F495172

General Info

Members Datasets Scaffolds Average Seq Length
1642 790 3284 125

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10259749|Ga0207690_102597492
Length 137
Sequence MNVPAELKYTASHEWVRSEPDGAITTGITDHAQQALGDLVFIELPQVGRTLKAGEACAVVESVKAASDVYAPVAGVVLAVNEAVVAAPEKVNADAYGNWLYRLKPANPGDVAKLLDAPGISRWPANPDRPRTDDGYE

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
162 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
236 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
237 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
240 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
243 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
258 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
259 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
260 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
268 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
274 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
275 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
280 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
285 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
286 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
290 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
291 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
292 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
293 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
294 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
300 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
301 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
307 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
308 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
309 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
310 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
311 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
312 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
313 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
314 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
315 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
316 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
317 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
318 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
319 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
320 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
321 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
322 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
323 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
324 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
325 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
326 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
327 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
328 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
329 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
330 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
334 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
335 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
341 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
342 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
343 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
350 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
351 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
352 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
353 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
354 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
355 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
356 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
357 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
358 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
359 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
360 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
361 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
362 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
363 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
364 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
365 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
366 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
367 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
368 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
369 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
370 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
371 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
372 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
373 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
374 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
375 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
376 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
377 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
378 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
379 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
380 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
381 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
382 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
383 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
384 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
385 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
386 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
387 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
388 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
389 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
390 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
391 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
392 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
393 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
394 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
395 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
396 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
397 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
398 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
399 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
400 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
401 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
402 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
403 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
404 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
405 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
406 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
409 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
410 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
411 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
412 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
413 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
414 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
415 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
416 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
420 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
423 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
424 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
425 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
426 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
427 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
428 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
429 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
430 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
431 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
432 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
433 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
434 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
435 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
436 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
437 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
438 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
439 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
440 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
441 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
442 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
443 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
444 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
445 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
446 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
447 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
448 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
449 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
450 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
451 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
452 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
453 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
454 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
455 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
456 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
458 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
459 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
460 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
461 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
462 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
463 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
464 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
465 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
466 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
467 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
468 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
484 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
485 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
486 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
487 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
488 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
489 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
490 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
491 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
492 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
493 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
494 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
495 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
496 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
500 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
501 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
502 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
503 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
504 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
505 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
506 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
507 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
508 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
509 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
510 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
511 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
512 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
513 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
514 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
515 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
516 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
517 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
518 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
519 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
520 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
521 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
522 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
523 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
524 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
525 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
526 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
527 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
542 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
543 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
544 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
545 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
546 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
547 2512875024
548 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
549 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
550 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
551 2547132512 Azospira oryzae 6a3 Isolate Unclassified
552 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
553 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
554 2643221556 Massilia sp. Root1485 Isolate Unclassified
555 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
556 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
557 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
558 2643221684 Massilia sp. Root133 Isolate Unclassified
559 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
560 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
561 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
562 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
563 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
564 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
565 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
566 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
567 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
568 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
569 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
570 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
571 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
572 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
573 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
574 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
575 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
576 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
577 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
578 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
579 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
580 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
581 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
582 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
583 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
584 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
585 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
586 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
587 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
588 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
589 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
590 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
591 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
592 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
593 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
594 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
595 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
596 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
597 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
598 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
599 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
600 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
601 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
602 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
603 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
604 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
605 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
606 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
607 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
608 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
609 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
610 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
611 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
612 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
613 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
614 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
615 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
616 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
617 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
618 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
619 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
620 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
621 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
622 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
623 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
624 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
625 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
626 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
627 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
628 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
629 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
630 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
631 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
632 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
633 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
634 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
635 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
636 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
637 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
638 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
639 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
640 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
641 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
