496124_0243589_168_908 | 246 |
| 1254 | 3300048928 | Ga0496125_0002684 | Ga0496125_0002684_8427_9167 | 246 |
| 1255 | 3300048928 | Ga0496125_0014515 | Ga0496125_0014515_5868_6608 | 246 |
| 1256 | 3300048928 | Ga0496125_0040917 | Ga0496125_0040917_3021_3761 | 246 |
| 1257 | 3300048928 | Ga0496125_0147210 | Ga0496125_0147210_658_1398 | 246 |
| 1258 | 3300048929 | Ga0496126_0001193 | Ga0496126_0001193_17298_18038 | 246 |
| 1259 | 3300048929 | Ga0496126_0015119 | Ga0496126_0015119_2341_3081 | 246 |
| 1260 | 3300048929 | Ga0496126_0019399 | Ga0496126_0019399_816_1556 | 246 |
| 1261 | 3300048929 | Ga0496126_0066929 | Ga0496126_0066929_1223_2002 | 246 |
| 1262 | 3300048929 | Ga0496126_0148270 | Ga0496126_0148270_66_806 | 246 |
| 1263 | 3300048929 | Ga0496126_0236359 | Ga0496126_0236359_525_1265 | 246 |
| 1264 | 3300048929 | Ga0496126_0339699 | Ga0496126_0339699_25_768 | 246 |
| 1265 | 3300048929 | Ga0496126_0369161 | Ga0496126_0369161_399_1139 | 246 |
| 1266 | 3300049459 | Ga0495678_020140 | Ga0495678_020140_453_1193 | 246 |
| 1267 | 3300049521 | Ga0501298_001895 | Ga0501298_001895_81_821 | 246 |
| 1268 | 3300049568 | Ga0501031_0000009 | Ga0501031_0000009_114034_114780 | 246 |
| 1269 | 3300049568 | Ga0501031_0014617 | Ga0501031_0014617_409_1149 | 246 |
| 1270 | 3300049568 | Ga0501031_0018659 | Ga0501031_0018659_2346_3086 | 246 |
| 1271 | 3300049569 | Ga0501032_0000017 | Ga0501032_0000017_114035_114781 | 246 |
| 1272 | 3300049569 | Ga0501032_0042254 | Ga0501032_0042254_135_875 | 246 |
| 1273 | 3300049569 | Ga0501032_0042410 | Ga0501032_0042410_514_1254 | 246 |
| 1274 | 3300049569 | Ga0501032_0055957 | Ga0501032_0055957_1163_1903 | 246 |
| 1275 | 3300049569 | Ga0501032_0077697 | Ga0501032_0077697_940_1692 | 246 |
| 1276 | 3300049569 | Ga0501032_0116702 | Ga0501032_0116702_48_788 | 246 |
| 1277 | 3300049569 | Ga0501032_0375624 | Ga0501032_0375624_63_803 | 246 |
| 1278 | 3300049570 | Ga0501033_0000029 | Ga0501033_0000029_114026_114772 | 246 |
| 1279 | 3300049570 | Ga0501033_0000210 | Ga0501033_0000210_39232_39972 | 246 |
| 1280 | 3300049570 | Ga0501033_0014151 | Ga0501033_0014151_3103_3843 | 246 |
| 1281 | 3300049570 | Ga0501033_0029259 | Ga0501033_0029259_749_1495 | 246 |
| 1282 | 3300049570 | Ga0501033_0040867 | Ga0501033_0040867_753_1556 | 246 |
| 1283 | 3300049570 | Ga0501033_0050293 | Ga0501033_0050293_135_875 | 246 |
| 1284 | 3300049570 | Ga0501033_0142089 | Ga0501033_0142089_12_752 | 246 |
| 1285 | 3300049570 | Ga0501033_0226633 | Ga0501033_0226633_391_1143 | 246 |
| 1286 | 3300049571 | Ga0501034_0000102 | Ga0501034_0000102_114034_114780 | 246 |
| 1287 | 3300049571 | Ga0501034_0010066 | Ga0501034_0010066_3705_4445 | 246 |
| 1288 | 3300049571 | Ga0501034_0022378 | Ga0501034_0022378_4861_5670 | 246 |
| 1289 | 3300049571 | Ga0501034_0058070 | Ga0501034_0058070_1835_2581 | 246 |
| 1290 | 3300049571 | Ga0501034_0080355 | Ga0501034_0080355_1949_2689 | 246 |
| 1291 | 3300049571 | Ga0501034_0111704 | Ga0501034_0111704_135_875 | 246 |
| 1292 | 3300049571 | Ga0501034_0131166 | Ga0501034_0131166_677_1429 | 246 |
| 1293 | 3300049571 | Ga0501034_0138098 | Ga0501034_0138098_297_1037 | 246 |
| 1294 | 3300049571 | Ga0501034_0154056 | Ga0501034_0154056_888_1637 | 246 |
| 1295 | 3300049571 | Ga0501034_0185301 | Ga0501034_0185301_1064_1816 | 246 |
| 1296 | 3300049572 | Ga0501036_0000011 | Ga0501036_0000011_43523_44269 | 246 |
| 1297 | 3300049572 | Ga0501036_0028446 | Ga0501036_0028446_2994_3734 | 246 |
| 1298 | 3300049572 | Ga0501036_0029066 | Ga0501036_0029066_1233_1973 | 246 |
| 1299 | 3300049572 | Ga0501036_0112113 | Ga0501036_0112113_1535_2278 | 246 |
| 1300 | 3300049572 | Ga0501036_0151100 | Ga0501036_0151100_726_1469 | 246 |
| 1301 | 3300049572 | Ga0501036_0167560 | Ga0501036_0167560_975_1715 | 246 |
| 1302 | 3300049572 | Ga0501036_0270847 | Ga0501036_0270847_98_838 | 246 |
| 1303 | 3300049572 | Ga0501036_0308729 | Ga0501036_0308729_27_767 | 246 |
| 1304 | 3300049572 | Ga0501036_0505528 | Ga0501036_0505528_170_910 | 246 |
| 1305 | 3300049572 | Ga0501036_0580523 | Ga0501036_0580523_13_765 | 246 |