642 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
643 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
644 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
645 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
646 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
647 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
648 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
649 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
650 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
651 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
652 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
653 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
654 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
655 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
656 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
657 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
658 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
659 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
660 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
661 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
662 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
663 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
664 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
665 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
666 2919404418 Luteibacter sp. 3190 Isolate Unclassified
667 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
668 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
669 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
670 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
671 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
672 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
673 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
674 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
675 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
676 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
677 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
678 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
679 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
680 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
681 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
682 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
683 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
684 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
685 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
686 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
687 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
688 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
689 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
690 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
691 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
692 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
693 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
694 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
695 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
696 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
697 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
698 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
699 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
700 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
701 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
702 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
703 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
704 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
705 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
706 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
707 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
708 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
709 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
710 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
711 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
712 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
713 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
714 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
715 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
716 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
717 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
718 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
719 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
720 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
721 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
722 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
723 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
724 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
725 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
726 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
727 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
728 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
729 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
730 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
731 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
732 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
733 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
734 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
735 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
736 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
737 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
738 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
739 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
740 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
741 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
742 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
743 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
744 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
745 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
746 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
747 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
748 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
749 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
750 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
751 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
752 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
753 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
754 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
755 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
756 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
757 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
758 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
759 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
760 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
761 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
762 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
763 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
764 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
765 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
766 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
767 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
768 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
769 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
770 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
771 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
772 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
773 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
774 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
775 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
776 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
777 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
778 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
779 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
780 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
781 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
782 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
783 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
784 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
785 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
786 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
787 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
788 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
789 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
790 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.46
Metatranscriptomes 2.31
Isolates 15.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 6.94
Nodule 12.48
Rhizoplane 2.86
Rhizosphere 73.2
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10259749 3300025932 Bacteria 1345
2 JGI24736J21556_1065209 3300001904 Bacteria 565
3 JGI24740J21852_10008429 3300001979 Bacteria 4107
4 JGI24739J22299_10038979 3300001989 Bacteria 1594
5 JGI24739J22299_10136143 3300001989 Bacteria 729
6 JGI24735J21928_10043246 3300002067 Bacteria 1310
7 JGI25157J39369_1000145 3300002741 Bacteria 60335
8 JGI25157J39369_1000826 3300002741 Bacteria 15394
9 JGI25151J46595_10000186 3300003187 Bacteria 77356
10 JGI25406J46586_10046782 3300003203 Bacteria 1479
11 JGI25406J46586_10060919 3300003203 Bacteria 1219
12 JGI25406J46586_10094540 3300003203 Bacteria 898
13 JGI25165J46597_1000325 3300003214 Bacteria 57094
14 JGI25153J46596_10044278 3300003215 Bacteria 1339
15 rootL2_10273037 3300003322 Archaea 1170
16 Ga0007410J51695_1030494 3300003574 Bacteria 564
17 Ga0006562J51391_1057637 3300003578 Bacteria 3400
18 Ga0055539_1001430 3300003752 Bacteria 4467
19 Ga0055533_1001807 3300003756 Bacteria 5378
20 Ga0055527_1000043 3300003760 Bacteria 113506
21 Ga0055535_1000071 3300003761 Bacteria 113506
22 Ga0055542_1000096 3300003762 Bacteria 118398
23 Ga0055542_1000553 3300003762 Bacteria 33171
24 Ga0055529_1000114 3300003763 Bacteria 118398
25 Ga0055529_1003236 3300003763 Bacteria 2767
26 JGI25405J52794_10001981 3300003911 Unclassified 3471
27 Ga0065165_1002388 3300005262 Bacteria 16135
28 Ga0065714_10076975 3300005288 Bacteria 2734
29 Ga0065712_10089189 3300005290 Bacteria 2472
30 Ga0065712_10666360 3300005290 Unclassified 561
31 Ga0065715_10557850 3300005293 Bacteria 736
32 Ga0065715_11025097 3300005293 Bacteria 538
33 Ga0065707_10087092 3300005295 Bacteria 5169
34 Ga0065707_10299477 3300005295 Bacteria 1007
35 Ga0065707_10537776 3300005295 Bacteria 730
36 Ga0070658_10299601 3300005327 Bacteria 1371
37 Ga0070658_10727889 3300005327 Bacteria 862
38 Ga0070658_11568455 3300005327 Bacteria 571
39 Ga0070676_10099429 3300005328 Bacteria 1795
40 Ga0070676_10329302 3300005328 Bacteria 1044
41 Ga0070683_100309720 3300005329 Bacteria 1502
42 Ga0070690_100002820 3300005330 Bacteria 9376
43 Ga0070690_100134428 3300005330 Bacteria 1673
44 Ga0070670_100058784 3300005331 Bacteria 3301
45 Ga0070670_101114720 3300005331 Bacteria 720
46 Ga0070677_10180825 3300005333 Bacteria 1004
47 Ga0068869_100028475 3300005334 Bacteria 3904
48 Ga0068869_100036100 3300005334 Bacteria 3508
49 Ga0068869_100241015 3300005334 Bacteria 1441
50 Ga0070666_10044125 3300005335 Bacteria 2986
51 Ga0070680_100000436 3300005336 Bacteria 28412
52 Ga0070680_100339878 3300005336 Bacteria 1276
53 Ga0070682_100727644 3300005337 Bacteria 798
54 Ga0068868_100050486 3300005338 Bacteria 3267
55 Ga0068868_100052894 3300005338 Bacteria 3198
56 Ga0068868_100115865 3300005338 Bacteria 2181
57 Ga0068868_100301872 3300005338 Bacteria 1360
58 Ga0070660_100268695 3300005339 Bacteria 1393
59 Ga0070689_100012027 3300005340 Bacteria 6222
60 Ga0070689_100790291 3300005340 Bacteria 834
61 Ga0070691_10214210 3300005341 Bacteria 1018
62 Ga0070691_10633740 3300005341 Bacteria 635
63 Ga0070687_100073332 3300005343 Bacteria 1845
64 Ga0070687_100122652 3300005343 Bacteria 1489
65 Ga0070687_100205813 3300005343 Bacteria 1195
66 Ga0070687_100513490 3300005343 Bacteria 809
67 Ga0070661_100029628 3300005344 Bacteria 3951
68 Ga0070661_100494998 3300005344 Bacteria 978
69 Ga0070661_101247165 3300005344 Bacteria 623
70 Ga0070692_10026902 3300005345 Bacteria 2848
71 Ga0070669_100549427 3300005353 Bacteria 963
72 Ga0070669_101526777 3300005353 Bacteria 581
73 Ga0070675_100588158 3300005354 Bacteria 1009
74 Ga0070675_101070427 3300005354 Bacteria 741
75 Ga0070671_100007704 3300005355 Bacteria 8603
76 Ga0070671_100211677 3300005355 Bacteria 1644
77 Ga0070674_100437962 3300005356 Bacteria 1076
78 Ga0070673_100001822 3300005364 Bacteria 12725
79 Ga0070673_100605258 3300005364 Bacteria 1000
80 Ga0070673_100877423 3300005364 Bacteria 831
81 Ga0070688_100002648 3300005365 Bacteria 9085
82 Ga0070659_100262714 3300005366 Bacteria 1432
83 Ga0070659_102074733 3300005366 Bacteria 511
84 Ga0070667_100032425 3300005367 Bacteria 4357
85 Ga0070667_101391840 3300005367 Bacteria 658
86 Ga0070667_101665986 3300005367 Bacteria 600
87 Ga0070709_10100469 3300005434 Bacteria 1926
88 Ga0070714_100102313 3300005435 Bacteria 2525
89 Ga0070714_100178254 3300005435 Bacteria 1932
90 Ga0070714_100292931 3300005435 Bacteria 1515
91 Ga0070713_100012514 3300005436 Bacteria 6227
92 Ga0070713_100039298 3300005436 Bacteria 3839
93 Ga0070713_100193517 3300005436 Bacteria 1834
94 Ga0070713_101044345 3300005436 Bacteria 789
95 Ga0070710_10013019 3300005437 Bacteria 4149
96 Ga0070710_10036502 3300005437 Bacteria 2687
97 Ga0070701_10002995 3300005438 Bacteria 6609
98 Ga0070701_10064909 3300005438 Bacteria 1936
99 Ga0070701_10296987 3300005438 Bacteria 992
100 Ga0070711_100005477 3300005439 Bacteria 7594
101 Ga0070705_100039297 3300005440 Bacteria 2684
102 Ga0070705_100163135 3300005440 Bacteria 1492
103 Ga0070705_100468162 3300005440 Bacteria 949
104 Ga0070705_101828626 3300005440 Bacteria 516
105 Ga0070700_100296811 3300005441 Bacteria 1178
106 Ga0070694_100071045 3300005444 Bacteria 2399
107 Ga0070694_100103302 3300005444 Bacteria 2019
108 Ga0070694_100151881 3300005444 Bacteria 1692
109 Ga0070694_100202692 3300005444 Bacteria 1480
110 Ga0070694_100217262 3300005444 Bacteria 1432
111 Ga0070694_101429228 3300005444 Bacteria 584
112 Ga0070708_100007993 3300005445 Bacteria 8472
113 Ga0070708_100129914 3300005445 Bacteria 2331
114 Ga0070708_100240409 3300005445 Bacteria 1700
115 Ga0070708_100329407 3300005445 Bacteria 1439
116 Ga0070663_100359443 3300005455 Bacteria 1181
117 Ga0070663_100398405 3300005455 Bacteria 1125
118 Ga0070663_101752934 3300005455 Bacteria 556
119 Ga0070678_100059125 3300005456 Bacteria 2816
120 Ga0070678_100624413 3300005456 Bacteria 964
121 Ga0070662_100019430 3300005457 Bacteria 4611
122 Ga0070662_100287109 3300005457 Bacteria 1333
123 Ga0070662_100304462 3300005457 Bacteria 1296
124 Ga0070681_10090610 3300005458 Bacteria 3008
125 Ga0070681_10580572 3300005458 Bacteria 1035
126 Ga0070681_11209966 3300005458 Bacteria 677
127 Ga0068867_100593667 3300005459 Bacteria 965
128 Ga0068867_100894492 3300005459 Bacteria 798
129 Ga0068867_102043528 3300005459 Unclassified 542
130 Ga0068867_102176085 3300005459 Bacteria 526
131 Ga0068867_102314126 3300005459 Bacteria 511
132 Ga0070685_10108159 3300005466 Bacteria 1708
133 Ga0070706_100002397 3300005467 Bacteria 18908
134 Ga0070706_100039497 3300005467 Bacteria 4357
135 Ga0070706_100420659 3300005467 Bacteria 1243
136 Ga0070707_100016355 3300005468 Bacteria 6962
137 Ga0070707_100016400 3300005468 Bacteria 6949
138 Ga0070707_100021949 3300005468 Bacteria 6036
139 Ga0070707_100081493 3300005468 Bacteria 3124
140 Ga0070707_100322248 3300005468 Bacteria 1502
141 Ga0070698_100003111 3300005471 Bacteria 18293
142 Ga0070698_100022873 3300005471 Bacteria 6535
143 Ga0070698_100133725 3300005471 Bacteria 2434
144 Ga0070698_100255792 3300005471 Bacteria 1684
145 Ga0070698_100350384 3300005471 Bacteria 1408
146 Ga0070698_101241008 3300005471 Bacteria 695
147 Ga0070699_100018068 3300005518 Bacteria 6058
148 Ga0070699_100347512 3300005518 Bacteria 1336
149 Ga0070699_101275382 3300005518 Bacteria 674
150 Ga0070679_100625780 3300005530 Bacteria 1019
151 Ga0070679_100751640 3300005530 Bacteria 918
152 Ga0070684_100122750 3300005535 Bacteria 2337
153 Ga0070697_100005500 3300005536 Bacteria 9765
154 Ga0070697_100102973 3300005536 Bacteria 2372
155 Ga0070697_100127420 3300005536 Bacteria 2133
156 Ga0068853_100181578 3300005539 Bacteria 1908
157 Ga0068853_100214322 3300005539 Bacteria 1756
158 Ga0070672_100015498 3300005543 Bacteria 5431
159 Ga0070686_100051239 3300005544 Bacteria 2627
160 Ga0070686_100245868 3300005544 Bacteria 1304
161 Ga0070686_100259239 3300005544 Bacteria 1274
162 Ga0070695_100020958 3300005545 Bacteria 3996
163 Ga0070695_100050716 3300005545 Bacteria 2661
164 Ga0070696_100002641 3300005546 Bacteria 11884
165 Ga0070696_100036693 3300005546 Bacteria 3380
166 Ga0070696_100119158 3300005546 Bacteria 1909
167 Ga0070696_100246852 3300005546 Bacteria 1348
168 Ga0070696_100572093 3300005546 Bacteria 908
169 Ga0070696_100656110 3300005546 Bacteria 851
170 Ga0070693_100009343 3300005547 Bacteria 4874
171 Ga0070693_100562931 3300005547 Bacteria 818
172 Ga0070665_100005394 3300005548 Bacteria 13196
173 Ga0070665_100033046 3300005548 Bacteria 5205
174 Ga0070665_100199704 3300005548 Bacteria 2000
175 Ga0070665_100217878 3300005548 Bacteria 1909
176 Ga0070665_100403241 3300005548 Bacteria 1375
177 Ga0070665_101171156 3300005548 Bacteria 780
178 Ga0070704_100007251 3300005549 Bacteria 6594
179 Ga0070704_100049539 3300005549 Bacteria 2947
180 Ga0070704_100050460 3300005549 Bacteria 2925
181 Ga0070704_100089897 3300005549 Bacteria 2285
182 Ga0070704_100300780 3300005549 Bacteria 1337
183 Ga0070704_100409023 3300005549 Bacteria 1159
184 Ga0070704_100618643 3300005549 Bacteria 953
185 Ga0068855_100234888 3300005563 Bacteria 2051
186 Ga0068855_100699410 3300005563 Bacteria 1085
187 Ga0068855_101222444 3300005563 Bacteria 780
188 Ga0070664_100118858 3300005564 Bacteria 2312
189 Ga0070664_100226051 3300005564 Bacteria 1676
190 Ga0070664_100704853 3300005564 Bacteria 941
191 Ga0068854_100040324 3300005578 Bacteria 3294
192 Ga0068854_100158198 3300005578 Bacteria 1752
193 Ga0068854_100599234 3300005578 Bacteria 940
194 Ga0068854_101918268 3300005578 Bacteria 545
195 Ga0068856_100000975 3300005614 Bacteria 30525
196 Ga0068856_100366813 3300005614 Bacteria 1459
197 Ga0068856_100622140 3300005614 Bacteria 1100
198 Ga0068856_100793583 3300005614 Bacteria 967
199 Ga0068856_100851755 3300005614 Bacteria 931
200 Ga0070702_100358477 3300005615 Bacteria 1030
201 Ga0068852_100418869 3300005616 Bacteria 1321
202 Ga0068852_100431900 3300005616 Bacteria 1301
203 Ga0068852_101596299 3300005616 Bacteria 675
204 Ga0068859_100098458 3300005617 Bacteria 2978
205 Ga0068859_101747166 3300005617 Bacteria 687
206 Ga0068859_102356655 3300005617 Bacteria 587
207 Ga0068864_100496518 3300005618 Bacteria 1173
208 Ga0068866_10001452 3300005718 Bacteria 10132
209 Ga0068861_100948962 3300005719 Bacteria 818
210 Ga0068870_10754532 3300005840 Unclassified 676
211 Ga0068863_100003425 3300005841 Bacteria 15633
212 Ga0068858_100003418 3300005842 Bacteria 15791
213 Ga0068858_101317439 3300005842 Bacteria 711
214 Ga0068860_100042429 3300005843 Bacteria 4344
215 Ga0068860_100175892 3300005843 Bacteria 2069
216 Ga0068862_101585584 3300005844 Unclassified 661
217 Ga0081455_10204550 3300005937 Bacteria 1476
218 Ga0081538_10002065 3300005981 Bacteria 20042
219 Ga0081539_10002732 3300005985 Bacteria 23848
220 Ga0081539_10003664 3300005985 Bacteria 18487
221 Ga0081539_10005156 3300005985 Bacteria 13593
222 Ga0075365_10035098 3300006038 Bacteria 3243
223 Ga0075365_10073920 3300006038 Bacteria 2298
224 Ga0075365_10130899 3300006038 Bacteria 1736
225 Ga0075365_10363975 3300006038 Bacteria 1020
226 Ga0075365_10618750 3300006038 Bacteria 766
227 Ga0075365_11065245 3300006038 Bacteria 569
228 Ga0075368_10109170 3300006042 Bacteria 1140
229 Ga0075368_10122026 3300006042 Bacteria 1080
230 Ga0075368_10124881 3300006042 Bacteria 1067
231 Ga0075368_10199251 3300006042 Bacteria 847
232 Ga0075363_100013693 3300006048 Bacteria 3943
233 Ga0075363_100115082 3300006048 Bacteria 1497
234 Ga0075363_100284700 3300006048 Bacteria 957
235 Ga0075364_10027338 3300006051 Bacteria 3643
236 Ga0075364_10158631 3300006051 Bacteria 1526
237 Ga0075364_10366624 3300006051 Bacteria 982
238 Ga0075364_10642453 3300006051 Bacteria 725
239 Ga0075364_11012266 3300006051 Bacteria 565
240 Ga0070715_10165817 3300006163 Bacteria 1095
241 Ga0070716_100030710 3300006173 Bacteria 2918
242 Ga0070716_100035428 3300006173 Bacteria 2744
243 Ga0070712_100001906 3300006175 Bacteria 12750
244 Ga0070712_100084711 3300006175 Bacteria 2305
245 Ga0075362_10061470 3300006177 Bacteria 1700
246 Ga0075362_10224913 3300006177 Bacteria 918
247 Ga0075362_10758522 3300006177 Bacteria 509
248 Ga0075367_10051844 3300006178 Bacteria 2427
249 Ga0075367_10082677 3300006178 Bacteria 1944
250 Ga0075367_10089130 3300006178 Bacteria 1875
251 Ga0075367_10109720 3300006178 Bacteria 1693
252 Ga0075367_10171770 3300006178 Bacteria 1350
253 Ga0075367_10191222 3300006178 Bacteria 1277
254 Ga0075369_10007423 3300006186 Bacteria 4174
255 Ga0075369_10015022 3300006186 Bacteria 3102
256 Ga0075369_10036973 3300006186 Bacteria 2079
257 Ga0075366_10028361 3300006195 Bacteria 3286
258 Ga0075366_10047973 3300006195 Bacteria 2531
259 Ga0075366_10061070 3300006195 Bacteria 2239
260 Ga0075366_10416000 3300006195 Bacteria 828
261 Ga0075366_10590289 3300006195 Bacteria 688
262 Ga0097621_100029217 3300006237 Bacteria 4352
263 Ga0097621_100064142 3300006237 Bacteria 3020
264 Ga0097621_100278874 3300006237 Bacteria 1471
265 Ga0097621_100497382 3300006237 Bacteria 1104
266 Ga0075370_10166741 3300006353 Bacteria 1294
267 Ga0075370_10267925 3300006353 Bacteria 1013
268 Ga0075370_10516360 3300006353 Unclassified 721
269 Ga0075370_10686320 3300006353 Bacteria 622
270 Ga0068871_100008343 3300006358 Bacteria 7449
271 Ga0068871_100088736 3300006358 Bacteria 2573
272 Ga0068871_100331553 3300006358 Bacteria 1342
273 Ga0075428_100008527 3300006844 Bacteria 11369
274 Ga0075428_100710399 3300006844 Bacteria 1071
275 Ga0075428_101661436 3300006844 Unclassified 667
276 Ga0075431_100137098 3300006847 Bacteria 2523
277 Ga0075433_10154497 3300006852 Bacteria 2041
278 Ga0075433_10157084 3300006852 Bacteria 2023
279 Ga0075433_10486390 3300006852 Bacteria 1087
280 Ga0075434_100061710 3300006871 Bacteria 3730
281 Ga0075434_100128978 3300006871 Bacteria 2547
282 Ga0075429_100055859 3300006880 Bacteria 3436
283 Ga0068865_100085583 3300006881 Bacteria 2274
284 Ga0075436_100129397 3300006914 Bacteria 1770
285 Ga0075436_100367582 3300006914 Bacteria 1038
286 Ga0097620_100098462 3300006931 Bacteria 2978
287 Ga0097620_101746927 3300006931 Bacteria 687
288 Ga0097620_102356552 3300006931 Bacteria 587
289 Ga0075435_100196366 3300007076 Bacteria 1709
290 Ga0075435_100465357 3300007076 Bacteria 1091
291 Ga0075435_100525523 3300007076 Bacteria 1024
292 Ga0105250_10364994 3300009092 Unclassified 635
293 Ga0105240_10071001 3300009093 Bacteria 4307
294 Ga0105240_10273380 3300009093 Bacteria 1944
295 Ga0105240_10379812 3300009093 Bacteria 1596
296 Ga0105240_10715586 3300009093 Bacteria 1091
297 Ga0105240_11137155 3300009093 Bacteria 829
298 Ga0105240_11194290 3300009093 Bacteria 806
299 Ga0105240_12568433 3300009093 Bacteria 526
300 Ga0111539_10000011 3300009094 Bacteria 356900
301 Ga0111539_10137853 3300009094 Bacteria 2857
302 Ga0111539_10227258 3300009094 Bacteria 2173
303 Ga0111539_12983153 3300009094 Bacteria 547
304 Ga0105245_10042421 3300009098 Bacteria 4060
305 Ga0105245_10073210 3300009098 Bacteria 3115
306 Ga0105245_10503205 3300009098 Bacteria 1228
307 Ga0105245_10533162 3300009098 Bacteria 1194
308 Ga0105245_11000634 3300009098 Bacteria 880
309 Ga0105245_13204918 3300009098 Bacteria 507
310 Ga0105247_10025334 3300009101 Bacteria 3577
311 Ga0114129_10851601 3300009147 Bacteria 1159
312 Ga0105243_10516305 3300009148 Bacteria 1135
313 Ga0105241_10023869 3300009174 Bacteria 4538
314 Ga0105241_10170277 3300009174 Bacteria 1798
315 Ga0105242_10028271 3300009176 Bacteria 4463
316 Ga0105242_10137224 3300009176 Bacteria 2118
317 Ga0105242_11472907 3300009176 Bacteria 710
318 Ga0105248_10563098 3300009177 Bacteria 1286
319 Ga0105248_10666879 3300009177 Bacteria 1173
320 Ga0105248_11127750 3300009177 Bacteria 886
321 Ga0105237_10014788 3300009545 Bacteria 8144
322 Ga0105237_10104436 3300009545 Bacteria 2825
323 Ga0105237_10191465 3300009545 Bacteria 2045
324 Ga0105237_10222546 3300009545 Bacteria 1887
325 Ga0105237_10541853 3300009545 Bacteria 1170
326 Ga0105237_11216365 3300009545 Bacteria 760
327 Ga0105238_10003126 3300009551 Bacteria 16521
328 Ga0105238_10156605 3300009551 Bacteria 2253
329 Ga0105238_10156883 3300009551 Bacteria 2251
330 Ga0105238_10302342 3300009551 Bacteria 1584
331 Ga0105238_10428717 3300009551 Bacteria 1318
332 Ga0105238_10462684 3300009551 Bacteria 1266
333 Ga0105238_10975539 3300009551 Bacteria 868
334 Ga0105238_11134480 3300009551 Bacteria 805
335 Ga0105249_10635128 3300009553 Bacteria 1124
336 Ga0105249_10998992 3300009553 Bacteria 905
337 Ga0105249_11730529 3300009553 Bacteria 698
338 Ga0105239_10010085 3300010375 Bacteria 10590
339 Ga0105239_10043527 3300010375 Bacteria 4922
340 Ga0105239_10097049 3300010375 Bacteria 3257
341 Ga0105239_10097156 3300010375 Bacteria 3255
342 Ga0105239_10151280 3300010375 Bacteria 2590
343 Ga0105239_10210483 3300010375 Bacteria 2179
344 Ga0105239_10332058 3300010375 Bacteria 1715
345 Ga0105239_10345923 3300010375 Bacteria 1678
346 Ga0105239_10375329 3300010375 Bacteria 1607
347 Ga0105239_10655686 3300010375 Bacteria 1199
348 Ga0105239_11841558 3300010375 Bacteria 701
349 Ga0105246_10058596 3300011119 Bacteria 2669
350 Ga0105246_10101922 3300011119 Bacteria 2092
351 Ga0105246_10238398 3300011119 Bacteria 1436
352 Ga0105246_10913547 3300011119 Bacteria 788
353 Ga0157373_10099544 3300013100 Bacteria 2046
354 Ga0157371_10585355 3300013102 Bacteria 829
355 Ga0157370_10003103 3300013104 Bacteria 19672
356 Ga0157370_10087410 3300013104 Bacteria 2928
357 Ga0157369_10136983 3300013105 Bacteria 2592
358 Ga0157369_10288523 3300013105 Bacteria 1708
359 Ga0157374_10000596 3300013296 Bacteria 32001
360 Ga0157378_10065076 3300013297 Bacteria 3262
361 Ga0157378_10077986 3300013297 Bacteria 2987
362 Ga0157378_10121217 3300013297 Bacteria 2411
363 Ga0157378_10651121 3300013297 Bacteria 1069
364 Ga0163162_10004338 3300013306 Bacteria 13654
365 Ga0163162_10033110 3300013306 Bacteria 5134
366 Ga0163162_10812254 3300013306 Bacteria 1052
367 Ga0163162_12970585 3300013306 Bacteria 545
368 Ga0157372_10397839 3300013307 Bacteria 1605
369 Ga0157372_10463206 3300013307 Bacteria 1477
370 Ga0163163_12553753 3300014325 Unclassified 569
371 Ga0157380_10658364 3300014326 Bacteria 1046
372 Ga0157380_11129983 3300014326 Bacteria 824
373 Ga0157380_12608996 3300014326 Bacteria 571
374 Ga0157380_12632184 3300014326 Bacteria 569
375 Ga0157380_12756894 3300014326 Bacteria 558
376 Ga0182008_10126972 3300014497 Bacteria 1270
377 Ga0157377_10031272 3300014745 Bacteria 2891
378 Ga0157379_10037045 3300014968 Bacteria 4348
379 Ga0157379_10863368 3300014968 Bacteria 857
380 Ga0157379_12212193 3300014968 Bacteria 546
381 Ga0157376_10068710 3300014969 Bacteria 3001
382 Ga0157376_10078986 3300014969 Bacteria 2819
383 Ga0157376_10510544 3300014969 Bacteria 1183
384 Ga0157376_10771388 3300014969 Bacteria 972
385 Ga0163161_10000750 3300017792 Bacteria 25535
386 Ga0163161_10169733 3300017792 Bacteria 1667
387 Ga0163161_10817090 3300017792 Bacteria 784
388 Ga0206356_11719896 3300020070 Bacteria 568
389 Ga0206356_11855175 3300020070 Bacteria 740
390 Ga0206351_11007656 3300020077 Bacteria 1017
391 Ga0206350_11472044 3300020080 Bacteria 1036
392 Ga0213875_10006275 3300021388 Bacteria 6257
393 Ga0213875_10354288 3300021388 Bacteria 697
394 Ga0224712_10205346 3300022467 Bacteria 897
395 Ga0209674_100149 3300025226 Bacteria 97879
396 Ga0209674_101228 3300025226 Bacteria 7291
397 Ga0209672_100008 3300025228 Bacteria 946876
398 Ga0209258_100004 3300025242 Bacteria 1376422
399 Ga0209258_100008 3300025242 Bacteria 1009355
400 Ga0209026_1000024 3300025250 Bacteria 355839
401 Ga0209026_1000045 3300025250 Bacteria 263431
402 Ga0209677_103088 3300025253 Bacteria 5672
403 Ga0209148_1000050 3300025254 Bacteria 413178
404 Ga0209148_1000053 3300025254 Bacteria 373506
405 Ga0209148_1000985 3300025254 Bacteria 18369
406 Ga0209759_1000140 3300025256 Bacteria 124850
407 Ga0209759_1000302 3300025256 Bacteria 67678
408 Ga0209233_1000027 3300025261 Bacteria 652089
409 Ga0209455_1000007 3300025272 Bacteria 1157983
410 Ga0209455_1000379 3300025272 Bacteria 40354
411 Ga0209025_1000480 3300025294 Bacteria 77443
412 Ga0209758_1001305 3300025297 Bacteria 30465
413 Ga0209758_1008436 3300025297 Bacteria 6674
414 Ga0207653_10030781 3300025885 Bacteria 1732
415 Ga0207653_10186415 3300025885 Bacteria 778
416 Ga0207692_10006659 3300025898 Bacteria 4696
417 Ga0207692_10018398 3300025898 Bacteria 3136
418 Ga0207692_10075332 3300025898 Bacteria 1790
419 Ga0207642_10200281 3300025899 Bacteria 1102
420 Ga0207642_10565758 3300025899 Bacteria 704
421 Ga0207680_10001836 3300025903 Bacteria 9988
422 Ga0207647_10046507 3300025904 Bacteria 2704
423 Ga0207685_10135892 3300025905 Bacteria 1097
424 Ga0207699_10193349 3300025906 Bacteria 1374
425 Ga0207645_10132609 3300025907 Bacteria 1622
426 Ga0207645_10520943 3300025907 Bacteria 806
427 Ga0207643_10101309 3300025908 Bacteria 1689
428 Ga0207684_10000776 3300025910 Bacteria 37044
429 Ga0207684_10001236 3300025910 Bacteria 28372
430 Ga0207684_10109218 3300025910 Bacteria 2367
431 Ga0207684_10167063 3300025910 Bacteria 1896
432 Ga0207684_10467467 3300025910 Bacteria 1082
433 Ga0207654_10053109 3300025911 Bacteria 2338
434 Ga0207654_10104344 3300025911 Bacteria 1752
435 Ga0207654_10160809 3300025911 Bacteria 1451
436 Ga0207654_10213319 3300025911 Bacteria 1277
437 Ga0207695_10310498 3300025913 Bacteria 1467
438 Ga0207695_10524475 3300025913 Bacteria 1066
439 Ga0207695_10878985 3300025913 Bacteria 776
440 Ga0207671_10005928 3300025914 Bacteria 11080
441 Ga0207671_10407045 3300025914 Bacteria 1082
442 Ga0207671_11373339 3300025914 Bacteria 548
443 Ga0207693_10000104 3300025915 Bacteria 76023
444 Ga0207693_10175339 3300025915 Bacteria 1687
445 Ga0207663_10045982 3300025916 Bacteria 2688
446 Ga0207663_10326349 3300025916 Bacteria 1155
447 Ga0207663_10444919 3300025916 Bacteria 999
448 Ga0207660_10000002 3300025917 Bacteria 883566
449 Ga0207660_10526384 3300025917 Bacteria 960
450 Ga0207662_10092545 3300025918 Bacteria 1862
451 Ga0207662_10123259 3300025918 Bacteria 1627
452 Ga0207657_10002703 3300025919 Bacteria 19119
453 Ga0207657_10735403 3300025919 Bacteria 765
454 Ga0207649_10039428 3300025920 Bacteria 2864
455 Ga0207649_10283811 3300025920 Bacteria 1205
456 Ga0207649_10564603 3300025920 Bacteria 872
457 Ga0207652_10415910 3300025921 Bacteria 1213
458 Ga0207652_10773304 3300025921 Bacteria 854
459 Ga0207646_10000393 3300025922 Bacteria 58925
460 Ga0207646_10026917 3300025922 Bacteria 5243
461 Ga0207646_10027890 3300025922 Bacteria 5147
462 Ga0207646_10160372 3300025922 Bacteria 2029
463 Ga0207646_10997221 3300025922 Bacteria 740
464 Ga0207681_10545716 3300025923 Bacteria 954
465 Ga0207694_10003891 3300025924 Bacteria 11805
466 Ga0207694_10123486 3300025924 Bacteria 2069
467 Ga0207694_10244857 3300025924 Bacteria 1466
468 Ga0207694_10324943 3300025924 Bacteria 1270
469 Ga0207650_10043409 3300025925 Bacteria 3300
470 Ga0207650_10960542 3300025925 Unclassified 726
471 Ga0207659_11282375 3300025926 Bacteria 629
472 Ga0207659_11549339 3300025926 Bacteria 566
473 Ga0207687_10035960 3300025927 Bacteria 3372
474 Ga0207687_10374187 3300025927 Bacteria 1165
475 Ga0207687_10376854 3300025927 Bacteria 1161
476 Ga0207700_10029476 3300025928 Bacteria 3873
477 Ga0207700_10041321 3300025928 Bacteria 3373
478 Ga0207700_10320869 3300025928 Unclassified 1342
479 Ga0207700_11119093 3300025928 Bacteria 704
480 Ga0207664_10039482 3300025929 Bacteria 3665
481 Ga0207664_10250716 3300025929 Bacteria 1545
482 Ga0207644_10000914 3300025931 Bacteria 18734
483 Ga0207644_10095324 3300025931 Bacteria 2225
484 Ga0207644_10611339 3300025931 Bacteria 906
485 Ga0207644_11481821 3300025931 Bacteria 570
486 Ga0207690_10455777 3300025932 Bacteria 1029
487 Ga0207690_10959672 3300025932 Bacteria 710
488 Ga0207690_11599293 3300025932 Bacteria 545
489 Ga0207706_10197291 3300025933 Bacteria 1765
490 Ga0207686_10020327 3300025934 Bacteria 3791
491 Ga0207709_10727139 3300025935 Bacteria 796
492 Ga0207670_11520945 3300025936 Unclassified 569
493 Ga0207670_11850293 3300025936 Unclassified 513
494 Ga0207669_10022138 3300025937 Bacteria 3370
495 Ga0207669_10340592 3300025937 Bacteria 1155
496 Ga0207669_10908088 3300025937 Bacteria 736
497 Ga0207704_10014382 3300025938 Bacteria 3994
498 Ga0207665_10053310 3300025939 Bacteria 2726
499 Ga0207691_10023854 3300025940 Bacteria 5757
500 Ga0207711_10153988 3300025941 Bacteria 2076
501 Ga0207711_10751790 3300025941 Bacteria 909
502 Ga0207689_10091261 3300025942 Bacteria 2503
503 Ga0207689_10262548 3300025942 Bacteria 1429
504 Ga0207661_10076085 3300025944 Bacteria 2756
505 Ga0207679_10757328 3300025945 Bacteria 883
506 Ga0207667_10109347 3300025949 Bacteria 2851
507 Ga0207667_10201926 3300025949 Bacteria 2039
508 Ga0207667_10309404 3300025949 Bacteria 1614
509 Ga0207651_10006147 3300025960 Bacteria 6245
510 Ga0207651_10766459 3300025960 Bacteria 854
511 Ga0207651_10819706 3300025960 Bacteria 826
512 Ga0207651_11448671 3300025960 Bacteria 618
513 Ga0207712_10423063 3300025961 Bacteria 1124
514 Ga0207712_10847666 3300025961 Bacteria 805
515 Ga0207712_10925475 3300025961 Bacteria 771
516 Ga0207640_10062706 3300025981 Bacteria 2467
517 Ga0207640_10370523 3300025981 Bacteria 1157
518 Ga0207640_10577841 3300025981 Bacteria 948
519 Ga0207640_10627254 3300025981 Bacteria 913
520 Ga0207658_10018280 3300025986 Bacteria 4838
521 Ga0207677_10001312 3300026023 Bacteria 13359
522 Ga0207677_10049950 3300026023 Bacteria 2826
523 Ga0207677_10090075 3300026023 Bacteria 2228
524 Ga0207703_10002876 3300026035 Bacteria 14649
525 Ga0207703_11122521 3300026035 Bacteria 755
526 Ga0207639_10202265 3300026041 Bacteria 1704
527 Ga0207639_10991307 3300026041 Bacteria 787
528 Ga0207678_10167037 3300026067 Bacteria 1879
529 Ga0207678_10231093 3300026067 Bacteria 1584
530 Ga0207678_11530676 3300026067 Bacteria 588
531 Ga0207708_10188934 3300026075 Bacteria 1639
532 Ga0207708_11652448 3300026075 Bacteria 563
533 Ga0207702_10000380 3300026078 Bacteria 50635
534 Ga0207702_10073724 3300026078 Bacteria 2944
535 Ga0207702_10305139 3300026078 Bacteria 1512
536 Ga0207702_11184817 3300026078 Bacteria 758
537 Ga0207641_10020702 3300026088 Bacteria 5404
538 Ga0207641_11240485 3300026088 Unclassified 746
539 Ga0207641_11250735 3300026088 Unclassified 742
540 Ga0207648_10231345 3300026089 Bacteria 1644
541 Ga0207648_10540197 3300026089 Bacteria 1070
542 Ga0207648_10638978 3300026089 Bacteria 983
543 Ga0207676_10094240 3300026095 Bacteria 2466
544 Ga0207674_10012568 3300026116 Bacteria 9460
545 Ga0207674_10124750 3300026116 Bacteria 2541
546 Ga0207675_100911309 3300026118 Bacteria 896
547 Ga0207675_100959916 3300026118 Bacteria 872
548 Ga0207675_100988291 3300026118 Bacteria 860
549 Ga0207683_10001133 3300026121 Bacteria 24266
550 Ga0207683_10192190 3300026121 Bacteria 1853
551 Ga0207683_10438132 3300026121 Bacteria 1204
552 Ga0207683_12054079 3300026121 Bacteria 520
553 Ga0207698_10180270 3300026142 Bacteria 1870
554 Ga0209981_1081136 3300027378 Bacteria 505
555 Ga0209813_10052067 3300027866 Bacteria 1283
556 Ga0209813_10211157 3300027866 Bacteria 723
557 Ga0209813_10274592 3300027866 Bacteria 647