| 1306 | 3300049572 | Ga0501036_0754375 | Ga0501036_0754375_14_754 | 246 |
| 1307 | 3300049573 | Ga0501037_0000015 | Ga0501037_0000015_46532_47278 | 246 |
| 1308 | 3300049573 | Ga0501037_0015564 | Ga0501037_0015564_2665_3405 | 246 |
| 1309 | 3300049573 | Ga0501037_0036508 | Ga0501037_0036508_990_1730 | 246 |
| 1310 | 3300049573 | Ga0501037_0140858 | Ga0501037_0140858_442_1188 | 246 |
| 1311 | 3300049573 | Ga0501037_0154317 | Ga0501037_0154317_598_1386 | 246 |
| 1312 | 3300049573 | Ga0501037_0220141 | Ga0501037_0220141_307_1059 | 246 |
| 1313 | 3300049573 | Ga0501037_0226416 | Ga0501037_0226416_326_1066 | 246 |
| 1314 | 3300049574 | Ga0501038_0000016 | Ga0501038_0000016_114034_114780 | 246 |
| 1315 | 3300049574 | Ga0501038_0016141 | Ga0501038_0016141_2107_2898 | 246 |
| 1316 | 3300049574 | Ga0501038_0017713 | Ga0501038_0017713_3936_4676 | 246 |
| 1317 | 3300049574 | Ga0501038_0043422 | Ga0501038_0043422_1679_2419 | 246 |
| 1318 | 3300049574 | Ga0501038_0064206 | Ga0501038_0064206_135_875 | 246 |
| 1319 | 3300049574 | Ga0501038_0071775 | Ga0501038_0071775_791_1531 | 246 |
| 1320 | 3300049574 | Ga0501038_0089947 | Ga0501038_0089947_1459_2211 | 246 |
| 1321 | 3300049574 | Ga0501038_0093812 | Ga0501038_0093812_254_1003 | 246 |
| 1322 | 3300049574 | Ga0501038_0345032 | Ga0501038_0345032_346_1098 | 246 |
| 1323 | 3300049575 | Ga0501039_0000023 | Ga0501039_0000023_114034_114780 | 246 |
| 1324 | 3300049575 | Ga0501039_0004433 | Ga0501039_0004433_9803_10543 | 246 |
| 1325 | 3300049575 | Ga0501039_0028219 | Ga0501039_0028219_1232_2023 | 246 |
| 1326 | 3300049575 | Ga0501039_0031181 | Ga0501039_0031181_990_1730 | 246 |
| 1327 | 3300049575 | Ga0501039_0119894 | Ga0501039_0119894_1117_1857 | 246 |
| 1328 | 3300049575 | Ga0501039_0133599 | Ga0501039_0133599_641_1381 | 246 |
| 1329 | 3300049575 | Ga0501039_0325715 | Ga0501039_0325715_281_1021 | 246 |
| 1330 | 3300049576 | Ga0501040_0008206 | Ga0501040_0008206_4251_5054 | 246 |
| 1331 | 3300049576 | Ga0501040_0019932 | Ga0501040_0019932_3691_4437 | 246 |
| 1332 | 3300049576 | Ga0501040_0026385 | Ga0501040_0026385_2344_3084 | 246 |
| 1333 | 3300049576 | Ga0501040_0026743 | Ga0501040_0026743_1299_2090 | 246 |
| 1334 | 3300049576 | Ga0501040_0148247 | Ga0501040_0148247_614_1354 | 246 |
| 1335 | 3300049576 | Ga0501040_0181154 | Ga0501040_0181154_600_1340 | 246 |
| 1336 | 3300049577 | Ga0501041_0025799 | Ga0501041_0025799_2029_2769 | 246 |
| 1337 | 3300049577 | Ga0501041_0408741 | Ga0501041_0408741_45_785 | 246 |
| 1338 | 3300049578 | Ga0501042_0013408 | Ga0501042_0013408_1611_2351 | 246 |
| 1339 | 3300049578 | Ga0501042_0013841 | Ga0501042_0013841_709_1500 | 246 |
| 1340 | 3300049579 | Ga0501043_0023532 | Ga0501043_0023532_1538_2278 | 246 |
| 1341 | 3300049579 | Ga0501043_0032719 | Ga0501043_0032719_912_1652 | 246 |
| 1342 | 3300049579 | Ga0501043_0033981 | Ga0501043_0033981_135_875 | 246 |
| 1343 | 3300049579 | Ga0501043_0035819 | Ga0501043_0035819_2213_2953 | 246 |
| 1344 | 3300049579 | Ga0501043_0062648 | Ga0501043_0062648_1508_2248 | 246 |
| 1345 | 3300049579 | Ga0501043_0098517 | Ga0501043_0098517_1015_1755 | 246 |
| 1346 | 3300049579 | Ga0501043_0157612 | Ga0501043_0157612_134_874 | 246 |
| 1347 | 3300049580 | Ga0501046_0025041 | Ga0501046_0025041_2870_3673 | 246 |
| 1348 | 3300049580 | Ga0501046_0059780 | Ga0501046_0059780_1343_2134 | 246 |
| 1349 | 3300049580 | Ga0501046_0174005 | Ga0501046_0174005_224_976 | 246 |
| 1350 | 3300049581 | Ga0501047_0003203 | Ga0501047_0003203_13616_14362 | 246 |
| 1351 | 3300049581 | Ga0501047_0026623 | Ga0501047_0026623_1259_1999 | 246 |
| 1352 | 3300049581 | Ga0501047_0047340 | Ga0501047_0047340_2190_2942 | 246 |
| 1353 | 3300049581 | Ga0501047_0048280 | Ga0501047_0048280_2381_3121 | 246 |
| 1354 | 3300049581 | Ga0501047_0068877 | Ga0501047_0068877_2103_2855 | 246 |
| 1355 | 3300049581 | Ga0501047_0075275 | Ga0501047_0075275_2254_2994 | 246 |
| 1356 | 3300049581 | Ga0501047_0172479 | Ga0501047_0172479_1167_1907 | 246 |