558 Ga0209813_10315280 3300027866 Bacteria 611
559 Ga0209974_10032144 3300027876 Bacteria 1739
560 Ga0207428_10000212 3300027907 Bacteria 80663
561 Ga0207428_10058241 3300027907 Bacteria 3066
562 Ga0268266_10000850 3300028379 Bacteria 39769
563 Ga0268266_10007186 3300028379 Bacteria 10086
564 Ga0268266_10090757 3300028379 Bacteria 2678
565 Ga0268266_10608110 3300028379 Bacteria 1050
566 Ga0268265_10142710 3300028380 Bacteria 2007
567 Ga0268264_10003169 3300028381 Bacteria 14249
568 Ga0268264_10025615 3300028381 Bacteria 4819
569 Ga0265334_10201958 3300028573 Bacteria 690
570 Ga0265322_10029525 3300028654 Bacteria 1567
571 Ga0265336_10066977 3300028666 Bacteria 1074
572 Ga0265338_10003174 3300028800 Bacteria 23452
573 Ga0265338_10025995 3300028800 Bacteria 5919
574 Ga0265338_10650797 3300028800 Bacteria 730
575 Ga0307512_10233885 3300030522 Bacteria 940
576 Ga0265770_1049249 3300030878 Bacteria 758
577 Ga0265332_10000024 3300031238 Bacteria 209663
578 Ga0265332_10050683 3300031238 Bacteria 1784
579 Ga0265329_10003297 3300031242 Bacteria 7067
580 Ga0307513_10032790 3300031456 Bacteria 5850
581 Ga0307408_100152452 3300031548 Bacteria 1826
582 Ga0307408_101461699 3300031548 Bacteria 645
583 Ga0316579_10182376 3300031691 Bacteria 1015
584 Ga0316579_10263513 3300031691 Bacteria 834
585 Ga0316579_10378302 3300031691 Bacteria 685
586 Ga0265314_10000087 3300031711 Bacteria 138681
587 Ga0316576_10008783 3300031727 Bacteria 6476
588 Ga0316576_10010434 3300031727 Bacteria 6036
589 Ga0316576_10013218 3300031727 Bacteria 5477
590 Ga0316576_10019776 3300031727 Bacteria 4619
591 Ga0316576_10074568 3300031727 Bacteria 2509
592 Ga0316576_10184841 3300031727 Bacteria 1572
593 Ga0316576_10262497 3300031727 Bacteria 1295
594 Ga0316576_10373904 3300031727 Bacteria 1058
595 Ga0316576_10374916 3300031727 Bacteria 1057
596 Ga0316576_10488521 3300031727 Bacteria 907
597 Ga0316576_10580138 3300031727 Unclassified 820
598 Ga0316576_10681452 3300031727 Unclassified 746
599 Ga0316576_11010482 3300031727 Bacteria 592
600 Ga0316578_10004019 3300031728 Bacteria 6867
601 Ga0316578_10010761 3300031728 Bacteria 4760
602 Ga0316578_10018445 3300031728 Bacteria 3825
603 Ga0316578_10115712 3300031728 Bacteria 1611
604 Ga0316578_10349861 3300031728 Bacteria 879
605 Ga0316578_10802502 3300031728 Bacteria 545
606 Ga0316577_10042433 3300031733 Bacteria 2545
607 Ga0316577_10173854 3300031733 Bacteria 1216
608 Ga0316577_10325250 3300031733 Unclassified 872
609 Ga0316577_10874150 3300031733 Bacteria 510
610 Ga0307410_10747952 3300031852 Bacteria 828
611 Ga0307407_10274700 3300031903 Bacteria 1165
612 Ga0307412_11098294 3300031911 Bacteria 708
613 Ga0307409_102154263 3300031995 Unclassified 587
614 Ga0307416_100175520 3300032002 Bacteria 2001
615 Ga0307416_100572741 3300032002 Bacteria 1205
616 Ga0307416_100896297 3300032002 Bacteria 987
617 Ga0307416_102767757 3300032002 Bacteria 586
618 Ga0307414_10546309 3300032004 Bacteria 1032
619 Ga0307415_100635752 3300032126 Unclassified 955
620 Ga0316583_10031781 3300032133 Bacteria 1878
621 Ga0316583_10035505 3300032133 Bacteria 1769
622 Ga0316583_10154515 3300032133 Bacteria 799
623 Ga0316585_10013644 3300032137 Bacteria 2420
624 Ga0316580_10003959 3300032139 Bacteria 4259
625 Ga0316580_10010860 3300032139 Bacteria 2759
626 Ga0316593_10013684 3300032168 Bacteria 2408
627 Ga0316593_10023357 3300032168 Bacteria 1950
628 Ga0316593_10153884 3300032168 Bacteria 837
629 Ga0316592_1001361 3300033524 Bacteria 3908
630 Ga0316592_1002162 3300033524 Bacteria 3353
631 Ga0316592_1071258 3300033524 Bacteria 786
632 Ga0316586_1001301 3300033527 Bacteria 2812
633 Ga0316588_1041192 3300033528 Bacteria 1104
634 Ga0316588_1087417 3300033528 Bacteria 775
635 Ga0316587_1025310 3300033529 Bacteria 1031
636 Ga0316587_1118832 3300033529 Bacteria 517
637 Ga0316596_1007171 3300033541 Bacteria 2627
638 Ga0373926_0037925 3300035083 Bacteria 1715
639 Ga0373928_0038880 3300035084 Bacteria 1085
640 Ga0373929_0034483 3300035085 Bacteria 1098
641 Ga0373934_0005630 3300035086 Bacteria 4640
642 Ga0373940_0133651 3300035088 Bacteria 779
643 Ga0373944_0084426 3300035089 Bacteria 1053
644 Ga0373923_0000205 3300035111 Bacteria 12151
645 Ga0373923_0064846 3300035111 Bacteria 1558
646 Ga0373932_0269868 3300035112 Bacteria 626
647 Ga0373941_0032001 3300035115 Bacteria 1571
648 Ga0373945_0024779 3300035116 Bacteria 2081
649 Ga0373945_0053249 3300035116 Bacteria 1493
650 Ga0373953_0006354 3300035117 Bacteria 3889
651 Ga0373954_0034165 3300035118 Bacteria 2354
652 Ga0373956_0022360 3300035119 Bacteria 2705
653 Ga0373956_0262443 3300035119 Bacteria 821
654 Ga0373957_0004838 3300035120 Bacteria 4128
655 Ga0373957_0086871 3300035120 Bacteria 1239
656 Ga0373960_0183157 3300035121 Bacteria 732
657 Ga0373960_0359710 3300035121 Bacteria 554
658 Ga0373943_0013451 3300035170 Bacteria 3696
659 Ga0373943_0015517 3300035170 Bacteria 3462
660 Ga0373943_0018552 3300035170 Bacteria 3197
661 Ga0373943_0280165 3300035170 Bacteria 942
662 Ga0373946_0228097 3300035171 Bacteria 901
663 Ga0373955_0007175 3300035172 Bacteria 5108
664 Ga0373961_0119927 3300035241 Bacteria 871
665 Ga0316574_0021624 3300035398 Bacteria 3822
666 Ga0316574_0270263 3300035398 Bacteria 1084
667 Ga0316574_0307057 3300035398 Bacteria 1008
668 Ga0316574_0546536 3300035398 Bacteria 719
669 Ga0316574_0763097 3300035398 Unclassified 590
670 Ga0373924_0019718 3300035410 Bacteria 2614
671 Ga0373924_0165142 3300035410 Bacteria 972
672 Ga0373935_0003253 3300035692 Bacteria 9393
673 Ga0373935_0144651 3300035692 Bacteria 1608
674 Ga0373935_0930977 3300035692 Unclassified 644
675 Ga0373935_1130457 3300035692 Bacteria 583
676 Ga0373927_0045696 3300035695 Bacteria 2832
677 Ga0373927_0200717 3300035695 Bacteria 1309
678 Ga0373933_0130310 3300035724 Bacteria 1581
679 Ga0373933_0232935 3300035724 Bacteria 1183
680 Ga0373947_0003388 3300035725 Bacteria 9431
681 Ga0373947_0024078 3300035725 Bacteria 3545
682 Ga0373937_0043634 3300036401 Bacteria 4094
683 Ga0373937_0124881 3300036401 Bacteria 2400
684 Ga0373937_0182724 3300036401 Bacteria 1969
685 Ga0373937_0430849 3300036401 Bacteria 1252
686 Ga0373937_0752533 3300036401 Bacteria 922
687 Ga0373937_1702718 3300036401 Unclassified 577
688 Ga0372808_036355 3300036459 Bacteria 707
689 Ga0316582_0022819 3300036647 Bacteria 3722
690 Ga0316582_0068727 3300036647 Bacteria 2288
691 Ga0316582_0082778 3300036647 Bacteria 2098
692 Ga0316582_0261484 3300036647 Bacteria 1187
693 Ga0316582_0297525 3300036647 Bacteria 1108
694 Ga0316584_0067900 3300036712 Bacteria 2672
695 Ga0316584_0194355 3300036712 Bacteria 1499
696 Ga0316584_0211657 3300036712 Bacteria 1426
697 Ga0373925_0041456 3300037068 Bacteria 3412
698 Ga0395899_0000139 3300037312 Bacteria 110692
699 Ga0395899_0000164 3300037312 Bacteria 102165
700 Ga0395899_0012593 3300037312 Bacteria 6484
701 Ga0395899_0122589 3300037312 Bacteria 1860
702 Ga0395899_0355320 3300037312 Bacteria 979
703 Ga0395899_0403022 3300037312 Bacteria 904
704 Ga0395899_0403406 3300037312 Bacteria 904
705 Ga0395899_0492384 3300037312 Bacteria 796
706 Ga0395900_0000217 3300037418 Bacteria 90402
707 Ga0395900_0002078 3300037418 Bacteria 22454
708 Ga0395900_0110837 3300037418 Bacteria 2819
709 Ga0395900_0135659 3300037418 Bacteria 2521
710 Ga0395900_0170772 3300037418 Bacteria 2214
711 Ga0395900_0208752 3300037418 Bacteria 1973
712 Ga0395900_0246371 3300037418 Bacteria 1790
713 Ga0395900_0263559 3300037418 Bacteria 1720
714 Ga0395900_0973125 3300037418 Bacteria 769
715 Ga0395900_1199270 3300037418 Bacteria 674
716 Ga0395898_0000029 3300037466 Bacteria 370667
717 Ga0395898_0246545 3300037466 Bacteria 1703
718 Ga0395898_0397878 3300037466 Bacteria 1313
719 Ga0395898_0503740 3300037466 Bacteria 1151
720 Ga0395898_0566588 3300037466 Bacteria 1078
721 Ga0395898_1621798 3300037466 Bacteria 571
722 Ga0395905_0114628 3300037471 Bacteria 2532
723 Ga0395905_0162138 3300037471 Bacteria 2101
724 Ga0395905_0322941 3300037471 Bacteria 1433
725 Ga0395905_0369994 3300037471 Bacteria 1326
726 Ga0395905_0724389 3300037471 Bacteria 897
727 Ga0395905_0984124 3300037471 Bacteria 746
728 Ga0395905_1274934 3300037471 Bacteria 638
729 Ga0395905_1312554 3300037471 Bacteria 627
730 Ga0316581_0002998 3300037588 Bacteria 4150
731 Ga0316581_0063326 3300037588 Bacteria 1135
732 Ga0436364_0212987 3300037853 Bacteria 1202
733 Ga0436364_1367044 3300037853 Bacteria 3574
734 Ga0395901_0000250 3300038443 Bacteria 66983
735 Ga0395901_0055988 3300038443 Bacteria 4102
736 Ga0395901_0072336 3300038443 Bacteria 3595
737 Ga0395901_0110229 3300038443 Bacteria 2890
738 Ga0395901_0112883 3300038443 Bacteria 2854
739 Ga0395901_0262727 3300038443 Bacteria 1796
740 Ga0395901_0293924 3300038443 Bacteria 1685
741 Ga0395901_0321392 3300038443 Bacteria 1601
742 Ga0395901_0343309 3300038443 Bacteria 1542
743 Ga0395901_0598481 3300038443 Bacteria 1112
744 Ga0395901_1005584 3300038443 Bacteria 809
745 Ga0436365_0226758 3300039437 Bacteria 3042
746 Ga0436365_0449353 3300039437 Bacteria 876
747 Ga0436360_0389060 3300039438 Bacteria 676
748 Ga0436360_0670138 3300039438 Bacteria 609
749 Ga0436360_0806326 3300039438 Bacteria 706
750 Ga0436360_1097396 3300039438 Bacteria 737
751 Ga0436361_1118974 3300039447 Bacteria 1436
752 Ga0439436_0000974 3300041404 Bacteria 7926
753 Ga0439438_000863 3300041405 Bacteria 13555
754 Ga0439447_000231 3300041407 Bacteria 19695
755 Ga0439461_0121310 3300041410 Bacteria 654
756 Ga0439466_0000756 3300041411 Bacteria 12220
757 Ga0439466_0003886 3300041411 Bacteria 5766
758 Ga0439465_0069610 3300041413 Bacteria 1178
759 Ga0439465_0126301 3300041413 Bacteria 900
760 Ga0451789_0506225 3300041443 Bacteria 1109
761 Ga0451837_1132506 3300041494 Unclassified 1587
762 Ga0451853_0378017 3300041512 Bacteria 590
763 Ga0451853_3305277 3300041512 Bacteria 695
764 Ga0439431_0046627 3300041997 Bacteria 1116
765 Ga0439431_0072732 3300041997 Bacteria 918
766 Ga0439432_003631 3300042006 Bacteria 5708
767 Ga0439449_0070651 3300042007 Bacteria 1286
768 Ga0439452_008966 3300042010 Bacteria 2978
769 Ga0450919_024118 3300042121 Bacteria 689
770 Ga0450923_029321 3300042125 Bacteria 1114
771 Ga0450904_001054 3300042139 Bacteria 4259
772 Ga0439446_0008571 3300042156 Bacteria 2721
773 Ga0439458_0181330 3300042157 Bacteria 572
774 Ga0450908_076159 3300042184 Bacteria 599
775 Ga0450909_013992 3300042185 Bacteria 1181
776 Ga0450909_069802 3300042185 Bacteria 561
777 Ga0439434_0001105 3300042435 Bacteria 7811
778 Ga0439435_0030933 3300042436 Bacteria 1453
779 Ga0439459_0033904 3300042438 Bacteria 1054
780 Ga0439460_0223280 3300042461 Unclassified 646
781 Ga0451577_0025900 3300042876 Bacteria 5317
782 Ga0451577_0246518 3300042876 Bacteria 1617
783 Ga0451577_0268084 3300042876 Bacteria 1546
784 Ga0451577_0273041 3300042876 Bacteria 1531
785 Ga0451577_1672257 3300042876 Bacteria 560
786 Ga0466969_0008322 3300044656 Bacteria 5501
787 Ga0466969_0117745 3300044656 Bacteria 1238
788 Ga0466969_0159867 3300044656 Bacteria 1035
789 Ga0466969_0410834 3300044656 Bacteria 615
790 Ga0466972_0061569 3300044658 Bacteria 1799
791 Ga0466976_0329296 3300044662 Bacteria 851
792 Ga0453683_0579476 3300044673 Bacteria 731
793 Ga0466965_0022239 3300044683 Bacteria 3057
794 Ga0466965_0207337 3300044683 Bacteria 1041
795 Ga0466965_0395558 3300044683 Bacteria 763
796 Ga0466966_0001633 3300044684 Bacteria 14459
797 Ga0466966_0059034 3300044684 Bacteria 2423
798 Ga0466961_0001504 3300044693 Bacteria 14466
799 Ga0466963_0281149 3300044694 Bacteria 1170
800 Ga0466964_0014915 3300044706 Bacteria 2959
801 Ga0466964_0113483 3300044706 Bacteria 1212
802 Ga0453684_0000204 3300044712 Bacteria 258105
803 Ga0453684_0000395 3300044712 Bacteria 179647
804 Ga0453684_0004787 3300044712 Bacteria 27912
805 Ga0453684_0148792 3300044712 Bacteria 2785
806 Ga0453684_0568746 3300044712 Bacteria 1246
807 Ga0453684_2288871 3300044712 Unclassified 538
808 Ga0466971_0050778 3300044719 Bacteria 1866
809 Ga0466968_0655917 3300044735 Bacteria 533
810 Ga0466970_0152245 3300044765 Bacteria 1277
811 Ga0466970_0239282 3300044765 Bacteria 1015
812 Ga0466957_0000385 3300044842 Bacteria 21580
813 Ga0466957_0233804 3300044842 Bacteria 1217
814 Ga0466959_0000563 3300045049 Bacteria 21561
815 Ga0466959_0002207 3300045049 Bacteria 12392
816 Ga0466959_0020697 3300045049 Bacteria 4847
817 Ga0466959_0970227 3300045049 Bacteria 566
818 Ga0451576_0005710 3300045051 Bacteria 15519
819 Ga0451576_1266021 3300045051 Bacteria 769
820 Ga0451576_2420617 3300045051 Bacteria 537
821 Ga0466958_0081536 3300045836 Bacteria 1991
822 Ga0466958_0166802 3300045836 Bacteria 1393
823 Ga0466958_0603932 3300045836 Bacteria 714
824 Ga0466967_0378134 3300045976 Bacteria 1375
825 Ga0466967_0528181 3300045976 Bacteria 1160
826 Ga0466967_0677750 3300045976 Bacteria 1020
827 Ga0466967_2128418 3300045976 Bacteria 557
828 Ga0495617_000216 3300046452 Bacteria 35255
829 Ga0495627_005158 3300046453 Bacteria 5319
830 Ga0495592_0000054 3300046454 Bacteria 107373
831 Ga0495592_0122817 3300046454 Bacteria 1825
832 Ga0495603_0052705 3300046455 Bacteria 2415
833 Ga0495603_0115160 3300046455 Bacteria 1567
834 Ga0495603_0297199 3300046455 Bacteria 927
835 Ga0495590_0000077 3300046457 Bacteria 64092
836 Ga0495590_0003554 3300046457 Bacteria 6348
837 Ga0495590_0018501 3300046457 Bacteria 2494
838 Ga0495629_0049667 3300046459 Bacteria 2940
839 Ga0495629_0067752 3300046459 Bacteria 2490
840 Ga0495629_0081556 3300046459 Bacteria 2257
841 Ga0495629_0104214 3300046459 Bacteria 1978
842 Ga0495638_0046686 3300046460 Bacteria 2720
843 Ga0495638_0297327 3300046460 Bacteria 871
844 Ga0495651_0294344 3300046462 Bacteria 1091
845 Ga0495653_0042427 3300046463 Bacteria 3543
846 Ga0495653_0052385 3300046463 Bacteria 3127
847 Ga0495653_0073375 3300046463 Bacteria 2553
848 Ga0495653_0292562 3300046463 Bacteria 1065
849 Ga0495650_0025459 3300046471 Bacteria 2773
850 Ga0495580_0046916 3300046472 Bacteria 3063
851 Ga0495580_0343830 3300046472 Bacteria 1011
852 Ga0495582_0005646 3300046473 Bacteria 6965
853 Ga0495582_0010469 3300046473 Bacteria 5103
854 Ga0495582_0018626 3300046473 Bacteria 3795
855 Ga0495605_0000325 3300046474 Bacteria 48544
856 Ga0495605_0114818 3300046474 Bacteria 1225
857 Ga0495605_0122472 3300046474 Bacteria 1178
858 Ga0495639_0013210 3300046475 Bacteria 3563
859 Ga0495662_0009572 3300046476 Bacteria 4751
860 Ga0495662_0010489 3300046476 Bacteria 4534
861 Ga0495664_0410564 3300046477 Bacteria 813
862 Ga0495584_0000351 3300046491 Bacteria 31986
863 Ga0495584_0001690 3300046491 Bacteria 12941
864 Ga0495584_0001693 3300046491 Bacteria 12925
865 Ga0495584_0023105 3300046491 Bacteria 3153
866 Ga0495584_0023849 3300046491 Bacteria 3101
867 Ga0495584_0025577 3300046491 Bacteria 2992
868 Ga0495584_0050546 3300046491 Bacteria 2093
869 Ga0495584_0068022 3300046491 Bacteria 1789
870 Ga0495584_0170407 3300046491 Bacteria 1106
871 Ga0495584_0338320 3300046491 Bacteria 764
872 Ga0495585_0000563 3300046492 Bacteria 35041
873 Ga0495585_0001619 3300046492 Bacteria 17313
874 Ga0495585_0002446 3300046492 Bacteria 13306
875 Ga0495585_0002476 3300046492 Bacteria 13184
876 Ga0495585_0003138 3300046492 Bacteria 11326
877 Ga0495585_0003417 3300046492 Bacteria 10744
878 Ga0495585_0027979 3300046492 Bacteria 3217
879 Ga0495585_0046466 3300046492 Bacteria 2421
880 Ga0495585_0123123 3300046492 Bacteria 1370
881 Ga0495585_0277366 3300046492 Bacteria 829
882 Ga0495585_0344031 3300046492 Bacteria 725
883 Ga0495585_0462800 3300046492 Bacteria 605
884 Ga0495594_0039692 3300046499 Bacteria 2574
885 Ga0495594_0049418 3300046499 Bacteria 2311
886 Ga0495594_0060346 3300046499 Bacteria 2097
887 Ga0495596_0003192 3300046500 Bacteria 8437
888 Ga0495596_0048164 3300046500 Bacteria 1671
889 Ga0495596_0053296 3300046500 Bacteria 1582
890 Ga0495607_0009100 3300046501 Bacteria 6751
891 Ga0495607_0014486 3300046501 Bacteria 5126
892 Ga0495607_0092858 3300046501 Bacteria 1631
893 Ga0495583_0000424 3300046506 Bacteria 63938
894 Ga0495583_0003374 3300046506 Bacteria 12262
895 Ga0495583_0015810 3300046506 Bacteria 4086
896 Ga0495583_0029507 3300046506 Bacteria 2683
897 Ga0495583_0118069 3300046506 Bacteria 1119
898 Ga0495583_0154551 3300046506 Bacteria 949
899 Ga0495583_0246348 3300046506 Bacteria 717
900 Ga0495583_0349676 3300046506 Bacteria 583
901 Ga0495606_0020317 3300046507 Bacteria 4901
902 Ga0495606_0056953 3300046507 Bacteria 2519
903 Ga0495606_0057127 3300046507 Bacteria 2514
904 Ga0495606_0148920 3300046507 Bacteria 1375
905 Ga0495606_0283613 3300046507 Bacteria 904
906 Ga0495610_0000955 3300046512 Bacteria 26756
907 Ga0495610_0067078 3300046512 Bacteria 1687
908 Ga0495610_0081874 3300046512 Bacteria 1480
909 Ga0495616_0000316 3300046513 Bacteria 38626
910 Ga0495616_0001788 3300046513 Bacteria 14612
911 Ga0495616_0006596 3300046513 Bacteria 7013
912 Ga0495616_0016682 3300046513 Bacteria 4059
913 Ga0495616_0059927 3300046513 Bacteria 1870
914 Ga0495616_0095739 3300046513 Bacteria 1399
915 Ga0495616_0099042 3300046513 Bacteria 1369
916 Ga0495616_0180214 3300046513 Bacteria 939
917 Ga0495616_0263104 3300046513 Bacteria 737
918 Ga0495618_0002303 3300046514 Bacteria 12371
919 Ga0495618_0602385 3300046514 Bacteria 654
920 Ga0495620_0023660 3300046515 Bacteria 2933
921 Ga0495628_0015266 3300046516 Bacteria 6416
922 Ga0495628_0048896 3300046516 Bacteria 3350
923 Ga0495628_0056377 3300046516 Bacteria 3093
924 Ga0495630_0070115 3300046517 Bacteria 2637
925 Ga0495630_0077443 3300046517 Bacteria 2507
926 Ga0495630_0093467 3300046517 Bacteria 2273
927 Ga0495630_0229291 3300046517 Bacteria 1419
928 Ga0495631_0000341 3300046518 Bacteria 32087
929 Ga0495631_0003191 3300046518 Bacteria 9025
930 Ga0495631_0012248 3300046518 Bacteria 4197
931 Ga0495631_0038854 3300046518 Bacteria 2114
932 Ga0495631_0203642 3300046518 Bacteria 846
933 Ga0495632_0000081 3300046519 Bacteria 99136
934 Ga0495632_0032242 3300046519 Bacteria 2701
935 Ga0495632_0435046 3300046519 Bacteria 570
936 Ga0495637_0000008 3300046520 Bacteria 404658