| 1357 | 3300049581 | Ga0501047_0396161 | Ga0501047_0396161_105_845 | 246 |
| 1358 | 3300049582 | Ga0501048_0001620 | Ga0501048_0001620_13143_13883 | 246 |
| 1359 | 3300049583 | Ga0501067_0058783 | Ga0501067_0058783_376_1116 | 246 |
| 1360 | 3300049583 | Ga0501067_0070588 | Ga0501067_0070588_878_1618 | 246 |
| 1361 | 3300049583 | Ga0501067_0257412 | Ga0501067_0257412_69_809 | 246 |
| 1362 | 3300049584 | Ga0501068_0009831 | Ga0501068_0009831_357_1097 | 246 |
| 1363 | 3300049584 | Ga0501068_0015059 | Ga0501068_0015059_263_1003 | 246 |
| 1364 | 3300049584 | Ga0501068_0016664 | Ga0501068_0016664_3439_4191 | 246 |
| 1365 | 3300049584 | Ga0501068_0225359 | Ga0501068_0225359_439_1179 | 246 |
| 1366 | 3300049584 | Ga0501068_0251236 | Ga0501068_0251236_76_816 | 246 |
| 1367 | 3300049585 | Ga0501069_0084739 | Ga0501069_0084739_569_1309 | 246 |
| 1368 | 3300049586 | Ga0501070_0018522 | Ga0501070_0018522_2847_3593 | 246 |
| 1369 | 3300049586 | Ga0501070_0018945 | Ga0501070_0018945_1485_2231 | 246 |
| 1370 | 3300049586 | Ga0501070_0020275 | Ga0501070_0020275_989_1729 | 246 |
| 1371 | 3300049586 | Ga0501070_0025557 | Ga0501070_0025557_1935_2675 | 246 |
| 1372 | 3300049586 | Ga0501070_0037015 | Ga0501070_0037015_2620_3360 | 246 |
| 1373 | 3300049586 | Ga0501070_0068629 | Ga0501070_0068629_2135_2875 | 246 |
| 1374 | 3300049586 | Ga0501070_0133287 | Ga0501070_0133287_818_1558 | 246 |
| 1375 | 3300049586 | Ga0501070_0209466 | Ga0501070_0209466_158_898 | 246 |
| 1376 | 3300049587 | Ga0501071_0017388 | Ga0501071_0017388_132_872 | 246 |
| 1377 | 3300049587 | Ga0501071_0039620 | Ga0501071_0039620_2016_2819 | 246 |
| 1378 | 3300049587 | Ga0501071_0050093 | Ga0501071_0050093_1930_2670 | 246 |
| 1379 | 3300049587 | Ga0501071_0184284 | Ga0501071_0184284_169_972 | 246 |
| 1380 | 3300049587 | Ga0501071_0205630 | Ga0501071_0205630_252_1004 | 246 |
| 1381 | 3300049587 | Ga0501071_0217406 | Ga0501071_0217406_50_790 | 246 |
| 1382 | 3300049587 | Ga0501071_0315002 | Ga0501071_0315002_422_1162 | 246 |
| 1383 | 3300049588 | Ga0501072_0037641 | Ga0501072_0037641_2195_2935 | 246 |
| 1384 | 3300049588 | Ga0501072_0049250 | Ga0501072_0049250_1247_2038 | 246 |
| 1385 | 3300049588 | Ga0501072_0083812 | Ga0501072_0083812_1155_1895 | 246 |
| 1386 | 3300049589 | Ga0501073_0005813 | Ga0501073_0005813_387_1223 | 246 |
| 1387 | 3300049589 | Ga0501073_0008806 | Ga0501073_0008806_3605_4345 | 246 |
| 1388 | 3300049589 | Ga0501073_0019992 | Ga0501073_0019992_190_930 | 246 |
| 1389 | 3300049589 | Ga0501073_0042901 | Ga0501073_0042901_1948_2688 | 246 |
| 1390 | 3300049589 | Ga0501073_0066141 | Ga0501073_0066141_1408_2148 | 246 |
| 1391 | 3300049589 | Ga0501073_0073408 | Ga0501073_0073408_290_1030 | 246 |
| 1392 | 3300049589 | Ga0501073_0077498 | Ga0501073_0077498_1194_1934 | 246 |
| 1393 | 3300049589 | Ga0501073_0138474 | Ga0501073_0138474_883_1623 | 246 |
| 1394 | 3300049590 | Ga0501074_0047062 | Ga0501074_0047062_1405_2151 | 246 |
| 1395 | 3300049590 | Ga0501074_0060169 | Ga0501074_0060169_1820_2560 | 246 |
| 1396 | 3300049590 | Ga0501074_0065331 | Ga0501074_0065331_1086_1877 | 246 |
| 1397 | 3300049590 | Ga0501074_0155968 | Ga0501074_0155968_751_1503 | 246 |
| 1398 | 3300049590 | Ga0501074_0165729 | Ga0501074_0165729_536_1276 | 246 |
| 1399 | 3300049590 | Ga0501074_0385325 | Ga0501074_0385325_11_814 | 246 |
| 1400 | 3300049591 | Ga0501075_0000163 | Ga0501075_0000163_1306_2097 | 246 |
| 1401 | 3300049591 | Ga0501075_0020817 | Ga0501075_0020817_253_1056 | 246 |
| 1402 | 3300049591 | Ga0501075_0087012 | Ga0501075_0087012_1308_2096 | 246 |
| 1403 | 3300049592 | Ga0501076_0000053 | Ga0501076_0000053_13735_14526 | 246 |
| 1404 | 3300049592 | Ga0501076_0011116 | Ga0501076_0011116_5467_6270 | 246 |
| 1405 | 3300049592 | Ga0501076_0025466 | Ga0501076_0025466_2086_2826 | 246 |
| 1406 | 3300049592 | Ga0501076_0152505 | Ga0501076_0152505_506_1249 | 246 |
| 1407 | 3300049592 | Ga0501076_0227431 | Ga0501076_0227431_28_768 | 246 |
| 1408 | 3300049592 | Ga0501076_0322436 | Ga0501076_0322436_34_774 | 246 |