937 Ga0495637_0079214 3300046520 Bacteria 1312
938 Ga0495643_0003692 3300046522 Bacteria 11092
939 Ga0495643_0004226 3300046522 Bacteria 10163
940 Ga0495643_0028999 3300046522 Bacteria 3099
941 Ga0495644_0005571 3300046523 Bacteria 4914
942 Ga0495644_0010600 3300046523 Bacteria 3551
943 Ga0495644_0016582 3300046523 Bacteria 2819
944 Ga0495644_0029604 3300046523 Bacteria 2069
945 Ga0495644_0032762 3300046523 Bacteria 1963
946 Ga0495644_0294288 3300046523 Bacteria 634
947 Ga0495648_0000722 3300046524 Bacteria 35218
948 Ga0495648_0063018 3300046524 Bacteria 2192
949 Ga0495648_0135865 3300046524 Bacteria 1300
950 Ga0495648_0145297 3300046524 Bacteria 1243
951 Ga0495648_0326474 3300046524 Bacteria 709
952 Ga0495666_0012245 3300046526 Bacteria 4276
953 Ga0495666_0012371 3300046526 Bacteria 4254
954 Ga0495666_0048120 3300046526 Unclassified 2054
955 Ga0495666_0070145 3300046526 Bacteria 1666
956 Ga0495666_0120039 3300046526 Bacteria 1232
957 Ga0495666_0401230 3300046526 Bacteria 616
958 Ga0495642_0005225 3300046528 Bacteria 4994
959 Ga0495642_0008145 3300046528 Bacteria 4010
960 Ga0495642_0015210 3300046528 Bacteria 2987
961 Ga0495642_0122653 3300046528 Bacteria 1115
962 Ga0495652_0017091 3300046529 Bacteria 6479
963 Ga0495654_0044609 3300046530 Bacteria 2192
964 Ga0495665_0008680 3300046531 Bacteria 5515
965 Ga0495665_0022929 3300046531 Bacteria 3352
966 Ga0495640_0090715 3300046533 Bacteria 2017
967 Ga0495640_0143271 3300046533 Unclassified 1539
968 Ga0495640_0320740 3300046533 Bacteria 960
969 Ga0495586_0000670 3300046535 Bacteria 19540
970 Ga0495586_0008010 3300046535 Bacteria 5635
971 Ga0495586_0010132 3300046535 Bacteria 5016
972 Ga0495586_0011649 3300046535 Bacteria 4677
973 Ga0495586_0110158 3300046535 Bacteria 1532
974 Ga0495587_0022210 3300046536 Bacteria 3908
975 Ga0495587_0036803 3300046536 Bacteria 2942
976 Ga0495587_0074261 3300046536 Bacteria 1975
977 Ga0495587_0207037 3300046536 Bacteria 1108
978 Ga0495609_0000039 3300046538 Bacteria 179384
979 Ga0495609_0002266 3300046538 Bacteria 12004
980 Ga0495609_0038762 3300046538 Bacteria 2147
981 Ga0495609_0048087 3300046538 Bacteria 1907
982 Ga0495609_0137391 3300046538 Bacteria 1044
983 Ga0495609_0174146 3300046538 Bacteria 907
984 Ga0495609_0186161 3300046538 Bacteria 872
985 Ga0495609_0308053 3300046538 Bacteria 644
986 Ga0495621_0020476 3300046539 Bacteria 2171
987 Ga0495597_0001889 3300046542 Bacteria 14286
988 Ga0495597_0002795 3300046542 Bacteria 10727
989 Ga0495597_0003774 3300046542 Bacteria 8623
990 Ga0495597_0008819 3300046542 Bacteria 5030
991 Ga0495597_0112372 3300046542 Bacteria 1141
992 Ga0495597_0235810 3300046542 Bacteria 722
993 Ga0495597_0295419 3300046542 Bacteria 629
994 Ga0495645_0049898 3300046543 Bacteria 3047
995 Ga0495645_0065571 3300046543 Bacteria 2627
996 Ga0495622_0012056 3300046557 Bacteria 3996
997 Ga0495622_0027422 3300046557 Bacteria 2658
998 Ga0495622_0043674 3300046557 Bacteria 2083
999 Ga0495633_0002942 3300046558 Bacteria 11650
1000 Ga0495633_0025172 3300046558 Bacteria 2931
1001 Ga0495633_0052084 3300046558 Bacteria 1928
1002 Ga0495633_0069481 3300046558 Bacteria 1644
1003 Ga0495633_0103571 3300046558 Bacteria 1320
1004 Ga0495633_0107701 3300046558 Bacteria 1292
1005 Ga0495633_0203495 3300046558 Bacteria 908
1006 Ga0495633_0262437 3300046558 Bacteria 787
1007 Ga0495633_0392988 3300046558 Bacteria 627
1008 Ga0495667_0504629 3300046559 Bacteria 758
1009 Ga0495656_0000102 3300046615 Bacteria 35387
1010 Ga0495656_0000738 3300046615 Bacteria 10569
1011 Ga0495668_0003757 3300046616 Bacteria 11137
1012 Ga0495668_0012553 3300046616 Bacteria 5022
1013 Ga0495668_0018088 3300046616 Bacteria 4078
1014 Ga0495668_0020416 3300046616 Bacteria 3810
1015 Ga0495668_0035554 3300046616 Bacteria 2792
1016 Ga0495668_0037951 3300046616 Bacteria 2693
1017 Ga0495668_0065580 3300046616 Bacteria 1998
1018 Ga0495668_0263264 3300046616 Bacteria 944
1019 Ga0495634_0046550 3300046642 Bacteria 2926
1020 Ga0495634_0069764 3300046642 Bacteria 2318
1021 Ga0495634_0137156 3300046642 Bacteria 1556
1022 Ga0495611_0000988 3300046648 Bacteria 15104
1023 Ga0495611_0087497 3300046648 Bacteria 1437
1024 Ga0495611_0134895 3300046648 Bacteria 1152
1025 Ga0495611_0408306 3300046648 Bacteria 620
1026 Ga0495625_0025398 3300046660 Bacteria 4494
1027 Ga0495625_0110308 3300046660 Bacteria 1881
1028 Ga0495625_0169738 3300046660 Bacteria 1457
1029 Ga0495625_0294821 3300046660 Bacteria 1039
1030 Ga0495625_0386839 3300046660 Bacteria 876
1031 Ga0495625_0411907 3300046660 Bacteria 842
1032 Ga0495625_0447111 3300046660 Bacteria 799
1033 Ga0495625_0759142 3300046660 Bacteria 568
1034 Ga0495635_0006609 3300046663 Bacteria 8094
1035 Ga0495635_0020293 3300046663 Bacteria 4630
1036 Ga0495635_0241798 3300046663 Bacteria 1218
1037 Ga0495635_0351197 3300046663 Bacteria 984
1038 Ga0495635_0600174 3300046663 Unclassified 719
1039 Ga0495659_0176953 3300046664 Bacteria 867
1040 Ga0495659_0294743 3300046664 Bacteria 684
1041 Ga0495661_0002040 3300046665 Bacteria 15879
1042 Ga0495661_0002400 3300046665 Bacteria 14464
1043 Ga0495661_0008359 3300046665 Bacteria 7162
1044 Ga0495661_0013653 3300046665 Bacteria 5452
1045 Ga0495661_0030978 3300046665 Bacteria 3401
1046 Ga0495661_0053310 3300046665 Bacteria 2432
1047 Ga0495661_0066947 3300046665 Bacteria 2111
1048 Ga0495661_0103416 3300046665 Bacteria 1598
1049 Ga0495588_0045372 3300046674 Bacteria 2252
1050 Ga0495588_0064086 3300046674 Bacteria 1906
1051 Ga0495588_0175820 3300046674 Bacteria 1131
1052 Ga0495588_0189138 3300046674 Bacteria 1087
1053 Ga0495588_0302716 3300046674 Bacteria 841
1054 Ga0495588_0325695 3300046674 Unclassified 808
1055 Ga0495588_0474960 3300046674 Bacteria 656
1056 Ga0495588_0494278 3300046674 Bacteria 641
1057 Ga0495588_0640182 3300046674 Bacteria 556
1058 Ga0495599_0081489 3300046678 Unclassified 2021
1059 Ga0495623_0007763 3300046679 Bacteria 6972
1060 Ga0495623_0142828 3300046679 Bacteria 1422
1061 Ga0495623_0554568 3300046679 Bacteria 601
1062 Ga0495646_0083899 3300046680 Bacteria 1851
1063 Ga0495646_0145809 3300046680 Unclassified 1320
1064 Ga0495647_0054424 3300046681 Bacteria 1563
1065 Ga0495658_0184385 3300046683 Bacteria 1295
1066 Ga0495669_0000062 3300046684 Bacteria 70803
1067 Ga0495669_0137072 3300046684 Bacteria 1154
1068 Ga0495669_0167178 3300046684 Bacteria 1045
1069 Ga0495613_0045553 3300046689 Bacteria 3243
1070 Ga0495613_0123631 3300046689 Bacteria 1856
1071 Ga0495613_0207884 3300046689 Bacteria 1377
1072 Ga0495624_0022904 3300046690 Bacteria 4122
1073 Ga0495624_0063884 3300046690 Bacteria 2301
1074 Ga0495624_0166871 3300046690 Bacteria 1344
1075 Ga0495670_0001891 3300046691 Bacteria 10317
1076 Ga0495670_0005171 3300046691 Bacteria 6421
1077 Ga0495670_0016227 3300046691 Bacteria 3660
1078 Ga0495670_0076623 3300046691 Bacteria 1699
1079 Ga0495670_0303648 3300046691 Bacteria 855
1080 Ga0495670_0350486 3300046691 Bacteria 794
1081 Ga0495671_0020871 3300046692 Bacteria 3448
1082 Ga0495671_0119136 3300046692 Bacteria 1288
1083 Ga0495671_0198487 3300046692 Bacteria 973
1084 Ga0495649_0097556 3300046694 Bacteria 1563
1085 Ga0495589_0000019 3300046794 Bacteria 200814
1086 Ga0495589_0000265 3300046794 Bacteria 42827
1087 Ga0495589_0004722 3300046794 Bacteria 7229
1088 Ga0495589_0022072 3300046794 Bacteria 3251
1089 Ga0495589_0022653 3300046794 Bacteria 3204
1090 Ga0495589_0038942 3300046794 Bacteria 2377
1091 Ga0495589_0054681 3300046794 Bacteria 1968
1092 Ga0495589_0076983 3300046794 Bacteria 1625
1093 Ga0495589_0080044 3300046794 Bacteria 1589
1094 Ga0495589_0152931 3300046794 Bacteria 1101
1095 Ga0495600_0008649 3300046809 Bacteria 6263
1096 Ga0495600_0027223 3300046809 Bacteria 3694
1097 Ga0495600_0036735 3300046809 Bacteria 3183
1098 Ga0495600_0614316 3300046809 Bacteria 660
1099 Ga0495660_0000354 3300046810 Bacteria 40565
1100 Ga0495660_0002057 3300046810 Bacteria 13073
1101 Ga0495660_0008891 3300046810 Bacteria 5869
1102 Ga0495660_0097749 3300046810 Bacteria 1515
1103 Ga0495660_0099745 3300046810 Bacteria 1496
1104 Ga0495660_0210163 3300046810 Bacteria 923
1105 Ga0495581_0008985 3300047315 Bacteria 5782
1106 Ga0495581_0016928 3300047315 Bacteria 4236
1107 Ga0495581_0043052 3300047315 Bacteria 2612
1108 Ga0495581_0169778 3300047315 Bacteria 1275
1109 Ga0495581_0719232 3300047315 Bacteria 575
1110 Ga0495604_0011342 3300047317 Bacteria 7072
1111 Ga0495604_0102230 3300047317 Bacteria 2104
1112 Ga0495604_0178030 3300047317 Bacteria 1489
1113 Ga0495604_0186383 3300047317 Bacteria 1448
1114 Ga0495636_0167189 3300047318 Bacteria 993
1115 Ga0495636_0659447 3300047318 Bacteria 514
1116 Ga0495674_0028557 3300047319 Bacteria 5084
1117 Ga0495674_0083471 3300047319 Bacteria 2738
1118 Ga0495674_0162200 3300047319 Bacteria 1870
1119 Ga0495674_0415038 3300047319 Bacteria 1085
1120 Ga0495672_0000296 3300047320 Bacteria 68060
1121 Ga0495672_0003026 3300047320 Bacteria 14783
1122 Ga0495672_0004452 3300047320 Bacteria 11466
1123 Ga0495672_0010886 3300047320 Bacteria 6452
1124 Ga0495672_0047594 3300047320 Bacteria 2549
1125 Ga0495676_0000114 3300047321 Bacteria 61730
1126 Ga0495676_0144768 3300047321 Bacteria 1699
1127 Ga0495680_0024292 3300047322 Bacteria 5029
1128 Ga0495680_0123052 3300047322 Bacteria 1913
1129 Ga0495683_0000151 3300047323 Bacteria 68310
1130 Ga0495683_0000783 3300047323 Bacteria 22706
1131 Ga0495683_0058747 3300047323 Bacteria 1909
1132 Ga0495683_0078107 3300047323 Bacteria 1617
1133 Ga0495687_000002 3300047443 Bacteria 1085770
1134 Ga0495687_000007 3300047443 Bacteria 552679
1135 Ga0495687_000059 3300047443 Bacteria 179357
1136 Ga0495687_004997 3300047443 Bacteria 8665
1137 Ga0495687_124166 3300047443 Bacteria 926
1138 Ga0495687_176299 3300047443 Bacteria 702
1139 Ga0495675_0021840 3300047444 Bacteria 4077
1140 Ga0495675_0212261 3300047444 Bacteria 1174
1141 Ga0495677_0000006 3300047445 Bacteria 199230
1142 Ga0495677_0003632 3300047445 Bacteria 5981
1143 Ga0495677_0006321 3300047445 Bacteria 4475
1144 Ga0495677_0012922 3300047445 Bacteria 3040
1145 Ga0495677_0029121 3300047445 Bacteria 2007
1146 Ga0495679_012484 3300047446 Bacteria 3231
1147 Ga0495679_074338 3300047446 Bacteria 973
1148 Ga0495679_098007 3300047446 Bacteria 816
1149 Ga0495685_007399 3300047447 Bacteria 3623
1150 Ga0495685_054110 3300047447 Bacteria 1358
1151 Ga0495685_080198 3300047447 Bacteria 1087
1152 Ga0495685_158216 3300047447 Bacteria 734
1153 Ga0495685_207016 3300047447 Bacteria 628
1154 Ga0495681_0013904 3300047470 Bacteria 4645
1155 Ga0495681_0018418 3300047470 Bacteria 3847
1156 Ga0495681_0053880 3300047470 Bacteria 1881
1157 Ga0495681_0082542 3300047470 Bacteria 1432
1158 Ga0495681_0088444 3300047470 Bacteria 1371
1159 Ga0495681_0221978 3300047470 Bacteria 757
1160 Ga0495684_0041822 3300047471 Bacteria 3511
1161 Ga0495686_0000797 3300047472 Bacteria 40927
1162 Ga0495593_0007642 3300047673 Bacteria 6314
1163 Ga0495593_0052150 3300047673 Bacteria 2163
1164 Ga0495593_0067683 3300047673 Bacteria 1859
1165 Ga0495593_0172516 3300047673 Bacteria 1090
1166 Ga0495593_0264094 3300047673 Bacteria 861
1167 Ga0495602_0020385 3300048088 Bacteria 6553
1168 Ga0495602_0123482 3300048088 Bacteria 2079
1169 Ga0495614_0010515 3300048089 Bacteria 4081
1170 Ga0495614_0013242 3300048089 Bacteria 3617
1171 Ga0495614_0017760 3300048089 Bacteria 3087
1172 Ga0495626_0000103 3300048091 Bacteria 110163
1173 Ga0495626_0002196 3300048091 Bacteria 14014
1174 Ga0495626_0002740 3300048091 Bacteria 11862
1175 Ga0495626_0043676 3300048091 Bacteria 2101
1176 Ga0495626_0044975 3300048091 Bacteria 2063
1177 Ga0495626_0047598 3300048091 Bacteria 1992
1178 Ga0495626_0166905 3300048091 Bacteria 919
1179 Ga0495626_0354504 3300048091 Bacteria 572
1180 Ga0496100_0135118 3300048903 Bacteria 1741
1181 Ga0496100_0249929 3300048903 Bacteria 1311
1182 Ga0496101_0003635 3300048904 Bacteria 9629
1183 Ga0496101_0041474 3300048904 Bacteria 3282
1184 Ga0496101_0690581 3300048904 Bacteria 806
1185 Ga0496102_0000939 3300048905 Bacteria 27514
1186 Ga0496102_0222801 3300048905 Bacteria 1778
1187 Ga0496102_1054810 3300048905 Bacteria 733
1188 Ga0496102_1246871 3300048905 Bacteria 663
1189 Ga0496103_0194271 3300048906 Bacteria 1305
1190 Ga0496103_0474941 3300048906 Bacteria 801
1191 Ga0496103_0515617 3300048906 Bacteria 764
1192 Ga0496103_0601194 3300048906 Bacteria 701
1193 Ga0496104_0005181 3300048907 Bacteria 11391
1194 Ga0496105_0136044 3300048908 Bacteria 2024
1195 Ga0496106_0007554 3300048909 Bacteria 8042
1196 Ga0496106_0282133 3300048909 Bacteria 1331
1197 Ga0496106_0425229 3300048909 Bacteria 1067
1198 Ga0496107_0039446 3300048910 Bacteria 3388
1199 Ga0496109_0125473 3300048912 Bacteria 2393
1200 Ga0496109_0167037 3300048912 Bacteria 2063
1201 Ga0496109_0182761 3300048912 Bacteria 1970
1202 Ga0496109_0739142 3300048912 Bacteria 922
1203 Ga0496110_0102527 3300048913 Bacteria 2566
1204 Ga0496110_0156934 3300048913 Bacteria 2061
1205 Ga0496110_0185775 3300048913 Bacteria 1887
1206 Ga0496110_0950188 3300048913 Bacteria 766
1207 Ga0496111_0423021 3300048914 Bacteria 984
1208 Ga0496111_0797879 3300048914 Bacteria 683
1209 Ga0496112_0003934 3300048915 Bacteria 12439
1210 Ga0496112_0227089 3300048915 Bacteria 1822
1211 Ga0496112_0280272 3300048915 Bacteria 1614
1212 Ga0496112_0300660 3300048915 Bacteria 1550
1213 Ga0496112_0408344 3300048915 Bacteria 1297
1214 Ga0496112_0963591 3300048915 Bacteria 774
1215 Ga0496113_0038902 3300048916 Bacteria 3499
1216 Ga0496113_0336642 3300048916 Bacteria 1210
1217 Ga0496114_0000134 3300048917 Bacteria 53462
1218 Ga0496114_0966575 3300048917 Bacteria 734
1219 Ga0496115_0022204 3300048918 Bacteria 4914
1220 Ga0496115_0110002 3300048918 Bacteria 2263
1221 Ga0496115_0114680 3300048918 Bacteria 2215
1222 Ga0496115_0136155 3300048918 Bacteria 2025
1223 Ga0496115_0288325 3300048918 Bacteria 1347
1224 Ga0496115_0518997 3300048918 Bacteria 955
1225 Ga0496118_0429425 3300048921 Bacteria 677
1226 Ga0496119_0038726 3300048922 Bacteria 3076
1227 Ga0496120_0000863 3300048923 Bacteria 42869
1228 Ga0496120_0034227 3300048923 Bacteria 3046
1229 Ga0496120_0442227 3300048923 Bacteria 567
1230 Ga0496121_0388607 3300048924 Bacteria 918
1231 Ga0496122_0000727 3300048925 Bacteria 64439
1232 Ga0496123_0000791 3300048926 Bacteria 51059
1233 Ga0496123_0443427 3300048926 Bacteria 580
1234 Ga0496124_0000313 3300048927 Bacteria 89891
1235 Ga0496124_0000314 3300048927 Bacteria 89797
1236 Ga0496124_0048155 3300048927 Bacteria 3644
1237 Ga0496124_0104859 3300048927 Bacteria 2285
1238 Ga0496124_0631296 3300048927 Bacteria 691
1239 Ga0496125_0019499 3300048928 Bacteria 6394
1240 Ga0496125_0143910 3300048928 Bacteria 1652
1241 Ga0496125_0304433 3300048928 Bacteria 975
1242 Ga0496125_0749729 3300048928 Bacteria 512
1243 Ga0496126_0337892 3300048929 Bacteria 1234
1244 Ga0495678_004280 3300049459 Bacteria 8333
1245 Ga0495678_004747 3300049459 Bacteria 7748
1246 Ga0495678_035328 3300049459 Bacteria 2049
1247 Ga0495678_215603 3300049459 Bacteria 585
1248 Ga0495682_0003596 3300049460 Bacteria 6833
1249 Ga0495682_0067660 3300049460 Bacteria 1287
1250 Ga0495682_0106446 3300049460 Bacteria 1005
1251 Ga0501320_071114 3300049536 Bacteria 504
1252 Ga0501032_0000117 3300049569 Bacteria 67270
1253 Ga0501032_0006793 3300049569 Bacteria 8396
1254 Ga0501033_0000623 3300049570 Bacteria 32807
1255 Ga0501033_0217104 3300049570 Bacteria 1362
1256 Ga0501034_0000556 3300049571 Bacteria 59195
1257 Ga0501034_0005112 3300049571 Bacteria 14400
1258 Ga0501034_0124643 3300049571 Bacteria 2562
1259 Ga0501034_0922152 3300049571 Bacteria 760
1260 Ga0501036_0000102 3300049572 Bacteria 53579
1261 Ga0501037_0000296 3300049573 Bacteria 42150
1262 Ga0501037_0092362 3300049573 Bacteria 2189
1263 Ga0501038_0003768 3300049574 Bacteria 14107
1264 Ga0501039_0000003 3300049575 Bacteria 357424
1265 Ga0501039_0538879 3300049575 Unclassified 916
1266 Ga0501039_0725080 3300049575 Bacteria 777
1267 Ga0501039_1004021 3300049575 Bacteria 648
1268 Ga0501040_0000498 3300049576 Bacteria 23447
1269 Ga0501040_0054182 3300049576 Bacteria 2749
1270 Ga0501040_0077549 3300049576 Bacteria 2299
1271 Ga0501040_0755715 3300049576 Bacteria 703
1272 Ga0501041_0125087 3300049577 Bacteria 1600
1273 Ga0501042_0003681 3300049578 Bacteria 9669
1274 Ga0501042_0127956 3300049578 Bacteria 1829
1275 Ga0501043_0000068 3300049579 Bacteria 93023
1276 Ga0501046_0028892 3300049580 Bacteria 4512
1277 Ga0501046_0198412 3300049580 Bacteria 1494
1278 Ga0501046_0216812 3300049580 Bacteria 1419
1279 Ga0501047_0012297 3300049581 Bacteria 8100
1280 Ga0501047_0235955 3300049581 Bacteria 1681
1281 Ga0501047_0428209 3300049581 Bacteria 1154
1282 Ga0501047_0626755 3300049581 Bacteria 896
1283 Ga0501048_0122889 3300049582 Bacteria 1835
1284 Ga0501067_0033268 3300049583 Bacteria 2861
1285 Ga0501067_0292143 3300049583 Bacteria 907
1286 Ga0501068_0849685 3300049584 Bacteria 600
1287 Ga0501069_0000877 3300049585 Bacteria 14345
1288 Ga0501070_0000831 3300049586 Bacteria 28088
1289 Ga0501070_0403017 3300049586 Bacteria 1106
1290 Ga0501070_0524892 3300049586 Bacteria 950
1291 Ga0501072_0051143 3300049588 Bacteria 3254
1292 Ga0501073_0003992 3300049589 Bacteria 11079
1293 Ga0501074_0049521 3300049590 Bacteria 3033
1294 Ga0501075_0507878 3300049591 Bacteria 920
1295 Ga0501076_0155238 3300049592 Bacteria 1863
1296 Ga0501076_1288561 3300049592 Bacteria 601
1297 Ga0501235_220994 3300049669 Unclassified 520
1298 Ga0501079_0015904 3300049741 Bacteria 5751
1299 Ga0501079_0630421 3300049741 Bacteria 844
1300 Ga0501079_0791288 3300049741 Bacteria 747
1301 Ga0501079_0891070 3300049741 Bacteria 701
1302 Ga0501080_0012533 3300049742 Bacteria 7775
1303 Ga0501081_0122066 3300049743 Bacteria 1857
1304 Ga0501083_0004385 3300049744 Bacteria 9949
1305 Ga0501035_0000032 3300049822 Bacteria 175435
1306 Ga0501035_0013083 3300049822 Bacteria 7658
1307 Ga0501035_0468159 3300049822 Bacteria 1041
1308 Ga0501044_0081509 3300049823 Bacteria 3275
1309 Ga0501044_0254919 3300049823 Bacteria 1694
1310 Ga0501044_0570042 3300049823 Bacteria 1027
1311 Ga0501045_0452317 3300049824 Bacteria 955
1312 nmdc:mga03683_153934_c1 3300050489 Bacteria 1039
1313 nmdc:mga03683_181958_c1 3300050489 Bacteria 959
1314 nmdc:mga03n38_196633_c1 3300050490 Bacteria 1041
1315 nmdc:mga03n38_203557_c1 3300050490 Bacteria 1026
1316 nmdc:mga03n38_71205_c1 3300050490 Bacteria 1610
1317 nmdc:mga03n38_960649_c1 3300050490 Bacteria 505
1318 nmdc:mga00v17_136978_c1 3300050491 Bacteria 1568
1319 nmdc:mga00v17_180199_c1 3300050491 Bacteria 1363
1320 nmdc:mga00v17_531685_c1 3300050491 Bacteria 761
1321 nmdc:mga00v17_538272_c1 3300050491 Bacteria 756
1322 nmdc:mga0yw44_100254_c1 3300050492 Bacteria 1844
1323 nmdc:mga0yw44_1146_c1 3300050492 Bacteria 10266
1324 nmdc:mga0yw44_223453_c1 3300050492 Bacteria 1249
1325 nmdc:mga0yw44_328994_c1 3300050492 Bacteria 1027
1326 nmdc:mga0yw44_43625_c1 3300050492 Bacteria 2678
1327 nmdc:mga0yw44_83422_c1 3300050492 Bacteria 2007
1328 nmdc:mga0yw44_972727_c1 3300050492 Bacteria 575
1329 nmdc:mga0k408_109436_c1 3300050493 Bacteria 1633
1330 nmdc:mga0k408_133169_c1 3300050493 Bacteria 1476
1331 nmdc:mga0k408_499912_c1 3300050493 Bacteria 720
1332 nmdc:mga0k408_881944_c1 3300050493 Bacteria 519
1333 nmdc:mga06z11_135991_c1 3300050494 Bacteria 1385
1334 nmdc:mga06z11_143135_c1 3300050494 Bacteria 1353
1335 nmdc:mga06z11_149909_c1 3300050494 Bacteria 1325
1336 nmdc:mga06z11_6352_c1 3300050494 Bacteria 4800
1337 nmdc:mga04h51_116979_c1 3300050495 Bacteria 989
1338 nmdc:mga04h51_241241_c1 3300050495 Bacteria 722
1339 nmdc:mga04h51_309069_c1 3300050495 Bacteria 646
1340 nmdc:mga04h51_350908_c1 3300050495 Bacteria 610
1341 nmdc:mga04h51_62207_c1 3300050495 Bacteria 1282
1342 nmdc:mga07m45_308232_c1 3300050496 Bacteria 921
1343 nmdc:mga07m45_369704_c1 3300050496 Bacteria 833
1344 nmdc:mga07m45_43067_c1 3300050496 Bacteria 2531
1345 nmdc:mga07m45_623799_c1 3300050496 Bacteria 622
1346 nmdc:mga06r32_201443_c1 3300050510 Bacteria 1978
1347 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
1348 nmdc:mga08y16_148583_c1 3300050511 Bacteria 2436
1349 nmdc:mga08y16_858433_c1 3300050511 Unclassified 896
1350 nmdc:mga0n895_213386_c1 3300050512 Bacteria 1960
1351 nmdc:mga0rr50_1022361_c1 3300050513 Bacteria 704
1352 nmdc:mga0rr50_1511783_c1 3300050513 Bacteria 567
1353 nmdc:mga0rr50_356859_c1 3300050513 Bacteria 1230
1354 nmdc:mga0rr50_398223_c1 3300050513 Bacteria 1163
1355 nmdc:mga08x19_117937_c1 3300050514 Bacteria 1776
1356 nmdc:mga0a205_290952_c1 3300050515 Bacteria 1508
1357 nmdc:mga0a205_62875_c1 3300050515 Bacteria 3586
1358 nmdc:mga0sz30_110001_c1 3300050516 Bacteria 1207
1359 nmdc:mga0sz30_140867_c1 3300050516 Bacteria 1065
1360 nmdc:mga0sz30_41551_c1 3300050516 Bacteria 1933
1361 Ga0495601_0083953 3300053077 Bacteria 2046
1362 Ga0495601_0316216 3300053077 Bacteria 1017
1363 Ga0495601_0582321 3300053077 Bacteria 719
1364 Ga0495655_0251909 3300053083 Bacteria 594
1365 Ga0495595_0240802 3300053084 Bacteria 905
1366 Ga0495619_0032650 3300053085 Bacteria 3378
1367 Ga0500644_0036255 3300053088 Bacteria 1604
1368 Ga0500650_0443934 3300053098 Bacteria 557
1369 Ga0500595_011249 3300053119 Bacteria 3513
1370 Ga0500595_080771 3300053119 Bacteria 952
1371 Ga0500628_061402 3300053129 Bacteria 919
1372 Ga0500642_0148074 3300053130 Bacteria 1102
1373 Ga0500588_0000160 3300053146 Bacteria 8978
1374 Ga0501084_0285955 3300054114 Bacteria 1392
1375 Ga0590075_079850 3300059424 Unclassified 847
1376 Ga0587082_123775 3300059504 Bacteria 587
1377 Ga0587083_0106630 3300059505 Bacteria 706
1378 Ga0587088_009150 3300059508 Bacteria 1419
1379 Ga0587088_160033 3300059508 Bacteria 551
1380 Ga0587062_017899 3300059639 Bacteria 974
1381 Ga0587067_021806 3300059640 Bacteria 1109
1382 Ga0587069_060719 3300059642 Bacteria 696
1383 Ga0587072_046400 3300059643 Bacteria 859
1384 Ga0587075_015894 3300059644 Bacteria 1064
1385 Ga0587104_004120 3300059650 Bacteria 919
1386 Ga0587105_002691 3300059651 Bacteria 1030
1387 Ga0587107_045183 3300059652 Bacteria 727
1388 Ga0587124_006915 3300059660 Bacteria 944
1389 Ga0587071_038705 3300060344 Bacteria 948
1390 Ga0587071_133895 3300060344 Bacteria 603
1391 Ga0587111_0102544 3300060346 Bacteria 715
1392 Ga0501082_1842569 3300060353 Bacteria 528
1393 2509373386 2509276018 Bacteria 6910194
1394 2510285363 2510065053 Bacteria 5005518
1395 2510311375 2510065058 Bacteria 5005894
1396 2510317604 2510065059 Bacteria 6847884
1397 2512930985 2512875016 Bacteria 6529530
1398 2512958717 2512875024 Bacteria 7195110
1399 2513611068 2513237090 Bacteria 7096802
1400 2514034868 2513237164 Bacteria 7563725
1401 2514418508 2513237305 Bacteria 7293571
1402 2548847635 2547132512 Bacteria 3416496
1403 2588516674 2588253730 Bacteria 6881675
1404 2599940448 2599185301 Bacteria 6161860
1405 2643799876 2643221556 Bacteria 7251154
1406 2643840504 2643221564 Bacteria 4193379
1407 2643989283 2643221595 Bacteria 6565519
1408 2644152856 2643221627 Bacteria 6761570
1409 2644474876 2643221684 Bacteria 7145183
1410 2688599534 2687453392 Bacteria 6880454
1411 2694629732 2693429783 Bacteria 7019804
1412 2694636395 2693429784 Bacteria 7241525
1413 2723575872 2721755686 Bacteria 7343952
1414 2729146746 2728369097 Bacteria 4333476
1415 2756677250 2756170246 Bacteria 7451806
1416 2774129613 2773857672 Bacteria 4993178
1417 2792749867 2791355123 Bacteria 8049106
1418 2795786503 2795385470 Bacteria 8317180
1419 2809146783 2808606418 Bacteria 6724496
1420 2828306718 2828305725 Bacteria 4916900
1421 2838056618 2838054893 Bacteria 7451788
1422 2844006330 2844002411 Bacteria 7168230
1423 2844014809 2844009547 Bacteria 6728125
1424 2847676065 2847670302 Bacteria 6165597
1425 2847692707 2847686936 Bacteria 6278406
1426 2856315852 2856314179 Bacteria 6477897
1427 2856334052 2856328259 Bacteria 6528202
1428 2856341279 2856334872 Bacteria 7037011
1429 2856355262 2856349417 Bacteria 6230045
1430 2856361103 2856356410 Bacteria 6297484
1431 2856370624 2856364286 Bacteria 6939991
1432 2857350544 2857349434 Bacteria 7926032
1433 2857372817 2857367948 Bacteria 6965560
1434 2869171425 2869169390 Bacteria 6659796
1435 2869235123 2869234852 Bacteria 6654993
1436 2869248067 2869242130 Bacteria 6609239
1437 2869251384 2869249662 Bacteria 6868783
1438 2869260540 2869256925 Bacteria 6981691
1439 2869267095 2869264136 Bacteria 6880765
1440 2869274911 2869271264 Bacteria 6908218
1441 2869291648 2869285874 Bacteria 6901219
1442 2871434858 2871429161 Bacteria 6547891
1443 2871443414 2871435913 Bacteria 6880295
1444 2871447774 2871444079 Bacteria 6423508
1445 2871452772 2871451962 Bacteria 7336357
1446 2871460495 2871459585 Bacteria 6866887
1447 2871470858 2871466892 Bacteria 6923287
1448 2871487103 2871481445 Bacteria 6700002
1449 2871495481 2871488783 Bacteria 6929816
1450 2871502751 2871495908 Bacteria 6935695
1451 2874103897 2874102143 Bacteria 6342645
1452 2874110085 2874109183 Bacteria 6517025
1453 2874119714 2874116593 Bacteria 6674494
1454 2874130979 2874123672 Bacteria 7238285
1455 2874135031 2874131515 Bacteria 6820270
1456 2874149247 2874146452 Bacteria 7533118
1457 2874157512 2874155637 Bacteria 6724144
1458 2874165530 2874162495 Bacteria 6174670
1459 2874176099 2874168670 Bacteria 8062617
1460 2876365864 2876363079 Bacteria 6544991
1461 2876377563 2876369609 Bacteria 6807521
1462 2876384737 2876377896 Bacteria 6565995
1463 2876391667 2876386047 Bacteria 6698674
1464 2876394713 2876392853 Bacteria 6660880
1465 2876402210 2876399893 Bacteria 6927900
1466 2876413579 2876406927 Bacteria 6191900
1467 2876415714 2876413966 Bacteria 6831344
1468 2876425035 2876420981 Bacteria 6687741
1469 2878040120 2878035449 Bacteria 6555736
1470 2878733601 2878730984 Bacteria 6380721
1471 2878751992 2878745973 Bacteria 6867388
1472 2878757895 2878753008 Bacteria 6922523
1473 2878766643 2878760144 Bacteria 6823465
1474 2878773840 2878767105 Bacteria 6898628
1475 2878775418 2878774303 Bacteria 6108671
1476 2878783977 2878781027 Bacteria 6834456
1477 2881152065 2881147464 Bacteria 7779814
1478 2881155787 2881155292 Bacteria 6461656
1479 2881168042 2881161766 Bacteria 7127907
1480 2881850866 2881845957 Bacteria 6611900
1481 2881860291 2881853255 Bacteria 6698367
1482 2881867465 2881861095 Bacteria 7128710
1483 2882637090 2882632389 Bacteria 8154593
1484 2882916591 2882912400 Bacteria 6801539
1485 2885309926 2885305155 Bacteria 7348390
1486 2885317012 2885312484 Bacteria 6415165
1487 2885324934 2885318864 Bacteria 6729568
1488 2885326933 2885326080 Bacteria 7134805
1489 2885336051 2885334103 Bacteria 7216818
1490 2885350497 2885342637 Bacteria 7011821
1491 2885352730 2885350715 Bacteria 6787678
1492 2888356291 2888350351 Bacteria 7372807
1493 2889011215 2889010040 Bacteria 6749192
1494 2889017060 2889016732 Bacteria 6700763
1495 2894657464 2894652903 Bacteria 4587256
1496 2903493449 2903492973 Bacteria 13473544
1497 2903506641 2903492973 Bacteria 13473544
1498 2903517332 2903513507 Bacteria 6344008
1499 2903523812 2903521522 Bacteria 6525694
1500 2903534327 2903528002 Bacteria 6586099
1501 2903547890 2903540706 Bacteria 7062119
1502 2904661345 2904659560 Bacteria 6685615
1503 2906314386 2906308376 Bacteria 6841989
1504 2906327555 2906321335 Bacteria 6579571
1505 2906329410 2906328253 Bacteria 6585166
1506 2906355938 2906354277 Bacteria 6991324
1507 2906369130 2906363423 Bacteria 6856682
1508 2906376577 2906370794 Bacteria 6881062
1509 2906380163 2906378014 Bacteria 6911440
1510 2906387057 2906386501 Bacteria 5977019
1511 2906395976 2906393657 Bacteria 6790866
1512 2906407137 2906401398 Bacteria 6693206
1513 2906410659 2906408224 Bacteria 6162342
1514 2906415989 2906414383 Bacteria 6580790
1515 2906432640 2906427513 Bacteria 6375796
1516 2917834581 2917832318 Bacteria 5346010
1517 2919127225 2919125081 Bacteria 5385106
1518 2919406581 2919404418 Bacteria 4232372
1519 2922131987 2922130491 Bacteria 7173936
1520 2922152585 2922151315 Bacteria 6902399
1521 2922160098 2922158528 Bacteria 6573167
1522 2922175959 2922172374 Bacteria 6167644
1523 2922191098 2922185730 Bacteria 7113964
1524 2924711439 2924710171 Bacteria 6752351
1525 2924728055 2924726620 Bacteria 6271473
1526 2924744929 2924741084 Bacteria 6661321
1527 2924750967 2924748358 Bacteria 6154725
1528 2924766926 2924762789 Bacteria 6561353
1529 2924784609 2924784321 Bacteria 7416538
1530 2937816310 2937813078 Bacteria 7783518
1531 2937854970 2937848649 Bacteria 6983481
1532 2937865365 2937861824 Bacteria 6660327
1533 2937870369 2937868953 Bacteria 6639878
1534 2937896728 2937891427 Bacteria 6357007
1535 2937985532 2937980651 Bacteria 6517427
1536 2938001768 2937994558 Bacteria 7036190
1537 2938015808 2938014810 Bacteria 6700592
1538 2958103020 2958100919 Bacteria 6800575
1539 2958111112 2958108152 Bacteria 6681128
1540 2958118901 2958115193 Bacteria 6923548
1541 2958124321 2958122699 Bacteria 7280457
1542 2958136048 2958130278 Bacteria 6897202
1543 2958140455 2958137437 Bacteria 6050276
1544 2958159728 2958158011 Bacteria 6058449
1545 2958171823 2958165035 Bacteria 6906348
1546 2958174434 2958172287 Bacteria 6716688
1547 2958185515 2958179912 Bacteria 6874908
1548 2961083893 2961077736 Bacteria 7079850
1549 2961116499 2961114664 Bacteria 6680456
1550 2961135427 2961127735 Bacteria 7196641
1551 2961141554 2961136820 Bacteria 6775228
1552 2961170269 2961163497 Bacteria 6901077
1553 2961174439 2961170736 Bacteria 7072258
1554 2961190131 2961183825 Bacteria 6688536
1555 2963648239 2963644680 Bacteria 6530403
1556 2965025015 2965018300 Bacteria 6883036
1557 2965027771 2965025482 Bacteria 6532201
1558 2965035252 2965032056 Bacteria 6887443
1559 2965041277 2965040258 Bacteria 6855979
1560 2965051594 2965047637 Bacteria 6623551
1561 2965069091 2965062239 Bacteria 7412989
1562 2965096148 2965089291 Bacteria 6866420
1563 2965108067 2965102966 Bacteria 6800987
1564 2965123722 2965119406 Bacteria 6956431
1565 2968000430 2967996073 Bacteria 6787468
1566 2968003659 2968003550 Bacteria 6929263
1567 2968095824 2968091066 Bacteria 6052692
1568 2968101049 2968097103 Bacteria 6107094
1569 2968112405 2968110612 Bacteria 6814636
1570 2968121200 2968117919 Bacteria 6536078
1571 2968132773 2968128360 Bacteria 6270294
1572 2968146124 2968138860 Bacteria 6605449
1573 2968178656 2968171901 Bacteria 6894245
1574 2970490220 2970489779 Bacteria 6517260
1575 2970507026 2970503327 Bacteria 7099517
1576 2970513035 2970510686 Bacteria 7006402
1577 2970533245 2970532167 Bacteria 6553173
1578 2970549423 2970547951 Bacteria 6931819
1579 2970561501 2970554993 Bacteria 6814252
1580 2970626669 2970619444 Bacteria 6986144
1581 2970633751 2970627176 Bacteria 6680862
1582 2974301986 2974298342 Bacteria 4840922
1583 2977822428 2977821940 Bacteria 6906439
1584 2977833098 2977828996 Bacteria 7007971
1585 2977846544 2977843712 Bacteria 6753583
1586 2977855462 2977851361 Bacteria 6694324
1587 2977861521 2977858184 Bacteria 6215359
1588 2977865750 2977864932 Bacteria 7534097
1589 2977876214 2977872689 Bacteria 7270173
1590 2977907042 2977898635 Bacteria 6675551
1591 2977908240 2977907340 Bacteria 6577984
1592 2977922223 2977915119 Bacteria 6829656
1593 2977929359 2977922695 Bacteria 6956781
1594 2977936874 2977935797 Bacteria 6252826
1595 2977947744 2977942078 Bacteria 7570577
1596 2977955493 2977950692 Bacteria 6893264
1597 2977962774 2977957713 Bacteria 6877875
1598 2977972123 2977971508 Bacteria 7472917
1599 2977992801 2977986579 Bacteria 6581278
1600 2979714445 2979710463 Bacteria 6785254
1601 2979747397 2979742915 Bacteria 7301278
1602 2979766569 2979764755 Bacteria 6610066
1603 2979776549 2979772303 Bacteria 6618277
1604 2979784568 2979779861 Bacteria 6219781
1605 2979800424 2979793036 Bacteria 6808957
1606 2979812221 2979808191 Bacteria 7179355
1607 2984500446 2984499530 Bacteria 5020881
1608 2984506959 2984504281 Bacteria 5262371
1609 2987637728 2987636660 Bacteria 8088555
1610 2987646190 2987645492 Bacteria 6117018
1611 2987652794 2987652177 Bacteria 6969023
1612 2987666510 2987659509 Bacteria 6966464
1613 2987668733 2987666974 Bacteria 6509233
1614 2987679705 2987673487 Bacteria 6884027
1615 2996341117 2996336353 Bacteria 5511628
1616 2996346655 2996341866 Bacteria 6643098
1617 2996393026 2996386984 Bacteria 6978667
1618 3000140075 3000135777 Bacteria 6891109
1619 3003933593 3003930520 Bacteria 5667563
1620 3004195512 3004188549 Bacteria 6952365
1621 3004197669 3004195979 Bacteria 6776956
1622 3004205950 3004203850 Bacteria 7307914
1623 3004211783 3004211236 Bacteria 7417683
1624 3004219030 3004218560 Bacteria 7421728
1625 3004235852 3004232784 Bacteria 6662140
1626 3004241752 3004239961 Bacteria 6892290
1627 3004251017 3004248173 Bacteria 6563236
1628 3004274626 3004268573 Bacteria 7043476
1629 637074027 637000159 Bacteria 7596297
1630 649874037 649633066 Bacteria 6690028
1631 8004302354 8004300914 Bacteria 6132239
1632 8004365256 8004361976 Bacteria 6858373
1633 8004379407 8004374579 Bacteria 6898112
1634 8004394625 8004387939 Bacteria 7049250
1635 8004447623 8004445564 Bacteria 6322258
1636 8004640217 8004640170 Bacteria 6723001
1637 8004702278 8004695233 Bacteria 6731676
1638 8004709803 8004703790 Bacteria 8006957
1639 8004720649 8004714634 Bacteria 6776161
1640 8004728410 8004727605 Bacteria 6643904
1641 8016730978 8016728285 Bacteria 5263933
1642 8047673274 8047673197 Bacteria 7395230
1643 Ga0207690_10259749
1644 JGI24736J21556_1065209
1645 JGI24740J21852_10008429
1646 JGI24739J22299_10038979
1647 JGI24739J22299_10136143
1648 JGI24735J21928_10043246
1649 JGI25157J39369_1000145
1650 JGI25157J39369_1000826
1651 JGI25151J46595_10000186
1652 JGI25406J46586_10046782
1653 JGI25406J46586_10060919
1654 JGI25406J46586_10094540
1655 JGI25165J46597_1000325
1656 JGI25153J46596_10044278
1657 rootL2_10273037
1658 Ga0007410J51695_1030494
1659 Ga0006562J51391_1057637
1660 Ga0055539_1001430
1661 Ga0055533_1001807
1662 Ga0055527_1000043
1663 Ga0055535_1000071
1664 Ga0055542_1000096
1665 Ga0055542_1000553
1666 Ga0055529_1000114
1667 Ga0055529_1003236
1668 JGI25405J52794_10001981
1669 Ga0065165_1002388
1670 Ga0065714_10076975
1671 Ga0065712_10089189
1672 Ga0065712_10666360
1673 Ga0065715_10557850
1674 Ga0065715_11025097
1675 Ga0065707_10087092
1676 Ga0065707_10299477
1677 Ga0065707_10537776
1678 Ga0070658_10299601
1679 Ga0070658_10727889
1680 Ga0070658_11568455
1681 Ga0070676_10099429
1682 Ga0070676_10329302
1683 Ga0070683_100309720
1684 Ga0070690_100002820
1685 Ga0070690_100134428
1686 Ga0070670_100058784
1687 Ga0070670_101114720
1688 Ga0070677_10180825
1689 Ga0068869_100028475
1690 Ga0068869_100036100
1691 Ga0068869_100241015
1692 Ga0070666_10044125
1693 Ga0070680_100000436
1694 Ga0070680_100339878
1695 Ga0070682_100727644
1696 Ga0068868_100050486
1697 Ga0068868_100052894
1698 Ga0068868_100115865
1699 Ga0068868_100301872
1700 Ga0070660_100268695
1701 Ga0070689_100012027
1702 Ga0070689_100790291
1703 Ga0070691_10214210
1704 Ga0070691_10633740
1705 Ga0070687_100073332
1706 Ga0070687_100122652
1707 Ga0070687_100205813
1708 Ga0070687_100513490
1709 Ga0070661_100029628
1710 Ga0070661_100494998
1711 Ga0070661_101247165
1712 Ga0070692_10026902
1713 Ga0070669_100549427
1714 Ga0070669_101526777
1715 Ga0070675_100588158
1716 Ga0070675_101070427
1717 Ga0070671_100007704
1718 Ga0070671_100211677
1719 Ga0070674_100437962
1720 Ga0070673_100001822
1721 Ga0070673_100605258
1722 Ga0070673_100877423
1723 Ga0070688_100002648
1724 Ga0070659_100262714
1725 Ga0070659_102074733
1726 Ga0070667_100032425
1727 Ga0070667_101391840
1728 Ga0070667_101665986
1729 Ga0070709_10100469
1730 Ga0070714_100102313
1731 Ga0070714_100178254
1732 Ga0070714_100292931
1733 Ga0070713_100012514
1734 Ga0070713_100039298
1735 Ga0070713_100193517
1736 Ga0070713_101044345
1737 Ga0070710_10013019
1738 Ga0070710_10036502
1739 Ga0070701_10002995
1740 Ga0070701_10064909
1741 Ga0070701_10296987
1742 Ga0070711_100005477
1743 Ga0070705_100039297
1744 Ga0070705_100163135
1745 Ga0070705_100468162
1746 Ga0070705_101828626