| 1409 | 3300049593 | Ga0501077_0015654 | Ga0501077_0015654_2083_2823 | 246 |
| 1410 | 3300049593 | Ga0501077_0039624 | Ga0501077_0039624_419_1210 | 246 |
| 1411 | 3300049593 | Ga0501077_0137745 | Ga0501077_0137745_135_875 | 246 |
| 1412 | 3300049593 | Ga0501077_0399241 | Ga0501077_0399241_71_811 | 246 |
| 1413 | 3300049686 | Ga0501257_006345 | Ga0501257_006345_1797_2537 | 246 |
| 1414 | 3300049741 | Ga0501079_0014659 | Ga0501079_0014659_1299_2090 | 246 |
| 1415 | 3300049741 | Ga0501079_0035053 | Ga0501079_0035053_386_1189 | 246 |
| 1416 | 3300049741 | Ga0501079_0045986 | Ga0501079_0045986_1058_1798 | 246 |
| 1417 | 3300049741 | Ga0501079_0305361 | Ga0501079_0305361_422_1162 | 246 |
| 1418 | 3300049741 | Ga0501079_0394709 | Ga0501079_0394709_202_942 | 246 |
| 1419 | 3300049741 | Ga0501079_0406008 | Ga0501079_0406008_47_787 | 246 |
| 1420 | 3300049742 | Ga0501080_0021292 | Ga0501080_0021292_2901_3662 | 246 |
| 1421 | 3300049742 | Ga0501080_0033395 | Ga0501080_0033395_2077_2817 | 246 |
| 1422 | 3300049742 | Ga0501080_0034299 | Ga0501080_0034299_3465_4256 | 246 |
| 1423 | 3300049742 | Ga0501080_0036427 | Ga0501080_0036427_2426_3166 | 246 |
| 1424 | 3300049742 | Ga0501080_0044767 | Ga0501080_0044767_2512_3252 | 246 |
| 1425 | 3300049742 | Ga0501080_0053973 | Ga0501080_0053973_1885_2637 | 246 |
| 1426 | 3300049742 | Ga0501080_0073436 | Ga0501080_0073436_1348_2088 | 246 |
| 1427 | 3300049742 | Ga0501080_0212505 | Ga0501080_0212505_497_1237 | 246 |
| 1428 | 3300049743 | Ga0501081_0005369 | Ga0501081_0005369_7520_8260 | 246 |
| 1429 | 3300049743 | Ga0501081_0074096 | Ga0501081_0074096_263_1003 | 246 |
| 1430 | 3300049743 | Ga0501081_0102062 | Ga0501081_0102062_859_1599 | 246 |
| 1431 | 3300049743 | Ga0501081_0326101 | Ga0501081_0326101_304_1044 | 246 |
| 1432 | 3300049744 | Ga0501083_0031312 | Ga0501083_0031312_2052_2792 | 246 |
| 1433 | 3300049744 | Ga0501083_0057902 | Ga0501083_0057902_279_1070 | 246 |
| 1434 | 3300049744 | Ga0501083_0072113 | Ga0501083_0072113_1312_2058 | 246 |
| 1435 | 3300049744 | Ga0501083_0137946 | Ga0501083_0137946_107_847 | 246 |
| 1436 | 3300049744 | Ga0501083_0374056 | Ga0501083_0374056_63_803 | 246 |
| 1437 | 3300049822 | Ga0501035_0000038 | Ga0501035_0000038_44039_44785 | 246 |
| 1438 | 3300049822 | Ga0501035_0003069 | Ga0501035_0003069_2957_3697 | 246 |
| 1439 | 3300049822 | Ga0501035_0025834 | Ga0501035_0025834_2931_3671 | 246 |
| 1440 | 3300049822 | Ga0501035_0076163 | Ga0501035_0076163_518_1258 | 246 |
| 1441 | 3300049822 | Ga0501035_0105264 | Ga0501035_0105264_135_875 | 246 |
| 1442 | 3300049822 | Ga0501035_0194557 | Ga0501035_0194557_424_1176 | 246 |
| 1443 | 3300049822 | Ga0501035_0198470 | Ga0501035_0198470_345_1085 | 246 |
| 1444 | 3300049822 | Ga0501035_0259307 | Ga0501035_0259307_333_1085 | 246 |
| 1445 | 3300049822 | Ga0501035_0500299 | Ga0501035_0500299_16_762 | 246 |
| 1446 | 3300049822 | Ga0501035_0518539 | Ga0501035_0518539_131_880 | 246 |
| 1447 | 3300049823 | Ga0501044_0000046 | Ga0501044_0000046_32033_32779 | 246 |
| 1448 | 3300049823 | Ga0501044_0028299 | Ga0501044_0028299_2141_2881 | 246 |
| 1449 | 3300049823 | Ga0501044_0060853 | Ga0501044_0060853_2990_3730 | 246 |
| 1450 | 3300049823 | Ga0501044_0085509 | Ga0501044_0085509_1789_2541 | 246 |
| 1451 | 3300049823 | Ga0501044_0155718 | Ga0501044_0155718_763_1503 | 246 |
| 1452 | 3300049823 | Ga0501044_0165843 | Ga0501044_0165843_879_1619 | 246 |
| 1453 | 3300049823 | Ga0501044_0223045 | Ga0501044_0223045_804_1544 | 246 |
| 1454 | 3300049823 | Ga0501044_0574492 | Ga0501044_0574492_191_940 | 246 |
| 1455 | 3300049824 | Ga0501045_0026735 | Ga0501045_0026735_1271_2074 | 246 |
| 1456 | 3300049824 | Ga0501045_0033596 | Ga0501045_0033596_1892_2632 | 246 |
| 1457 | 3300049824 | Ga0501045_0126575 | Ga0501045_0126575_902_1693 | 246 |
| 1458 | 3300049824 | Ga0501045_0195777 | Ga0501045_0195777_632_1372 | 246 |
| 1459 | 3300049824 | Ga0501045_0243791 | Ga0501045_0243791_72_812 | 246 |
| 1460 | 3300049824 | Ga0501045_0530819 | Ga0501045_0530819_113_853 | 246 |
| 1461 | 3300050490 | nmdc:mga03n38_24270_c1 | nmdc:mga03n38_24270_c1_435_1175 | 246 |
| 1462 | 3300050490 | nmdc:mga03n38_299517_c1 | nmdc:mga03n38_299517_c1_20_760 | 246 |
| 1463 | 3300050490 | nmdc:mga03n38_42252_c1 | nmdc:mga03n38_42252_c1_103_1023 | 246 |
| 1464 | 3300050491 | nmdc:mga00v17_46612_c1 | nmdc:mga00v17_46612_c1_252_1025 | 246 |
| 1465 | 3300050491 | nmdc:mga00v17_68047_c1 | nmdc:mga00v17_68047_c1_917_1657 | 246 |
| 1466 | 3300050491 | nmdc:mga00v17_78770_c1 | nmdc:mga00v17_78770_c1_678_1418 | 246 |
| 1467 | 3300050492 | nmdc:mga0yw44_104110_c1 | nmdc:mga0yw44_104110_c1_378_1118 | 246 |
| 1468 | 3300050492 | nmdc:mga0yw44_114611_c1 | nmdc:mga0yw44_114611_c1_461_1204 | 246 |
| 1469 | 3300050492 | nmdc:mga0yw44_17726_c1 | nmdc:mga0yw44_17726_c1_1445_2185 | 246 |
| 1470 | 3300050492 | nmdc:mga0yw44_5085_c1 | nmdc:mga0yw44_5085_c1_2530_3270 | 246 |
| 1471 | 3300050492 | nmdc:mga0yw44_71757_c1 | nmdc:mga0yw44_71757_c1_518_1261 | 246 |
| 1472 | 3300050492 | nmdc:mga0yw44_7481_c1 | nmdc:mga0yw44_7481_c1_4560_5303 | 246 |
| 1473 | 3300050492 | nmdc:mga0yw44_8283_c1 | nmdc:mga0yw44_8283_c1_3382_4155 | 246 |
| 1474 | 3300050493 | nmdc:mga0k408_137152_c1 | nmdc:mga0k408_137152_c1_636_1376 | 246 |
| 1475 | 3300050493 | nmdc:mga0k408_1436_c1 | nmdc:mga0k408_1436_c1_2935_3675 | 246 |
| 1476 | 3300050493 | nmdc:mga0k408_37877_c1 | nmdc:mga0k408_37877_c1_1012_1752 | 246 |
| 1477 | 3300050493 | nmdc:mga0k408_4087_c1 | nmdc:mga0k408_4087_c1_2592_3332 | 246 |
| 1478 | 3300050494 | nmdc:mga06z11_10062_c1 | nmdc:mga06z11_10062_c1_1304_2044 | 246 |
| 1479 | 3300050494 | nmdc:mga06z11_18996_c1 | nmdc:mga06z11_18996_c1_975_1748 | 246 |
| 1480 | 3300050494 | nmdc:mga06z11_96099_c1 | nmdc:mga06z11_96099_c1_601_1521 | 246 |
| 1481 | 3300050495 | nmdc:mga04h51_141771_c1 | nmdc:mga04h51_141771_c1_42_815 | 246 |
| 1482 | 3300050495 | nmdc:mga04h51_3374_c1 | nmdc:mga04h51_3374_c1_2611_3351 | 246 |
| 1483 | 3300050496 | nmdc:mga07m45_15562_c1 | nmdc:mga07m45_15562_c1_3214_3954 | 246 |
| 1484 | 3300050496 | nmdc:mga07m45_38336_c1 | nmdc:mga07m45_38336_c1_907_1647 | 246 |
| 1485 | 3300050507 | nmdc:mga05p37_155007_c1 | nmdc:mga05p37_155007_c1_957_1820 | 246 |
| 1486 | 3300050507 | nmdc:mga05p37_233069_c1 | nmdc:mga05p37_233069_c1_314_1054 | 246 |
| 1487 | 3300050508 | nmdc:mga09592_244179_c1 | nmdc:mga09592_244179_c1_223_963 | 246 |
| 1488 | 3300050509 | nmdc:mga0qj67_49363_c1 | nmdc:mga0qj67_49363_c1_1488_2228 | 246 |
| 1489 | 3300050510 | nmdc:mga06r32_3096_c1 | nmdc:mga06r32_3096_c1_10111_10851 | 246 |
| 1490 | 3300050510 | nmdc:mga06r32_76935_c1 | nmdc:mga06r32_76935_c1_1628_2368 | 246 |
| 1491 | 3300050511 | nmdc:mga08y16_212436_c1 | nmdc:mga08y16_212436_c1_648_1388 | 246 |
| 1492 | 3300050511 | nmdc:mga08y16_473803_c1 | nmdc:mga08y16_473803_c1_194_934 | 246 |
| 1493 | 3300050511 | nmdc:mga08y16_595_c1 | nmdc:mga08y16_595_c1_2388_3128 | 246 |
| 1494 | 3300050511 | nmdc:mga08y16_955572_c1 | nmdc:mga08y16_955572_c1_43_783 | 246 |
| 1495 | 3300050512 | nmdc:mga0n895_71252_c1 | nmdc:mga0n895_71252_c1_648_1388 | 246 |
| 1496 | 3300050512 | nmdc:mga0n895_782_c1 | nmdc:mga0n895_782_c1_16762_17502 | 246 |
| 1497 | 3300050513 | nmdc:mga0rr50_24139_c1 | nmdc:mga0rr50_24139_c1_1637_2377 | 246 |
| 1498 | 3300050515 | nmdc:mga0a205_216920_c1 | nmdc:mga0a205_216920_c1_736_1476 | 246 |
| 1499 | 3300050515 | nmdc:mga0a205_377503_c1 | nmdc:mga0a205_377503_c1_188_928 | 246 |
| 1500 | 3300050515 | nmdc:mga0a205_6389_c1 | nmdc:mga0a205_6389_c1_856_1596 | 246 |
| 1501 | 3300050516 | nmdc:mga0sz30_2709_c1 | nmdc:mga0sz30_2709_c1_2195_2935 | 246 |
| 1502 | 3300050516 | nmdc:mga0sz30_42656_c1 | nmdc:mga0sz30_42656_c1_793_1533 | 246 |
| 1503 | 3300050516 | nmdc:mga0sz30_51037_c1 | nmdc:mga0sz30_51037_c1_912_1652 | 246 |
| 1504 | 3300053077 | Ga0495601_0000401 | Ga0495601_0000401_18350_19096 | 246 |
| 1505 | 3300053077 | Ga0495601_0041759 | Ga0495601_0041759_1772_2572 | 246 |
| 1506 | 3300053078 | Ga0495612_0004593 | Ga0495612_0004593_476_1222 | 246 |
| 1507 | 3300053080 | Ga0500635_0001263 | Ga0500635_0001263_3522_4265 | 246 |