1747 Ga0070700_100296811
1748 Ga0070694_100071045
1749 Ga0070694_100103302
1750 Ga0070694_100151881
1751 Ga0070694_100202692
1752 Ga0070694_100217262
1753 Ga0070694_101429228
1754 Ga0070708_100007993
1755 Ga0070708_100129914
1756 Ga0070708_100240409
1757 Ga0070708_100329407
1758 Ga0070663_100359443
1759 Ga0070663_100398405
1760 Ga0070663_101752934
1761 Ga0070678_100059125
1762 Ga0070678_100624413
1763 Ga0070662_100019430
1764 Ga0070662_100287109
1765 Ga0070662_100304462
1766 Ga0070681_10090610
1767 Ga0070681_10580572
1768 Ga0070681_11209966
1769 Ga0068867_100593667
1770 Ga0068867_100894492
1771 Ga0068867_102043528
1772 Ga0068867_102176085
1773 Ga0068867_102314126
1774 Ga0070685_10108159
1775 Ga0070706_100002397
1776 Ga0070706_100039497
1777 Ga0070706_100420659
1778 Ga0070707_100016355
1779 Ga0070707_100016400
1780 Ga0070707_100021949
1781 Ga0070707_100081493
1782 Ga0070707_100322248
1783 Ga0070698_100003111
1784 Ga0070698_100022873
1785 Ga0070698_100133725
1786 Ga0070698_100255792
1787 Ga0070698_100350384
1788 Ga0070698_101241008
1789 Ga0070699_100018068
1790 Ga0070699_100347512
1791 Ga0070699_101275382
1792 Ga0070679_100625780
1793 Ga0070679_100751640
1794 Ga0070684_100122750
1795 Ga0070697_100005500
1796 Ga0070697_100102973
1797 Ga0070697_100127420
1798 Ga0068853_100181578
1799 Ga0068853_100214322
1800 Ga0070672_100015498
1801 Ga0070686_100051239
1802 Ga0070686_100245868
1803 Ga0070686_100259239
1804 Ga0070695_100020958
1805 Ga0070695_100050716
1806 Ga0070696_100002641
1807 Ga0070696_100036693
1808 Ga0070696_100119158
1809 Ga0070696_100246852
1810 Ga0070696_100572093
1811 Ga0070696_100656110
1812 Ga0070693_100009343
1813 Ga0070693_100562931
1814 Ga0070665_100005394
1815 Ga0070665_100033046
1816 Ga0070665_100199704
1817 Ga0070665_100217878
1818 Ga0070665_100403241
1819 Ga0070665_101171156
1820 Ga0070704_100007251
1821 Ga0070704_100049539
1822 Ga0070704_100050460
1823 Ga0070704_100089897
1824 Ga0070704_100300780
1825 Ga0070704_100409023
1826 Ga0070704_100618643
1827 Ga0068855_100234888
1828 Ga0068855_100699410
1829 Ga0068855_101222444
1830 Ga0070664_100118858
1831 Ga0070664_100226051
1832 Ga0070664_100704853
1833 Ga0068854_100040324
1834 Ga0068854_100158198
1835 Ga0068854_100599234
1836 Ga0068854_101918268
1837 Ga0068856_100000975
1838 Ga0068856_100366813
1839 Ga0068856_100622140
1840 Ga0068856_100793583
1841 Ga0068856_100851755
1842 Ga0070702_100358477
1843 Ga0068852_100418869
1844 Ga0068852_100431900
1845 Ga0068852_101596299
1846 Ga0068859_100098458
1847 Ga0068859_101747166
1848 Ga0068859_102356655
1849 Ga0068864_100496518
1850 Ga0068866_10001452
1851 Ga0068861_100948962
1852 Ga0068870_10754532
1853 Ga0068863_100003425
1854 Ga0068858_100003418
1855 Ga0068858_101317439
1856 Ga0068860_100042429
1857 Ga0068860_100175892
1858 Ga0068862_101585584
1859 Ga0081455_10204550
1860 Ga0081538_10002065
1861 Ga0081539_10002732
1862 Ga0081539_10003664
1863 Ga0081539_10005156
1864 Ga0075365_10035098
1865 Ga0075365_10073920
1866 Ga0075365_10130899
1867 Ga0075365_10363975
1868 Ga0075365_10618750
1869 Ga0075365_11065245
1870 Ga0075368_10109170
1871 Ga0075368_10122026
1872 Ga0075368_10124881
1873 Ga0075368_10199251
1874 Ga0075363_100013693
1875 Ga0075363_100115082
1876 Ga0075363_100284700
1877 Ga0075364_10027338
1878 Ga0075364_10158631
1879 Ga0075364_10366624
1880 Ga0075364_10642453
1881 Ga0075364_11012266
1882 Ga0070715_10165817
1883 Ga0070716_100030710
1884 Ga0070716_100035428
1885 Ga0070712_100001906
1886 Ga0070712_100084711
1887 Ga0075362_10061470
1888 Ga0075362_10224913
1889 Ga0075362_10758522
1890 Ga0075367_10051844
1891 Ga0075367_10082677
1892 Ga0075367_10089130
1893 Ga0075367_10109720
1894 Ga0075367_10171770
1895 Ga0075367_10191222
1896 Ga0075369_10007423
1897 Ga0075369_10015022
1898 Ga0075369_10036973
1899 Ga0075366_10028361
1900 Ga0075366_10047973
1901 Ga0075366_10061070
1902 Ga0075366_10416000
1903 Ga0075366_10590289
1904 Ga0097621_100029217
1905 Ga0097621_100064142
1906 Ga0097621_100278874
1907 Ga0097621_100497382
1908 Ga0075370_10166741
1909 Ga0075370_10267925
1910 Ga0075370_10516360
1911 Ga0075370_10686320
1912 Ga0068871_100008343
1913 Ga0068871_100088736
1914 Ga0068871_100331553
1915 Ga0075428_100008527
1916 Ga0075428_100710399
1917 Ga0075428_101661436
1918 Ga0075431_100137098
1919 Ga0075433_10154497
1920 Ga0075433_10157084
1921 Ga0075433_10486390
1922 Ga0075434_100061710
1923 Ga0075434_100128978
1924 Ga0075429_100055859
1925 Ga0068865_100085583
1926 Ga0075436_100129397
1927 Ga0075436_100367582
1928 Ga0097620_100098462
1929 Ga0097620_101746927
1930 Ga0097620_102356552
1931 Ga0075435_100196366
1932 Ga0075435_100465357
1933 Ga0075435_100525523
1934 Ga0105250_10364994
1935 Ga0105240_10071001
1936 Ga0105240_10273380
1937 Ga0105240_10379812
1938 Ga0105240_10715586
1939 Ga0105240_11137155
1940 Ga0105240_11194290
1941 Ga0105240_12568433
1942 Ga0111539_10000011
1943 Ga0111539_10137853
1944 Ga0111539_10227258
1945 Ga0111539_12983153
1946 Ga0105245_10042421
1947 Ga0105245_10073210
1948 Ga0105245_10503205
1949 Ga0105245_10533162
1950 Ga0105245_11000634
1951 Ga0105245_13204918
1952 Ga0105247_10025334
1953 Ga0114129_10851601
1954 Ga0105243_10516305
1955 Ga0105241_10023869
1956 Ga0105241_10170277
1957 Ga0105242_10028271
1958 Ga0105242_10137224
1959 Ga0105242_11472907
1960 Ga0105248_10563098
1961 Ga0105248_10666879
1962 Ga0105248_11127750
1963 Ga0105237_10014788
1964 Ga0105237_10104436
1965 Ga0105237_10191465
1966 Ga0105237_10222546
1967 Ga0105237_10541853
1968 Ga0105237_11216365
1969 Ga0105238_10003126
1970 Ga0105238_10156605
1971 Ga0105238_10156883
1972 Ga0105238_10302342
1973 Ga0105238_10428717
1974 Ga0105238_10462684
1975 Ga0105238_10975539
1976 Ga0105238_11134480
1977 Ga0105249_10635128
1978 Ga0105249_10998992
1979 Ga0105249_11730529
1980 Ga0105239_10010085
1981 Ga0105239_10043527
1982 Ga0105239_10097049
1983 Ga0105239_10097156
1984 Ga0105239_10151280
1985 Ga0105239_10210483
1986 Ga0105239_10332058
1987 Ga0105239_10345923
1988 Ga0105239_10375329
1989 Ga0105239_10655686
1990 Ga0105239_11841558
1991 Ga0105246_10058596
1992 Ga0105246_10101922
1993 Ga0105246_10238398
1994 Ga0105246_10913547
1995 Ga0157373_10099544
1996 Ga0157371_10585355
1997 Ga0157370_10003103
1998 Ga0157370_10087410
1999 Ga0157369_10136983
2000 Ga0157369_10288523
2001 Ga0157374_10000596
2002 Ga0157378_10065076
2003 Ga0157378_10077986
2004 Ga0157378_10121217
2005 Ga0157378_10651121
2006 Ga0163162_10004338
2007 Ga0163162_10033110
2008 Ga0163162_10812254
2009 Ga0163162_12970585
2010 Ga0157372_10397839
2011 Ga0157372_10463206
2012 Ga0163163_12553753
2013 Ga0157380_10658364
2014 Ga0157380_11129983
2015 Ga0157380_12608996
2016 Ga0157380_12632184
2017 Ga0157380_12756894
2018 Ga0182008_10126972
2019 Ga0157377_10031272
2020 Ga0157379_10037045
2021 Ga0157379_10863368
2022 Ga0157379_12212193
2023 Ga0157376_10068710
2024 Ga0157376_10078986
2025 Ga0157376_10510544
2026 Ga0157376_10771388
2027 Ga0163161_10000750
2028 Ga0163161_10169733
2029 Ga0163161_10817090
2030 Ga0206356_11719896
2031 Ga0206356_11855175
2032 Ga0206351_11007656
2033 Ga0206350_11472044
2034 Ga0213875_10006275
2035 Ga0213875_10354288
2036 Ga0224712_10205346
2037 Ga0209674_100149
2038 Ga0209674_101228
2039 Ga0209672_100008
2040 Ga0209258_100004
2041 Ga0209258_100008
2042 Ga0209026_1000024
2043 Ga0209026_1000045
2044 Ga0209677_103088
2045 Ga0209148_1000050
2046 Ga0209148_1000053
2047 Ga0209148_1000985
2048 Ga0209759_1000140
2049 Ga0209759_1000302
2050 Ga0209233_1000027
2051 Ga0209455_1000007
2052 Ga0209455_1000379
2053 Ga0209025_1000480
2054 Ga0209758_1001305
2055 Ga0209758_1008436
2056 Ga0207653_10030781
2057 Ga0207653_10186415
2058 Ga0207692_10006659
2059 Ga0207692_10018398
2060 Ga0207692_10075332
2061 Ga0207642_10200281
2062 Ga0207642_10565758
2063 Ga0207680_10001836
2064 Ga0207647_10046507
2065 Ga0207685_10135892
2066 Ga0207699_10193349
2067 Ga0207645_10132609
2068 Ga0207645_10520943
2069 Ga0207643_10101309
2070 Ga0207684_10000776
2071 Ga0207684_10001236
2072 Ga0207684_10109218
2073 Ga0207684_10167063
2074 Ga0207684_10467467
2075 Ga0207654_10053109
2076 Ga0207654_10104344
2077 Ga0207654_10160809
2078 Ga0207654_10213319
2079 Ga0207695_10310498
2080 Ga0207695_10524475
2081 Ga0207695_10878985
2082 Ga0207671_10005928
2083 Ga0207671_10407045
2084 Ga0207671_11373339
2085 Ga0207693_10000104
2086 Ga0207693_10175339
2087 Ga0207663_10045982
2088 Ga0207663_10326349
2089 Ga0207663_10444919
2090 Ga0207660_10000002
2091 Ga0207660_10526384
2092 Ga0207662_10092545
2093 Ga0207662_10123259
2094 Ga0207657_10002703
2095 Ga0207657_10735403
2096 Ga0207649_10039428
2097 Ga0207649_10283811
2098 Ga0207649_10564603
2099 Ga0207652_10415910
2100 Ga0207652_10773304
2101 Ga0207646_10000393
2102 Ga0207646_10026917
2103 Ga0207646_10027890
2104 Ga0207646_10160372
2105 Ga0207646_10997221
2106 Ga0207681_10545716
2107 Ga0207694_10003891
2108 Ga0207694_10123486
2109 Ga0207694_10244857
2110 Ga0207694_10324943
2111 Ga0207650_10043409
2112 Ga0207650_10960542
2113 Ga0207659_11282375
2114 Ga0207659_11549339
2115 Ga0207687_10035960
2116 Ga0207687_10374187
2117 Ga0207687_10376854
2118 Ga0207700_10029476
2119 Ga0207700_10041321
2120 Ga0207700_10320869
2121 Ga0207700_11119093
2122 Ga0207664_10039482
2123 Ga0207664_10250716
2124 Ga0207644_10000914
2125 Ga0207644_10095324
2126 Ga0207644_10611339
2127 Ga0207644_11481821
2128 Ga0207690_10455777
2129 Ga0207690_10959672
2130 Ga0207690_11599293
2131 Ga0207706_10197291
2132 Ga0207686_10020327
2133 Ga0207709_10727139
2134 Ga0207670_11520945
2135 Ga0207670_11850293
2136 Ga0207669_10022138
2137 Ga0207669_10340592
2138 Ga0207669_10908088
2139 Ga0207704_10014382
2140 Ga0207665_10053310
2141 Ga0207691_10023854
2142 Ga0207711_10153988
2143 Ga0207711_10751790
2144 Ga0207689_10091261
2145 Ga0207689_10262548
2146 Ga0207661_10076085
2147 Ga0207679_10757328
2148 Ga0207667_10109347
2149 Ga0207667_10201926
2150 Ga0207667_10309404
2151 Ga0207651_10006147
2152 Ga0207651_10766459
2153 Ga0207651_10819706
2154 Ga0207651_11448671
2155 Ga0207712_10423063
2156 Ga0207712_10847666
2157 Ga0207712_10925475
2158 Ga0207640_10062706
2159 Ga0207640_10370523
2160 Ga0207640_10577841
2161 Ga0207640_10627254
2162 Ga0207658_10018280
2163 Ga0207677_10001312
2164 Ga0207677_10049950
2165 Ga0207677_10090075
2166 Ga0207703_10002876
2167 Ga0207703_11122521
2168 Ga0207639_10202265
2169 Ga0207639_10991307
2170 Ga0207678_10167037
2171 Ga0207678_10231093
2172 Ga0207678_11530676
2173 Ga0207708_10188934
2174 Ga0207708_11652448
2175 Ga0207702_10000380
2176 Ga0207702_10073724
2177 Ga0207702_10305139
2178 Ga0207702_11184817
2179 Ga0207641_10020702
2180 Ga0207641_11240485
2181 Ga0207641_11250735
2182 Ga0207648_10231345
2183 Ga0207648_10540197
2184 Ga0207648_10638978
2185 Ga0207676_10094240
2186 Ga0207674_10012568
2187 Ga0207674_10124750
2188 Ga0207675_100911309
2189 Ga0207675_100959916
2190 Ga0207675_100988291
2191 Ga0207683_10001133
2192 Ga0207683_10192190
2193 Ga0207683_10438132
2194 Ga0207683_12054079
2195 Ga0207698_10180270
2196 Ga0209981_1081136
2197 Ga0209813_10052067
2198 Ga0209813_10211157
2199 Ga0209813_10274592
2200 Ga0209813_10315280
2201 Ga0209974_10032144
2202 Ga0207428_10000212
2203 Ga0207428_10058241
2204 Ga0268266_10000850
2205 Ga0268266_10007186
2206 Ga0268266_10090757
2207 Ga0268266_10608110
2208 Ga0268265_10142710
2209 Ga0268264_10003169
2210 Ga0268264_10025615
2211 Ga0265334_10201958
2212 Ga0265322_10029525
2213 Ga0265336_10066977
2214 Ga0265338_10003174
2215 Ga0265338_10025995
2216 Ga0265338_10650797
2217 Ga0307512_10233885
2218 Ga0265770_1049249
2219 Ga0265332_10000024
2220 Ga0265332_10050683
2221 Ga0265329_10003297
2222 Ga0307513_10032790
2223 Ga0307408_100152452
2224 Ga0307408_101461699
2225 Ga0316579_10182376
2226 Ga0316579_10263513
2227 Ga0316579_10378302
2228 Ga0265314_10000087
2229 Ga0316576_10008783
2230 Ga0316576_10010434
2231 Ga0316576_10013218
2232 Ga0316576_10019776
2233 Ga0316576_10074568
2234 Ga0316576_10184841
2235 Ga0316576_10262497
2236 Ga0316576_10373904
2237 Ga0316576_10374916
2238 Ga0316576_10488521
2239 Ga0316576_10580138
2240 Ga0316576_10681452
2241 Ga0316576_11010482
2242 Ga0316578_10004019
2243 Ga0316578_10010761
2244 Ga0316578_10018445
2245 Ga0316578_10115712
2246 Ga0316578_10349861
2247 Ga0316578_10802502
2248 Ga0316577_10042433
2249 Ga0316577_10173854
2250 Ga0316577_10325250
2251 Ga0316577_10874150
2252 Ga0307410_10747952
2253 Ga0307407_10274700
2254 Ga0307412_11098294
2255 Ga0307409_102154263
2256 Ga0307416_100175520
2257 Ga0307416_100572741
2258 Ga0307416_100896297
2259 Ga0307416_102767757
2260 Ga0307414_10546309
2261 Ga0307415_100635752
2262 Ga0316583_10031781
2263 Ga0316583_10035505
2264 Ga0316583_10154515
2265 Ga0316585_10013644
2266 Ga0316580_10003959
2267 Ga0316580_10010860
2268 Ga0316593_10013684
2269 Ga0316593_10023357
2270 Ga0316593_10153884
2271 Ga0316592_1001361
2272 Ga0316592_1002162
2273 Ga0316592_1071258
2274 Ga0316586_1001301
2275 Ga0316588_1041192
2276 Ga0316588_1087417
2277 Ga0316587_1025310
2278 Ga0316587_1118832
2279 Ga0316596_1007171
2280 Ga0373926_0037925
2281 Ga0373928_0038880
2282 Ga0373929_0034483
2283 Ga0373934_0005630
2284 Ga0373940_0133651
2285 Ga0373944_0084426
2286 Ga0373923_0000205
2287 Ga0373923_0064846
2288 Ga0373932_0269868
2289 Ga0373941_0032001
2290 Ga0373945_0024779
2291 Ga0373945_0053249
2292 Ga0373953_0006354
2293 Ga0373954_0034165
2294 Ga0373956_0022360
2295 Ga0373956_0262443
2296 Ga0373957_0004838
2297 Ga0373957_0086871
2298 Ga0373960_0183157
2299 Ga0373960_0359710
2300 Ga0373943_0013451
2301 Ga0373943_0015517
2302 Ga0373943_0018552
2303 Ga0373943_0280165
2304 Ga0373946_0228097
2305 Ga0373955_0007175
2306 Ga0373961_0119927
2307 Ga0316574_0021624
2308 Ga0316574_0270263
2309 Ga0316574_0307057
2310 Ga0316574_0546536
2311 Ga0316574_0763097
2312 Ga0373924_0019718
2313 Ga0373924_0165142
2314 Ga0373935_0003253
2315 Ga0373935_0144651
2316 Ga0373935_0930977
2317 Ga0373935_1130457
2318 Ga0373927_0045696
2319 Ga0373927_0200717
2320 Ga0373933_0130310
2321 Ga0373933_0232935
2322 Ga0373947_0003388
2323 Ga0373947_0024078
2324 Ga0373937_0043634
2325 Ga0373937_0124881
2326 Ga0373937_0182724
2327 Ga0373937_0430849
2328 Ga0373937_0752533
2329 Ga0373937_1702718
2330 Ga0372808_036355
2331 Ga0316582_0022819
2332 Ga0316582_0068727
2333 Ga0316582_0082778
2334 Ga0316582_0261484
2335 Ga0316582_0297525
2336 Ga0316584_0067900
2337 Ga0316584_0194355
2338 Ga0316584_0211657
2339 Ga0373925_0041456
2340 Ga0395899_0000139
2341 Ga0395899_0000164
2342 Ga0395899_0012593
2343 Ga0395899_0122589
2344 Ga0395899_0355320
2345 Ga0395899_0403022
2346 Ga0395899_0403406
2347 Ga0395899_0492384
2348 Ga0395900_0000217
2349 Ga0395900_0002078
2350 Ga0395900_0110837
2351 Ga0395900_0135659
2352 Ga0395900_0170772
2353 Ga0395900_0208752
2354 Ga0395900_0246371
2355 Ga0395900_0263559
2356 Ga0395900_0973125
2357 Ga0395900_1199270
2358 Ga0395898_0000029
2359 Ga0395898_0246545
2360 Ga0395898_0397878
2361 Ga0395898_0503740
2362 Ga0395898_0566588
2363 Ga0395898_1621798
2364 Ga0395905_0114628
2365 Ga0395905_0162138
2366 Ga0395905_0322941
2367 Ga0395905_0369994
2368 Ga0395905_0724389
2369 Ga0395905_0984124
2370 Ga0395905_1274934
2371 Ga0395905_1312554
2372 Ga0316581_0002998
2373 Ga0316581_0063326
2374 Ga0436364_0212987
2375 Ga0436364_1367044
2376 Ga0395901_0000250
2377 Ga0395901_0055988
2378 Ga0395901_0072336
2379 Ga0395901_0110229
2380 Ga0395901_0112883
2381 Ga0395901_0262727
2382 Ga0395901_0293924
2383 Ga0395901_0321392
2384 Ga0395901_0343309
2385 Ga0395901_0598481
2386 Ga0395901_1005584
2387 Ga0436365_0226758
2388 Ga0436365_0449353
2389 Ga0436360_0389060
2390 Ga0436360_0670138
2391 Ga0436360_0806326
2392 Ga0436360_1097396
2393 Ga0436361_1118974
2394 Ga0439436_0000974
2395 Ga0439438_000863
2396 Ga0439447_000231
2397 Ga0439461_0121310
2398 Ga0439466_0000756
2399 Ga0439466_0003886
2400 Ga0439465_0069610
2401 Ga0439465_0126301
2402 Ga0451789_0506225
2403 Ga0451837_1132506
2404 Ga0451853_0378017
2405 Ga0451853_3305277
2406 Ga0439431_0046627
2407 Ga0439431_0072732
2408 Ga0439432_003631
2409 Ga0439449_0070651
2410 Ga0439452_008966
2411 Ga0450919_024118
2412 Ga0450923_029321
2413 Ga0450904_001054
2414 Ga0439446_0008571
2415 Ga0439458_0181330
2416 Ga0450908_076159
2417 Ga0450909_013992
2418 Ga0450909_069802
2419 Ga0439434_0001105
2420 Ga0439435_0030933
2421 Ga0439459_0033904
2422 Ga0439460_0223280
2423 Ga0451577_0025900
2424 Ga0451577_0246518
2425 Ga0451577_0268084
2426 Ga0451577_0273041
2427 Ga0451577_1672257
2428 Ga0466969_0008322
2429 Ga0466969_0117745
2430 Ga0466969_0159867
2431 Ga0466969_0410834
2432 Ga0466972_0061569
2433 Ga0466976_0329296
2434 Ga0453683_0579476
2435 Ga0466965_0022239
2436 Ga0466965_0207337
2437 Ga0466965_0395558
2438 Ga0466966_0001633
2439 Ga0466966_0059034
2440 Ga0466961_0001504
2441 Ga0466963_0281149
2442 Ga0466964_0014915
2443 Ga0466964_0113483
2444 Ga0453684_0000204
2445 Ga0453684_0000395
2446 Ga0453684_0004787
2447 Ga0453684_0148792
2448 Ga0453684_0568746
2449 Ga0453684_2288871
2450 Ga0466971_0050778
2451 Ga0466968_0655917
2452 Ga0466970_0152245
2453 Ga0466970_0239282
2454 Ga0466957_0000385
2455 Ga0466957_0233804
2456 Ga0466959_0000563
2457 Ga0466959_0002207
2458 Ga0466959_0020697
2459 Ga0466959_0970227
2460 Ga0451576_0005710
2461 Ga0451576_1266021
2462 Ga0451576_2420617
2463 Ga0466958_0081536
2464 Ga0466958_0166802
2465 Ga0466958_0603932
2466 Ga0466967_0378134
2467 Ga0466967_0528181
2468 Ga0466967_0677750
2469 Ga0466967_2128418
2470 Ga0495617_000216
2471 Ga0495627_005158
2472 Ga0495592_0000054
2473 Ga0495592_0122817
2474 Ga0495603_0052705
2475 Ga0495603_0115160
2476 Ga0495603_0297199
2477 Ga0495590_0000077
2478 Ga0495590_0003554
2479 Ga0495590_0018501
2480 Ga0495629_0049667
2481 Ga0495629_0067752
2482 Ga0495629_0081556
2483 Ga0495629_0104214
2484 Ga0495638_0046686
2485 Ga0495638_0297327
2486 Ga0495651_0294344
2487 Ga0495653_0042427
2488 Ga0495653_0052385
2489 Ga0495653_0073375
2490 Ga0495653_0292562
2491 Ga0495650_0025459
2492 Ga0495580_0046916
2493 Ga0495580_0343830
2494 Ga0495582_0005646
2495 Ga0495582_0010469