| 1508 | 3300053083 | Ga0495655_0006637 | Ga0495655_0006637_738_1478 | 246 |
| 1509 | 3300053084 | Ga0495595_0028715 | Ga0495595_0028715_1565_2359 | 246 |
| 1510 | 3300053085 | Ga0495619_0021683 | Ga0495619_0021683_2009_2755 | 246 |
| 1511 | 3300053085 | Ga0495619_0065107 | Ga0495619_0065107_842_1588 | 246 |
| 1512 | 3300053085 | Ga0495619_0086737 | Ga0495619_0086737_203_949 | 246 |
| 1513 | 3300053085 | Ga0495619_0119100 | Ga0495619_0119100_659_1453 | 246 |
| 1514 | 3300053086 | Ga0500578_0039666 | Ga0500578_0039666_1439_2179 | 246 |
| 1515 | 3300053087 | Ga0500643_051840 | Ga0500643_051840_71_811 | 246 |
| 1516 | 3300053088 | Ga0500644_0034129 | Ga0500644_0034129_236_976 | 246 |
| 1517 | 3300053090 | Ga0500646_0017535 | Ga0500646_0017535_633_1373 | 246 |
| 1518 | 3300053091 | Ga0500647_0006028 | Ga0500647_0006028_1745_2488 | 246 |
| 1519 | 3300053091 | Ga0500647_0106100 | Ga0500647_0106100_376_1116 | 246 |
| 1520 | 3300053092 | Ga0500583_0016915 | Ga0500583_0016915_460_1200 | 246 |
| 1521 | 3300053093 | Ga0500651_0048095 | Ga0500651_0048095_1177_1917 | 246 |
| 1522 | 3300053094 | Ga0500566_0007888 | Ga0500566_0007888_4044_4787 | 246 |
| 1523 | 3300053094 | Ga0500566_0031098 | Ga0500566_0031098_310_1050 | 246 |
| 1524 | 3300053094 | Ga0500566_0158317 | Ga0500566_0158317_106_846 | 246 |
| 1525 | 3300053096 | Ga0500641_0152109 | Ga0500641_0152109_142_885 | 246 |
| 1526 | 3300053098 | Ga0500650_0033296 | Ga0500650_0033296_1269_2009 | 246 |
| 1527 | 3300053103 | Ga0500555_003111 | Ga0500555_003111_2165_2905 | 246 |
| 1528 | 3300053103 | Ga0500555_012168 | Ga0500555_012168_947_1687 | 246 |
| 1529 | 3300053104 | Ga0500556_0024413 | Ga0500556_0024413_290_1030 | 246 |
| 1530 | 3300053108 | Ga0500562_006674 | Ga0500562_006674_1781_2521 | 246 |
| 1531 | 3300053108 | Ga0500562_079513 | Ga0500562_079513_67_807 | 246 |
| 1532 | 3300053111 | Ga0500572_024060 | Ga0500572_024060_342_1085 | 246 |
| 1533 | 3300053116 | Ga0500592_008699 | Ga0500592_008699_304_1044 | 246 |
| 1534 | 3300053118 | Ga0500594_0004484 | Ga0500594_0004484_330_1070 | 246 |
| 1535 | 3300053118 | Ga0500594_0047780 | Ga0500594_0047780_85_894 | 246 |
| 1536 | 3300053119 | Ga0500595_000266 | Ga0500595_000266_28683_29462 | 246 |
| 1537 | 3300053119 | Ga0500595_001200 | Ga0500595_001200_7525_8265 | 246 |
| 1538 | 3300053119 | Ga0500595_015995 | Ga0500595_015995_833_1573 | 246 |
| 1539 | 3300053119 | Ga0500595_020314 | Ga0500595_020314_1513_2292 | 246 |
| 1540 | 3300053119 | Ga0500595_028672 | Ga0500595_028672_464_1207 | 246 |
| 1541 | 3300053122 | Ga0500608_063462 | Ga0500608_063462_778_1518 | 246 |
| 1542 | 3300053122 | Ga0500608_117175 | Ga0500608_117175_96_839 | 246 |
| 1543 | 3300053123 | Ga0500614_043074 | Ga0500614_043074_38_781 | 246 |
| 1544 | 3300053130 | Ga0500642_0000900 | Ga0500642_0000900_6005_6745 | 246 |
| 1545 | 3300053130 | Ga0500642_0065334 | Ga0500642_0065334_732_1472 | 246 |
| 1546 | 3300053130 | Ga0500642_0129993 | Ga0500642_0129993_319_1128 | 246 |
| 1547 | 3300053134 | Ga0500658_0007094 | Ga0500658_0007094_2865_3605 | 246 |
| 1548 | 3300053134 | Ga0500658_0016918 | Ga0500658_0016918_399_1139 | 246 |
| 1549 | 3300053134 | Ga0500658_0113384 | Ga0500658_0113384_340_1080 | 246 |
| 1550 | 3300053137 | Ga0500561_0044642 | Ga0500561_0044642_383_1123 | 246 |
| 1551 | 3300053139 | Ga0500568_0000415 | Ga0500568_0000415_4178_4918 | 246 |
| 1552 | 3300053139 | Ga0500568_0001174 | Ga0500568_0001174_2477_3217 | 246 |
| 1553 | 3300053140 | Ga0500573_0060387 | Ga0500573_0060387_157_897 | 246 |
| 1554 | 3300053142 | Ga0500577_0068019 | Ga0500577_0068019_624_1364 | 246 |
| 1555 | 3300053142 | Ga0500577_0105596 | Ga0500577_0105596_377_1117 | 246 |
| 1556 | 3300053146 | Ga0500588_0001609 | Ga0500588_0001609_128_868 | 246 |
| 1557 | 3300053146 | Ga0500588_0007470 | Ga0500588_0007470_732_1472 | 246 |
| 1558 | 3300053150 | Ga0500603_021372 | Ga0500603_021372_587_1327 | 246 |
| 1559 | 3300053151 | Ga0500604_0009878 | Ga0500604_0009878_1281_2021 | 246 |