2496 Ga0495582_0018626
2497 Ga0495605_0000325
2498 Ga0495605_0114818
2499 Ga0495605_0122472
2500 Ga0495639_0013210
2501 Ga0495662_0009572
2502 Ga0495662_0010489
2503 Ga0495664_0410564
2504 Ga0495584_0000351
2505 Ga0495584_0001690
2506 Ga0495584_0001693
2507 Ga0495584_0023105
2508 Ga0495584_0023849
2509 Ga0495584_0025577
2510 Ga0495584_0050546
2511 Ga0495584_0068022
2512 Ga0495584_0170407
2513 Ga0495584_0338320
2514 Ga0495585_0000563
2515 Ga0495585_0001619
2516 Ga0495585_0002446
2517 Ga0495585_0002476
2518 Ga0495585_0003138
2519 Ga0495585_0003417
2520 Ga0495585_0027979
2521 Ga0495585_0046466
2522 Ga0495585_0123123
2523 Ga0495585_0277366
2524 Ga0495585_0344031
2525 Ga0495585_0462800
2526 Ga0495594_0039692
2527 Ga0495594_0049418
2528 Ga0495594_0060346
2529 Ga0495596_0003192
2530 Ga0495596_0048164
2531 Ga0495596_0053296
2532 Ga0495607_0009100
2533 Ga0495607_0014486
2534 Ga0495607_0092858
2535 Ga0495583_0000424
2536 Ga0495583_0003374
2537 Ga0495583_0015810
2538 Ga0495583_0029507
2539 Ga0495583_0118069
2540 Ga0495583_0154551
2541 Ga0495583_0246348
2542 Ga0495583_0349676
2543 Ga0495606_0020317
2544 Ga0495606_0056953
2545 Ga0495606_0057127
2546 Ga0495606_0148920
2547 Ga0495606_0283613
2548 Ga0495610_0000955
2549 Ga0495610_0067078
2550 Ga0495610_0081874
2551 Ga0495616_0000316
2552 Ga0495616_0001788
2553 Ga0495616_0006596
2554 Ga0495616_0016682
2555 Ga0495616_0059927
2556 Ga0495616_0095739
2557 Ga0495616_0099042
2558 Ga0495616_0180214
2559 Ga0495616_0263104
2560 Ga0495618_0002303
2561 Ga0495618_0602385
2562 Ga0495620_0023660
2563 Ga0495628_0015266
2564 Ga0495628_0048896
2565 Ga0495628_0056377
2566 Ga0495630_0070115
2567 Ga0495630_0077443
2568 Ga0495630_0093467
2569 Ga0495630_0229291
2570 Ga0495631_0000341
2571 Ga0495631_0003191
2572 Ga0495631_0012248
2573 Ga0495631_0038854
2574 Ga0495631_0203642
2575 Ga0495632_0000081
2576 Ga0495632_0032242
2577 Ga0495632_0435046
2578 Ga0495637_0000008
2579 Ga0495637_0079214
2580 Ga0495643_0003692
2581 Ga0495643_0004226
2582 Ga0495643_0028999
2583 Ga0495644_0005571
2584 Ga0495644_0010600
2585 Ga0495644_0016582
2586 Ga0495644_0029604
2587 Ga0495644_0032762
2588 Ga0495644_0294288
2589 Ga0495648_0000722
2590 Ga0495648_0063018
2591 Ga0495648_0135865
2592 Ga0495648_0145297
2593 Ga0495648_0326474
2594 Ga0495666_0012245
2595 Ga0495666_0012371
2596 Ga0495666_0048120
2597 Ga0495666_0070145
2598 Ga0495666_0120039
2599 Ga0495666_0401230
2600 Ga0495642_0005225
2601 Ga0495642_0008145
2602 Ga0495642_0015210
2603 Ga0495642_0122653
2604 Ga0495652_0017091
2605 Ga0495654_0044609
2606 Ga0495665_0008680
2607 Ga0495665_0022929
2608 Ga0495640_0090715
2609 Ga0495640_0143271
2610 Ga0495640_0320740
2611 Ga0495586_0000670
2612 Ga0495586_0008010
2613 Ga0495586_0010132
2614 Ga0495586_0011649
2615 Ga0495586_0110158
2616 Ga0495587_0022210
2617 Ga0495587_0036803
2618 Ga0495587_0074261
2619 Ga0495587_0207037
2620 Ga0495609_0000039
2621 Ga0495609_0002266
2622 Ga0495609_0038762
2623 Ga0495609_0048087
2624 Ga0495609_0137391
2625 Ga0495609_0174146
2626 Ga0495609_0186161
2627 Ga0495609_0308053
2628 Ga0495621_0020476
2629 Ga0495597_0001889
2630 Ga0495597_0002795
2631 Ga0495597_0003774
2632 Ga0495597_0008819
2633 Ga0495597_0112372
2634 Ga0495597_0235810
2635 Ga0495597_0295419
2636 Ga0495645_0049898
2637 Ga0495645_0065571
2638 Ga0495622_0012056
2639 Ga0495622_0027422
2640 Ga0495622_0043674
2641 Ga0495633_0002942
2642 Ga0495633_0025172
2643 Ga0495633_0052084
2644 Ga0495633_0069481
2645 Ga0495633_0103571
2646 Ga0495633_0107701
2647 Ga0495633_0203495
2648 Ga0495633_0262437
2649 Ga0495633_0392988
2650 Ga0495667_0504629
2651 Ga0495656_0000102
2652 Ga0495656_0000738
2653 Ga0495668_0003757
2654 Ga0495668_0012553
2655 Ga0495668_0018088
2656 Ga0495668_0020416
2657 Ga0495668_0035554
2658 Ga0495668_0037951
2659 Ga0495668_0065580
2660 Ga0495668_0263264
2661 Ga0495634_0046550
2662 Ga0495634_0069764
2663 Ga0495634_0137156
2664 Ga0495611_0000988
2665 Ga0495611_0087497
2666 Ga0495611_0134895
2667 Ga0495611_0408306
2668 Ga0495625_0025398
2669 Ga0495625_0110308
2670 Ga0495625_0169738
2671 Ga0495625_0294821
2672 Ga0495625_0386839
2673 Ga0495625_0411907
2674 Ga0495625_0447111
2675 Ga0495625_0759142
2676 Ga0495635_0006609
2677 Ga0495635_0020293
2678 Ga0495635_0241798
2679 Ga0495635_0351197
2680 Ga0495635_0600174
2681 Ga0495659_0176953
2682 Ga0495659_0294743
2683 Ga0495661_0002040
2684 Ga0495661_0002400
2685 Ga0495661_0008359
2686 Ga0495661_0013653
2687 Ga0495661_0030978
2688 Ga0495661_0053310
2689 Ga0495661_0066947
2690 Ga0495661_0103416
2691 Ga0495588_0045372
2692 Ga0495588_0064086
2693 Ga0495588_0175820
2694 Ga0495588_0189138
2695 Ga0495588_0302716
2696 Ga0495588_0325695
2697 Ga0495588_0474960
2698 Ga0495588_0494278
2699 Ga0495588_0640182
2700 Ga0495599_0081489
2701 Ga0495623_0007763
2702 Ga0495623_0142828
2703 Ga0495623_0554568
2704 Ga0495646_0083899
2705 Ga0495646_0145809
2706 Ga0495647_0054424
2707 Ga0495658_0184385
2708 Ga0495669_0000062
2709 Ga0495669_0137072
2710 Ga0495669_0167178
2711 Ga0495613_0045553
2712 Ga0495613_0123631
2713 Ga0495613_0207884
2714 Ga0495624_0022904
2715 Ga0495624_0063884
2716 Ga0495624_0166871
2717 Ga0495670_0001891
2718 Ga0495670_0005171
2719 Ga0495670_0016227
2720 Ga0495670_0076623
2721 Ga0495670_0303648
2722 Ga0495670_0350486
2723 Ga0495671_0020871
2724 Ga0495671_0119136
2725 Ga0495671_0198487
2726 Ga0495649_0097556
2727 Ga0495589_0000019
2728 Ga0495589_0000265
2729 Ga0495589_0004722
2730 Ga0495589_0022072
2731 Ga0495589_0022653
2732 Ga0495589_0038942
2733 Ga0495589_0054681
2734 Ga0495589_0076983
2735 Ga0495589_0080044
2736 Ga0495589_0152931
2737 Ga0495600_0008649
2738 Ga0495600_0027223
2739 Ga0495600_0036735
2740 Ga0495600_0614316
2741 Ga0495660_0000354
2742 Ga0495660_0002057
2743 Ga0495660_0008891
2744 Ga0495660_0097749
2745 Ga0495660_0099745
2746 Ga0495660_0210163
2747 Ga0495581_0008985
2748 Ga0495581_0016928
2749 Ga0495581_0043052
2750 Ga0495581_0169778
2751 Ga0495581_0719232
2752 Ga0495604_0011342
2753 Ga0495604_0102230
2754 Ga0495604_0178030
2755 Ga0495604_0186383
2756 Ga0495636_0167189
2757 Ga0495636_0659447
2758 Ga0495674_0028557
2759 Ga0495674_0083471
2760 Ga0495674_0162200
2761 Ga0495674_0415038
2762 Ga0495672_0000296
2763 Ga0495672_0003026
2764 Ga0495672_0004452
2765 Ga0495672_0010886
2766 Ga0495672_0047594
2767 Ga0495676_0000114
2768 Ga0495676_0144768
2769 Ga0495680_0024292
2770 Ga0495680_0123052
2771 Ga0495683_0000151
2772 Ga0495683_0000783
2773 Ga0495683_0058747
2774 Ga0495683_0078107
2775 Ga0495687_000002
2776 Ga0495687_000007
2777 Ga0495687_000059
2778 Ga0495687_004997
2779 Ga0495687_124166
2780 Ga0495687_176299
2781 Ga0495675_0021840
2782 Ga0495675_0212261
2783 Ga0495677_0000006
2784 Ga0495677_0003632
2785 Ga0495677_0006321
2786 Ga0495677_0012922
2787 Ga0495677_0029121
2788 Ga0495679_012484
2789 Ga0495679_074338
2790 Ga0495679_098007
2791 Ga0495685_007399
2792 Ga0495685_054110
2793 Ga0495685_080198
2794 Ga0495685_158216
2795 Ga0495685_207016
2796 Ga0495681_0013904
2797 Ga0495681_0018418
2798 Ga0495681_0053880
2799 Ga0495681_0082542
2800 Ga0495681_0088444
2801 Ga0495681_0221978
2802 Ga0495684_0041822
2803 Ga0495686_0000797
2804 Ga0495593_0007642
2805 Ga0495593_0052150
2806 Ga0495593_0067683
2807 Ga0495593_0172516
2808 Ga0495593_0264094
2809 Ga0495602_0020385
2810 Ga0495602_0123482
2811 Ga0495614_0010515
2812 Ga0495614_0013242
2813 Ga0495614_0017760
2814 Ga0495626_0000103
2815 Ga0495626_0002196
2816 Ga0495626_0002740
2817 Ga0495626_0043676
2818 Ga0495626_0044975
2819 Ga0495626_0047598
2820 Ga0495626_0166905
2821 Ga0495626_0354504
2822 Ga0496100_0135118
2823 Ga0496100_0249929
2824 Ga0496101_0003635
2825 Ga0496101_0041474
2826 Ga0496101_0690581
2827 Ga0496102_0000939
2828 Ga0496102_0222801
2829 Ga0496102_1054810
2830 Ga0496102_1246871
2831 Ga0496103_0194271
2832 Ga0496103_0474941
2833 Ga0496103_0515617
2834 Ga0496103_0601194
2835 Ga0496104_0005181
2836 Ga0496105_0136044
2837 Ga0496106_0007554
2838 Ga0496106_0282133
2839 Ga0496106_0425229
2840 Ga0496107_0039446
2841 Ga0496109_0125473
2842 Ga0496109_0167037
2843 Ga0496109_0182761
2844 Ga0496109_0739142
2845 Ga0496110_0102527
2846 Ga0496110_0156934
2847 Ga0496110_0185775
2848 Ga0496110_0950188
2849 Ga0496111_0423021
2850 Ga0496111_0797879
2851 Ga0496112_0003934
2852 Ga0496112_0227089
2853 Ga0496112_0280272
2854 Ga0496112_0300660
2855 Ga0496112_0408344
2856 Ga0496112_0963591
2857 Ga0496113_0038902
2858 Ga0496113_0336642
2859 Ga0496114_0000134
2860 Ga0496114_0966575
2861 Ga0496115_0022204
2862 Ga0496115_0110002
2863 Ga0496115_0114680
2864 Ga0496115_0136155
2865 Ga0496115_0288325
2866 Ga0496115_0518997
2867 Ga0496118_0429425
2868 Ga0496119_0038726
2869 Ga0496120_0000863
2870 Ga0496120_0034227
2871 Ga0496120_0442227
2872 Ga0496121_0388607
2873 Ga0496122_0000727
2874 Ga0496123_0000791
2875 Ga0496123_0443427
2876 Ga0496124_0000313
2877 Ga0496124_0000314
2878 Ga0496124_0048155
2879 Ga0496124_0104859
2880 Ga0496124_0631296
2881 Ga0496125_0019499
2882 Ga0496125_0143910
2883 Ga0496125_0304433
2884 Ga0496125_0749729
2885 Ga0496126_0337892
2886 Ga0495678_004280
2887 Ga0495678_004747
2888 Ga0495678_035328
2889 Ga0495678_215603
2890 Ga0495682_0003596
2891 Ga0495682_0067660
2892 Ga0495682_0106446
2893 Ga0501320_071114
2894 Ga0501032_0000117
2895 Ga0501032_0006793
2896 Ga0501033_0000623
2897 Ga0501033_0217104
2898 Ga0501034_0000556
2899 Ga0501034_0005112
2900 Ga0501034_0124643
2901 Ga0501034_0922152
2902 Ga0501036_0000102
2903 Ga0501037_0000296
2904 Ga0501037_0092362
2905 Ga0501038_0003768
2906 Ga0501039_0000003
2907 Ga0501039_0538879
2908 Ga0501039_0725080
2909 Ga0501039_1004021
2910 Ga0501040_0000498
2911 Ga0501040_0054182
2912 Ga0501040_0077549
2913 Ga0501040_0755715
2914 Ga0501041_0125087
2915 Ga0501042_0003681
2916 Ga0501042_0127956
2917 Ga0501043_0000068
2918 Ga0501046_0028892
2919 Ga0501046_0198412
2920 Ga0501046_0216812
2921 Ga0501047_0012297
2922 Ga0501047_0235955
2923 Ga0501047_0428209
2924 Ga0501047_0626755
2925 Ga0501048_0122889
2926 Ga0501067_0033268
2927 Ga0501067_0292143
2928 Ga0501068_0849685
2929 Ga0501069_0000877
2930 Ga0501070_0000831
2931 Ga0501070_0403017
2932 Ga0501070_0524892
2933 Ga0501072_0051143
2934 Ga0501073_0003992
2935 Ga0501074_0049521
2936 Ga0501075_0507878
2937 Ga0501076_0155238
2938 Ga0501076_1288561
2939 Ga0501235_220994
2940 Ga0501079_0015904
2941 Ga0501079_0630421
2942 Ga0501079_0791288
2943 Ga0501079_0891070
2944 Ga0501080_0012533
2945 Ga0501081_0122066
2946 Ga0501083_0004385
2947 Ga0501035_0000032
2948 Ga0501035_0013083
2949 Ga0501035_0468159
2950 Ga0501044_0081509
2951 Ga0501044_0254919
2952 Ga0501044_0570042
2953 Ga0501045_0452317
2954 nmdc:mga03683_153934_c1
2955 nmdc:mga03683_181958_c1
2956 nmdc:mga03n38_196633_c1
2957 nmdc:mga03n38_203557_c1
2958 nmdc:mga03n38_71205_c1
2959 nmdc:mga03n38_960649_c1
2960 nmdc:mga00v17_136978_c1
2961 nmdc:mga00v17_180199_c1
2962 nmdc:mga00v17_531685_c1
2963 nmdc:mga00v17_538272_c1
2964 nmdc:mga0yw44_100254_c1
2965 nmdc:mga0yw44_1146_c1
2966 nmdc:mga0yw44_223453_c1
2967 nmdc:mga0yw44_328994_c1
2968 nmdc:mga0yw44_43625_c1
2969 nmdc:mga0yw44_83422_c1
2970 nmdc:mga0yw44_972727_c1
2971 nmdc:mga0k408_109436_c1
2972 nmdc:mga0k408_133169_c1
2973 nmdc:mga0k408_499912_c1
2974 nmdc:mga0k408_881944_c1
2975 nmdc:mga06z11_135991_c1
2976 nmdc:mga06z11_143135_c1
2977 nmdc:mga06z11_149909_c1
2978 nmdc:mga06z11_6352_c1
2979 nmdc:mga04h51_116979_c1
2980 nmdc:mga04h51_241241_c1
2981 nmdc:mga04h51_309069_c1
2982 nmdc:mga04h51_350908_c1
2983 nmdc:mga04h51_62207_c1
2984 nmdc:mga07m45_308232_c1
2985 nmdc:mga07m45_369704_c1
2986 nmdc:mga07m45_43067_c1
2987 nmdc:mga07m45_623799_c1
2988 nmdc:mga06r32_201443_c1
2989 nmdc:mga08y16_12_c1
2990 nmdc:mga08y16_148583_c1
2991 nmdc:mga08y16_858433_c1
2992 nmdc:mga0n895_213386_c1
2993 nmdc:mga0rr50_1022361_c1
2994 nmdc:mga0rr50_1511783_c1
2995 nmdc:mga0rr50_356859_c1
2996 nmdc:mga0rr50_398223_c1
2997 nmdc:mga08x19_117937_c1
2998 nmdc:mga0a205_290952_c1
2999 nmdc:mga0a205_62875_c1
3000 nmdc:mga0sz30_110001_c1
3001 nmdc:mga0sz30_140867_c1
3002 nmdc:mga0sz30_41551_c1
3003 Ga0495601_0083953
3004 Ga0495601_0316216
3005 Ga0495601_0582321
3006 Ga0495655_0251909
3007 Ga0495595_0240802
3008 Ga0495619_0032650
3009 Ga0500644_0036255
3010 Ga0500650_0443934
3011 Ga0500595_011249
3012 Ga0500595_080771
3013 Ga0500628_061402
3014 Ga0500642_0148074
3015 Ga0500588_0000160
3016 Ga0501084_0285955
3017 Ga0590075_079850
3018 Ga0587082_123775
3019 Ga0587083_0106630
3020 Ga0587088_009150
3021 Ga0587088_160033
3022 Ga0587062_017899
3023 Ga0587067_021806
3024 Ga0587069_060719
3025 Ga0587072_046400
3026 Ga0587075_015894
3027 Ga0587104_004120
3028 Ga0587105_002691
3029 Ga0587107_045183
3030 Ga0587124_006915
3031 Ga0587071_038705
3032 Ga0587071_133895
3033 Ga0587111_0102544
3034 Ga0501082_1842569
3035 2509373386
3036 2510285363
3037 2510311375
3038 2510317604
3039 2512930985
3040 2512958717
3041 2513611068
3042 2514034868
3043 2514418508
3044 2548847635
3045 2588516674
3046 2599940448
3047 2643799876
3048 2643840504
3049 2643989283
3050 2644152856
3051 2644474876
3052 2688599534
3053 2694629732
3054 2694636395
3055 2723575872
3056 2729146746
3057 2756677250
3058 2774129613
3059 2792749867
3060 2795786503
3061 2809146783
3062 2828306718
3063 2838056618
3064 2844006330
3065 2844014809
3066 2847676065
3067 2847692707
3068 2856315852
3069 2856334052
3070 2856341279
3071 2856355262
3072 2856361103
3073 2856370624
3074 2857350544
3075 2857372817
3076 2869171425
3077 2869235123
3078 2869248067
3079 2869251384
3080 2869260540
3081 2869267095
3082 2869274911
3083 2869291648
3084 2871434858
3085 2871443414
3086 2871447774
3087 2871452772
3088 2871460495
3089 2871470858
3090 2871487103
3091 2871495481
3092 2871502751
3093 2874103897
3094 2874110085
3095 2874119714
3096 2874130979
3097 2874135031
3098 2874149247
3099 2874157512
3100 2874165530
3101 2874176099
3102 2876365864
3103 2876377563
3104 2876384737
3105 2876391667
3106 2876394713
3107 2876402210
3108 2876413579
3109 2876415714
3110 2876425035
3111 2878040120
3112 2878733601
3113 2878751992
3114 2878757895
3115 2878766643
3116 2878773840
3117 2878775418
3118 2878783977
3119 2881152065
3120 2881155787
3121 2881168042
3122 2881850866
3123 2881860291
3124 2881867465
3125 2882637090
3126 2882916591
3127 2885309926
3128 2885317012
3129 2885324934
3130 2885326933
3131 2885336051
3132 2885350497
3133 2885352730
3134 2888356291
3135 2889011215
3136 2889017060
3137 2894657464
3138 2903493449
3139 2903506641
3140 2903517332
3141 2903523812
3142 2903534327
3143 2903547890
3144 2904661345
3145 2906314386
3146 2906327555
3147 2906329410
3148 2906355938
3149 2906369130
3150 2906376577
3151 2906380163
3152 2906387057
3153 2906395976
3154 2906407137
3155 2906410659
3156 2906415989
3157 2906432640
3158 2917834581
3159 2919127225
3160 2919406581
3161 2922131987
3162 2922152585
3163 2922160098
3164 2922175959
3165 2922191098
3166 2924711439
3167 2924728055
3168 2924744929
3169 2924750967
3170 2924766926
3171 2924784609
3172 2937816310
3173 2937854970
3174 2937865365
3175 2937870369
3176 2937896728
3177 2937985532
3178 2938001768
3179 2938015808
3180 2958103020
3181 2958111112
3182 2958118901
3183 2958124321
3184 2958136048
3185 2958140455
3186 2958159728
3187 2958171823
3188 2958174434
3189 2958185515
3190 2961083893
3191 2961116499
3192 2961135427
3193 2961141554
3194 2961170269
3195 2961174439
3196 2961190131
3197 2963648239
3198 2965025015
3199 2965027771
3200 2965035252
3201 2965041277
3202 2965051594
3203 2965069091
3204 2965096148
3205 2965108067
3206 2965123722
3207 2968000430
3208 2968003659
3209 2968095824
3210 2968101049
3211 2968112405
3212 2968121200
3213 2968132773
3214 2968146124
3215 2968178656
3216 2970490220
3217 2970507026
3218 2970513035
3219 2970533245
3220 2970549423
3221 2970561501
3222 2970626669
3223 2970633751
3224 2974301986
3225 2977822428
3226 2977833098
3227 2977846544
3228 2977855462
3229 2977861521
3230 2977865750
3231 2977876214
3232 2977907042
3233 2977908240
3234 2977922223
3235 2977929359
3236 2977936874
3237 2977947744
3238 2977955493
3239 2977962774
3240 2977972123
3241 2977992801
3242 2979714445
3243 2979747397
3244 2979766569
3245 2979776549
3246 2979784568
3247 2979800424
3248 2979812221
3249 2984500446
3250 2984506959
3251 2987637728
3252 2987646190
3253 2987652794
3254 2987666510
3255 2987668733
3256 2987679705
3257 2996341117
3258 2996346655
3259 2996393026
3260 3000140075
3261 3003933593
3262 3004195512
3263 3004197669
3264 3004205950
3265 3004211783
3266 3004219030
3267 3004235852
3268 3004241752
3269 3004251017
3270 3004274626
3271 637074027
3272 649874037
3273 8004302354
3274 8004365256
3275 8004379407
3276 8004394625
3277 8004447623
3278 8004640217
3279 8004702278
3280 8004709803
3281 8004720649
3282 8004728410
3283 8016730978
3284 8047673274

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9934 3 121
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9907 1 120
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9865 3 121
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9706 1 119
2ka7-assembly1.cif.gz_A nmr solution structure of tm0212 at 40 c 0.9673 1 121
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9968 4 120 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9936 3 121 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9935 1 122 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9872 3 122 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9855 1 122 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3A5KCJ1-F1-model_v4 Glycine cleavage system H protein 1.005 1 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A090GV12-F1-model_v4 Glycine cleavage system H protein 1.004 1 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A440D7A1-F1-model_v4 deleted 1.004 1 122
AF-A0A3S0HHE3-F1-model_v4 Glycine cleavage system H protein 1.004 1 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A5F2GW17-F1-model_v4 Glycine cleavage system H protein 1.004 1 122 GO:0005829
GO:0005960
GO:0019464

Map