| 1560 | 3300053151 | Ga0500604_0019145 | Ga0500604_0019145_827_1567 | 246 |
| 1561 | 3300053153 | Ga0500616_0002694 | Ga0500616_0002694_7533_8273 | 246 |
| 1562 | 3300053153 | Ga0500616_0055477 | Ga0500616_0055477_222_965 | 246 |
| 1563 | 3300053153 | Ga0500616_0088404 | Ga0500616_0088404_349_1089 | 246 |
| 1564 | 3300053153 | Ga0500616_0208982 | Ga0500616_0208982_26_766 | 246 |
| 1565 | 3300053154 | Ga0500619_122099 | Ga0500619_122099_32_814 | 246 |
| 1566 | 3300053155 | Ga0500620_000234 | Ga0500620_000234_356_1099 | 246 |
| 1567 | 3300053156 | Ga0500622_0000646 | Ga0500622_0000646_17335_18075 | 246 |
| 1568 | 3300053156 | Ga0500622_0000772 | Ga0500622_0000772_5567_6307 | 246 |
| 1569 | 3300053156 | Ga0500622_0059991 | Ga0500622_0059991_1044_1787 | 246 |
| 1570 | 3300053156 | Ga0500622_0084763 | Ga0500622_0084763_796_1536 | 246 |
| 1571 | 3300053158 | Ga0500627_0006268 | Ga0500627_0006268_186_926 | 246 |
| 1572 | 3300053158 | Ga0500627_0032262 | Ga0500627_0032262_990_1733 | 246 |
| 1573 | 3300053158 | Ga0500627_0073122 | Ga0500627_0073122_656_1396 | 246 |
| 1574 | 3300053158 | Ga0500627_0079467 | Ga0500627_0079467_63_803 | 246 |
| 1575 | 3300053158 | Ga0500627_0099687 | Ga0500627_0099687_334_1074 | 246 |
| 1576 | 3300053158 | Ga0500627_0236847 | Ga0500627_0236847_12_752 | 246 |
| 1577 | 3300053159 | Ga0500630_121514 | Ga0500630_121514_233_976 | 246 |
| 1578 | 3300053160 | Ga0500633_0030142 | Ga0500633_0030142_748_1488 | 246 |
| 1579 | 3300053161 | Ga0500634_0037402 | Ga0500634_0037402_97_837 | 246 |
| 1580 | 3300053161 | Ga0500634_0062976 | Ga0500634_0062976_169_930 | 246 |
| 1581 | 3300053162 | Ga0500638_158005 | Ga0500638_158005_188_928 | 246 |
| 1582 | 3300053163 | Ga0500639_004632 | Ga0500639_004632_3096_3839 | 246 |
| 1583 | 3300053163 | Ga0500639_089488 | Ga0500639_089488_263_1003 | 246 |
| 1584 | 3300053177 | Ga0500636_0011613 | Ga0500636_0011613_1464_2243 | 246 |
| 1585 | 3300053177 | Ga0500636_0044811 | Ga0500636_0044811_1521_2261 | 246 |
| 1586 | 3300053177 | Ga0500636_0050905 | Ga0500636_0050905_1450_2190 | 246 |
| 1587 | 3300053177 | Ga0500636_0121702 | Ga0500636_0121702_284_1024 | 246 |
| 1588 | 3300053177 | Ga0500636_0166768 | Ga0500636_0166768_395_1135 | 246 |
| 1589 | 3300053177 | Ga0500636_0237738 | Ga0500636_0237738_118_858 | 246 |
| 1590 | 3300053178 | Ga0500637_0060181 | Ga0500637_0060181_351_1091 | 246 |
| 1591 | 3300053727 | Ga0500611_003636 | Ga0500611_003636_1004_1813 | 246 |
| 1592 | 3300053730 | Ga0500645_030897 | Ga0500645_030897_139_879 | 246 |
| 1593 | 3300053731 | Ga0500609_004076 | Ga0500609_004076_65_805 | 246 |
| 1594 | 3300053731 | Ga0500609_012380 | Ga0500609_012380_61_801 | 246 |
| 1595 | 3300053731 | Ga0500609_027406 | Ga0500609_027406_29_769 | 246 |
| 1596 | 3300053735 | Ga0500596_015532 | Ga0500596_015532_162_902 | 246 |
| 1597 | 3300053739 | Ga0500587_000428 | Ga0500587_000428_73_813 | 246 |
| 1598 | 3300054114 | Ga0501084_0007550 | Ga0501084_0007550_2250_3053 | 246 |
| 1599 | 3300054114 | Ga0501084_0018918 | Ga0501084_0018918_3930_4721 | 246 |
| 1600 | 3300054114 | Ga0501084_0074772 | Ga0501084_0074772_1833_2573 | 246 |
| 1601 | 3300054114 | Ga0501084_0144096 | Ga0501084_0144096_614_1354 | 246 |
| 1602 | 3300054114 | Ga0501084_0189154 | Ga0501084_0189154_202_990 | 246 |
| 1603 | 3300054114 | Ga0501084_0724310 | Ga0501084_0724310_87_827 | 246 |
| 1604 | 3300055283 | Ga0500661_008047 | Ga0500661_008047_323_1063 | 246 |
| 1605 | 3300059424 | Ga0590075_003951 | Ga0590075_003951_748_1488 | 246 |
| 1606 | 3300060353 | Ga0501082_0032387 | Ga0501082_0032387_98_838 | 246 |
| 1607 | 3300060353 | Ga0501082_0060048 | Ga0501082_0060048_225_965 | 246 |
| 1608 | 3300060353 | Ga0501082_0062878 | Ga0501082_0062878_1323_2114 | 246 |
| 1609 | 3300060353 | Ga0501082_0097519 | Ga0501082_0097519_108_848 | 246 |
| 1610 | 3300060353 | Ga0501082_0108271 | Ga0501082_0108271_1599_2339 | 246 |
| 1611 | 3300060353 | Ga0501082_0403043 | Ga0501082_0403043_67_807 | 246 |
| 1612 | 3300060353 | Ga0501082_0538073 | Ga0501082_0538073_30_770 | 246 |
| 1613 | 3300061734 | Ga0530510_0000093 | Ga0530510_0000093_32184_32975 | 246 |
| 1614 | 3300061734 | Ga0530510_0013400 | Ga0530510_0013400_3135_3938 | 246 |
| 1615 | 3300061734 | Ga0530510_0040966 | Ga0530510_0040966_1196_1936 | 246 |
| 1616 | 3300061734 | Ga0530510_0047637 | Ga0530510_0047637_1714_2454 | 246 |
| 1617 | 3300061734 | Ga0530510_0182661 | Ga0530510_0182661_360_1100 | 246 |
| 1618 | iso_pu_bacteria | 2509276021 | 2509390254 | 246 |
| 1619 | iso_pu_bacteria | 2513237146 | 2513927193 | 246 |
| 1620 | iso_pu_bacteria | 2588253730 | 2588517406 | 246 |
| 1621 | iso_pu_bacteria | 2599185170 | 2599415368 | 246 |
| 1622 | iso_pu_bacteria | 2802429605 | 2805926745 | 246 |
| 1623 | iso_pu_bacteria | 2838668709 | 2838671678 | 246 |
| 1624 | iso_pu_bacteria | 2838701080 | 2838704357 | 246 |
| 1625 | iso_pu_bacteria | 2842146304 | 2842149576 | 246 |
| 1626 | iso_pu_bacteria | 2842250916 | 2842254259 | 246 |
| 1627 | iso_pu_bacteria | 2842285085 | 2842285276 | 246 |
| 1628 | iso_pu_bacteria | 2842402390 | 2842402635 | 246 |
| 1629 | iso_pu_bacteria | 2842409023 | 2842409993 | 246 |
| 1630 | iso_pu_bacteria | 2842415677 | 2842416642 | 246 |
| 1631 | iso_pu_bacteria | 2842434925 | 2842436806 | 246 |
| 1632 | iso_pu_bacteria | 2904578770 | 2904581789 | 246 |
| 1633 | iso_pu_bacteria | 2919119836 | 2919123456 | 246 |
| 1634 | iso_pu_bacteria | 2932794094 | 2932795588 | 246 |
| 1635 | iso_pu_bacteria | 2932801729 | 2932807816 | 246 |
| 1636 | iso_pu_bacteria | 2935883170 | 2935885993 | 246 |
| 1637 | iso_pu_bacteria | 2937848649 | 2937854458 | 246 |
| 1638 | iso_pu_bacteria | 2970540015 | 2970540791 | 246 |
| 1639 | iso_pu_bacteria | 2977922695 | 2977924153 | 246 |
| 1640 | iso_pu_bacteria | 2977986579 | 2977991745 | 246 |
| 1641 | iso_pu_bacteria | 2996887358 | 2996891769 | 246 |
| 1642 | iso_pu_bacteria | 2996893221 | 2996897971 | 246 |
| 1643 | iso_pu_bacteria | 3000135777 | 3000140742 | 246 |
| 1644 | iso_pu_bacteria | 3004211236 | 3004215888 | 246 |
| 1645 | iso_pu_bacteria | 3004218560 | 3004221946 | 246 |
| 1646 | iso_pu_bacteria | 8005258706 | 8005263099 | 246 |
| 1647 | iso_pu_bacteria | 8005289223 | 8005289733 | 246 |
| 1648 | iso_pu_bacteria | 8005321885 | 8005326296 | 246 |
| 1649 | iso_pu_bacteria | 8005430974 | 8005433375 | 246 |
| 1650 | iso_pu_bacteria | 8005626139 | 8005630117 | 246 |
| 1651 | iso_pu_bacteria | 8016583857 | 8016589698 | 246 |
| 1652 | iso_pu_bacteria | 8024501048 | 8024501281 | 246 |
| 1653 | iso_pu_bacteria | 8049293176 | 8049298039 | 246 |
| 1654 | iso_pu_bacteria | 8057575449 | 8057579364 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9186 | 4 | 228 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9087 | 3 | 228 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.8861 | 1 | 226 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8827 | 2 | 228 |
| 2ihy-assembly1.cif.gz_A | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.8814 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6BEX0_1_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9759 | 1 | 241 | 3.40.50.300 |
| af_P77509_7_245_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9503 | 2 | 238 | 3.40.50.300 |
| af_P37388_2_240_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9494 | 1 | 241 | 3.40.50.300 |
| af_P37388_2_240_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9455 | 1 | 241 | 3.40.50.300 |
| af_P77257_8_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9372 | 2 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3AXL3-F1-model_v4 | deleted | 0.9934 | 1 | 246 |
|
| AF-A0A0Q6QFP7-F1-model_v4 | ABC transporter ATP-binding protein | 0.993 | 2 | 246 |
GO:0005524
GO:0016887 |
| AF-A0A0Q6QFP7-F1-model_v4 | ABC transporter ATP-binding protein | 0.985 | 2 | 246 |
GO:0005524
GO:0016887 |
| AF-A0A3R7AWQ6-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.9789 | 2 | 242 |
GO:0005524
GO:0016887 |
| AF-A0A2P7BRZ9-F1-model_v4 | ABC transporter ATP-binding protein | 0.9757 | 2 | 242 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar