F495172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1642 | 790 | 3284 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300025932|Ga0207690_10259749|Ga0207690_102597492 |
| Length | 137 |
| Sequence | MNVPAELKYTASHEWVRSEPDGAITTGITDHAQQALGDLVFIELPQVGRTLKAGEACAVVESVKAASDVYAPVAGVVLAVNEAVVAAPEKVNADAYGNWLYRLKPANPGDVAKLLDAPGISRWPANPDRPRTDDGYE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 240 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 249 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 258 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 259 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 260 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 286 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 293 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 294 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 300 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 301 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 302 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 307 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 308 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 309 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 310 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 311 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 312 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 314 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 315 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 316 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 317 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 318 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 319 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 320 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 321 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 322 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 323 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 324 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 325 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 326 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 327 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 328 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 329 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 330 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044662 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E | Metagenome | Unclassified |
| 334 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 335 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 338 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 339 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 340 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 341 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 342 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 343 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 344 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 347 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 445 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 446 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 447 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 448 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 449 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 450 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 452 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 453 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 454 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 455 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 456 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 457 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 458 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 459 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 460 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 461 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 462 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 463 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 464 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 465 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 466 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 493 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 501 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 502 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 503 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 504 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 505 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 506 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 507 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 508 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 515 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 521 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 522 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 523 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 524 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 525 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 527 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 543 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 544 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 545 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 546 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 547 | 2512875024 | |||
| 548 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 549 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 550 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 551 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 552 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 553 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 554 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 555 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 556 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 557 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 558 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 559 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 560 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 561 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 562 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 563 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 564 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 565 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 566 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 567 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 568 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 569 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 570 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 571 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 572 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 573 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 574 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 575 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 576 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 577 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 578 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 579 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 580 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 581 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 582 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 583 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 584 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 585 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 586 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 587 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 588 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 589 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 590 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 591 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 592 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 593 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 594 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 595 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 596 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 597 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 598 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 599 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 600 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 601 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 602 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 603 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 604 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 605 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 606 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 607 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 608 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 609 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 610 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 611 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 612 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 613 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 614 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 615 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 616 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 617 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 618 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 619 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 620 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 621 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 622 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 623 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 624 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 625 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 626 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 627 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 628 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 629 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 630 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 631 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 632 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 633 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 634 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 635 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 636 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 637 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 638 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 639 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 640 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 641 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 642 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 643 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 644 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 645 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 646 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 647 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 648 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 649 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 650 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 651 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 652 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 653 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 654 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 655 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 656 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 657 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 658 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 659 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 660 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 661 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 662 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 663 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 664 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 665 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 666 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 667 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 668 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 669 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 670 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 671 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 672 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 673 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 674 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 675 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 676 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 677 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 678 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 679 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 680 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 681 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 682 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 683 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 684 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 685 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 686 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 687 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 688 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 689 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 690 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 691 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 692 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 693 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 694 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 695 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 696 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 697 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 698 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 699 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 700 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 701 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 702 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 703 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 704 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 705 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 706 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 707 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 708 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 709 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 710 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 711 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 712 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 713 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 714 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 715 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 716 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 717 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 718 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 719 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 720 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 721 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 722 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 723 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 724 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 725 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 726 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 727 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 728 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 729 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 730 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 731 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 732 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 733 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 734 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 735 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 736 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 737 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 738 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 739 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 740 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 741 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 742 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 743 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 744 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 745 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 746 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 747 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 748 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 749 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 750 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 751 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 752 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 753 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 754 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 755 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 756 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 757 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 758 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 759 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 760 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 761 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 762 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 763 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 764 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 765 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 766 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 767 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 768 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 769 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 770 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 771 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 772 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 773 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 774 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 775 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 776 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 777 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 778 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 779 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 780 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 781 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 782 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 783 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 784 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 785 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 786 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 787 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 788 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 789 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 790 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.46 |
| Metatranscriptomes | 2.31 |
| Isolates | 15.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 6.94 |
| Nodule | 12.48 |
| Rhizoplane | 2.86 |
| Rhizosphere | 73.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207690_10259749 | 3300025932 | Bacteria | 1345 |
| 2 | JGI24736J21556_1065209 | 3300001904 | Bacteria | 565 |
| 3 | JGI24740J21852_10008429 | 3300001979 | Bacteria | 4107 |
| 4 | JGI24739J22299_10038979 | 3300001989 | Bacteria | 1594 |
| 5 | JGI24739J22299_10136143 | 3300001989 | Bacteria | 729 |
| 6 | JGI24735J21928_10043246 | 3300002067 | Bacteria | 1310 |
| 7 | JGI25157J39369_1000145 | 3300002741 | Bacteria | 60335 |
| 8 | JGI25157J39369_1000826 | 3300002741 | Bacteria | 15394 |
| 9 | JGI25151J46595_10000186 | 3300003187 | Bacteria | 77356 |
| 10 | JGI25406J46586_10046782 | 3300003203 | Bacteria | 1479 |
| 11 | JGI25406J46586_10060919 | 3300003203 | Bacteria | 1219 |
| 12 | JGI25406J46586_10094540 | 3300003203 | Bacteria | 898 |
| 13 | JGI25165J46597_1000325 | 3300003214 | Bacteria | 57094 |
| 14 | JGI25153J46596_10044278 | 3300003215 | Bacteria | 1339 |
| 15 | rootL2_10273037 | 3300003322 | Archaea | 1170 |
| 16 | Ga0007410J51695_1030494 | 3300003574 | Bacteria | 564 |
| 17 | Ga0006562J51391_1057637 | 3300003578 | Bacteria | 3400 |
| 18 | Ga0055539_1001430 | 3300003752 | Bacteria | 4467 |
| 19 | Ga0055533_1001807 | 3300003756 | Bacteria | 5378 |
| 20 | Ga0055527_1000043 | 3300003760 | Bacteria | 113506 |
| 21 | Ga0055535_1000071 | 3300003761 | Bacteria | 113506 |
| 22 | Ga0055542_1000096 | 3300003762 | Bacteria | 118398 |
| 23 | Ga0055542_1000553 | 3300003762 | Bacteria | 33171 |
| 24 | Ga0055529_1000114 | 3300003763 | Bacteria | 118398 |
| 25 | Ga0055529_1003236 | 3300003763 | Bacteria | 2767 |
| 26 | JGI25405J52794_10001981 | 3300003911 | Unclassified | 3471 |
| 27 | Ga0065165_1002388 | 3300005262 | Bacteria | 16135 |
| 28 | Ga0065714_10076975 | 3300005288 | Bacteria | 2734 |
| 29 | Ga0065712_10089189 | 3300005290 | Bacteria | 2472 |
| 30 | Ga0065712_10666360 | 3300005290 | Unclassified | 561 |
| 31 | Ga0065715_10557850 | 3300005293 | Bacteria | 736 |
| 32 | Ga0065715_11025097 | 3300005293 | Bacteria | 538 |
| 33 | Ga0065707_10087092 | 3300005295 | Bacteria | 5169 |
| 34 | Ga0065707_10299477 | 3300005295 | Bacteria | 1007 |
| 35 | Ga0065707_10537776 | 3300005295 | Bacteria | 730 |
| 36 | Ga0070658_10299601 | 3300005327 | Bacteria | 1371 |
| 37 | Ga0070658_10727889 | 3300005327 | Bacteria | 862 |
| 38 | Ga0070658_11568455 | 3300005327 | Bacteria | 571 |
| 39 | Ga0070676_10099429 | 3300005328 | Bacteria | 1795 |
| 40 | Ga0070676_10329302 | 3300005328 | Bacteria | 1044 |
| 41 | Ga0070683_100309720 | 3300005329 | Bacteria | 1502 |
| 42 | Ga0070690_100002820 | 3300005330 | Bacteria | 9376 |
| 43 | Ga0070690_100134428 | 3300005330 | Bacteria | 1673 |
| 44 | Ga0070670_100058784 | 3300005331 | Bacteria | 3301 |
| 45 | Ga0070670_101114720 | 3300005331 | Bacteria | 720 |
| 46 | Ga0070677_10180825 | 3300005333 | Bacteria | 1004 |
| 47 | Ga0068869_100028475 | 3300005334 | Bacteria | 3904 |
| 48 | Ga0068869_100036100 | 3300005334 | Bacteria | 3508 |
| 49 | Ga0068869_100241015 | 3300005334 | Bacteria | 1441 |
| 50 | Ga0070666_10044125 | 3300005335 | Bacteria | 2986 |
| 51 | Ga0070680_100000436 | 3300005336 | Bacteria | 28412 |
| 52 | Ga0070680_100339878 | 3300005336 | Bacteria | 1276 |
| 53 | Ga0070682_100727644 | 3300005337 | Bacteria | 798 |
| 54 | Ga0068868_100050486 | 3300005338 | Bacteria | 3267 |
| 55 | Ga0068868_100052894 | 3300005338 | Bacteria | 3198 |
| 56 | Ga0068868_100115865 | 3300005338 | Bacteria | 2181 |
| 57 | Ga0068868_100301872 | 3300005338 | Bacteria | 1360 |
| 58 | Ga0070660_100268695 | 3300005339 | Bacteria | 1393 |
| 59 | Ga0070689_100012027 | 3300005340 | Bacteria | 6222 |
| 60 | Ga0070689_100790291 | 3300005340 | Bacteria | 834 |
| 61 | Ga0070691_10214210 | 3300005341 | Bacteria | 1018 |
| 62 | Ga0070691_10633740 | 3300005341 | Bacteria | 635 |
| 63 | Ga0070687_100073332 | 3300005343 | Bacteria | 1845 |
| 64 | Ga0070687_100122652 | 3300005343 | Bacteria | 1489 |
| 65 | Ga0070687_100205813 | 3300005343 | Bacteria | 1195 |
| 66 | Ga0070687_100513490 | 3300005343 | Bacteria | 809 |
| 67 | Ga0070661_100029628 | 3300005344 | Bacteria | 3951 |
| 68 | Ga0070661_100494998 | 3300005344 | Bacteria | 978 |
| 69 | Ga0070661_101247165 | 3300005344 | Bacteria | 623 |
| 70 | Ga0070692_10026902 | 3300005345 | Bacteria | 2848 |
| 71 | Ga0070669_100549427 | 3300005353 | Bacteria | 963 |
| 72 | Ga0070669_101526777 | 3300005353 | Bacteria | 581 |
| 73 | Ga0070675_100588158 | 3300005354 | Bacteria | 1009 |
| 74 | Ga0070675_101070427 | 3300005354 | Bacteria | 741 |
| 75 | Ga0070671_100007704 | 3300005355 | Bacteria | 8603 |
| 76 | Ga0070671_100211677 | 3300005355 | Bacteria | 1644 |
| 77 | Ga0070674_100437962 | 3300005356 | Bacteria | 1076 |
| 78 | Ga0070673_100001822 | 3300005364 | Bacteria | 12725 |
| 79 | Ga0070673_100605258 | 3300005364 | Bacteria | 1000 |
| 80 | Ga0070673_100877423 | 3300005364 | Bacteria | 831 |
| 81 | Ga0070688_100002648 | 3300005365 | Bacteria | 9085 |
| 82 | Ga0070659_100262714 | 3300005366 | Bacteria | 1432 |
| 83 | Ga0070659_102074733 | 3300005366 | Bacteria | 511 |
| 84 | Ga0070667_100032425 | 3300005367 | Bacteria | 4357 |
| 85 | Ga0070667_101391840 | 3300005367 | Bacteria | 658 |
| 86 | Ga0070667_101665986 | 3300005367 | Bacteria | 600 |
| 87 | Ga0070709_10100469 | 3300005434 | Bacteria | 1926 |
| 88 | Ga0070714_100102313 | 3300005435 | Bacteria | 2525 |
| 89 | Ga0070714_100178254 | 3300005435 | Bacteria | 1932 |
| 90 | Ga0070714_100292931 | 3300005435 | Bacteria | 1515 |
| 91 | Ga0070713_100012514 | 3300005436 | Bacteria | 6227 |
| 92 | Ga0070713_100039298 | 3300005436 | Bacteria | 3839 |
| 93 | Ga0070713_100193517 | 3300005436 | Bacteria | 1834 |
| 94 | Ga0070713_101044345 | 3300005436 | Bacteria | 789 |
| 95 | Ga0070710_10013019 | 3300005437 | Bacteria | 4149 |
| 96 | Ga0070710_10036502 | 3300005437 | Bacteria | 2687 |
| 97 | Ga0070701_10002995 | 3300005438 | Bacteria | 6609 |
| 98 | Ga0070701_10064909 | 3300005438 | Bacteria | 1936 |
| 99 | Ga0070701_10296987 | 3300005438 | Bacteria | 992 |
| 100 | Ga0070711_100005477 | 3300005439 | Bacteria | 7594 |
| 101 | Ga0070705_100039297 | 3300005440 | Bacteria | 2684 |
| 102 | Ga0070705_100163135 | 3300005440 | Bacteria | 1492 |
| 103 | Ga0070705_100468162 | 3300005440 | Bacteria | 949 |
| 104 | Ga0070705_101828626 | 3300005440 | Bacteria | 516 |
| 105 | Ga0070700_100296811 | 3300005441 | Bacteria | 1178 |
| 106 | Ga0070694_100071045 | 3300005444 | Bacteria | 2399 |
| 107 | Ga0070694_100103302 | 3300005444 | Bacteria | 2019 |
| 108 | Ga0070694_100151881 | 3300005444 | Bacteria | 1692 |
| 109 | Ga0070694_100202692 | 3300005444 | Bacteria | 1480 |
| 110 | Ga0070694_100217262 | 3300005444 | Bacteria | 1432 |
| 111 | Ga0070694_101429228 | 3300005444 | Bacteria | 584 |
| 112 | Ga0070708_100007993 | 3300005445 | Bacteria | 8472 |
| 113 | Ga0070708_100129914 | 3300005445 | Bacteria | 2331 |
| 114 | Ga0070708_100240409 | 3300005445 | Bacteria | 1700 |
| 115 | Ga0070708_100329407 | 3300005445 | Bacteria | 1439 |
| 116 | Ga0070663_100359443 | 3300005455 | Bacteria | 1181 |
| 117 | Ga0070663_100398405 | 3300005455 | Bacteria | 1125 |
| 118 | Ga0070663_101752934 | 3300005455 | Bacteria | 556 |
| 119 | Ga0070678_100059125 | 3300005456 | Bacteria | 2816 |
| 120 | Ga0070678_100624413 | 3300005456 | Bacteria | 964 |
| 121 | Ga0070662_100019430 | 3300005457 | Bacteria | 4611 |
| 122 | Ga0070662_100287109 | 3300005457 | Bacteria | 1333 |
| 123 | Ga0070662_100304462 | 3300005457 | Bacteria | 1296 |
| 124 | Ga0070681_10090610 | 3300005458 | Bacteria | 3008 |
| 125 | Ga0070681_10580572 | 3300005458 | Bacteria | 1035 |
| 126 | Ga0070681_11209966 | 3300005458 | Bacteria | 677 |
| 127 | Ga0068867_100593667 | 3300005459 | Bacteria | 965 |
| 128 | Ga0068867_100894492 | 3300005459 | Bacteria | 798 |
| 129 | Ga0068867_102043528 | 3300005459 | Unclassified | 542 |
| 130 | Ga0068867_102176085 | 3300005459 | Bacteria | 526 |
| 131 | Ga0068867_102314126 | 3300005459 | Bacteria | 511 |
| 132 | Ga0070685_10108159 | 3300005466 | Bacteria | 1708 |
| 133 | Ga0070706_100002397 | 3300005467 | Bacteria | 18908 |
| 134 | Ga0070706_100039497 | 3300005467 | Bacteria | 4357 |
| 135 | Ga0070706_100420659 | 3300005467 | Bacteria | 1243 |
| 136 | Ga0070707_100016355 | 3300005468 | Bacteria | 6962 |
| 137 | Ga0070707_100016400 | 3300005468 | Bacteria | 6949 |
| 138 | Ga0070707_100021949 | 3300005468 | Bacteria | 6036 |
| 139 | Ga0070707_100081493 | 3300005468 | Bacteria | 3124 |
| 140 | Ga0070707_100322248 | 3300005468 | Bacteria | 1502 |
| 141 | Ga0070698_100003111 | 3300005471 | Bacteria | 18293 |
| 142 | Ga0070698_100022873 | 3300005471 | Bacteria | 6535 |
| 143 | Ga0070698_100133725 | 3300005471 | Bacteria | 2434 |
| 144 | Ga0070698_100255792 | 3300005471 | Bacteria | 1684 |
| 145 | Ga0070698_100350384 | 3300005471 | Bacteria | 1408 |
| 146 | Ga0070698_101241008 | 3300005471 | Bacteria | 695 |
| 147 | Ga0070699_100018068 | 3300005518 | Bacteria | 6058 |
| 148 | Ga0070699_100347512 | 3300005518 | Bacteria | 1336 |
| 149 | Ga0070699_101275382 | 3300005518 | Bacteria | 674 |
| 150 | Ga0070679_100625780 | 3300005530 | Bacteria | 1019 |
| 151 | Ga0070679_100751640 | 3300005530 | Bacteria | 918 |
| 152 | Ga0070684_100122750 | 3300005535 | Bacteria | 2337 |
| 153 | Ga0070697_100005500 | 3300005536 | Bacteria | 9765 |
| 154 | Ga0070697_100102973 | 3300005536 | Bacteria | 2372 |
| 155 | Ga0070697_100127420 | 3300005536 | Bacteria | 2133 |
| 156 | Ga0068853_100181578 | 3300005539 | Bacteria | 1908 |
| 157 | Ga0068853_100214322 | 3300005539 | Bacteria | 1756 |
| 158 | Ga0070672_100015498 | 3300005543 | Bacteria | 5431 |
| 159 | Ga0070686_100051239 | 3300005544 | Bacteria | 2627 |
| 160 | Ga0070686_100245868 | 3300005544 | Bacteria | 1304 |
| 161 | Ga0070686_100259239 | 3300005544 | Bacteria | 1274 |
| 162 | Ga0070695_100020958 | 3300005545 | Bacteria | 3996 |
| 163 | Ga0070695_100050716 | 3300005545 | Bacteria | 2661 |
| 164 | Ga0070696_100002641 | 3300005546 | Bacteria | 11884 |
| 165 | Ga0070696_100036693 | 3300005546 | Bacteria | 3380 |
| 166 | Ga0070696_100119158 | 3300005546 | Bacteria | 1909 |
| 167 | Ga0070696_100246852 | 3300005546 | Bacteria | 1348 |
| 168 | Ga0070696_100572093 | 3300005546 | Bacteria | 908 |
| 169 | Ga0070696_100656110 | 3300005546 | Bacteria | 851 |
| 170 | Ga0070693_100009343 | 3300005547 | Bacteria | 4874 |
| 171 | Ga0070693_100562931 | 3300005547 | Bacteria | 818 |
| 172 | Ga0070665_100005394 | 3300005548 | Bacteria | 13196 |
| 173 | Ga0070665_100033046 | 3300005548 | Bacteria | 5205 |
| 174 | Ga0070665_100199704 | 3300005548 | Bacteria | 2000 |
| 175 | Ga0070665_100217878 | 3300005548 | Bacteria | 1909 |
| 176 | Ga0070665_100403241 | 3300005548 | Bacteria | 1375 |
| 177 | Ga0070665_101171156 | 3300005548 | Bacteria | 780 |
| 178 | Ga0070704_100007251 | 3300005549 | Bacteria | 6594 |
| 179 | Ga0070704_100049539 | 3300005549 | Bacteria | 2947 |
| 180 | Ga0070704_100050460 | 3300005549 | Bacteria | 2925 |
| 181 | Ga0070704_100089897 | 3300005549 | Bacteria | 2285 |
| 182 | Ga0070704_100300780 | 3300005549 | Bacteria | 1337 |
| 183 | Ga0070704_100409023 | 3300005549 | Bacteria | 1159 |
| 184 | Ga0070704_100618643 | 3300005549 | Bacteria | 953 |
| 185 | Ga0068855_100234888 | 3300005563 | Bacteria | 2051 |
| 186 | Ga0068855_100699410 | 3300005563 | Bacteria | 1085 |
| 187 | Ga0068855_101222444 | 3300005563 | Bacteria | 780 |
| 188 | Ga0070664_100118858 | 3300005564 | Bacteria | 2312 |
| 189 | Ga0070664_100226051 | 3300005564 | Bacteria | 1676 |
| 190 | Ga0070664_100704853 | 3300005564 | Bacteria | 941 |
| 191 | Ga0068854_100040324 | 3300005578 | Bacteria | 3294 |
| 192 | Ga0068854_100158198 | 3300005578 | Bacteria | 1752 |
| 193 | Ga0068854_100599234 | 3300005578 | Bacteria | 940 |
| 194 | Ga0068854_101918268 | 3300005578 | Bacteria | 545 |
| 195 | Ga0068856_100000975 | 3300005614 | Bacteria | 30525 |
| 196 | Ga0068856_100366813 | 3300005614 | Bacteria | 1459 |
| 197 | Ga0068856_100622140 | 3300005614 | Bacteria | 1100 |
| 198 | Ga0068856_100793583 | 3300005614 | Bacteria | 967 |
| 199 | Ga0068856_100851755 | 3300005614 | Bacteria | 931 |
| 200 | Ga0070702_100358477 | 3300005615 | Bacteria | 1030 |
| 201 | Ga0068852_100418869 | 3300005616 | Bacteria | 1321 |
| 202 | Ga0068852_100431900 | 3300005616 | Bacteria | 1301 |
| 203 | Ga0068852_101596299 | 3300005616 | Bacteria | 675 |
| 204 | Ga0068859_100098458 | 3300005617 | Bacteria | 2978 |
| 205 | Ga0068859_101747166 | 3300005617 | Bacteria | 687 |
| 206 | Ga0068859_102356655 | 3300005617 | Bacteria | 587 |
| 207 | Ga0068864_100496518 | 3300005618 | Bacteria | 1173 |
| 208 | Ga0068866_10001452 | 3300005718 | Bacteria | 10132 |
| 209 | Ga0068861_100948962 | 3300005719 | Bacteria | 818 |
| 210 | Ga0068870_10754532 | 3300005840 | Unclassified | 676 |
| 211 | Ga0068863_100003425 | 3300005841 | Bacteria | 15633 |
| 212 | Ga0068858_100003418 | 3300005842 | Bacteria | 15791 |
| 213 | Ga0068858_101317439 | 3300005842 | Bacteria | 711 |
| 214 | Ga0068860_100042429 | 3300005843 | Bacteria | 4344 |
| 215 | Ga0068860_100175892 | 3300005843 | Bacteria | 2069 |
| 216 | Ga0068862_101585584 | 3300005844 | Unclassified | 661 |
| 217 | Ga0081455_10204550 | 3300005937 | Bacteria | 1476 |
| 218 | Ga0081538_10002065 | 3300005981 | Bacteria | 20042 |
| 219 | Ga0081539_10002732 | 3300005985 | Bacteria | 23848 |
| 220 | Ga0081539_10003664 | 3300005985 | Bacteria | 18487 |
| 221 | Ga0081539_10005156 | 3300005985 | Bacteria | 13593 |
| 222 | Ga0075365_10035098 | 3300006038 | Bacteria | 3243 |
| 223 | Ga0075365_10073920 | 3300006038 | Bacteria | 2298 |
| 224 | Ga0075365_10130899 | 3300006038 | Bacteria | 1736 |
| 225 | Ga0075365_10363975 | 3300006038 | Bacteria | 1020 |
| 226 | Ga0075365_10618750 | 3300006038 | Bacteria | 766 |
| 227 | Ga0075365_11065245 | 3300006038 | Bacteria | 569 |
| 228 | Ga0075368_10109170 | 3300006042 | Bacteria | 1140 |
| 229 | Ga0075368_10122026 | 3300006042 | Bacteria | 1080 |
| 230 | Ga0075368_10124881 | 3300006042 | Bacteria | 1067 |
| 231 | Ga0075368_10199251 | 3300006042 | Bacteria | 847 |
| 232 | Ga0075363_100013693 | 3300006048 | Bacteria | 3943 |
| 233 | Ga0075363_100115082 | 3300006048 | Bacteria | 1497 |
| 234 | Ga0075363_100284700 | 3300006048 | Bacteria | 957 |
| 235 | Ga0075364_10027338 | 3300006051 | Bacteria | 3643 |
| 236 | Ga0075364_10158631 | 3300006051 | Bacteria | 1526 |
| 237 | Ga0075364_10366624 | 3300006051 | Bacteria | 982 |
| 238 | Ga0075364_10642453 | 3300006051 | Bacteria | 725 |
| 239 | Ga0075364_11012266 | 3300006051 | Bacteria | 565 |
| 240 | Ga0070715_10165817 | 3300006163 | Bacteria | 1095 |
| 241 | Ga0070716_100030710 | 3300006173 | Bacteria | 2918 |
| 242 | Ga0070716_100035428 | 3300006173 | Bacteria | 2744 |
| 243 | Ga0070712_100001906 | 3300006175 | Bacteria | 12750 |
| 244 | Ga0070712_100084711 | 3300006175 | Bacteria | 2305 |
| 245 | Ga0075362_10061470 | 3300006177 | Bacteria | 1700 |
| 246 | Ga0075362_10224913 | 3300006177 | Bacteria | 918 |
| 247 | Ga0075362_10758522 | 3300006177 | Bacteria | 509 |
| 248 | Ga0075367_10051844 | 3300006178 | Bacteria | 2427 |
| 249 | Ga0075367_10082677 | 3300006178 | Bacteria | 1944 |
| 250 | Ga0075367_10089130 | 3300006178 | Bacteria | 1875 |
| 251 | Ga0075367_10109720 | 3300006178 | Bacteria | 1693 |
| 252 | Ga0075367_10171770 | 3300006178 | Bacteria | 1350 |
| 253 | Ga0075367_10191222 | 3300006178 | Bacteria | 1277 |
| 254 | Ga0075369_10007423 | 3300006186 | Bacteria | 4174 |
| 255 | Ga0075369_10015022 | 3300006186 | Bacteria | 3102 |
| 256 | Ga0075369_10036973 | 3300006186 | Bacteria | 2079 |
| 257 | Ga0075366_10028361 | 3300006195 | Bacteria | 3286 |
| 258 | Ga0075366_10047973 | 3300006195 | Bacteria | 2531 |
| 259 | Ga0075366_10061070 | 3300006195 | Bacteria | 2239 |
| 260 | Ga0075366_10416000 | 3300006195 | Bacteria | 828 |
| 261 | Ga0075366_10590289 | 3300006195 | Bacteria | 688 |
| 262 | Ga0097621_100029217 | 3300006237 | Bacteria | 4352 |
| 263 | Ga0097621_100064142 | 3300006237 | Bacteria | 3020 |
| 264 | Ga0097621_100278874 | 3300006237 | Bacteria | 1471 |
| 265 | Ga0097621_100497382 | 3300006237 | Bacteria | 1104 |
| 266 | Ga0075370_10166741 | 3300006353 | Bacteria | 1294 |
| 267 | Ga0075370_10267925 | 3300006353 | Bacteria | 1013 |
| 268 | Ga0075370_10516360 | 3300006353 | Unclassified | 721 |
| 269 | Ga0075370_10686320 | 3300006353 | Bacteria | 622 |
| 270 | Ga0068871_100008343 | 3300006358 | Bacteria | 7449 |
| 271 | Ga0068871_100088736 | 3300006358 | Bacteria | 2573 |
| 272 | Ga0068871_100331553 | 3300006358 | Bacteria | 1342 |
| 273 | Ga0075428_100008527 | 3300006844 | Bacteria | 11369 |
| 274 | Ga0075428_100710399 | 3300006844 | Bacteria | 1071 |
| 275 | Ga0075428_101661436 | 3300006844 | Unclassified | 667 |
| 276 | Ga0075431_100137098 | 3300006847 | Bacteria | 2523 |
| 277 | Ga0075433_10154497 | 3300006852 | Bacteria | 2041 |
| 278 | Ga0075433_10157084 | 3300006852 | Bacteria | 2023 |
| 279 | Ga0075433_10486390 | 3300006852 | Bacteria | 1087 |
| 280 | Ga0075434_100061710 | 3300006871 | Bacteria | 3730 |
| 281 | Ga0075434_100128978 | 3300006871 | Bacteria | 2547 |
| 282 | Ga0075429_100055859 | 3300006880 | Bacteria | 3436 |
| 283 | Ga0068865_100085583 | 3300006881 | Bacteria | 2274 |
| 284 | Ga0075436_100129397 | 3300006914 | Bacteria | 1770 |
| 285 | Ga0075436_100367582 | 3300006914 | Bacteria | 1038 |
| 286 | Ga0097620_100098462 | 3300006931 | Bacteria | 2978 |
| 287 | Ga0097620_101746927 | 3300006931 | Bacteria | 687 |
| 288 | Ga0097620_102356552 | 3300006931 | Bacteria | 587 |
| 289 | Ga0075435_100196366 | 3300007076 | Bacteria | 1709 |
| 290 | Ga0075435_100465357 | 3300007076 | Bacteria | 1091 |
| 291 | Ga0075435_100525523 | 3300007076 | Bacteria | 1024 |
| 292 | Ga0105250_10364994 | 3300009092 | Unclassified | 635 |
| 293 | Ga0105240_10071001 | 3300009093 | Bacteria | 4307 |
| 294 | Ga0105240_10273380 | 3300009093 | Bacteria | 1944 |
| 295 | Ga0105240_10379812 | 3300009093 | Bacteria | 1596 |
| 296 | Ga0105240_10715586 | 3300009093 | Bacteria | 1091 |
| 297 | Ga0105240_11137155 | 3300009093 | Bacteria | 829 |
| 298 | Ga0105240_11194290 | 3300009093 | Bacteria | 806 |
| 299 | Ga0105240_12568433 | 3300009093 | Bacteria | 526 |
| 300 | Ga0111539_10000011 | 3300009094 | Bacteria | 356900 |
| 301 | Ga0111539_10137853 | 3300009094 | Bacteria | 2857 |
| 302 | Ga0111539_10227258 | 3300009094 | Bacteria | 2173 |
| 303 | Ga0111539_12983153 | 3300009094 | Bacteria | 547 |
| 304 | Ga0105245_10042421 | 3300009098 | Bacteria | 4060 |
| 305 | Ga0105245_10073210 | 3300009098 | Bacteria | 3115 |
| 306 | Ga0105245_10503205 | 3300009098 | Bacteria | 1228 |
| 307 | Ga0105245_10533162 | 3300009098 | Bacteria | 1194 |
| 308 | Ga0105245_11000634 | 3300009098 | Bacteria | 880 |
| 309 | Ga0105245_13204918 | 3300009098 | Bacteria | 507 |
| 310 | Ga0105247_10025334 | 3300009101 | Bacteria | 3577 |
| 311 | Ga0114129_10851601 | 3300009147 | Bacteria | 1159 |
| 312 | Ga0105243_10516305 | 3300009148 | Bacteria | 1135 |
| 313 | Ga0105241_10023869 | 3300009174 | Bacteria | 4538 |
| 314 | Ga0105241_10170277 | 3300009174 | Bacteria | 1798 |
| 315 | Ga0105242_10028271 | 3300009176 | Bacteria | 4463 |
| 316 | Ga0105242_10137224 | 3300009176 | Bacteria | 2118 |
| 317 | Ga0105242_11472907 | 3300009176 | Bacteria | 710 |
| 318 | Ga0105248_10563098 | 3300009177 | Bacteria | 1286 |
| 319 | Ga0105248_10666879 | 3300009177 | Bacteria | 1173 |
| 320 | Ga0105248_11127750 | 3300009177 | Bacteria | 886 |
| 321 | Ga0105237_10014788 | 3300009545 | Bacteria | 8144 |
| 322 | Ga0105237_10104436 | 3300009545 | Bacteria | 2825 |
| 323 | Ga0105237_10191465 | 3300009545 | Bacteria | 2045 |
| 324 | Ga0105237_10222546 | 3300009545 | Bacteria | 1887 |
| 325 | Ga0105237_10541853 | 3300009545 | Bacteria | 1170 |
| 326 | Ga0105237_11216365 | 3300009545 | Bacteria | 760 |
| 327 | Ga0105238_10003126 | 3300009551 | Bacteria | 16521 |
| 328 | Ga0105238_10156605 | 3300009551 | Bacteria | 2253 |
| 329 | Ga0105238_10156883 | 3300009551 | Bacteria | 2251 |
| 330 | Ga0105238_10302342 | 3300009551 | Bacteria | 1584 |
| 331 | Ga0105238_10428717 | 3300009551 | Bacteria | 1318 |
| 332 | Ga0105238_10462684 | 3300009551 | Bacteria | 1266 |
| 333 | Ga0105238_10975539 | 3300009551 | Bacteria | 868 |
| 334 | Ga0105238_11134480 | 3300009551 | Bacteria | 805 |
| 335 | Ga0105249_10635128 | 3300009553 | Bacteria | 1124 |
| 336 | Ga0105249_10998992 | 3300009553 | Bacteria | 905 |
| 337 | Ga0105249_11730529 | 3300009553 | Bacteria | 698 |
| 338 | Ga0105239_10010085 | 3300010375 | Bacteria | 10590 |
| 339 | Ga0105239_10043527 | 3300010375 | Bacteria | 4922 |
| 340 | Ga0105239_10097049 | 3300010375 | Bacteria | 3257 |
| 341 | Ga0105239_10097156 | 3300010375 | Bacteria | 3255 |
| 342 | Ga0105239_10151280 | 3300010375 | Bacteria | 2590 |
| 343 | Ga0105239_10210483 | 3300010375 | Bacteria | 2179 |
| 344 | Ga0105239_10332058 | 3300010375 | Bacteria | 1715 |
| 345 | Ga0105239_10345923 | 3300010375 | Bacteria | 1678 |
| 346 | Ga0105239_10375329 | 3300010375 | Bacteria | 1607 |
| 347 | Ga0105239_10655686 | 3300010375 | Bacteria | 1199 |
| 348 | Ga0105239_11841558 | 3300010375 | Bacteria | 701 |
| 349 | Ga0105246_10058596 | 3300011119 | Bacteria | 2669 |
| 350 | Ga0105246_10101922 | 3300011119 | Bacteria | 2092 |
| 351 | Ga0105246_10238398 | 3300011119 | Bacteria | 1436 |
| 352 | Ga0105246_10913547 | 3300011119 | Bacteria | 788 |
| 353 | Ga0157373_10099544 | 3300013100 | Bacteria | 2046 |
| 354 | Ga0157371_10585355 | 3300013102 | Bacteria | 829 |
| 355 | Ga0157370_10003103 | 3300013104 | Bacteria | 19672 |
| 356 | Ga0157370_10087410 | 3300013104 | Bacteria | 2928 |
| 357 | Ga0157369_10136983 | 3300013105 | Bacteria | 2592 |
| 358 | Ga0157369_10288523 | 3300013105 | Bacteria | 1708 |
| 359 | Ga0157374_10000596 | 3300013296 | Bacteria | 32001 |
| 360 | Ga0157378_10065076 | 3300013297 | Bacteria | 3262 |
| 361 | Ga0157378_10077986 | 3300013297 | Bacteria | 2987 |
| 362 | Ga0157378_10121217 | 3300013297 | Bacteria | 2411 |
| 363 | Ga0157378_10651121 | 3300013297 | Bacteria | 1069 |
| 364 | Ga0163162_10004338 | 3300013306 | Bacteria | 13654 |
| 365 | Ga0163162_10033110 | 3300013306 | Bacteria | 5134 |
| 366 | Ga0163162_10812254 | 3300013306 | Bacteria | 1052 |
| 367 | Ga0163162_12970585 | 3300013306 | Bacteria | 545 |
| 368 | Ga0157372_10397839 | 3300013307 | Bacteria | 1605 |
| 369 | Ga0157372_10463206 | 3300013307 | Bacteria | 1477 |
| 370 | Ga0163163_12553753 | 3300014325 | Unclassified | 569 |
| 371 | Ga0157380_10658364 | 3300014326 | Bacteria | 1046 |
| 372 | Ga0157380_11129983 | 3300014326 | Bacteria | 824 |
| 373 | Ga0157380_12608996 | 3300014326 | Bacteria | 571 |
| 374 | Ga0157380_12632184 | 3300014326 | Bacteria | 569 |
| 375 | Ga0157380_12756894 | 3300014326 | Bacteria | 558 |
| 376 | Ga0182008_10126972 | 3300014497 | Bacteria | 1270 |
| 377 | Ga0157377_10031272 | 3300014745 | Bacteria | 2891 |
| 378 | Ga0157379_10037045 | 3300014968 | Bacteria | 4348 |
| 379 | Ga0157379_10863368 | 3300014968 | Bacteria | 857 |
| 380 | Ga0157379_12212193 | 3300014968 | Bacteria | 546 |
| 381 | Ga0157376_10068710 | 3300014969 | Bacteria | 3001 |
| 382 | Ga0157376_10078986 | 3300014969 | Bacteria | 2819 |
| 383 | Ga0157376_10510544 | 3300014969 | Bacteria | 1183 |
| 384 | Ga0157376_10771388 | 3300014969 | Bacteria | 972 |
| 385 | Ga0163161_10000750 | 3300017792 | Bacteria | 25535 |
| 386 | Ga0163161_10169733 | 3300017792 | Bacteria | 1667 |
| 387 | Ga0163161_10817090 | 3300017792 | Bacteria | 784 |
| 388 | Ga0206356_11719896 | 3300020070 | Bacteria | 568 |
| 389 | Ga0206356_11855175 | 3300020070 | Bacteria | 740 |
| 390 | Ga0206351_11007656 | 3300020077 | Bacteria | 1017 |
| 391 | Ga0206350_11472044 | 3300020080 | Bacteria | 1036 |
| 392 | Ga0213875_10006275 | 3300021388 | Bacteria | 6257 |
| 393 | Ga0213875_10354288 | 3300021388 | Bacteria | 697 |
| 394 | Ga0224712_10205346 | 3300022467 | Bacteria | 897 |
| 395 | Ga0209674_100149 | 3300025226 | Bacteria | 97879 |
| 396 | Ga0209674_101228 | 3300025226 | Bacteria | 7291 |
| 397 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 398 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 399 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 400 | Ga0209026_1000024 | 3300025250 | Bacteria | 355839 |
| 401 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 402 | Ga0209677_103088 | 3300025253 | Bacteria | 5672 |
| 403 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 404 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 405 | Ga0209148_1000985 | 3300025254 | Bacteria | 18369 |
| 406 | Ga0209759_1000140 | 3300025256 | Bacteria | 124850 |
| 407 | Ga0209759_1000302 | 3300025256 | Bacteria | 67678 |
| 408 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 409 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 410 | Ga0209455_1000379 | 3300025272 | Bacteria | 40354 |
| 411 | Ga0209025_1000480 | 3300025294 | Bacteria | 77443 |
| 412 | Ga0209758_1001305 | 3300025297 | Bacteria | 30465 |
| 413 | Ga0209758_1008436 | 3300025297 | Bacteria | 6674 |
| 414 | Ga0207653_10030781 | 3300025885 | Bacteria | 1732 |
| 415 | Ga0207653_10186415 | 3300025885 | Bacteria | 778 |
| 416 | Ga0207692_10006659 | 3300025898 | Bacteria | 4696 |
| 417 | Ga0207692_10018398 | 3300025898 | Bacteria | 3136 |
| 418 | Ga0207692_10075332 | 3300025898 | Bacteria | 1790 |
| 419 | Ga0207642_10200281 | 3300025899 | Bacteria | 1102 |
| 420 | Ga0207642_10565758 | 3300025899 | Bacteria | 704 |
| 421 | Ga0207680_10001836 | 3300025903 | Bacteria | 9988 |
| 422 | Ga0207647_10046507 | 3300025904 | Bacteria | 2704 |
| 423 | Ga0207685_10135892 | 3300025905 | Bacteria | 1097 |
| 424 | Ga0207699_10193349 | 3300025906 | Bacteria | 1374 |
| 425 | Ga0207645_10132609 | 3300025907 | Bacteria | 1622 |
| 426 | Ga0207645_10520943 | 3300025907 | Bacteria | 806 |
| 427 | Ga0207643_10101309 | 3300025908 | Bacteria | 1689 |
| 428 | Ga0207684_10000776 | 3300025910 | Bacteria | 37044 |
| 429 | Ga0207684_10001236 | 3300025910 | Bacteria | 28372 |
| 430 | Ga0207684_10109218 | 3300025910 | Bacteria | 2367 |
| 431 | Ga0207684_10167063 | 3300025910 | Bacteria | 1896 |
| 432 | Ga0207684_10467467 | 3300025910 | Bacteria | 1082 |
| 433 | Ga0207654_10053109 | 3300025911 | Bacteria | 2338 |
| 434 | Ga0207654_10104344 | 3300025911 | Bacteria | 1752 |
| 435 | Ga0207654_10160809 | 3300025911 | Bacteria | 1451 |
| 436 | Ga0207654_10213319 | 3300025911 | Bacteria | 1277 |
| 437 | Ga0207695_10310498 | 3300025913 | Bacteria | 1467 |
| 438 | Ga0207695_10524475 | 3300025913 | Bacteria | 1066 |
| 439 | Ga0207695_10878985 | 3300025913 | Bacteria | 776 |
| 440 | Ga0207671_10005928 | 3300025914 | Bacteria | 11080 |
| 441 | Ga0207671_10407045 | 3300025914 | Bacteria | 1082 |
| 442 | Ga0207671_11373339 | 3300025914 | Bacteria | 548 |
| 443 | Ga0207693_10000104 | 3300025915 | Bacteria | 76023 |
| 444 | Ga0207693_10175339 | 3300025915 | Bacteria | 1687 |
| 445 | Ga0207663_10045982 | 3300025916 | Bacteria | 2688 |
| 446 | Ga0207663_10326349 | 3300025916 | Bacteria | 1155 |
| 447 | Ga0207663_10444919 | 3300025916 | Bacteria | 999 |
| 448 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 449 | Ga0207660_10526384 | 3300025917 | Bacteria | 960 |
| 450 | Ga0207662_10092545 | 3300025918 | Bacteria | 1862 |
| 451 | Ga0207662_10123259 | 3300025918 | Bacteria | 1627 |
| 452 | Ga0207657_10002703 | 3300025919 | Bacteria | 19119 |
| 453 | Ga0207657_10735403 | 3300025919 | Bacteria | 765 |
| 454 | Ga0207649_10039428 | 3300025920 | Bacteria | 2864 |
| 455 | Ga0207649_10283811 | 3300025920 | Bacteria | 1205 |
| 456 | Ga0207649_10564603 | 3300025920 | Bacteria | 872 |
| 457 | Ga0207652_10415910 | 3300025921 | Bacteria | 1213 |
| 458 | Ga0207652_10773304 | 3300025921 | Bacteria | 854 |
| 459 | Ga0207646_10000393 | 3300025922 | Bacteria | 58925 |
| 460 | Ga0207646_10026917 | 3300025922 | Bacteria | 5243 |
| 461 | Ga0207646_10027890 | 3300025922 | Bacteria | 5147 |
| 462 | Ga0207646_10160372 | 3300025922 | Bacteria | 2029 |
| 463 | Ga0207646_10997221 | 3300025922 | Bacteria | 740 |
| 464 | Ga0207681_10545716 | 3300025923 | Bacteria | 954 |
| 465 | Ga0207694_10003891 | 3300025924 | Bacteria | 11805 |
| 466 | Ga0207694_10123486 | 3300025924 | Bacteria | 2069 |
| 467 | Ga0207694_10244857 | 3300025924 | Bacteria | 1466 |
| 468 | Ga0207694_10324943 | 3300025924 | Bacteria | 1270 |
| 469 | Ga0207650_10043409 | 3300025925 | Bacteria | 3300 |
| 470 | Ga0207650_10960542 | 3300025925 | Unclassified | 726 |
| 471 | Ga0207659_11282375 | 3300025926 | Bacteria | 629 |
| 472 | Ga0207659_11549339 | 3300025926 | Bacteria | 566 |
| 473 | Ga0207687_10035960 | 3300025927 | Bacteria | 3372 |
| 474 | Ga0207687_10374187 | 3300025927 | Bacteria | 1165 |
| 475 | Ga0207687_10376854 | 3300025927 | Bacteria | 1161 |
| 476 | Ga0207700_10029476 | 3300025928 | Bacteria | 3873 |
| 477 | Ga0207700_10041321 | 3300025928 | Bacteria | 3373 |
| 478 | Ga0207700_10320869 | 3300025928 | Unclassified | 1342 |
| 479 | Ga0207700_11119093 | 3300025928 | Bacteria | 704 |
| 480 | Ga0207664_10039482 | 3300025929 | Bacteria | 3665 |
| 481 | Ga0207664_10250716 | 3300025929 | Bacteria | 1545 |
| 482 | Ga0207644_10000914 | 3300025931 | Bacteria | 18734 |
| 483 | Ga0207644_10095324 | 3300025931 | Bacteria | 2225 |
| 484 | Ga0207644_10611339 | 3300025931 | Bacteria | 906 |
| 485 | Ga0207644_11481821 | 3300025931 | Bacteria | 570 |
| 486 | Ga0207690_10455777 | 3300025932 | Bacteria | 1029 |
| 487 | Ga0207690_10959672 | 3300025932 | Bacteria | 710 |
| 488 | Ga0207690_11599293 | 3300025932 | Bacteria | 545 |
| 489 | Ga0207706_10197291 | 3300025933 | Bacteria | 1765 |
| 490 | Ga0207686_10020327 | 3300025934 | Bacteria | 3791 |
| 491 | Ga0207709_10727139 | 3300025935 | Bacteria | 796 |
| 492 | Ga0207670_11520945 | 3300025936 | Unclassified | 569 |
| 493 | Ga0207670_11850293 | 3300025936 | Unclassified | 513 |
| 494 | Ga0207669_10022138 | 3300025937 | Bacteria | 3370 |
| 495 | Ga0207669_10340592 | 3300025937 | Bacteria | 1155 |
| 496 | Ga0207669_10908088 | 3300025937 | Bacteria | 736 |
| 497 | Ga0207704_10014382 | 3300025938 | Bacteria | 3994 |
| 498 | Ga0207665_10053310 | 3300025939 | Bacteria | 2726 |
| 499 | Ga0207691_10023854 | 3300025940 | Bacteria | 5757 |
| 500 | Ga0207711_10153988 | 3300025941 | Bacteria | 2076 |
| 501 | Ga0207711_10751790 | 3300025941 | Bacteria | 909 |
| 502 | Ga0207689_10091261 | 3300025942 | Bacteria | 2503 |
| 503 | Ga0207689_10262548 | 3300025942 | Bacteria | 1429 |
| 504 | Ga0207661_10076085 | 3300025944 | Bacteria | 2756 |
| 505 | Ga0207679_10757328 | 3300025945 | Bacteria | 883 |
| 506 | Ga0207667_10109347 | 3300025949 | Bacteria | 2851 |
| 507 | Ga0207667_10201926 | 3300025949 | Bacteria | 2039 |
| 508 | Ga0207667_10309404 | 3300025949 | Bacteria | 1614 |
| 509 | Ga0207651_10006147 | 3300025960 | Bacteria | 6245 |
| 510 | Ga0207651_10766459 | 3300025960 | Bacteria | 854 |
| 511 | Ga0207651_10819706 | 3300025960 | Bacteria | 826 |
| 512 | Ga0207651_11448671 | 3300025960 | Bacteria | 618 |
| 513 | Ga0207712_10423063 | 3300025961 | Bacteria | 1124 |
| 514 | Ga0207712_10847666 | 3300025961 | Bacteria | 805 |
| 515 | Ga0207712_10925475 | 3300025961 | Bacteria | 771 |
| 516 | Ga0207640_10062706 | 3300025981 | Bacteria | 2467 |
| 517 | Ga0207640_10370523 | 3300025981 | Bacteria | 1157 |
| 518 | Ga0207640_10577841 | 3300025981 | Bacteria | 948 |
| 519 | Ga0207640_10627254 | 3300025981 | Bacteria | 913 |
| 520 | Ga0207658_10018280 | 3300025986 | Bacteria | 4838 |
| 521 | Ga0207677_10001312 | 3300026023 | Bacteria | 13359 |
| 522 | Ga0207677_10049950 | 3300026023 | Bacteria | 2826 |
| 523 | Ga0207677_10090075 | 3300026023 | Bacteria | 2228 |
| 524 | Ga0207703_10002876 | 3300026035 | Bacteria | 14649 |
| 525 | Ga0207703_11122521 | 3300026035 | Bacteria | 755 |
| 526 | Ga0207639_10202265 | 3300026041 | Bacteria | 1704 |
| 527 | Ga0207639_10991307 | 3300026041 | Bacteria | 787 |
| 528 | Ga0207678_10167037 | 3300026067 | Bacteria | 1879 |
| 529 | Ga0207678_10231093 | 3300026067 | Bacteria | 1584 |
| 530 | Ga0207678_11530676 | 3300026067 | Bacteria | 588 |
| 531 | Ga0207708_10188934 | 3300026075 | Bacteria | 1639 |
| 532 | Ga0207708_11652448 | 3300026075 | Bacteria | 563 |
| 533 | Ga0207702_10000380 | 3300026078 | Bacteria | 50635 |
| 534 | Ga0207702_10073724 | 3300026078 | Bacteria | 2944 |
| 535 | Ga0207702_10305139 | 3300026078 | Bacteria | 1512 |
| 536 | Ga0207702_11184817 | 3300026078 | Bacteria | 758 |
| 537 | Ga0207641_10020702 | 3300026088 | Bacteria | 5404 |
| 538 | Ga0207641_11240485 | 3300026088 | Unclassified | 746 |
| 539 | Ga0207641_11250735 | 3300026088 | Unclassified | 742 |
| 540 | Ga0207648_10231345 | 3300026089 | Bacteria | 1644 |
| 541 | Ga0207648_10540197 | 3300026089 | Bacteria | 1070 |
| 542 | Ga0207648_10638978 | 3300026089 | Bacteria | 983 |
| 543 | Ga0207676_10094240 | 3300026095 | Bacteria | 2466 |
| 544 | Ga0207674_10012568 | 3300026116 | Bacteria | 9460 |
| 545 | Ga0207674_10124750 | 3300026116 | Bacteria | 2541 |
| 546 | Ga0207675_100911309 | 3300026118 | Bacteria | 896 |
| 547 | Ga0207675_100959916 | 3300026118 | Bacteria | 872 |
| 548 | Ga0207675_100988291 | 3300026118 | Bacteria | 860 |
| 549 | Ga0207683_10001133 | 3300026121 | Bacteria | 24266 |
| 550 | Ga0207683_10192190 | 3300026121 | Bacteria | 1853 |
| 551 | Ga0207683_10438132 | 3300026121 | Bacteria | 1204 |
| 552 | Ga0207683_12054079 | 3300026121 | Bacteria | 520 |
| 553 | Ga0207698_10180270 | 3300026142 | Bacteria | 1870 |
| 554 | Ga0209981_1081136 | 3300027378 | Bacteria | 505 |
| 555 | Ga0209813_10052067 | 3300027866 | Bacteria | 1283 |
| 556 | Ga0209813_10211157 | 3300027866 | Bacteria | 723 |
| 557 | Ga0209813_10274592 | 3300027866 | Bacteria | 647 |
| 558 | Ga0209813_10315280 | 3300027866 | Bacteria | 611 |
| 559 | Ga0209974_10032144 | 3300027876 | Bacteria | 1739 |
| 560 | Ga0207428_10000212 | 3300027907 | Bacteria | 80663 |
| 561 | Ga0207428_10058241 | 3300027907 | Bacteria | 3066 |
| 562 | Ga0268266_10000850 | 3300028379 | Bacteria | 39769 |
| 563 | Ga0268266_10007186 | 3300028379 | Bacteria | 10086 |
| 564 | Ga0268266_10090757 | 3300028379 | Bacteria | 2678 |
| 565 | Ga0268266_10608110 | 3300028379 | Bacteria | 1050 |
| 566 | Ga0268265_10142710 | 3300028380 | Bacteria | 2007 |
| 567 | Ga0268264_10003169 | 3300028381 | Bacteria | 14249 |
| 568 | Ga0268264_10025615 | 3300028381 | Bacteria | 4819 |
| 569 | Ga0265334_10201958 | 3300028573 | Bacteria | 690 |
| 570 | Ga0265322_10029525 | 3300028654 | Bacteria | 1567 |
| 571 | Ga0265336_10066977 | 3300028666 | Bacteria | 1074 |
| 572 | Ga0265338_10003174 | 3300028800 | Bacteria | 23452 |
| 573 | Ga0265338_10025995 | 3300028800 | Bacteria | 5919 |
| 574 | Ga0265338_10650797 | 3300028800 | Bacteria | 730 |
| 575 | Ga0307512_10233885 | 3300030522 | Bacteria | 940 |
| 576 | Ga0265770_1049249 | 3300030878 | Bacteria | 758 |
| 577 | Ga0265332_10000024 | 3300031238 | Bacteria | 209663 |
| 578 | Ga0265332_10050683 | 3300031238 | Bacteria | 1784 |
| 579 | Ga0265329_10003297 | 3300031242 | Bacteria | 7067 |
| 580 | Ga0307513_10032790 | 3300031456 | Bacteria | 5850 |
| 581 | Ga0307408_100152452 | 3300031548 | Bacteria | 1826 |
| 582 | Ga0307408_101461699 | 3300031548 | Bacteria | 645 |
| 583 | Ga0316579_10182376 | 3300031691 | Bacteria | 1015 |
| 584 | Ga0316579_10263513 | 3300031691 | Bacteria | 834 |
| 585 | Ga0316579_10378302 | 3300031691 | Bacteria | 685 |
| 586 | Ga0265314_10000087 | 3300031711 | Bacteria | 138681 |
| 587 | Ga0316576_10008783 | 3300031727 | Bacteria | 6476 |
| 588 | Ga0316576_10010434 | 3300031727 | Bacteria | 6036 |
| 589 | Ga0316576_10013218 | 3300031727 | Bacteria | 5477 |
| 590 | Ga0316576_10019776 | 3300031727 | Bacteria | 4619 |
| 591 | Ga0316576_10074568 | 3300031727 | Bacteria | 2509 |
| 592 | Ga0316576_10184841 | 3300031727 | Bacteria | 1572 |
| 593 | Ga0316576_10262497 | 3300031727 | Bacteria | 1295 |
| 594 | Ga0316576_10373904 | 3300031727 | Bacteria | 1058 |
| 595 | Ga0316576_10374916 | 3300031727 | Bacteria | 1057 |
| 596 | Ga0316576_10488521 | 3300031727 | Bacteria | 907 |
| 597 | Ga0316576_10580138 | 3300031727 | Unclassified | 820 |
| 598 | Ga0316576_10681452 | 3300031727 | Unclassified | 746 |
| 599 | Ga0316576_11010482 | 3300031727 | Bacteria | 592 |
| 600 | Ga0316578_10004019 | 3300031728 | Bacteria | 6867 |
| 601 | Ga0316578_10010761 | 3300031728 | Bacteria | 4760 |
| 602 | Ga0316578_10018445 | 3300031728 | Bacteria | 3825 |
| 603 | Ga0316578_10115712 | 3300031728 | Bacteria | 1611 |
| 604 | Ga0316578_10349861 | 3300031728 | Bacteria | 879 |
| 605 | Ga0316578_10802502 | 3300031728 | Bacteria | 545 |
| 606 | Ga0316577_10042433 | 3300031733 | Bacteria | 2545 |
| 607 | Ga0316577_10173854 | 3300031733 | Bacteria | 1216 |
| 608 | Ga0316577_10325250 | 3300031733 | Unclassified | 872 |
| 609 | Ga0316577_10874150 | 3300031733 | Bacteria | 510 |
| 610 | Ga0307410_10747952 | 3300031852 | Bacteria | 828 |
| 611 | Ga0307407_10274700 | 3300031903 | Bacteria | 1165 |
| 612 | Ga0307412_11098294 | 3300031911 | Bacteria | 708 |
| 613 | Ga0307409_102154263 | 3300031995 | Unclassified | 587 |
| 614 | Ga0307416_100175520 | 3300032002 | Bacteria | 2001 |
| 615 | Ga0307416_100572741 | 3300032002 | Bacteria | 1205 |
| 616 | Ga0307416_100896297 | 3300032002 | Bacteria | 987 |
| 617 | Ga0307416_102767757 | 3300032002 | Bacteria | 586 |
| 618 | Ga0307414_10546309 | 3300032004 | Bacteria | 1032 |
| 619 | Ga0307415_100635752 | 3300032126 | Unclassified | 955 |
| 620 | Ga0316583_10031781 | 3300032133 | Bacteria | 1878 |
| 621 | Ga0316583_10035505 | 3300032133 | Bacteria | 1769 |
| 622 | Ga0316583_10154515 | 3300032133 | Bacteria | 799 |
| 623 | Ga0316585_10013644 | 3300032137 | Bacteria | 2420 |
| 624 | Ga0316580_10003959 | 3300032139 | Bacteria | 4259 |
| 625 | Ga0316580_10010860 | 3300032139 | Bacteria | 2759 |
| 626 | Ga0316593_10013684 | 3300032168 | Bacteria | 2408 |
| 627 | Ga0316593_10023357 | 3300032168 | Bacteria | 1950 |
| 628 | Ga0316593_10153884 | 3300032168 | Bacteria | 837 |
| 629 | Ga0316592_1001361 | 3300033524 | Bacteria | 3908 |
| 630 | Ga0316592_1002162 | 3300033524 | Bacteria | 3353 |
| 631 | Ga0316592_1071258 | 3300033524 | Bacteria | 786 |
| 632 | Ga0316586_1001301 | 3300033527 | Bacteria | 2812 |
| 633 | Ga0316588_1041192 | 3300033528 | Bacteria | 1104 |
| 634 | Ga0316588_1087417 | 3300033528 | Bacteria | 775 |
| 635 | Ga0316587_1025310 | 3300033529 | Bacteria | 1031 |
| 636 | Ga0316587_1118832 | 3300033529 | Bacteria | 517 |
| 637 | Ga0316596_1007171 | 3300033541 | Bacteria | 2627 |
| 638 | Ga0373926_0037925 | 3300035083 | Bacteria | 1715 |
| 639 | Ga0373928_0038880 | 3300035084 | Bacteria | 1085 |
| 640 | Ga0373929_0034483 | 3300035085 | Bacteria | 1098 |
| 641 | Ga0373934_0005630 | 3300035086 | Bacteria | 4640 |
| 642 | Ga0373940_0133651 | 3300035088 | Bacteria | 779 |
| 643 | Ga0373944_0084426 | 3300035089 | Bacteria | 1053 |
| 644 | Ga0373923_0000205 | 3300035111 | Bacteria | 12151 |
| 645 | Ga0373923_0064846 | 3300035111 | Bacteria | 1558 |
| 646 | Ga0373932_0269868 | 3300035112 | Bacteria | 626 |
| 647 | Ga0373941_0032001 | 3300035115 | Bacteria | 1571 |
| 648 | Ga0373945_0024779 | 3300035116 | Bacteria | 2081 |
| 649 | Ga0373945_0053249 | 3300035116 | Bacteria | 1493 |
| 650 | Ga0373953_0006354 | 3300035117 | Bacteria | 3889 |
| 651 | Ga0373954_0034165 | 3300035118 | Bacteria | 2354 |
| 652 | Ga0373956_0022360 | 3300035119 | Bacteria | 2705 |
| 653 | Ga0373956_0262443 | 3300035119 | Bacteria | 821 |
| 654 | Ga0373957_0004838 | 3300035120 | Bacteria | 4128 |
| 655 | Ga0373957_0086871 | 3300035120 | Bacteria | 1239 |
| 656 | Ga0373960_0183157 | 3300035121 | Bacteria | 732 |
| 657 | Ga0373960_0359710 | 3300035121 | Bacteria | 554 |
| 658 | Ga0373943_0013451 | 3300035170 | Bacteria | 3696 |
| 659 | Ga0373943_0015517 | 3300035170 | Bacteria | 3462 |
| 660 | Ga0373943_0018552 | 3300035170 | Bacteria | 3197 |
| 661 | Ga0373943_0280165 | 3300035170 | Bacteria | 942 |
| 662 | Ga0373946_0228097 | 3300035171 | Bacteria | 901 |
| 663 | Ga0373955_0007175 | 3300035172 | Bacteria | 5108 |
| 664 | Ga0373961_0119927 | 3300035241 | Bacteria | 871 |
| 665 | Ga0316574_0021624 | 3300035398 | Bacteria | 3822 |
| 666 | Ga0316574_0270263 | 3300035398 | Bacteria | 1084 |
| 667 | Ga0316574_0307057 | 3300035398 | Bacteria | 1008 |
| 668 | Ga0316574_0546536 | 3300035398 | Bacteria | 719 |
| 669 | Ga0316574_0763097 | 3300035398 | Unclassified | 590 |
| 670 | Ga0373924_0019718 | 3300035410 | Bacteria | 2614 |
| 671 | Ga0373924_0165142 | 3300035410 | Bacteria | 972 |
| 672 | Ga0373935_0003253 | 3300035692 | Bacteria | 9393 |
| 673 | Ga0373935_0144651 | 3300035692 | Bacteria | 1608 |
| 674 | Ga0373935_0930977 | 3300035692 | Unclassified | 644 |
| 675 | Ga0373935_1130457 | 3300035692 | Bacteria | 583 |
| 676 | Ga0373927_0045696 | 3300035695 | Bacteria | 2832 |
| 677 | Ga0373927_0200717 | 3300035695 | Bacteria | 1309 |
| 678 | Ga0373933_0130310 | 3300035724 | Bacteria | 1581 |
| 679 | Ga0373933_0232935 | 3300035724 | Bacteria | 1183 |
| 680 | Ga0373947_0003388 | 3300035725 | Bacteria | 9431 |
| 681 | Ga0373947_0024078 | 3300035725 | Bacteria | 3545 |
| 682 | Ga0373937_0043634 | 3300036401 | Bacteria | 4094 |
| 683 | Ga0373937_0124881 | 3300036401 | Bacteria | 2400 |
| 684 | Ga0373937_0182724 | 3300036401 | Bacteria | 1969 |
| 685 | Ga0373937_0430849 | 3300036401 | Bacteria | 1252 |
| 686 | Ga0373937_0752533 | 3300036401 | Bacteria | 922 |
| 687 | Ga0373937_1702718 | 3300036401 | Unclassified | 577 |
| 688 | Ga0372808_036355 | 3300036459 | Bacteria | 707 |
| 689 | Ga0316582_0022819 | 3300036647 | Bacteria | 3722 |
| 690 | Ga0316582_0068727 | 3300036647 | Bacteria | 2288 |
| 691 | Ga0316582_0082778 | 3300036647 | Bacteria | 2098 |
| 692 | Ga0316582_0261484 | 3300036647 | Bacteria | 1187 |
| 693 | Ga0316582_0297525 | 3300036647 | Bacteria | 1108 |
| 694 | Ga0316584_0067900 | 3300036712 | Bacteria | 2672 |
| 695 | Ga0316584_0194355 | 3300036712 | Bacteria | 1499 |
| 696 | Ga0316584_0211657 | 3300036712 | Bacteria | 1426 |
| 697 | Ga0373925_0041456 | 3300037068 | Bacteria | 3412 |
| 698 | Ga0395899_0000139 | 3300037312 | Bacteria | 110692 |
| 699 | Ga0395899_0000164 | 3300037312 | Bacteria | 102165 |
| 700 | Ga0395899_0012593 | 3300037312 | Bacteria | 6484 |
| 701 | Ga0395899_0122589 | 3300037312 | Bacteria | 1860 |
| 702 | Ga0395899_0355320 | 3300037312 | Bacteria | 979 |
| 703 | Ga0395899_0403022 | 3300037312 | Bacteria | 904 |
| 704 | Ga0395899_0403406 | 3300037312 | Bacteria | 904 |
| 705 | Ga0395899_0492384 | 3300037312 | Bacteria | 796 |
| 706 | Ga0395900_0000217 | 3300037418 | Bacteria | 90402 |
| 707 | Ga0395900_0002078 | 3300037418 | Bacteria | 22454 |
| 708 | Ga0395900_0110837 | 3300037418 | Bacteria | 2819 |
| 709 | Ga0395900_0135659 | 3300037418 | Bacteria | 2521 |
| 710 | Ga0395900_0170772 | 3300037418 | Bacteria | 2214 |
| 711 | Ga0395900_0208752 | 3300037418 | Bacteria | 1973 |
| 712 | Ga0395900_0246371 | 3300037418 | Bacteria | 1790 |
| 713 | Ga0395900_0263559 | 3300037418 | Bacteria | 1720 |
| 714 | Ga0395900_0973125 | 3300037418 | Bacteria | 769 |
| 715 | Ga0395900_1199270 | 3300037418 | Bacteria | 674 |
| 716 | Ga0395898_0000029 | 3300037466 | Bacteria | 370667 |
| 717 | Ga0395898_0246545 | 3300037466 | Bacteria | 1703 |
| 718 | Ga0395898_0397878 | 3300037466 | Bacteria | 1313 |
| 719 | Ga0395898_0503740 | 3300037466 | Bacteria | 1151 |
| 720 | Ga0395898_0566588 | 3300037466 | Bacteria | 1078 |
| 721 | Ga0395898_1621798 | 3300037466 | Bacteria | 571 |
| 722 | Ga0395905_0114628 | 3300037471 | Bacteria | 2532 |
| 723 | Ga0395905_0162138 | 3300037471 | Bacteria | 2101 |
| 724 | Ga0395905_0322941 | 3300037471 | Bacteria | 1433 |
| 725 | Ga0395905_0369994 | 3300037471 | Bacteria | 1326 |
| 726 | Ga0395905_0724389 | 3300037471 | Bacteria | 897 |
| 727 | Ga0395905_0984124 | 3300037471 | Bacteria | 746 |
| 728 | Ga0395905_1274934 | 3300037471 | Bacteria | 638 |
| 729 | Ga0395905_1312554 | 3300037471 | Bacteria | 627 |
| 730 | Ga0316581_0002998 | 3300037588 | Bacteria | 4150 |
| 731 | Ga0316581_0063326 | 3300037588 | Bacteria | 1135 |
| 732 | Ga0436364_0212987 | 3300037853 | Bacteria | 1202 |
| 733 | Ga0436364_1367044 | 3300037853 | Bacteria | 3574 |
| 734 | Ga0395901_0000250 | 3300038443 | Bacteria | 66983 |
| 735 | Ga0395901_0055988 | 3300038443 | Bacteria | 4102 |
| 736 | Ga0395901_0072336 | 3300038443 | Bacteria | 3595 |
| 737 | Ga0395901_0110229 | 3300038443 | Bacteria | 2890 |
| 738 | Ga0395901_0112883 | 3300038443 | Bacteria | 2854 |
| 739 | Ga0395901_0262727 | 3300038443 | Bacteria | 1796 |
| 740 | Ga0395901_0293924 | 3300038443 | Bacteria | 1685 |
| 741 | Ga0395901_0321392 | 3300038443 | Bacteria | 1601 |
| 742 | Ga0395901_0343309 | 3300038443 | Bacteria | 1542 |
| 743 | Ga0395901_0598481 | 3300038443 | Bacteria | 1112 |
| 744 | Ga0395901_1005584 | 3300038443 | Bacteria | 809 |
| 745 | Ga0436365_0226758 | 3300039437 | Bacteria | 3042 |
| 746 | Ga0436365_0449353 | 3300039437 | Bacteria | 876 |
| 747 | Ga0436360_0389060 | 3300039438 | Bacteria | 676 |
| 748 | Ga0436360_0670138 | 3300039438 | Bacteria | 609 |
| 749 | Ga0436360_0806326 | 3300039438 | Bacteria | 706 |
| 750 | Ga0436360_1097396 | 3300039438 | Bacteria | 737 |
| 751 | Ga0436361_1118974 | 3300039447 | Bacteria | 1436 |
| 752 | Ga0439436_0000974 | 3300041404 | Bacteria | 7926 |
| 753 | Ga0439438_000863 | 3300041405 | Bacteria | 13555 |
| 754 | Ga0439447_000231 | 3300041407 | Bacteria | 19695 |
| 755 | Ga0439461_0121310 | 3300041410 | Bacteria | 654 |
| 756 | Ga0439466_0000756 | 3300041411 | Bacteria | 12220 |
| 757 | Ga0439466_0003886 | 3300041411 | Bacteria | 5766 |
| 758 | Ga0439465_0069610 | 3300041413 | Bacteria | 1178 |
| 759 | Ga0439465_0126301 | 3300041413 | Bacteria | 900 |
| 760 | Ga0451789_0506225 | 3300041443 | Bacteria | 1109 |
| 761 | Ga0451837_1132506 | 3300041494 | Unclassified | 1587 |
| 762 | Ga0451853_0378017 | 3300041512 | Bacteria | 590 |
| 763 | Ga0451853_3305277 | 3300041512 | Bacteria | 695 |
| 764 | Ga0439431_0046627 | 3300041997 | Bacteria | 1116 |
| 765 | Ga0439431_0072732 | 3300041997 | Bacteria | 918 |
| 766 | Ga0439432_003631 | 3300042006 | Bacteria | 5708 |
| 767 | Ga0439449_0070651 | 3300042007 | Bacteria | 1286 |
| 768 | Ga0439452_008966 | 3300042010 | Bacteria | 2978 |
| 769 | Ga0450919_024118 | 3300042121 | Bacteria | 689 |
| 770 | Ga0450923_029321 | 3300042125 | Bacteria | 1114 |
| 771 | Ga0450904_001054 | 3300042139 | Bacteria | 4259 |
| 772 | Ga0439446_0008571 | 3300042156 | Bacteria | 2721 |
| 773 | Ga0439458_0181330 | 3300042157 | Bacteria | 572 |
| 774 | Ga0450908_076159 | 3300042184 | Bacteria | 599 |
| 775 | Ga0450909_013992 | 3300042185 | Bacteria | 1181 |
| 776 | Ga0450909_069802 | 3300042185 | Bacteria | 561 |
| 777 | Ga0439434_0001105 | 3300042435 | Bacteria | 7811 |
| 778 | Ga0439435_0030933 | 3300042436 | Bacteria | 1453 |
| 779 | Ga0439459_0033904 | 3300042438 | Bacteria | 1054 |
| 780 | Ga0439460_0223280 | 3300042461 | Unclassified | 646 |
| 781 | Ga0451577_0025900 | 3300042876 | Bacteria | 5317 |
| 782 | Ga0451577_0246518 | 3300042876 | Bacteria | 1617 |
| 783 | Ga0451577_0268084 | 3300042876 | Bacteria | 1546 |
| 784 | Ga0451577_0273041 | 3300042876 | Bacteria | 1531 |
| 785 | Ga0451577_1672257 | 3300042876 | Bacteria | 560 |
| 786 | Ga0466969_0008322 | 3300044656 | Bacteria | 5501 |
| 787 | Ga0466969_0117745 | 3300044656 | Bacteria | 1238 |
| 788 | Ga0466969_0159867 | 3300044656 | Bacteria | 1035 |
| 789 | Ga0466969_0410834 | 3300044656 | Bacteria | 615 |
| 790 | Ga0466972_0061569 | 3300044658 | Bacteria | 1799 |
| 791 | Ga0466976_0329296 | 3300044662 | Bacteria | 851 |
| 792 | Ga0453683_0579476 | 3300044673 | Bacteria | 731 |
| 793 | Ga0466965_0022239 | 3300044683 | Bacteria | 3057 |
| 794 | Ga0466965_0207337 | 3300044683 | Bacteria | 1041 |
| 795 | Ga0466965_0395558 | 3300044683 | Bacteria | 763 |
| 796 | Ga0466966_0001633 | 3300044684 | Bacteria | 14459 |
| 797 | Ga0466966_0059034 | 3300044684 | Bacteria | 2423 |
| 798 | Ga0466961_0001504 | 3300044693 | Bacteria | 14466 |
| 799 | Ga0466963_0281149 | 3300044694 | Bacteria | 1170 |
| 800 | Ga0466964_0014915 | 3300044706 | Bacteria | 2959 |
| 801 | Ga0466964_0113483 | 3300044706 | Bacteria | 1212 |
| 802 | Ga0453684_0000204 | 3300044712 | Bacteria | 258105 |
| 803 | Ga0453684_0000395 | 3300044712 | Bacteria | 179647 |
| 804 | Ga0453684_0004787 | 3300044712 | Bacteria | 27912 |
| 805 | Ga0453684_0148792 | 3300044712 | Bacteria | 2785 |
| 806 | Ga0453684_0568746 | 3300044712 | Bacteria | 1246 |
| 807 | Ga0453684_2288871 | 3300044712 | Unclassified | 538 |
| 808 | Ga0466971_0050778 | 3300044719 | Bacteria | 1866 |
| 809 | Ga0466968_0655917 | 3300044735 | Bacteria | 533 |
| 810 | Ga0466970_0152245 | 3300044765 | Bacteria | 1277 |
| 811 | Ga0466970_0239282 | 3300044765 | Bacteria | 1015 |
| 812 | Ga0466957_0000385 | 3300044842 | Bacteria | 21580 |
| 813 | Ga0466957_0233804 | 3300044842 | Bacteria | 1217 |
| 814 | Ga0466959_0000563 | 3300045049 | Bacteria | 21561 |
| 815 | Ga0466959_0002207 | 3300045049 | Bacteria | 12392 |
| 816 | Ga0466959_0020697 | 3300045049 | Bacteria | 4847 |
| 817 | Ga0466959_0970227 | 3300045049 | Bacteria | 566 |
| 818 | Ga0451576_0005710 | 3300045051 | Bacteria | 15519 |
| 819 | Ga0451576_1266021 | 3300045051 | Bacteria | 769 |
| 820 | Ga0451576_2420617 | 3300045051 | Bacteria | 537 |
| 821 | Ga0466958_0081536 | 3300045836 | Bacteria | 1991 |
| 822 | Ga0466958_0166802 | 3300045836 | Bacteria | 1393 |
| 823 | Ga0466958_0603932 | 3300045836 | Bacteria | 714 |
| 824 | Ga0466967_0378134 | 3300045976 | Bacteria | 1375 |
| 825 | Ga0466967_0528181 | 3300045976 | Bacteria | 1160 |
| 826 | Ga0466967_0677750 | 3300045976 | Bacteria | 1020 |
| 827 | Ga0466967_2128418 | 3300045976 | Bacteria | 557 |
| 828 | Ga0495617_000216 | 3300046452 | Bacteria | 35255 |
| 829 | Ga0495627_005158 | 3300046453 | Bacteria | 5319 |
| 830 | Ga0495592_0000054 | 3300046454 | Bacteria | 107373 |
| 831 | Ga0495592_0122817 | 3300046454 | Bacteria | 1825 |
| 832 | Ga0495603_0052705 | 3300046455 | Bacteria | 2415 |
| 833 | Ga0495603_0115160 | 3300046455 | Bacteria | 1567 |
| 834 | Ga0495603_0297199 | 3300046455 | Bacteria | 927 |
| 835 | Ga0495590_0000077 | 3300046457 | Bacteria | 64092 |
| 836 | Ga0495590_0003554 | 3300046457 | Bacteria | 6348 |
| 837 | Ga0495590_0018501 | 3300046457 | Bacteria | 2494 |
| 838 | Ga0495629_0049667 | 3300046459 | Bacteria | 2940 |
| 839 | Ga0495629_0067752 | 3300046459 | Bacteria | 2490 |
| 840 | Ga0495629_0081556 | 3300046459 | Bacteria | 2257 |
| 841 | Ga0495629_0104214 | 3300046459 | Bacteria | 1978 |
| 842 | Ga0495638_0046686 | 3300046460 | Bacteria | 2720 |
| 843 | Ga0495638_0297327 | 3300046460 | Bacteria | 871 |
| 844 | Ga0495651_0294344 | 3300046462 | Bacteria | 1091 |
| 845 | Ga0495653_0042427 | 3300046463 | Bacteria | 3543 |
| 846 | Ga0495653_0052385 | 3300046463 | Bacteria | 3127 |
| 847 | Ga0495653_0073375 | 3300046463 | Bacteria | 2553 |
| 848 | Ga0495653_0292562 | 3300046463 | Bacteria | 1065 |
| 849 | Ga0495650_0025459 | 3300046471 | Bacteria | 2773 |
| 850 | Ga0495580_0046916 | 3300046472 | Bacteria | 3063 |
| 851 | Ga0495580_0343830 | 3300046472 | Bacteria | 1011 |
| 852 | Ga0495582_0005646 | 3300046473 | Bacteria | 6965 |
| 853 | Ga0495582_0010469 | 3300046473 | Bacteria | 5103 |
| 854 | Ga0495582_0018626 | 3300046473 | Bacteria | 3795 |
| 855 | Ga0495605_0000325 | 3300046474 | Bacteria | 48544 |
| 856 | Ga0495605_0114818 | 3300046474 | Bacteria | 1225 |
| 857 | Ga0495605_0122472 | 3300046474 | Bacteria | 1178 |
| 858 | Ga0495639_0013210 | 3300046475 | Bacteria | 3563 |
| 859 | Ga0495662_0009572 | 3300046476 | Bacteria | 4751 |
| 860 | Ga0495662_0010489 | 3300046476 | Bacteria | 4534 |
| 861 | Ga0495664_0410564 | 3300046477 | Bacteria | 813 |
| 862 | Ga0495584_0000351 | 3300046491 | Bacteria | 31986 |
| 863 | Ga0495584_0001690 | 3300046491 | Bacteria | 12941 |
| 864 | Ga0495584_0001693 | 3300046491 | Bacteria | 12925 |
| 865 | Ga0495584_0023105 | 3300046491 | Bacteria | 3153 |
| 866 | Ga0495584_0023849 | 3300046491 | Bacteria | 3101 |
| 867 | Ga0495584_0025577 | 3300046491 | Bacteria | 2992 |
| 868 | Ga0495584_0050546 | 3300046491 | Bacteria | 2093 |
| 869 | Ga0495584_0068022 | 3300046491 | Bacteria | 1789 |
| 870 | Ga0495584_0170407 | 3300046491 | Bacteria | 1106 |
| 871 | Ga0495584_0338320 | 3300046491 | Bacteria | 764 |
| 872 | Ga0495585_0000563 | 3300046492 | Bacteria | 35041 |
| 873 | Ga0495585_0001619 | 3300046492 | Bacteria | 17313 |
| 874 | Ga0495585_0002446 | 3300046492 | Bacteria | 13306 |
| 875 | Ga0495585_0002476 | 3300046492 | Bacteria | 13184 |
| 876 | Ga0495585_0003138 | 3300046492 | Bacteria | 11326 |
| 877 | Ga0495585_0003417 | 3300046492 | Bacteria | 10744 |
| 878 | Ga0495585_0027979 | 3300046492 | Bacteria | 3217 |
| 879 | Ga0495585_0046466 | 3300046492 | Bacteria | 2421 |
| 880 | Ga0495585_0123123 | 3300046492 | Bacteria | 1370 |
| 881 | Ga0495585_0277366 | 3300046492 | Bacteria | 829 |
| 882 | Ga0495585_0344031 | 3300046492 | Bacteria | 725 |
| 883 | Ga0495585_0462800 | 3300046492 | Bacteria | 605 |
| 884 | Ga0495594_0039692 | 3300046499 | Bacteria | 2574 |
| 885 | Ga0495594_0049418 | 3300046499 | Bacteria | 2311 |
| 886 | Ga0495594_0060346 | 3300046499 | Bacteria | 2097 |
| 887 | Ga0495596_0003192 | 3300046500 | Bacteria | 8437 |
| 888 | Ga0495596_0048164 | 3300046500 | Bacteria | 1671 |
| 889 | Ga0495596_0053296 | 3300046500 | Bacteria | 1582 |
| 890 | Ga0495607_0009100 | 3300046501 | Bacteria | 6751 |
| 891 | Ga0495607_0014486 | 3300046501 | Bacteria | 5126 |
| 892 | Ga0495607_0092858 | 3300046501 | Bacteria | 1631 |
| 893 | Ga0495583_0000424 | 3300046506 | Bacteria | 63938 |
| 894 | Ga0495583_0003374 | 3300046506 | Bacteria | 12262 |
| 895 | Ga0495583_0015810 | 3300046506 | Bacteria | 4086 |
| 896 | Ga0495583_0029507 | 3300046506 | Bacteria | 2683 |
| 897 | Ga0495583_0118069 | 3300046506 | Bacteria | 1119 |
| 898 | Ga0495583_0154551 | 3300046506 | Bacteria | 949 |
| 899 | Ga0495583_0246348 | 3300046506 | Bacteria | 717 |
| 900 | Ga0495583_0349676 | 3300046506 | Bacteria | 583 |
| 901 | Ga0495606_0020317 | 3300046507 | Bacteria | 4901 |
| 902 | Ga0495606_0056953 | 3300046507 | Bacteria | 2519 |
| 903 | Ga0495606_0057127 | 3300046507 | Bacteria | 2514 |
| 904 | Ga0495606_0148920 | 3300046507 | Bacteria | 1375 |
| 905 | Ga0495606_0283613 | 3300046507 | Bacteria | 904 |
| 906 | Ga0495610_0000955 | 3300046512 | Bacteria | 26756 |
| 907 | Ga0495610_0067078 | 3300046512 | Bacteria | 1687 |
| 908 | Ga0495610_0081874 | 3300046512 | Bacteria | 1480 |
| 909 | Ga0495616_0000316 | 3300046513 | Bacteria | 38626 |
| 910 | Ga0495616_0001788 | 3300046513 | Bacteria | 14612 |
| 911 | Ga0495616_0006596 | 3300046513 | Bacteria | 7013 |
| 912 | Ga0495616_0016682 | 3300046513 | Bacteria | 4059 |
| 913 | Ga0495616_0059927 | 3300046513 | Bacteria | 1870 |
| 914 | Ga0495616_0095739 | 3300046513 | Bacteria | 1399 |
| 915 | Ga0495616_0099042 | 3300046513 | Bacteria | 1369 |
| 916 | Ga0495616_0180214 | 3300046513 | Bacteria | 939 |
| 917 | Ga0495616_0263104 | 3300046513 | Bacteria | 737 |
| 918 | Ga0495618_0002303 | 3300046514 | Bacteria | 12371 |
| 919 | Ga0495618_0602385 | 3300046514 | Bacteria | 654 |
| 920 | Ga0495620_0023660 | 3300046515 | Bacteria | 2933 |
| 921 | Ga0495628_0015266 | 3300046516 | Bacteria | 6416 |
| 922 | Ga0495628_0048896 | 3300046516 | Bacteria | 3350 |
| 923 | Ga0495628_0056377 | 3300046516 | Bacteria | 3093 |
| 924 | Ga0495630_0070115 | 3300046517 | Bacteria | 2637 |
| 925 | Ga0495630_0077443 | 3300046517 | Bacteria | 2507 |
| 926 | Ga0495630_0093467 | 3300046517 | Bacteria | 2273 |
| 927 | Ga0495630_0229291 | 3300046517 | Bacteria | 1419 |
| 928 | Ga0495631_0000341 | 3300046518 | Bacteria | 32087 |
| 929 | Ga0495631_0003191 | 3300046518 | Bacteria | 9025 |
| 930 | Ga0495631_0012248 | 3300046518 | Bacteria | 4197 |
| 931 | Ga0495631_0038854 | 3300046518 | Bacteria | 2114 |
| 932 | Ga0495631_0203642 | 3300046518 | Bacteria | 846 |
| 933 | Ga0495632_0000081 | 3300046519 | Bacteria | 99136 |
| 934 | Ga0495632_0032242 | 3300046519 | Bacteria | 2701 |
| 935 | Ga0495632_0435046 | 3300046519 | Bacteria | 570 |
| 936 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 937 | Ga0495637_0079214 | 3300046520 | Bacteria | 1312 |
| 938 | Ga0495643_0003692 | 3300046522 | Bacteria | 11092 |
| 939 | Ga0495643_0004226 | 3300046522 | Bacteria | 10163 |
| 940 | Ga0495643_0028999 | 3300046522 | Bacteria | 3099 |
| 941 | Ga0495644_0005571 | 3300046523 | Bacteria | 4914 |
| 942 | Ga0495644_0010600 | 3300046523 | Bacteria | 3551 |
| 943 | Ga0495644_0016582 | 3300046523 | Bacteria | 2819 |
| 944 | Ga0495644_0029604 | 3300046523 | Bacteria | 2069 |
| 945 | Ga0495644_0032762 | 3300046523 | Bacteria | 1963 |
| 946 | Ga0495644_0294288 | 3300046523 | Bacteria | 634 |
| 947 | Ga0495648_0000722 | 3300046524 | Bacteria | 35218 |
| 948 | Ga0495648_0063018 | 3300046524 | Bacteria | 2192 |
| 949 | Ga0495648_0135865 | 3300046524 | Bacteria | 1300 |
| 950 | Ga0495648_0145297 | 3300046524 | Bacteria | 1243 |
| 951 | Ga0495648_0326474 | 3300046524 | Bacteria | 709 |
| 952 | Ga0495666_0012245 | 3300046526 | Bacteria | 4276 |
| 953 | Ga0495666_0012371 | 3300046526 | Bacteria | 4254 |
| 954 | Ga0495666_0048120 | 3300046526 | Unclassified | 2054 |
| 955 | Ga0495666_0070145 | 3300046526 | Bacteria | 1666 |
| 956 | Ga0495666_0120039 | 3300046526 | Bacteria | 1232 |
| 957 | Ga0495666_0401230 | 3300046526 | Bacteria | 616 |
| 958 | Ga0495642_0005225 | 3300046528 | Bacteria | 4994 |
| 959 | Ga0495642_0008145 | 3300046528 | Bacteria | 4010 |
| 960 | Ga0495642_0015210 | 3300046528 | Bacteria | 2987 |
| 961 | Ga0495642_0122653 | 3300046528 | Bacteria | 1115 |
| 962 | Ga0495652_0017091 | 3300046529 | Bacteria | 6479 |
| 963 | Ga0495654_0044609 | 3300046530 | Bacteria | 2192 |
| 964 | Ga0495665_0008680 | 3300046531 | Bacteria | 5515 |
| 965 | Ga0495665_0022929 | 3300046531 | Bacteria | 3352 |
| 966 | Ga0495640_0090715 | 3300046533 | Bacteria | 2017 |
| 967 | Ga0495640_0143271 | 3300046533 | Unclassified | 1539 |
| 968 | Ga0495640_0320740 | 3300046533 | Bacteria | 960 |
| 969 | Ga0495586_0000670 | 3300046535 | Bacteria | 19540 |
| 970 | Ga0495586_0008010 | 3300046535 | Bacteria | 5635 |
| 971 | Ga0495586_0010132 | 3300046535 | Bacteria | 5016 |
| 972 | Ga0495586_0011649 | 3300046535 | Bacteria | 4677 |
| 973 | Ga0495586_0110158 | 3300046535 | Bacteria | 1532 |
| 974 | Ga0495587_0022210 | 3300046536 | Bacteria | 3908 |
| 975 | Ga0495587_0036803 | 3300046536 | Bacteria | 2942 |
| 976 | Ga0495587_0074261 | 3300046536 | Bacteria | 1975 |
| 977 | Ga0495587_0207037 | 3300046536 | Bacteria | 1108 |
| 978 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 979 | Ga0495609_0002266 | 3300046538 | Bacteria | 12004 |
| 980 | Ga0495609_0038762 | 3300046538 | Bacteria | 2147 |
| 981 | Ga0495609_0048087 | 3300046538 | Bacteria | 1907 |
| 982 | Ga0495609_0137391 | 3300046538 | Bacteria | 1044 |
| 983 | Ga0495609_0174146 | 3300046538 | Bacteria | 907 |
| 984 | Ga0495609_0186161 | 3300046538 | Bacteria | 872 |
| 985 | Ga0495609_0308053 | 3300046538 | Bacteria | 644 |
| 986 | Ga0495621_0020476 | 3300046539 | Bacteria | 2171 |
| 987 | Ga0495597_0001889 | 3300046542 | Bacteria | 14286 |
| 988 | Ga0495597_0002795 | 3300046542 | Bacteria | 10727 |
| 989 | Ga0495597_0003774 | 3300046542 | Bacteria | 8623 |
| 990 | Ga0495597_0008819 | 3300046542 | Bacteria | 5030 |
| 991 | Ga0495597_0112372 | 3300046542 | Bacteria | 1141 |
| 992 | Ga0495597_0235810 | 3300046542 | Bacteria | 722 |
| 993 | Ga0495597_0295419 | 3300046542 | Bacteria | 629 |
| 994 | Ga0495645_0049898 | 3300046543 | Bacteria | 3047 |
| 995 | Ga0495645_0065571 | 3300046543 | Bacteria | 2627 |
| 996 | Ga0495622_0012056 | 3300046557 | Bacteria | 3996 |
| 997 | Ga0495622_0027422 | 3300046557 | Bacteria | 2658 |
| 998 | Ga0495622_0043674 | 3300046557 | Bacteria | 2083 |
| 999 | Ga0495633_0002942 | 3300046558 | Bacteria | 11650 |
| 1000 | Ga0495633_0025172 | 3300046558 | Bacteria | 2931 |
| 1001 | Ga0495633_0052084 | 3300046558 | Bacteria | 1928 |
| 1002 | Ga0495633_0069481 | 3300046558 | Bacteria | 1644 |
| 1003 | Ga0495633_0103571 | 3300046558 | Bacteria | 1320 |
| 1004 | Ga0495633_0107701 | 3300046558 | Bacteria | 1292 |
| 1005 | Ga0495633_0203495 | 3300046558 | Bacteria | 908 |
| 1006 | Ga0495633_0262437 | 3300046558 | Bacteria | 787 |
| 1007 | Ga0495633_0392988 | 3300046558 | Bacteria | 627 |
| 1008 | Ga0495667_0504629 | 3300046559 | Bacteria | 758 |
| 1009 | Ga0495656_0000102 | 3300046615 | Bacteria | 35387 |
| 1010 | Ga0495656_0000738 | 3300046615 | Bacteria | 10569 |
| 1011 | Ga0495668_0003757 | 3300046616 | Bacteria | 11137 |
| 1012 | Ga0495668_0012553 | 3300046616 | Bacteria | 5022 |
| 1013 | Ga0495668_0018088 | 3300046616 | Bacteria | 4078 |
| 1014 | Ga0495668_0020416 | 3300046616 | Bacteria | 3810 |
| 1015 | Ga0495668_0035554 | 3300046616 | Bacteria | 2792 |
| 1016 | Ga0495668_0037951 | 3300046616 | Bacteria | 2693 |
| 1017 | Ga0495668_0065580 | 3300046616 | Bacteria | 1998 |
| 1018 | Ga0495668_0263264 | 3300046616 | Bacteria | 944 |
| 1019 | Ga0495634_0046550 | 3300046642 | Bacteria | 2926 |
| 1020 | Ga0495634_0069764 | 3300046642 | Bacteria | 2318 |
| 1021 | Ga0495634_0137156 | 3300046642 | Bacteria | 1556 |
| 1022 | Ga0495611_0000988 | 3300046648 | Bacteria | 15104 |
| 1023 | Ga0495611_0087497 | 3300046648 | Bacteria | 1437 |
| 1024 | Ga0495611_0134895 | 3300046648 | Bacteria | 1152 |
| 1025 | Ga0495611_0408306 | 3300046648 | Bacteria | 620 |
| 1026 | Ga0495625_0025398 | 3300046660 | Bacteria | 4494 |
| 1027 | Ga0495625_0110308 | 3300046660 | Bacteria | 1881 |
| 1028 | Ga0495625_0169738 | 3300046660 | Bacteria | 1457 |
| 1029 | Ga0495625_0294821 | 3300046660 | Bacteria | 1039 |
| 1030 | Ga0495625_0386839 | 3300046660 | Bacteria | 876 |
| 1031 | Ga0495625_0411907 | 3300046660 | Bacteria | 842 |
| 1032 | Ga0495625_0447111 | 3300046660 | Bacteria | 799 |
| 1033 | Ga0495625_0759142 | 3300046660 | Bacteria | 568 |
| 1034 | Ga0495635_0006609 | 3300046663 | Bacteria | 8094 |
| 1035 | Ga0495635_0020293 | 3300046663 | Bacteria | 4630 |
| 1036 | Ga0495635_0241798 | 3300046663 | Bacteria | 1218 |
| 1037 | Ga0495635_0351197 | 3300046663 | Bacteria | 984 |
| 1038 | Ga0495635_0600174 | 3300046663 | Unclassified | 719 |
| 1039 | Ga0495659_0176953 | 3300046664 | Bacteria | 867 |
| 1040 | Ga0495659_0294743 | 3300046664 | Bacteria | 684 |
| 1041 | Ga0495661_0002040 | 3300046665 | Bacteria | 15879 |
| 1042 | Ga0495661_0002400 | 3300046665 | Bacteria | 14464 |
| 1043 | Ga0495661_0008359 | 3300046665 | Bacteria | 7162 |
| 1044 | Ga0495661_0013653 | 3300046665 | Bacteria | 5452 |
| 1045 | Ga0495661_0030978 | 3300046665 | Bacteria | 3401 |
| 1046 | Ga0495661_0053310 | 3300046665 | Bacteria | 2432 |
| 1047 | Ga0495661_0066947 | 3300046665 | Bacteria | 2111 |
| 1048 | Ga0495661_0103416 | 3300046665 | Bacteria | 1598 |
| 1049 | Ga0495588_0045372 | 3300046674 | Bacteria | 2252 |
| 1050 | Ga0495588_0064086 | 3300046674 | Bacteria | 1906 |
| 1051 | Ga0495588_0175820 | 3300046674 | Bacteria | 1131 |
| 1052 | Ga0495588_0189138 | 3300046674 | Bacteria | 1087 |
| 1053 | Ga0495588_0302716 | 3300046674 | Bacteria | 841 |
| 1054 | Ga0495588_0325695 | 3300046674 | Unclassified | 808 |
| 1055 | Ga0495588_0474960 | 3300046674 | Bacteria | 656 |
| 1056 | Ga0495588_0494278 | 3300046674 | Bacteria | 641 |
| 1057 | Ga0495588_0640182 | 3300046674 | Bacteria | 556 |
| 1058 | Ga0495599_0081489 | 3300046678 | Unclassified | 2021 |
| 1059 | Ga0495623_0007763 | 3300046679 | Bacteria | 6972 |
| 1060 | Ga0495623_0142828 | 3300046679 | Bacteria | 1422 |
| 1061 | Ga0495623_0554568 | 3300046679 | Bacteria | 601 |
| 1062 | Ga0495646_0083899 | 3300046680 | Bacteria | 1851 |
| 1063 | Ga0495646_0145809 | 3300046680 | Unclassified | 1320 |
| 1064 | Ga0495647_0054424 | 3300046681 | Bacteria | 1563 |
| 1065 | Ga0495658_0184385 | 3300046683 | Bacteria | 1295 |
| 1066 | Ga0495669_0000062 | 3300046684 | Bacteria | 70803 |
| 1067 | Ga0495669_0137072 | 3300046684 | Bacteria | 1154 |
| 1068 | Ga0495669_0167178 | 3300046684 | Bacteria | 1045 |
| 1069 | Ga0495613_0045553 | 3300046689 | Bacteria | 3243 |
| 1070 | Ga0495613_0123631 | 3300046689 | Bacteria | 1856 |
| 1071 | Ga0495613_0207884 | 3300046689 | Bacteria | 1377 |
| 1072 | Ga0495624_0022904 | 3300046690 | Bacteria | 4122 |
| 1073 | Ga0495624_0063884 | 3300046690 | Bacteria | 2301 |
| 1074 | Ga0495624_0166871 | 3300046690 | Bacteria | 1344 |
| 1075 | Ga0495670_0001891 | 3300046691 | Bacteria | 10317 |
| 1076 | Ga0495670_0005171 | 3300046691 | Bacteria | 6421 |
| 1077 | Ga0495670_0016227 | 3300046691 | Bacteria | 3660 |
| 1078 | Ga0495670_0076623 | 3300046691 | Bacteria | 1699 |
| 1079 | Ga0495670_0303648 | 3300046691 | Bacteria | 855 |
| 1080 | Ga0495670_0350486 | 3300046691 | Bacteria | 794 |
| 1081 | Ga0495671_0020871 | 3300046692 | Bacteria | 3448 |
| 1082 | Ga0495671_0119136 | 3300046692 | Bacteria | 1288 |
| 1083 | Ga0495671_0198487 | 3300046692 | Bacteria | 973 |
| 1084 | Ga0495649_0097556 | 3300046694 | Bacteria | 1563 |
| 1085 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 1086 | Ga0495589_0000265 | 3300046794 | Bacteria | 42827 |
| 1087 | Ga0495589_0004722 | 3300046794 | Bacteria | 7229 |
| 1088 | Ga0495589_0022072 | 3300046794 | Bacteria | 3251 |
| 1089 | Ga0495589_0022653 | 3300046794 | Bacteria | 3204 |
| 1090 | Ga0495589_0038942 | 3300046794 | Bacteria | 2377 |
| 1091 | Ga0495589_0054681 | 3300046794 | Bacteria | 1968 |
| 1092 | Ga0495589_0076983 | 3300046794 | Bacteria | 1625 |
| 1093 | Ga0495589_0080044 | 3300046794 | Bacteria | 1589 |
| 1094 | Ga0495589_0152931 | 3300046794 | Bacteria | 1101 |
| 1095 | Ga0495600_0008649 | 3300046809 | Bacteria | 6263 |
| 1096 | Ga0495600_0027223 | 3300046809 | Bacteria | 3694 |
| 1097 | Ga0495600_0036735 | 3300046809 | Bacteria | 3183 |
| 1098 | Ga0495600_0614316 | 3300046809 | Bacteria | 660 |
| 1099 | Ga0495660_0000354 | 3300046810 | Bacteria | 40565 |
| 1100 | Ga0495660_0002057 | 3300046810 | Bacteria | 13073 |
| 1101 | Ga0495660_0008891 | 3300046810 | Bacteria | 5869 |
| 1102 | Ga0495660_0097749 | 3300046810 | Bacteria | 1515 |
| 1103 | Ga0495660_0099745 | 3300046810 | Bacteria | 1496 |
| 1104 | Ga0495660_0210163 | 3300046810 | Bacteria | 923 |
| 1105 | Ga0495581_0008985 | 3300047315 | Bacteria | 5782 |
| 1106 | Ga0495581_0016928 | 3300047315 | Bacteria | 4236 |
| 1107 | Ga0495581_0043052 | 3300047315 | Bacteria | 2612 |
| 1108 | Ga0495581_0169778 | 3300047315 | Bacteria | 1275 |
| 1109 | Ga0495581_0719232 | 3300047315 | Bacteria | 575 |
| 1110 | Ga0495604_0011342 | 3300047317 | Bacteria | 7072 |
| 1111 | Ga0495604_0102230 | 3300047317 | Bacteria | 2104 |
| 1112 | Ga0495604_0178030 | 3300047317 | Bacteria | 1489 |
| 1113 | Ga0495604_0186383 | 3300047317 | Bacteria | 1448 |
| 1114 | Ga0495636_0167189 | 3300047318 | Bacteria | 993 |
| 1115 | Ga0495636_0659447 | 3300047318 | Bacteria | 514 |
| 1116 | Ga0495674_0028557 | 3300047319 | Bacteria | 5084 |
| 1117 | Ga0495674_0083471 | 3300047319 | Bacteria | 2738 |
| 1118 | Ga0495674_0162200 | 3300047319 | Bacteria | 1870 |
| 1119 | Ga0495674_0415038 | 3300047319 | Bacteria | 1085 |
| 1120 | Ga0495672_0000296 | 3300047320 | Bacteria | 68060 |
| 1121 | Ga0495672_0003026 | 3300047320 | Bacteria | 14783 |
| 1122 | Ga0495672_0004452 | 3300047320 | Bacteria | 11466 |
| 1123 | Ga0495672_0010886 | 3300047320 | Bacteria | 6452 |
| 1124 | Ga0495672_0047594 | 3300047320 | Bacteria | 2549 |
| 1125 | Ga0495676_0000114 | 3300047321 | Bacteria | 61730 |
| 1126 | Ga0495676_0144768 | 3300047321 | Bacteria | 1699 |
| 1127 | Ga0495680_0024292 | 3300047322 | Bacteria | 5029 |
| 1128 | Ga0495680_0123052 | 3300047322 | Bacteria | 1913 |
| 1129 | Ga0495683_0000151 | 3300047323 | Bacteria | 68310 |
| 1130 | Ga0495683_0000783 | 3300047323 | Bacteria | 22706 |
| 1131 | Ga0495683_0058747 | 3300047323 | Bacteria | 1909 |
| 1132 | Ga0495683_0078107 | 3300047323 | Bacteria | 1617 |
| 1133 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 1134 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 1135 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 1136 | Ga0495687_004997 | 3300047443 | Bacteria | 8665 |
| 1137 | Ga0495687_124166 | 3300047443 | Bacteria | 926 |
| 1138 | Ga0495687_176299 | 3300047443 | Bacteria | 702 |
| 1139 | Ga0495675_0021840 | 3300047444 | Bacteria | 4077 |
| 1140 | Ga0495675_0212261 | 3300047444 | Bacteria | 1174 |
| 1141 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 1142 | Ga0495677_0003632 | 3300047445 | Bacteria | 5981 |
| 1143 | Ga0495677_0006321 | 3300047445 | Bacteria | 4475 |
| 1144 | Ga0495677_0012922 | 3300047445 | Bacteria | 3040 |
| 1145 | Ga0495677_0029121 | 3300047445 | Bacteria | 2007 |
| 1146 | Ga0495679_012484 | 3300047446 | Bacteria | 3231 |
| 1147 | Ga0495679_074338 | 3300047446 | Bacteria | 973 |
| 1148 | Ga0495679_098007 | 3300047446 | Bacteria | 816 |
| 1149 | Ga0495685_007399 | 3300047447 | Bacteria | 3623 |
| 1150 | Ga0495685_054110 | 3300047447 | Bacteria | 1358 |
| 1151 | Ga0495685_080198 | 3300047447 | Bacteria | 1087 |
| 1152 | Ga0495685_158216 | 3300047447 | Bacteria | 734 |
| 1153 | Ga0495685_207016 | 3300047447 | Bacteria | 628 |
| 1154 | Ga0495681_0013904 | 3300047470 | Bacteria | 4645 |
| 1155 | Ga0495681_0018418 | 3300047470 | Bacteria | 3847 |
| 1156 | Ga0495681_0053880 | 3300047470 | Bacteria | 1881 |
| 1157 | Ga0495681_0082542 | 3300047470 | Bacteria | 1432 |
| 1158 | Ga0495681_0088444 | 3300047470 | Bacteria | 1371 |
| 1159 | Ga0495681_0221978 | 3300047470 | Bacteria | 757 |
| 1160 | Ga0495684_0041822 | 3300047471 | Bacteria | 3511 |
| 1161 | Ga0495686_0000797 | 3300047472 | Bacteria | 40927 |
| 1162 | Ga0495593_0007642 | 3300047673 | Bacteria | 6314 |
| 1163 | Ga0495593_0052150 | 3300047673 | Bacteria | 2163 |
| 1164 | Ga0495593_0067683 | 3300047673 | Bacteria | 1859 |
| 1165 | Ga0495593_0172516 | 3300047673 | Bacteria | 1090 |
| 1166 | Ga0495593_0264094 | 3300047673 | Bacteria | 861 |
| 1167 | Ga0495602_0020385 | 3300048088 | Bacteria | 6553 |
| 1168 | Ga0495602_0123482 | 3300048088 | Bacteria | 2079 |
| 1169 | Ga0495614_0010515 | 3300048089 | Bacteria | 4081 |
| 1170 | Ga0495614_0013242 | 3300048089 | Bacteria | 3617 |
| 1171 | Ga0495614_0017760 | 3300048089 | Bacteria | 3087 |
| 1172 | Ga0495626_0000103 | 3300048091 | Bacteria | 110163 |
| 1173 | Ga0495626_0002196 | 3300048091 | Bacteria | 14014 |
| 1174 | Ga0495626_0002740 | 3300048091 | Bacteria | 11862 |
| 1175 | Ga0495626_0043676 | 3300048091 | Bacteria | 2101 |
| 1176 | Ga0495626_0044975 | 3300048091 | Bacteria | 2063 |
| 1177 | Ga0495626_0047598 | 3300048091 | Bacteria | 1992 |
| 1178 | Ga0495626_0166905 | 3300048091 | Bacteria | 919 |
| 1179 | Ga0495626_0354504 | 3300048091 | Bacteria | 572 |
| 1180 | Ga0496100_0135118 | 3300048903 | Bacteria | 1741 |
| 1181 | Ga0496100_0249929 | 3300048903 | Bacteria | 1311 |
| 1182 | Ga0496101_0003635 | 3300048904 | Bacteria | 9629 |
| 1183 | Ga0496101_0041474 | 3300048904 | Bacteria | 3282 |
| 1184 | Ga0496101_0690581 | 3300048904 | Bacteria | 806 |
| 1185 | Ga0496102_0000939 | 3300048905 | Bacteria | 27514 |
| 1186 | Ga0496102_0222801 | 3300048905 | Bacteria | 1778 |
| 1187 | Ga0496102_1054810 | 3300048905 | Bacteria | 733 |
| 1188 | Ga0496102_1246871 | 3300048905 | Bacteria | 663 |
| 1189 | Ga0496103_0194271 | 3300048906 | Bacteria | 1305 |
| 1190 | Ga0496103_0474941 | 3300048906 | Bacteria | 801 |
| 1191 | Ga0496103_0515617 | 3300048906 | Bacteria | 764 |
| 1192 | Ga0496103_0601194 | 3300048906 | Bacteria | 701 |
| 1193 | Ga0496104_0005181 | 3300048907 | Bacteria | 11391 |
| 1194 | Ga0496105_0136044 | 3300048908 | Bacteria | 2024 |
| 1195 | Ga0496106_0007554 | 3300048909 | Bacteria | 8042 |
| 1196 | Ga0496106_0282133 | 3300048909 | Bacteria | 1331 |
| 1197 | Ga0496106_0425229 | 3300048909 | Bacteria | 1067 |
| 1198 | Ga0496107_0039446 | 3300048910 | Bacteria | 3388 |
| 1199 | Ga0496109_0125473 | 3300048912 | Bacteria | 2393 |
| 1200 | Ga0496109_0167037 | 3300048912 | Bacteria | 2063 |
| 1201 | Ga0496109_0182761 | 3300048912 | Bacteria | 1970 |
| 1202 | Ga0496109_0739142 | 3300048912 | Bacteria | 922 |
| 1203 | Ga0496110_0102527 | 3300048913 | Bacteria | 2566 |
| 1204 | Ga0496110_0156934 | 3300048913 | Bacteria | 2061 |
| 1205 | Ga0496110_0185775 | 3300048913 | Bacteria | 1887 |
| 1206 | Ga0496110_0950188 | 3300048913 | Bacteria | 766 |
| 1207 | Ga0496111_0423021 | 3300048914 | Bacteria | 984 |
| 1208 | Ga0496111_0797879 | 3300048914 | Bacteria | 683 |
| 1209 | Ga0496112_0003934 | 3300048915 | Bacteria | 12439 |
| 1210 | Ga0496112_0227089 | 3300048915 | Bacteria | 1822 |
| 1211 | Ga0496112_0280272 | 3300048915 | Bacteria | 1614 |
| 1212 | Ga0496112_0300660 | 3300048915 | Bacteria | 1550 |
| 1213 | Ga0496112_0408344 | 3300048915 | Bacteria | 1297 |
| 1214 | Ga0496112_0963591 | 3300048915 | Bacteria | 774 |
| 1215 | Ga0496113_0038902 | 3300048916 | Bacteria | 3499 |
| 1216 | Ga0496113_0336642 | 3300048916 | Bacteria | 1210 |
| 1217 | Ga0496114_0000134 | 3300048917 | Bacteria | 53462 |
| 1218 | Ga0496114_0966575 | 3300048917 | Bacteria | 734 |
| 1219 | Ga0496115_0022204 | 3300048918 | Bacteria | 4914 |
| 1220 | Ga0496115_0110002 | 3300048918 | Bacteria | 2263 |
| 1221 | Ga0496115_0114680 | 3300048918 | Bacteria | 2215 |
| 1222 | Ga0496115_0136155 | 3300048918 | Bacteria | 2025 |
| 1223 | Ga0496115_0288325 | 3300048918 | Bacteria | 1347 |
| 1224 | Ga0496115_0518997 | 3300048918 | Bacteria | 955 |
| 1225 | Ga0496118_0429425 | 3300048921 | Bacteria | 677 |
| 1226 | Ga0496119_0038726 | 3300048922 | Bacteria | 3076 |
| 1227 | Ga0496120_0000863 | 3300048923 | Bacteria | 42869 |
| 1228 | Ga0496120_0034227 | 3300048923 | Bacteria | 3046 |
| 1229 | Ga0496120_0442227 | 3300048923 | Bacteria | 567 |
| 1230 | Ga0496121_0388607 | 3300048924 | Bacteria | 918 |
| 1231 | Ga0496122_0000727 | 3300048925 | Bacteria | 64439 |
| 1232 | Ga0496123_0000791 | 3300048926 | Bacteria | 51059 |
| 1233 | Ga0496123_0443427 | 3300048926 | Bacteria | 580 |
| 1234 | Ga0496124_0000313 | 3300048927 | Bacteria | 89891 |
| 1235 | Ga0496124_0000314 | 3300048927 | Bacteria | 89797 |
| 1236 | Ga0496124_0048155 | 3300048927 | Bacteria | 3644 |
| 1237 | Ga0496124_0104859 | 3300048927 | Bacteria | 2285 |
| 1238 | Ga0496124_0631296 | 3300048927 | Bacteria | 691 |
| 1239 | Ga0496125_0019499 | 3300048928 | Bacteria | 6394 |
| 1240 | Ga0496125_0143910 | 3300048928 | Bacteria | 1652 |
| 1241 | Ga0496125_0304433 | 3300048928 | Bacteria | 975 |
| 1242 | Ga0496125_0749729 | 3300048928 | Bacteria | 512 |
| 1243 | Ga0496126_0337892 | 3300048929 | Bacteria | 1234 |
| 1244 | Ga0495678_004280 | 3300049459 | Bacteria | 8333 |
| 1245 | Ga0495678_004747 | 3300049459 | Bacteria | 7748 |
| 1246 | Ga0495678_035328 | 3300049459 | Bacteria | 2049 |
| 1247 | Ga0495678_215603 | 3300049459 | Bacteria | 585 |
| 1248 | Ga0495682_0003596 | 3300049460 | Bacteria | 6833 |
| 1249 | Ga0495682_0067660 | 3300049460 | Bacteria | 1287 |
| 1250 | Ga0495682_0106446 | 3300049460 | Bacteria | 1005 |
| 1251 | Ga0501320_071114 | 3300049536 | Bacteria | 504 |
| 1252 | Ga0501032_0000117 | 3300049569 | Bacteria | 67270 |
| 1253 | Ga0501032_0006793 | 3300049569 | Bacteria | 8396 |
| 1254 | Ga0501033_0000623 | 3300049570 | Bacteria | 32807 |
| 1255 | Ga0501033_0217104 | 3300049570 | Bacteria | 1362 |
| 1256 | Ga0501034_0000556 | 3300049571 | Bacteria | 59195 |
| 1257 | Ga0501034_0005112 | 3300049571 | Bacteria | 14400 |
| 1258 | Ga0501034_0124643 | 3300049571 | Bacteria | 2562 |
| 1259 | Ga0501034_0922152 | 3300049571 | Bacteria | 760 |
| 1260 | Ga0501036_0000102 | 3300049572 | Bacteria | 53579 |
| 1261 | Ga0501037_0000296 | 3300049573 | Bacteria | 42150 |
| 1262 | Ga0501037_0092362 | 3300049573 | Bacteria | 2189 |
| 1263 | Ga0501038_0003768 | 3300049574 | Bacteria | 14107 |
| 1264 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 1265 | Ga0501039_0538879 | 3300049575 | Unclassified | 916 |
| 1266 | Ga0501039_0725080 | 3300049575 | Bacteria | 777 |
| 1267 | Ga0501039_1004021 | 3300049575 | Bacteria | 648 |
| 1268 | Ga0501040_0000498 | 3300049576 | Bacteria | 23447 |
| 1269 | Ga0501040_0054182 | 3300049576 | Bacteria | 2749 |
| 1270 | Ga0501040_0077549 | 3300049576 | Bacteria | 2299 |
| 1271 | Ga0501040_0755715 | 3300049576 | Bacteria | 703 |
| 1272 | Ga0501041_0125087 | 3300049577 | Bacteria | 1600 |
| 1273 | Ga0501042_0003681 | 3300049578 | Bacteria | 9669 |
| 1274 | Ga0501042_0127956 | 3300049578 | Bacteria | 1829 |
| 1275 | Ga0501043_0000068 | 3300049579 | Bacteria | 93023 |
| 1276 | Ga0501046_0028892 | 3300049580 | Bacteria | 4512 |
| 1277 | Ga0501046_0198412 | 3300049580 | Bacteria | 1494 |
| 1278 | Ga0501046_0216812 | 3300049580 | Bacteria | 1419 |
| 1279 | Ga0501047_0012297 | 3300049581 | Bacteria | 8100 |
| 1280 | Ga0501047_0235955 | 3300049581 | Bacteria | 1681 |
| 1281 | Ga0501047_0428209 | 3300049581 | Bacteria | 1154 |
| 1282 | Ga0501047_0626755 | 3300049581 | Bacteria | 896 |
| 1283 | Ga0501048_0122889 | 3300049582 | Bacteria | 1835 |
| 1284 | Ga0501067_0033268 | 3300049583 | Bacteria | 2861 |
| 1285 | Ga0501067_0292143 | 3300049583 | Bacteria | 907 |
| 1286 | Ga0501068_0849685 | 3300049584 | Bacteria | 600 |
| 1287 | Ga0501069_0000877 | 3300049585 | Bacteria | 14345 |
| 1288 | Ga0501070_0000831 | 3300049586 | Bacteria | 28088 |
| 1289 | Ga0501070_0403017 | 3300049586 | Bacteria | 1106 |
| 1290 | Ga0501070_0524892 | 3300049586 | Bacteria | 950 |
| 1291 | Ga0501072_0051143 | 3300049588 | Bacteria | 3254 |
| 1292 | Ga0501073_0003992 | 3300049589 | Bacteria | 11079 |
| 1293 | Ga0501074_0049521 | 3300049590 | Bacteria | 3033 |
| 1294 | Ga0501075_0507878 | 3300049591 | Bacteria | 920 |
| 1295 | Ga0501076_0155238 | 3300049592 | Bacteria | 1863 |
| 1296 | Ga0501076_1288561 | 3300049592 | Bacteria | 601 |
| 1297 | Ga0501235_220994 | 3300049669 | Unclassified | 520 |
| 1298 | Ga0501079_0015904 | 3300049741 | Bacteria | 5751 |
| 1299 | Ga0501079_0630421 | 3300049741 | Bacteria | 844 |
| 1300 | Ga0501079_0791288 | 3300049741 | Bacteria | 747 |
| 1301 | Ga0501079_0891070 | 3300049741 | Bacteria | 701 |
| 1302 | Ga0501080_0012533 | 3300049742 | Bacteria | 7775 |
| 1303 | Ga0501081_0122066 | 3300049743 | Bacteria | 1857 |
| 1304 | Ga0501083_0004385 | 3300049744 | Bacteria | 9949 |
| 1305 | Ga0501035_0000032 | 3300049822 | Bacteria | 175435 |
| 1306 | Ga0501035_0013083 | 3300049822 | Bacteria | 7658 |
| 1307 | Ga0501035_0468159 | 3300049822 | Bacteria | 1041 |
| 1308 | Ga0501044_0081509 | 3300049823 | Bacteria | 3275 |
| 1309 | Ga0501044_0254919 | 3300049823 | Bacteria | 1694 |
| 1310 | Ga0501044_0570042 | 3300049823 | Bacteria | 1027 |
| 1311 | Ga0501045_0452317 | 3300049824 | Bacteria | 955 |
| 1312 | nmdc:mga03683_153934_c1 | 3300050489 | Bacteria | 1039 |
| 1313 | nmdc:mga03683_181958_c1 | 3300050489 | Bacteria | 959 |
| 1314 | nmdc:mga03n38_196633_c1 | 3300050490 | Bacteria | 1041 |
| 1315 | nmdc:mga03n38_203557_c1 | 3300050490 | Bacteria | 1026 |
| 1316 | nmdc:mga03n38_71205_c1 | 3300050490 | Bacteria | 1610 |
| 1317 | nmdc:mga03n38_960649_c1 | 3300050490 | Bacteria | 505 |
| 1318 | nmdc:mga00v17_136978_c1 | 3300050491 | Bacteria | 1568 |
| 1319 | nmdc:mga00v17_180199_c1 | 3300050491 | Bacteria | 1363 |
| 1320 | nmdc:mga00v17_531685_c1 | 3300050491 | Bacteria | 761 |
| 1321 | nmdc:mga00v17_538272_c1 | 3300050491 | Bacteria | 756 |
| 1322 | nmdc:mga0yw44_100254_c1 | 3300050492 | Bacteria | 1844 |
| 1323 | nmdc:mga0yw44_1146_c1 | 3300050492 | Bacteria | 10266 |
| 1324 | nmdc:mga0yw44_223453_c1 | 3300050492 | Bacteria | 1249 |
| 1325 | nmdc:mga0yw44_328994_c1 | 3300050492 | Bacteria | 1027 |
| 1326 | nmdc:mga0yw44_43625_c1 | 3300050492 | Bacteria | 2678 |
| 1327 | nmdc:mga0yw44_83422_c1 | 3300050492 | Bacteria | 2007 |
| 1328 | nmdc:mga0yw44_972727_c1 | 3300050492 | Bacteria | 575 |
| 1329 | nmdc:mga0k408_109436_c1 | 3300050493 | Bacteria | 1633 |
| 1330 | nmdc:mga0k408_133169_c1 | 3300050493 | Bacteria | 1476 |
| 1331 | nmdc:mga0k408_499912_c1 | 3300050493 | Bacteria | 720 |
| 1332 | nmdc:mga0k408_881944_c1 | 3300050493 | Bacteria | 519 |
| 1333 | nmdc:mga06z11_135991_c1 | 3300050494 | Bacteria | 1385 |
| 1334 | nmdc:mga06z11_143135_c1 | 3300050494 | Bacteria | 1353 |
| 1335 | nmdc:mga06z11_149909_c1 | 3300050494 | Bacteria | 1325 |
| 1336 | nmdc:mga06z11_6352_c1 | 3300050494 | Bacteria | 4800 |
| 1337 | nmdc:mga04h51_116979_c1 | 3300050495 | Bacteria | 989 |
| 1338 | nmdc:mga04h51_241241_c1 | 3300050495 | Bacteria | 722 |
| 1339 | nmdc:mga04h51_309069_c1 | 3300050495 | Bacteria | 646 |
| 1340 | nmdc:mga04h51_350908_c1 | 3300050495 | Bacteria | 610 |
| 1341 | nmdc:mga04h51_62207_c1 | 3300050495 | Bacteria | 1282 |
| 1342 | nmdc:mga07m45_308232_c1 | 3300050496 | Bacteria | 921 |
| 1343 | nmdc:mga07m45_369704_c1 | 3300050496 | Bacteria | 833 |
| 1344 | nmdc:mga07m45_43067_c1 | 3300050496 | Bacteria | 2531 |
| 1345 | nmdc:mga07m45_623799_c1 | 3300050496 | Bacteria | 622 |
| 1346 | nmdc:mga06r32_201443_c1 | 3300050510 | Bacteria | 1978 |
| 1347 | nmdc:mga08y16_12_c1 | 3300050511 | Bacteria | 438455 |
| 1348 | nmdc:mga08y16_148583_c1 | 3300050511 | Bacteria | 2436 |
| 1349 | nmdc:mga08y16_858433_c1 | 3300050511 | Unclassified | 896 |
| 1350 | nmdc:mga0n895_213386_c1 | 3300050512 | Bacteria | 1960 |
| 1351 | nmdc:mga0rr50_1022361_c1 | 3300050513 | Bacteria | 704 |
| 1352 | nmdc:mga0rr50_1511783_c1 | 3300050513 | Bacteria | 567 |
| 1353 | nmdc:mga0rr50_356859_c1 | 3300050513 | Bacteria | 1230 |
| 1354 | nmdc:mga0rr50_398223_c1 | 3300050513 | Bacteria | 1163 |
| 1355 | nmdc:mga08x19_117937_c1 | 3300050514 | Bacteria | 1776 |
| 1356 | nmdc:mga0a205_290952_c1 | 3300050515 | Bacteria | 1508 |
| 1357 | nmdc:mga0a205_62875_c1 | 3300050515 | Bacteria | 3586 |
| 1358 | nmdc:mga0sz30_110001_c1 | 3300050516 | Bacteria | 1207 |
| 1359 | nmdc:mga0sz30_140867_c1 | 3300050516 | Bacteria | 1065 |
| 1360 | nmdc:mga0sz30_41551_c1 | 3300050516 | Bacteria | 1933 |
| 1361 | Ga0495601_0083953 | 3300053077 | Bacteria | 2046 |
| 1362 | Ga0495601_0316216 | 3300053077 | Bacteria | 1017 |
| 1363 | Ga0495601_0582321 | 3300053077 | Bacteria | 719 |
| 1364 | Ga0495655_0251909 | 3300053083 | Bacteria | 594 |
| 1365 | Ga0495595_0240802 | 3300053084 | Bacteria | 905 |
| 1366 | Ga0495619_0032650 | 3300053085 | Bacteria | 3378 |
| 1367 | Ga0500644_0036255 | 3300053088 | Bacteria | 1604 |
| 1368 | Ga0500650_0443934 | 3300053098 | Bacteria | 557 |
| 1369 | Ga0500595_011249 | 3300053119 | Bacteria | 3513 |
| 1370 | Ga0500595_080771 | 3300053119 | Bacteria | 952 |
| 1371 | Ga0500628_061402 | 3300053129 | Bacteria | 919 |
| 1372 | Ga0500642_0148074 | 3300053130 | Bacteria | 1102 |
| 1373 | Ga0500588_0000160 | 3300053146 | Bacteria | 8978 |
| 1374 | Ga0501084_0285955 | 3300054114 | Bacteria | 1392 |
| 1375 | Ga0590075_079850 | 3300059424 | Unclassified | 847 |
| 1376 | Ga0587082_123775 | 3300059504 | Bacteria | 587 |
| 1377 | Ga0587083_0106630 | 3300059505 | Bacteria | 706 |
| 1378 | Ga0587088_009150 | 3300059508 | Bacteria | 1419 |
| 1379 | Ga0587088_160033 | 3300059508 | Bacteria | 551 |
| 1380 | Ga0587062_017899 | 3300059639 | Bacteria | 974 |
| 1381 | Ga0587067_021806 | 3300059640 | Bacteria | 1109 |
| 1382 | Ga0587069_060719 | 3300059642 | Bacteria | 696 |
| 1383 | Ga0587072_046400 | 3300059643 | Bacteria | 859 |
| 1384 | Ga0587075_015894 | 3300059644 | Bacteria | 1064 |
| 1385 | Ga0587104_004120 | 3300059650 | Bacteria | 919 |
| 1386 | Ga0587105_002691 | 3300059651 | Bacteria | 1030 |
| 1387 | Ga0587107_045183 | 3300059652 | Bacteria | 727 |
| 1388 | Ga0587124_006915 | 3300059660 | Bacteria | 944 |
| 1389 | Ga0587071_038705 | 3300060344 | Bacteria | 948 |
| 1390 | Ga0587071_133895 | 3300060344 | Bacteria | 603 |
| 1391 | Ga0587111_0102544 | 3300060346 | Bacteria | 715 |
| 1392 | Ga0501082_1842569 | 3300060353 | Bacteria | 528 |
| 1393 | 2509373386 | 2509276018 | Bacteria | 6910194 |
| 1394 | 2510285363 | 2510065053 | Bacteria | 5005518 |
| 1395 | 2510311375 | 2510065058 | Bacteria | 5005894 |
| 1396 | 2510317604 | 2510065059 | Bacteria | 6847884 |
| 1397 | 2512930985 | 2512875016 | Bacteria | 6529530 |
| 1398 | 2512958717 | 2512875024 | Bacteria | 7195110 |
| 1399 | 2513611068 | 2513237090 | Bacteria | 7096802 |
| 1400 | 2514034868 | 2513237164 | Bacteria | 7563725 |
| 1401 | 2514418508 | 2513237305 | Bacteria | 7293571 |
| 1402 | 2548847635 | 2547132512 | Bacteria | 3416496 |
| 1403 | 2588516674 | 2588253730 | Bacteria | 6881675 |
| 1404 | 2599940448 | 2599185301 | Bacteria | 6161860 |
| 1405 | 2643799876 | 2643221556 | Bacteria | 7251154 |
| 1406 | 2643840504 | 2643221564 | Bacteria | 4193379 |
| 1407 | 2643989283 | 2643221595 | Bacteria | 6565519 |
| 1408 | 2644152856 | 2643221627 | Bacteria | 6761570 |
| 1409 | 2644474876 | 2643221684 | Bacteria | 7145183 |
| 1410 | 2688599534 | 2687453392 | Bacteria | 6880454 |
| 1411 | 2694629732 | 2693429783 | Bacteria | 7019804 |
| 1412 | 2694636395 | 2693429784 | Bacteria | 7241525 |
| 1413 | 2723575872 | 2721755686 | Bacteria | 7343952 |
| 1414 | 2729146746 | 2728369097 | Bacteria | 4333476 |
| 1415 | 2756677250 | 2756170246 | Bacteria | 7451806 |
| 1416 | 2774129613 | 2773857672 | Bacteria | 4993178 |
| 1417 | 2792749867 | 2791355123 | Bacteria | 8049106 |
| 1418 | 2795786503 | 2795385470 | Bacteria | 8317180 |
| 1419 | 2809146783 | 2808606418 | Bacteria | 6724496 |
| 1420 | 2828306718 | 2828305725 | Bacteria | 4916900 |
| 1421 | 2838056618 | 2838054893 | Bacteria | 7451788 |
| 1422 | 2844006330 | 2844002411 | Bacteria | 7168230 |
| 1423 | 2844014809 | 2844009547 | Bacteria | 6728125 |
| 1424 | 2847676065 | 2847670302 | Bacteria | 6165597 |
| 1425 | 2847692707 | 2847686936 | Bacteria | 6278406 |
| 1426 | 2856315852 | 2856314179 | Bacteria | 6477897 |
| 1427 | 2856334052 | 2856328259 | Bacteria | 6528202 |
| 1428 | 2856341279 | 2856334872 | Bacteria | 7037011 |
| 1429 | 2856355262 | 2856349417 | Bacteria | 6230045 |
| 1430 | 2856361103 | 2856356410 | Bacteria | 6297484 |
| 1431 | 2856370624 | 2856364286 | Bacteria | 6939991 |
| 1432 | 2857350544 | 2857349434 | Bacteria | 7926032 |
| 1433 | 2857372817 | 2857367948 | Bacteria | 6965560 |
| 1434 | 2869171425 | 2869169390 | Bacteria | 6659796 |
| 1435 | 2869235123 | 2869234852 | Bacteria | 6654993 |
| 1436 | 2869248067 | 2869242130 | Bacteria | 6609239 |
| 1437 | 2869251384 | 2869249662 | Bacteria | 6868783 |
| 1438 | 2869260540 | 2869256925 | Bacteria | 6981691 |
| 1439 | 2869267095 | 2869264136 | Bacteria | 6880765 |
| 1440 | 2869274911 | 2869271264 | Bacteria | 6908218 |
| 1441 | 2869291648 | 2869285874 | Bacteria | 6901219 |
| 1442 | 2871434858 | 2871429161 | Bacteria | 6547891 |
| 1443 | 2871443414 | 2871435913 | Bacteria | 6880295 |
| 1444 | 2871447774 | 2871444079 | Bacteria | 6423508 |
| 1445 | 2871452772 | 2871451962 | Bacteria | 7336357 |
| 1446 | 2871460495 | 2871459585 | Bacteria | 6866887 |
| 1447 | 2871470858 | 2871466892 | Bacteria | 6923287 |
| 1448 | 2871487103 | 2871481445 | Bacteria | 6700002 |
| 1449 | 2871495481 | 2871488783 | Bacteria | 6929816 |
| 1450 | 2871502751 | 2871495908 | Bacteria | 6935695 |
| 1451 | 2874103897 | 2874102143 | Bacteria | 6342645 |
| 1452 | 2874110085 | 2874109183 | Bacteria | 6517025 |
| 1453 | 2874119714 | 2874116593 | Bacteria | 6674494 |
| 1454 | 2874130979 | 2874123672 | Bacteria | 7238285 |
| 1455 | 2874135031 | 2874131515 | Bacteria | 6820270 |
| 1456 | 2874149247 | 2874146452 | Bacteria | 7533118 |
| 1457 | 2874157512 | 2874155637 | Bacteria | 6724144 |
| 1458 | 2874165530 | 2874162495 | Bacteria | 6174670 |
| 1459 | 2874176099 | 2874168670 | Bacteria | 8062617 |
| 1460 | 2876365864 | 2876363079 | Bacteria | 6544991 |
| 1461 | 2876377563 | 2876369609 | Bacteria | 6807521 |
| 1462 | 2876384737 | 2876377896 | Bacteria | 6565995 |
| 1463 | 2876391667 | 2876386047 | Bacteria | 6698674 |
| 1464 | 2876394713 | 2876392853 | Bacteria | 6660880 |
| 1465 | 2876402210 | 2876399893 | Bacteria | 6927900 |
| 1466 | 2876413579 | 2876406927 | Bacteria | 6191900 |
| 1467 | 2876415714 | 2876413966 | Bacteria | 6831344 |
| 1468 | 2876425035 | 2876420981 | Bacteria | 6687741 |
| 1469 | 2878040120 | 2878035449 | Bacteria | 6555736 |
| 1470 | 2878733601 | 2878730984 | Bacteria | 6380721 |
| 1471 | 2878751992 | 2878745973 | Bacteria | 6867388 |
| 1472 | 2878757895 | 2878753008 | Bacteria | 6922523 |
| 1473 | 2878766643 | 2878760144 | Bacteria | 6823465 |
| 1474 | 2878773840 | 2878767105 | Bacteria | 6898628 |
| 1475 | 2878775418 | 2878774303 | Bacteria | 6108671 |
| 1476 | 2878783977 | 2878781027 | Bacteria | 6834456 |
| 1477 | 2881152065 | 2881147464 | Bacteria | 7779814 |
| 1478 | 2881155787 | 2881155292 | Bacteria | 6461656 |
| 1479 | 2881168042 | 2881161766 | Bacteria | 7127907 |
| 1480 | 2881850866 | 2881845957 | Bacteria | 6611900 |
| 1481 | 2881860291 | 2881853255 | Bacteria | 6698367 |
| 1482 | 2881867465 | 2881861095 | Bacteria | 7128710 |
| 1483 | 2882637090 | 2882632389 | Bacteria | 8154593 |
| 1484 | 2882916591 | 2882912400 | Bacteria | 6801539 |
| 1485 | 2885309926 | 2885305155 | Bacteria | 7348390 |
| 1486 | 2885317012 | 2885312484 | Bacteria | 6415165 |
| 1487 | 2885324934 | 2885318864 | Bacteria | 6729568 |
| 1488 | 2885326933 | 2885326080 | Bacteria | 7134805 |
| 1489 | 2885336051 | 2885334103 | Bacteria | 7216818 |
| 1490 | 2885350497 | 2885342637 | Bacteria | 7011821 |
| 1491 | 2885352730 | 2885350715 | Bacteria | 6787678 |
| 1492 | 2888356291 | 2888350351 | Bacteria | 7372807 |
| 1493 | 2889011215 | 2889010040 | Bacteria | 6749192 |
| 1494 | 2889017060 | 2889016732 | Bacteria | 6700763 |
| 1495 | 2894657464 | 2894652903 | Bacteria | 4587256 |
| 1496 | 2903493449 | 2903492973 | Bacteria | 13473544 |
| 1497 | 2903506641 | 2903492973 | Bacteria | 13473544 |
| 1498 | 2903517332 | 2903513507 | Bacteria | 6344008 |
| 1499 | 2903523812 | 2903521522 | Bacteria | 6525694 |
| 1500 | 2903534327 | 2903528002 | Bacteria | 6586099 |
| 1501 | 2903547890 | 2903540706 | Bacteria | 7062119 |
| 1502 | 2904661345 | 2904659560 | Bacteria | 6685615 |
| 1503 | 2906314386 | 2906308376 | Bacteria | 6841989 |
| 1504 | 2906327555 | 2906321335 | Bacteria | 6579571 |
| 1505 | 2906329410 | 2906328253 | Bacteria | 6585166 |
| 1506 | 2906355938 | 2906354277 | Bacteria | 6991324 |
| 1507 | 2906369130 | 2906363423 | Bacteria | 6856682 |
| 1508 | 2906376577 | 2906370794 | Bacteria | 6881062 |
| 1509 | 2906380163 | 2906378014 | Bacteria | 6911440 |
| 1510 | 2906387057 | 2906386501 | Bacteria | 5977019 |
| 1511 | 2906395976 | 2906393657 | Bacteria | 6790866 |
| 1512 | 2906407137 | 2906401398 | Bacteria | 6693206 |
| 1513 | 2906410659 | 2906408224 | Bacteria | 6162342 |
| 1514 | 2906415989 | 2906414383 | Bacteria | 6580790 |
| 1515 | 2906432640 | 2906427513 | Bacteria | 6375796 |
| 1516 | 2917834581 | 2917832318 | Bacteria | 5346010 |
| 1517 | 2919127225 | 2919125081 | Bacteria | 5385106 |
| 1518 | 2919406581 | 2919404418 | Bacteria | 4232372 |
| 1519 | 2922131987 | 2922130491 | Bacteria | 7173936 |
| 1520 | 2922152585 | 2922151315 | Bacteria | 6902399 |
| 1521 | 2922160098 | 2922158528 | Bacteria | 6573167 |
| 1522 | 2922175959 | 2922172374 | Bacteria | 6167644 |
| 1523 | 2922191098 | 2922185730 | Bacteria | 7113964 |
| 1524 | 2924711439 | 2924710171 | Bacteria | 6752351 |
| 1525 | 2924728055 | 2924726620 | Bacteria | 6271473 |
| 1526 | 2924744929 | 2924741084 | Bacteria | 6661321 |
| 1527 | 2924750967 | 2924748358 | Bacteria | 6154725 |
| 1528 | 2924766926 | 2924762789 | Bacteria | 6561353 |
| 1529 | 2924784609 | 2924784321 | Bacteria | 7416538 |
| 1530 | 2937816310 | 2937813078 | Bacteria | 7783518 |
| 1531 | 2937854970 | 2937848649 | Bacteria | 6983481 |
| 1532 | 2937865365 | 2937861824 | Bacteria | 6660327 |
| 1533 | 2937870369 | 2937868953 | Bacteria | 6639878 |
| 1534 | 2937896728 | 2937891427 | Bacteria | 6357007 |
| 1535 | 2937985532 | 2937980651 | Bacteria | 6517427 |
| 1536 | 2938001768 | 2937994558 | Bacteria | 7036190 |
| 1537 | 2938015808 | 2938014810 | Bacteria | 6700592 |
| 1538 | 2958103020 | 2958100919 | Bacteria | 6800575 |
| 1539 | 2958111112 | 2958108152 | Bacteria | 6681128 |
| 1540 | 2958118901 | 2958115193 | Bacteria | 6923548 |
| 1541 | 2958124321 | 2958122699 | Bacteria | 7280457 |
| 1542 | 2958136048 | 2958130278 | Bacteria | 6897202 |
| 1543 | 2958140455 | 2958137437 | Bacteria | 6050276 |
| 1544 | 2958159728 | 2958158011 | Bacteria | 6058449 |
| 1545 | 2958171823 | 2958165035 | Bacteria | 6906348 |
| 1546 | 2958174434 | 2958172287 | Bacteria | 6716688 |
| 1547 | 2958185515 | 2958179912 | Bacteria | 6874908 |
| 1548 | 2961083893 | 2961077736 | Bacteria | 7079850 |
| 1549 | 2961116499 | 2961114664 | Bacteria | 6680456 |
| 1550 | 2961135427 | 2961127735 | Bacteria | 7196641 |
| 1551 | 2961141554 | 2961136820 | Bacteria | 6775228 |
| 1552 | 2961170269 | 2961163497 | Bacteria | 6901077 |
| 1553 | 2961174439 | 2961170736 | Bacteria | 7072258 |
| 1554 | 2961190131 | 2961183825 | Bacteria | 6688536 |
| 1555 | 2963648239 | 2963644680 | Bacteria | 6530403 |
| 1556 | 2965025015 | 2965018300 | Bacteria | 6883036 |
| 1557 | 2965027771 | 2965025482 | Bacteria | 6532201 |
| 1558 | 2965035252 | 2965032056 | Bacteria | 6887443 |
| 1559 | 2965041277 | 2965040258 | Bacteria | 6855979 |
| 1560 | 2965051594 | 2965047637 | Bacteria | 6623551 |
| 1561 | 2965069091 | 2965062239 | Bacteria | 7412989 |
| 1562 | 2965096148 | 2965089291 | Bacteria | 6866420 |
| 1563 | 2965108067 | 2965102966 | Bacteria | 6800987 |
| 1564 | 2965123722 | 2965119406 | Bacteria | 6956431 |
| 1565 | 2968000430 | 2967996073 | Bacteria | 6787468 |
| 1566 | 2968003659 | 2968003550 | Bacteria | 6929263 |
| 1567 | 2968095824 | 2968091066 | Bacteria | 6052692 |
| 1568 | 2968101049 | 2968097103 | Bacteria | 6107094 |
| 1569 | 2968112405 | 2968110612 | Bacteria | 6814636 |
| 1570 | 2968121200 | 2968117919 | Bacteria | 6536078 |
| 1571 | 2968132773 | 2968128360 | Bacteria | 6270294 |
| 1572 | 2968146124 | 2968138860 | Bacteria | 6605449 |
| 1573 | 2968178656 | 2968171901 | Bacteria | 6894245 |
| 1574 | 2970490220 | 2970489779 | Bacteria | 6517260 |
| 1575 | 2970507026 | 2970503327 | Bacteria | 7099517 |
| 1576 | 2970513035 | 2970510686 | Bacteria | 7006402 |
| 1577 | 2970533245 | 2970532167 | Bacteria | 6553173 |
| 1578 | 2970549423 | 2970547951 | Bacteria | 6931819 |
| 1579 | 2970561501 | 2970554993 | Bacteria | 6814252 |
| 1580 | 2970626669 | 2970619444 | Bacteria | 6986144 |
| 1581 | 2970633751 | 2970627176 | Bacteria | 6680862 |
| 1582 | 2974301986 | 2974298342 | Bacteria | 4840922 |
| 1583 | 2977822428 | 2977821940 | Bacteria | 6906439 |
| 1584 | 2977833098 | 2977828996 | Bacteria | 7007971 |
| 1585 | 2977846544 | 2977843712 | Bacteria | 6753583 |
| 1586 | 2977855462 | 2977851361 | Bacteria | 6694324 |
| 1587 | 2977861521 | 2977858184 | Bacteria | 6215359 |
| 1588 | 2977865750 | 2977864932 | Bacteria | 7534097 |
| 1589 | 2977876214 | 2977872689 | Bacteria | 7270173 |
| 1590 | 2977907042 | 2977898635 | Bacteria | 6675551 |
| 1591 | 2977908240 | 2977907340 | Bacteria | 6577984 |
| 1592 | 2977922223 | 2977915119 | Bacteria | 6829656 |
| 1593 | 2977929359 | 2977922695 | Bacteria | 6956781 |
| 1594 | 2977936874 | 2977935797 | Bacteria | 6252826 |
| 1595 | 2977947744 | 2977942078 | Bacteria | 7570577 |
| 1596 | 2977955493 | 2977950692 | Bacteria | 6893264 |
| 1597 | 2977962774 | 2977957713 | Bacteria | 6877875 |
| 1598 | 2977972123 | 2977971508 | Bacteria | 7472917 |
| 1599 | 2977992801 | 2977986579 | Bacteria | 6581278 |
| 1600 | 2979714445 | 2979710463 | Bacteria | 6785254 |
| 1601 | 2979747397 | 2979742915 | Bacteria | 7301278 |
| 1602 | 2979766569 | 2979764755 | Bacteria | 6610066 |
| 1603 | 2979776549 | 2979772303 | Bacteria | 6618277 |
| 1604 | 2979784568 | 2979779861 | Bacteria | 6219781 |
| 1605 | 2979800424 | 2979793036 | Bacteria | 6808957 |
| 1606 | 2979812221 | 2979808191 | Bacteria | 7179355 |
| 1607 | 2984500446 | 2984499530 | Bacteria | 5020881 |
| 1608 | 2984506959 | 2984504281 | Bacteria | 5262371 |
| 1609 | 2987637728 | 2987636660 | Bacteria | 8088555 |
| 1610 | 2987646190 | 2987645492 | Bacteria | 6117018 |
| 1611 | 2987652794 | 2987652177 | Bacteria | 6969023 |
| 1612 | 2987666510 | 2987659509 | Bacteria | 6966464 |
| 1613 | 2987668733 | 2987666974 | Bacteria | 6509233 |
| 1614 | 2987679705 | 2987673487 | Bacteria | 6884027 |
| 1615 | 2996341117 | 2996336353 | Bacteria | 5511628 |
| 1616 | 2996346655 | 2996341866 | Bacteria | 6643098 |
| 1617 | 2996393026 | 2996386984 | Bacteria | 6978667 |
| 1618 | 3000140075 | 3000135777 | Bacteria | 6891109 |
| 1619 | 3003933593 | 3003930520 | Bacteria | 5667563 |
| 1620 | 3004195512 | 3004188549 | Bacteria | 6952365 |
| 1621 | 3004197669 | 3004195979 | Bacteria | 6776956 |
| 1622 | 3004205950 | 3004203850 | Bacteria | 7307914 |
| 1623 | 3004211783 | 3004211236 | Bacteria | 7417683 |
| 1624 | 3004219030 | 3004218560 | Bacteria | 7421728 |
| 1625 | 3004235852 | 3004232784 | Bacteria | 6662140 |
| 1626 | 3004241752 | 3004239961 | Bacteria | 6892290 |
| 1627 | 3004251017 | 3004248173 | Bacteria | 6563236 |
| 1628 | 3004274626 | 3004268573 | Bacteria | 7043476 |
| 1629 | 637074027 | 637000159 | Bacteria | 7596297 |
| 1630 | 649874037 | 649633066 | Bacteria | 6690028 |
| 1631 | 8004302354 | 8004300914 | Bacteria | 6132239 |
| 1632 | 8004365256 | 8004361976 | Bacteria | 6858373 |
| 1633 | 8004379407 | 8004374579 | Bacteria | 6898112 |
| 1634 | 8004394625 | 8004387939 | Bacteria | 7049250 |
| 1635 | 8004447623 | 8004445564 | Bacteria | 6322258 |
| 1636 | 8004640217 | 8004640170 | Bacteria | 6723001 |
| 1637 | 8004702278 | 8004695233 | Bacteria | 6731676 |
| 1638 | 8004709803 | 8004703790 | Bacteria | 8006957 |
| 1639 | 8004720649 | 8004714634 | Bacteria | 6776161 |
| 1640 | 8004728410 | 8004727605 | Bacteria | 6643904 |
| 1641 | 8016730978 | 8016728285 | Bacteria | 5263933 |
| 1642 | 8047673274 | 8047673197 | Bacteria | 7395230 |
| 1643 | Ga0207690_10259749 | |||
| 1644 | JGI24736J21556_1065209 | |||
| 1645 | JGI24740J21852_10008429 | |||
| 1646 | JGI24739J22299_10038979 | |||
| 1647 | JGI24739J22299_10136143 | |||
| 1648 | JGI24735J21928_10043246 | |||
| 1649 | JGI25157J39369_1000145 | |||
| 1650 | JGI25157J39369_1000826 | |||
| 1651 | JGI25151J46595_10000186 | |||
| 1652 | JGI25406J46586_10046782 | |||
| 1653 | JGI25406J46586_10060919 | |||
| 1654 | JGI25406J46586_10094540 | |||
| 1655 | JGI25165J46597_1000325 | |||
| 1656 | JGI25153J46596_10044278 | |||
| 1657 | rootL2_10273037 | |||
| 1658 | Ga0007410J51695_1030494 | |||
| 1659 | Ga0006562J51391_1057637 | |||
| 1660 | Ga0055539_1001430 | |||
| 1661 | Ga0055533_1001807 | |||
| 1662 | Ga0055527_1000043 | |||
| 1663 | Ga0055535_1000071 | |||
| 1664 | Ga0055542_1000096 | |||
| 1665 | Ga0055542_1000553 | |||
| 1666 | Ga0055529_1000114 | |||
| 1667 | Ga0055529_1003236 | |||
| 1668 | JGI25405J52794_10001981 | |||
| 1669 | Ga0065165_1002388 | |||
| 1670 | Ga0065714_10076975 | |||
| 1671 | Ga0065712_10089189 | |||
| 1672 | Ga0065712_10666360 | |||
| 1673 | Ga0065715_10557850 | |||
| 1674 | Ga0065715_11025097 | |||
| 1675 | Ga0065707_10087092 | |||
| 1676 | Ga0065707_10299477 | |||
| 1677 | Ga0065707_10537776 | |||
| 1678 | Ga0070658_10299601 | |||
| 1679 | Ga0070658_10727889 | |||
| 1680 | Ga0070658_11568455 | |||
| 1681 | Ga0070676_10099429 | |||
| 1682 | Ga0070676_10329302 | |||
| 1683 | Ga0070683_100309720 | |||
| 1684 | Ga0070690_100002820 | |||
| 1685 | Ga0070690_100134428 | |||
| 1686 | Ga0070670_100058784 | |||
| 1687 | Ga0070670_101114720 | |||
| 1688 | Ga0070677_10180825 | |||
| 1689 | Ga0068869_100028475 | |||
| 1690 | Ga0068869_100036100 | |||
| 1691 | Ga0068869_100241015 | |||
| 1692 | Ga0070666_10044125 | |||
| 1693 | Ga0070680_100000436 | |||
| 1694 | Ga0070680_100339878 | |||
| 1695 | Ga0070682_100727644 | |||
| 1696 | Ga0068868_100050486 | |||
| 1697 | Ga0068868_100052894 | |||
| 1698 | Ga0068868_100115865 | |||
| 1699 | Ga0068868_100301872 | |||
| 1700 | Ga0070660_100268695 | |||
| 1701 | Ga0070689_100012027 | |||
| 1702 | Ga0070689_100790291 | |||
| 1703 | Ga0070691_10214210 | |||
| 1704 | Ga0070691_10633740 | |||
| 1705 | Ga0070687_100073332 | |||
| 1706 | Ga0070687_100122652 | |||
| 1707 | Ga0070687_100205813 | |||
| 1708 | Ga0070687_100513490 | |||
| 1709 | Ga0070661_100029628 | |||
| 1710 | Ga0070661_100494998 | |||
| 1711 | Ga0070661_101247165 | |||
| 1712 | Ga0070692_10026902 | |||
| 1713 | Ga0070669_100549427 | |||
| 1714 | Ga0070669_101526777 | |||
| 1715 | Ga0070675_100588158 | |||
| 1716 | Ga0070675_101070427 | |||
| 1717 | Ga0070671_100007704 | |||
| 1718 | Ga0070671_100211677 | |||
| 1719 | Ga0070674_100437962 | |||
| 1720 | Ga0070673_100001822 | |||
| 1721 | Ga0070673_100605258 | |||
| 1722 | Ga0070673_100877423 | |||
| 1723 | Ga0070688_100002648 | |||
| 1724 | Ga0070659_100262714 | |||
| 1725 | Ga0070659_102074733 | |||
| 1726 | Ga0070667_100032425 | |||
| 1727 | Ga0070667_101391840 | |||
| 1728 | Ga0070667_101665986 | |||
| 1729 | Ga0070709_10100469 | |||
| 1730 | Ga0070714_100102313 | |||
| 1731 | Ga0070714_100178254 | |||
| 1732 | Ga0070714_100292931 | |||
| 1733 | Ga0070713_100012514 | |||
| 1734 | Ga0070713_100039298 | |||
| 1735 | Ga0070713_100193517 | |||
| 1736 | Ga0070713_101044345 | |||
| 1737 | Ga0070710_10013019 | |||
| 1738 | Ga0070710_10036502 | |||
| 1739 | Ga0070701_10002995 | |||
| 1740 | Ga0070701_10064909 | |||
| 1741 | Ga0070701_10296987 | |||
| 1742 | Ga0070711_100005477 | |||
| 1743 | Ga0070705_100039297 | |||
| 1744 | Ga0070705_100163135 | |||
| 1745 | Ga0070705_100468162 | |||
| 1746 | Ga0070705_101828626 | |||
| 1747 | Ga0070700_100296811 | |||
| 1748 | Ga0070694_100071045 | |||
| 1749 | Ga0070694_100103302 | |||
| 1750 | Ga0070694_100151881 | |||
| 1751 | Ga0070694_100202692 | |||
| 1752 | Ga0070694_100217262 | |||
| 1753 | Ga0070694_101429228 | |||
| 1754 | Ga0070708_100007993 | |||
| 1755 | Ga0070708_100129914 | |||
| 1756 | Ga0070708_100240409 | |||
| 1757 | Ga0070708_100329407 | |||
| 1758 | Ga0070663_100359443 | |||
| 1759 | Ga0070663_100398405 | |||
| 1760 | Ga0070663_101752934 | |||
| 1761 | Ga0070678_100059125 | |||
| 1762 | Ga0070678_100624413 | |||
| 1763 | Ga0070662_100019430 | |||
| 1764 | Ga0070662_100287109 | |||
| 1765 | Ga0070662_100304462 | |||
| 1766 | Ga0070681_10090610 | |||
| 1767 | Ga0070681_10580572 | |||
| 1768 | Ga0070681_11209966 | |||
| 1769 | Ga0068867_100593667 | |||
| 1770 | Ga0068867_100894492 | |||
| 1771 | Ga0068867_102043528 | |||
| 1772 | Ga0068867_102176085 | |||
| 1773 | Ga0068867_102314126 | |||
| 1774 | Ga0070685_10108159 | |||
| 1775 | Ga0070706_100002397 | |||
| 1776 | Ga0070706_100039497 | |||
| 1777 | Ga0070706_100420659 | |||
| 1778 | Ga0070707_100016355 | |||
| 1779 | Ga0070707_100016400 | |||
| 1780 | Ga0070707_100021949 | |||
| 1781 | Ga0070707_100081493 | |||
| 1782 | Ga0070707_100322248 | |||
| 1783 | Ga0070698_100003111 | |||
| 1784 | Ga0070698_100022873 | |||
| 1785 | Ga0070698_100133725 | |||
| 1786 | Ga0070698_100255792 | |||
| 1787 | Ga0070698_100350384 | |||
| 1788 | Ga0070698_101241008 | |||
| 1789 | Ga0070699_100018068 | |||
| 1790 | Ga0070699_100347512 | |||
| 1791 | Ga0070699_101275382 | |||
| 1792 | Ga0070679_100625780 | |||
| 1793 | Ga0070679_100751640 | |||
| 1794 | Ga0070684_100122750 | |||
| 1795 | Ga0070697_100005500 | |||
| 1796 | Ga0070697_100102973 | |||
| 1797 | Ga0070697_100127420 | |||
| 1798 | Ga0068853_100181578 | |||
| 1799 | Ga0068853_100214322 | |||
| 1800 | Ga0070672_100015498 | |||
| 1801 | Ga0070686_100051239 | |||
| 1802 | Ga0070686_100245868 | |||
| 1803 | Ga0070686_100259239 | |||
| 1804 | Ga0070695_100020958 | |||
| 1805 | Ga0070695_100050716 | |||
| 1806 | Ga0070696_100002641 | |||
| 1807 | Ga0070696_100036693 | |||
| 1808 | Ga0070696_100119158 | |||
| 1809 | Ga0070696_100246852 | |||
| 1810 | Ga0070696_100572093 | |||
| 1811 | Ga0070696_100656110 | |||
| 1812 | Ga0070693_100009343 | |||
| 1813 | Ga0070693_100562931 | |||
| 1814 | Ga0070665_100005394 | |||
| 1815 | Ga0070665_100033046 | |||
| 1816 | Ga0070665_100199704 | |||
| 1817 | Ga0070665_100217878 | |||
| 1818 | Ga0070665_100403241 | |||
| 1819 | Ga0070665_101171156 | |||
| 1820 | Ga0070704_100007251 | |||
| 1821 | Ga0070704_100049539 | |||
| 1822 | Ga0070704_100050460 | |||
| 1823 | Ga0070704_100089897 | |||
| 1824 | Ga0070704_100300780 | |||
| 1825 | Ga0070704_100409023 | |||
| 1826 | Ga0070704_100618643 | |||
| 1827 | Ga0068855_100234888 | |||
| 1828 | Ga0068855_100699410 | |||
| 1829 | Ga0068855_101222444 | |||
| 1830 | Ga0070664_100118858 | |||
| 1831 | Ga0070664_100226051 | |||
| 1832 | Ga0070664_100704853 | |||
| 1833 | Ga0068854_100040324 | |||
| 1834 | Ga0068854_100158198 | |||
| 1835 | Ga0068854_100599234 | |||
| 1836 | Ga0068854_101918268 | |||
| 1837 | Ga0068856_100000975 | |||
| 1838 | Ga0068856_100366813 | |||
| 1839 | Ga0068856_100622140 | |||
| 1840 | Ga0068856_100793583 | |||
| 1841 | Ga0068856_100851755 | |||
| 1842 | Ga0070702_100358477 | |||
| 1843 | Ga0068852_100418869 | |||
| 1844 | Ga0068852_100431900 | |||
| 1845 | Ga0068852_101596299 | |||
| 1846 | Ga0068859_100098458 | |||
| 1847 | Ga0068859_101747166 | |||
| 1848 | Ga0068859_102356655 | |||
| 1849 | Ga0068864_100496518 | |||
| 1850 | Ga0068866_10001452 | |||
| 1851 | Ga0068861_100948962 | |||
| 1852 | Ga0068870_10754532 | |||
| 1853 | Ga0068863_100003425 | |||
| 1854 | Ga0068858_100003418 | |||
| 1855 | Ga0068858_101317439 | |||
| 1856 | Ga0068860_100042429 | |||
| 1857 | Ga0068860_100175892 | |||
| 1858 | Ga0068862_101585584 | |||
| 1859 | Ga0081455_10204550 | |||
| 1860 | Ga0081538_10002065 | |||
| 1861 | Ga0081539_10002732 | |||
| 1862 | Ga0081539_10003664 | |||
| 1863 | Ga0081539_10005156 | |||
| 1864 | Ga0075365_10035098 | |||
| 1865 | Ga0075365_10073920 | |||
| 1866 | Ga0075365_10130899 | |||
| 1867 | Ga0075365_10363975 | |||
| 1868 | Ga0075365_10618750 | |||
| 1869 | Ga0075365_11065245 | |||
| 1870 | Ga0075368_10109170 | |||
| 1871 | Ga0075368_10122026 | |||
| 1872 | Ga0075368_10124881 | |||
| 1873 | Ga0075368_10199251 | |||
| 1874 | Ga0075363_100013693 | |||
| 1875 | Ga0075363_100115082 | |||
| 1876 | Ga0075363_100284700 | |||
| 1877 | Ga0075364_10027338 | |||
| 1878 | Ga0075364_10158631 | |||
| 1879 | Ga0075364_10366624 | |||
| 1880 | Ga0075364_10642453 | |||
| 1881 | Ga0075364_11012266 | |||
| 1882 | Ga0070715_10165817 | |||
| 1883 | Ga0070716_100030710 | |||
| 1884 | Ga0070716_100035428 | |||
| 1885 | Ga0070712_100001906 | |||
| 1886 | Ga0070712_100084711 | |||
| 1887 | Ga0075362_10061470 | |||
| 1888 | Ga0075362_10224913 | |||
| 1889 | Ga0075362_10758522 | |||
| 1890 | Ga0075367_10051844 | |||
| 1891 | Ga0075367_10082677 | |||
| 1892 | Ga0075367_10089130 | |||
| 1893 | Ga0075367_10109720 | |||
| 1894 | Ga0075367_10171770 | |||
| 1895 | Ga0075367_10191222 | |||
| 1896 | Ga0075369_10007423 | |||
| 1897 | Ga0075369_10015022 | |||
| 1898 | Ga0075369_10036973 | |||
| 1899 | Ga0075366_10028361 | |||
| 1900 | Ga0075366_10047973 | |||
| 1901 | Ga0075366_10061070 | |||
| 1902 | Ga0075366_10416000 | |||
| 1903 | Ga0075366_10590289 | |||
| 1904 | Ga0097621_100029217 | |||
| 1905 | Ga0097621_100064142 | |||
| 1906 | Ga0097621_100278874 | |||
| 1907 | Ga0097621_100497382 | |||
| 1908 | Ga0075370_10166741 | |||
| 1909 | Ga0075370_10267925 | |||
| 1910 | Ga0075370_10516360 | |||
| 1911 | Ga0075370_10686320 | |||
| 1912 | Ga0068871_100008343 | |||
| 1913 | Ga0068871_100088736 | |||
| 1914 | Ga0068871_100331553 | |||
| 1915 | Ga0075428_100008527 | |||
| 1916 | Ga0075428_100710399 | |||
| 1917 | Ga0075428_101661436 | |||
| 1918 | Ga0075431_100137098 | |||
| 1919 | Ga0075433_10154497 | |||
| 1920 | Ga0075433_10157084 | |||
| 1921 | Ga0075433_10486390 | |||
| 1922 | Ga0075434_100061710 | |||
| 1923 | Ga0075434_100128978 | |||
| 1924 | Ga0075429_100055859 | |||
| 1925 | Ga0068865_100085583 | |||
| 1926 | Ga0075436_100129397 | |||
| 1927 | Ga0075436_100367582 | |||
| 1928 | Ga0097620_100098462 | |||
| 1929 | Ga0097620_101746927 | |||
| 1930 | Ga0097620_102356552 | |||
| 1931 | Ga0075435_100196366 | |||
| 1932 | Ga0075435_100465357 | |||
| 1933 | Ga0075435_100525523 | |||
| 1934 | Ga0105250_10364994 | |||
| 1935 | Ga0105240_10071001 | |||
| 1936 | Ga0105240_10273380 | |||
| 1937 | Ga0105240_10379812 | |||
| 1938 | Ga0105240_10715586 | |||
| 1939 | Ga0105240_11137155 | |||
| 1940 | Ga0105240_11194290 | |||
| 1941 | Ga0105240_12568433 | |||
| 1942 | Ga0111539_10000011 | |||
| 1943 | Ga0111539_10137853 | |||
| 1944 | Ga0111539_10227258 | |||
| 1945 | Ga0111539_12983153 | |||
| 1946 | Ga0105245_10042421 | |||
| 1947 | Ga0105245_10073210 | |||
| 1948 | Ga0105245_10503205 | |||
| 1949 | Ga0105245_10533162 | |||
| 1950 | Ga0105245_11000634 | |||
| 1951 | Ga0105245_13204918 | |||
| 1952 | Ga0105247_10025334 | |||
| 1953 | Ga0114129_10851601 | |||
| 1954 | Ga0105243_10516305 | |||
| 1955 | Ga0105241_10023869 | |||
| 1956 | Ga0105241_10170277 | |||
| 1957 | Ga0105242_10028271 | |||
| 1958 | Ga0105242_10137224 | |||
| 1959 | Ga0105242_11472907 | |||
| 1960 | Ga0105248_10563098 | |||
| 1961 | Ga0105248_10666879 | |||
| 1962 | Ga0105248_11127750 | |||
| 1963 | Ga0105237_10014788 | |||
| 1964 | Ga0105237_10104436 | |||
| 1965 | Ga0105237_10191465 | |||
| 1966 | Ga0105237_10222546 | |||
| 1967 | Ga0105237_10541853 | |||
| 1968 | Ga0105237_11216365 | |||
| 1969 | Ga0105238_10003126 | |||
| 1970 | Ga0105238_10156605 | |||
| 1971 | Ga0105238_10156883 | |||
| 1972 | Ga0105238_10302342 | |||
| 1973 | Ga0105238_10428717 | |||
| 1974 | Ga0105238_10462684 | |||
| 1975 | Ga0105238_10975539 | |||
| 1976 | Ga0105238_11134480 | |||
| 1977 | Ga0105249_10635128 | |||
| 1978 | Ga0105249_10998992 | |||
| 1979 | Ga0105249_11730529 | |||
| 1980 | Ga0105239_10010085 | |||
| 1981 | Ga0105239_10043527 | |||
| 1982 | Ga0105239_10097049 | |||
| 1983 | Ga0105239_10097156 | |||
| 1984 | Ga0105239_10151280 | |||
| 1985 | Ga0105239_10210483 | |||
| 1986 | Ga0105239_10332058 | |||
| 1987 | Ga0105239_10345923 | |||
| 1988 | Ga0105239_10375329 | |||
| 1989 | Ga0105239_10655686 | |||
| 1990 | Ga0105239_11841558 | |||
| 1991 | Ga0105246_10058596 | |||
| 1992 | Ga0105246_10101922 | |||
| 1993 | Ga0105246_10238398 | |||
| 1994 | Ga0105246_10913547 | |||
| 1995 | Ga0157373_10099544 | |||
| 1996 | Ga0157371_10585355 | |||
| 1997 | Ga0157370_10003103 | |||
| 1998 | Ga0157370_10087410 | |||
| 1999 | Ga0157369_10136983 | |||
| 2000 | Ga0157369_10288523 | |||
| 2001 | Ga0157374_10000596 | |||
| 2002 | Ga0157378_10065076 | |||
| 2003 | Ga0157378_10077986 | |||
| 2004 | Ga0157378_10121217 | |||
| 2005 | Ga0157378_10651121 | |||
| 2006 | Ga0163162_10004338 | |||
| 2007 | Ga0163162_10033110 | |||
| 2008 | Ga0163162_10812254 | |||
| 2009 | Ga0163162_12970585 | |||
| 2010 | Ga0157372_10397839 | |||
| 2011 | Ga0157372_10463206 | |||
| 2012 | Ga0163163_12553753 | |||
| 2013 | Ga0157380_10658364 | |||
| 2014 | Ga0157380_11129983 | |||
| 2015 | Ga0157380_12608996 | |||
| 2016 | Ga0157380_12632184 | |||
| 2017 | Ga0157380_12756894 | |||
| 2018 | Ga0182008_10126972 | |||
| 2019 | Ga0157377_10031272 | |||
| 2020 | Ga0157379_10037045 | |||
| 2021 | Ga0157379_10863368 | |||
| 2022 | Ga0157379_12212193 | |||
| 2023 | Ga0157376_10068710 | |||
| 2024 | Ga0157376_10078986 | |||
| 2025 | Ga0157376_10510544 | |||
| 2026 | Ga0157376_10771388 | |||
| 2027 | Ga0163161_10000750 | |||
| 2028 | Ga0163161_10169733 | |||
| 2029 | Ga0163161_10817090 | |||
| 2030 | Ga0206356_11719896 | |||
| 2031 | Ga0206356_11855175 | |||
| 2032 | Ga0206351_11007656 | |||
| 2033 | Ga0206350_11472044 | |||
| 2034 | Ga0213875_10006275 | |||
| 2035 | Ga0213875_10354288 | |||
| 2036 | Ga0224712_10205346 | |||
| 2037 | Ga0209674_100149 | |||
| 2038 | Ga0209674_101228 | |||
| 2039 | Ga0209672_100008 | |||
| 2040 | Ga0209258_100004 | |||
| 2041 | Ga0209258_100008 | |||
| 2042 | Ga0209026_1000024 | |||
| 2043 | Ga0209026_1000045 | |||
| 2044 | Ga0209677_103088 | |||
| 2045 | Ga0209148_1000050 | |||
| 2046 | Ga0209148_1000053 | |||
| 2047 | Ga0209148_1000985 | |||
| 2048 | Ga0209759_1000140 | |||
| 2049 | Ga0209759_1000302 | |||
| 2050 | Ga0209233_1000027 | |||
| 2051 | Ga0209455_1000007 | |||
| 2052 | Ga0209455_1000379 | |||
| 2053 | Ga0209025_1000480 | |||
| 2054 | Ga0209758_1001305 | |||
| 2055 | Ga0209758_1008436 | |||
| 2056 | Ga0207653_10030781 | |||
| 2057 | Ga0207653_10186415 | |||
| 2058 | Ga0207692_10006659 | |||
| 2059 | Ga0207692_10018398 | |||
| 2060 | Ga0207692_10075332 | |||
| 2061 | Ga0207642_10200281 | |||
| 2062 | Ga0207642_10565758 | |||
| 2063 | Ga0207680_10001836 | |||
| 2064 | Ga0207647_10046507 | |||
| 2065 | Ga0207685_10135892 | |||
| 2066 | Ga0207699_10193349 | |||
| 2067 | Ga0207645_10132609 | |||
| 2068 | Ga0207645_10520943 | |||
| 2069 | Ga0207643_10101309 | |||
| 2070 | Ga0207684_10000776 | |||
| 2071 | Ga0207684_10001236 | |||
| 2072 | Ga0207684_10109218 | |||
| 2073 | Ga0207684_10167063 | |||
| 2074 | Ga0207684_10467467 | |||
| 2075 | Ga0207654_10053109 | |||
| 2076 | Ga0207654_10104344 | |||
| 2077 | Ga0207654_10160809 | |||
| 2078 | Ga0207654_10213319 | |||
| 2079 | Ga0207695_10310498 | |||
| 2080 | Ga0207695_10524475 | |||
| 2081 | Ga0207695_10878985 | |||
| 2082 | Ga0207671_10005928 | |||
| 2083 | Ga0207671_10407045 | |||
| 2084 | Ga0207671_11373339 | |||
| 2085 | Ga0207693_10000104 | |||
| 2086 | Ga0207693_10175339 | |||
| 2087 | Ga0207663_10045982 | |||
| 2088 | Ga0207663_10326349 | |||
| 2089 | Ga0207663_10444919 | |||
| 2090 | Ga0207660_10000002 | |||
| 2091 | Ga0207660_10526384 | |||
| 2092 | Ga0207662_10092545 | |||
| 2093 | Ga0207662_10123259 | |||
| 2094 | Ga0207657_10002703 | |||
| 2095 | Ga0207657_10735403 | |||
| 2096 | Ga0207649_10039428 | |||
| 2097 | Ga0207649_10283811 | |||
| 2098 | Ga0207649_10564603 | |||
| 2099 | Ga0207652_10415910 | |||
| 2100 | Ga0207652_10773304 | |||
| 2101 | Ga0207646_10000393 | |||
| 2102 | Ga0207646_10026917 | |||
| 2103 | Ga0207646_10027890 | |||
| 2104 | Ga0207646_10160372 | |||
| 2105 | Ga0207646_10997221 | |||
| 2106 | Ga0207681_10545716 | |||
| 2107 | Ga0207694_10003891 | |||
| 2108 | Ga0207694_10123486 | |||
| 2109 | Ga0207694_10244857 | |||
| 2110 | Ga0207694_10324943 | |||
| 2111 | Ga0207650_10043409 | |||
| 2112 | Ga0207650_10960542 | |||
| 2113 | Ga0207659_11282375 | |||
| 2114 | Ga0207659_11549339 | |||
| 2115 | Ga0207687_10035960 | |||
| 2116 | Ga0207687_10374187 | |||
| 2117 | Ga0207687_10376854 | |||
| 2118 | Ga0207700_10029476 | |||
| 2119 | Ga0207700_10041321 | |||
| 2120 | Ga0207700_10320869 | |||
| 2121 | Ga0207700_11119093 | |||
| 2122 | Ga0207664_10039482 | |||
| 2123 | Ga0207664_10250716 | |||
| 2124 | Ga0207644_10000914 | |||
| 2125 | Ga0207644_10095324 | |||
| 2126 | Ga0207644_10611339 | |||
| 2127 | Ga0207644_11481821 | |||
| 2128 | Ga0207690_10455777 | |||
| 2129 | Ga0207690_10959672 | |||
| 2130 | Ga0207690_11599293 | |||
| 2131 | Ga0207706_10197291 | |||
| 2132 | Ga0207686_10020327 | |||
| 2133 | Ga0207709_10727139 | |||
| 2134 | Ga0207670_11520945 | |||
| 2135 | Ga0207670_11850293 | |||
| 2136 | Ga0207669_10022138 | |||
| 2137 | Ga0207669_10340592 | |||
| 2138 | Ga0207669_10908088 | |||
| 2139 | Ga0207704_10014382 | |||
| 2140 | Ga0207665_10053310 | |||
| 2141 | Ga0207691_10023854 | |||
| 2142 | Ga0207711_10153988 | |||
| 2143 | Ga0207711_10751790 | |||
| 2144 | Ga0207689_10091261 | |||
| 2145 | Ga0207689_10262548 | |||
| 2146 | Ga0207661_10076085 | |||
| 2147 | Ga0207679_10757328 | |||
| 2148 | Ga0207667_10109347 | |||
| 2149 | Ga0207667_10201926 | |||
| 2150 | Ga0207667_10309404 | |||
| 2151 | Ga0207651_10006147 | |||
| 2152 | Ga0207651_10766459 | |||
| 2153 | Ga0207651_10819706 | |||
| 2154 | Ga0207651_11448671 | |||
| 2155 | Ga0207712_10423063 | |||
| 2156 | Ga0207712_10847666 | |||
| 2157 | Ga0207712_10925475 | |||
| 2158 | Ga0207640_10062706 | |||
| 2159 | Ga0207640_10370523 | |||
| 2160 | Ga0207640_10577841 | |||
| 2161 | Ga0207640_10627254 | |||
| 2162 | Ga0207658_10018280 | |||
| 2163 | Ga0207677_10001312 | |||
| 2164 | Ga0207677_10049950 | |||
| 2165 | Ga0207677_10090075 | |||
| 2166 | Ga0207703_10002876 | |||
| 2167 | Ga0207703_11122521 | |||
| 2168 | Ga0207639_10202265 | |||
| 2169 | Ga0207639_10991307 | |||
| 2170 | Ga0207678_10167037 | |||
| 2171 | Ga0207678_10231093 | |||
| 2172 | Ga0207678_11530676 | |||
| 2173 | Ga0207708_10188934 | |||
| 2174 | Ga0207708_11652448 | |||
| 2175 | Ga0207702_10000380 | |||
| 2176 | Ga0207702_10073724 | |||
| 2177 | Ga0207702_10305139 | |||
| 2178 | Ga0207702_11184817 | |||
| 2179 | Ga0207641_10020702 | |||
| 2180 | Ga0207641_11240485 | |||
| 2181 | Ga0207641_11250735 | |||
| 2182 | Ga0207648_10231345 | |||
| 2183 | Ga0207648_10540197 | |||
| 2184 | Ga0207648_10638978 | |||
| 2185 | Ga0207676_10094240 | |||
| 2186 | Ga0207674_10012568 | |||
| 2187 | Ga0207674_10124750 | |||
| 2188 | Ga0207675_100911309 | |||
| 2189 | Ga0207675_100959916 | |||
| 2190 | Ga0207675_100988291 | |||
| 2191 | Ga0207683_10001133 | |||
| 2192 | Ga0207683_10192190 | |||
| 2193 | Ga0207683_10438132 | |||
| 2194 | Ga0207683_12054079 | |||
| 2195 | Ga0207698_10180270 | |||
| 2196 | Ga0209981_1081136 | |||
| 2197 | Ga0209813_10052067 | |||
| 2198 | Ga0209813_10211157 | |||
| 2199 | Ga0209813_10274592 | |||
| 2200 | Ga0209813_10315280 | |||
| 2201 | Ga0209974_10032144 | |||
| 2202 | Ga0207428_10000212 | |||
| 2203 | Ga0207428_10058241 | |||
| 2204 | Ga0268266_10000850 | |||
| 2205 | Ga0268266_10007186 | |||
| 2206 | Ga0268266_10090757 | |||
| 2207 | Ga0268266_10608110 | |||
| 2208 | Ga0268265_10142710 | |||
| 2209 | Ga0268264_10003169 | |||
| 2210 | Ga0268264_10025615 | |||
| 2211 | Ga0265334_10201958 | |||
| 2212 | Ga0265322_10029525 | |||
| 2213 | Ga0265336_10066977 | |||
| 2214 | Ga0265338_10003174 | |||
| 2215 | Ga0265338_10025995 | |||
| 2216 | Ga0265338_10650797 | |||
| 2217 | Ga0307512_10233885 | |||
| 2218 | Ga0265770_1049249 | |||
| 2219 | Ga0265332_10000024 | |||
| 2220 | Ga0265332_10050683 | |||
| 2221 | Ga0265329_10003297 | |||
| 2222 | Ga0307513_10032790 | |||
| 2223 | Ga0307408_100152452 | |||
| 2224 | Ga0307408_101461699 | |||
| 2225 | Ga0316579_10182376 | |||
| 2226 | Ga0316579_10263513 | |||
| 2227 | Ga0316579_10378302 | |||
| 2228 | Ga0265314_10000087 | |||
| 2229 | Ga0316576_10008783 | |||
| 2230 | Ga0316576_10010434 | |||
| 2231 | Ga0316576_10013218 | |||
| 2232 | Ga0316576_10019776 | |||
| 2233 | Ga0316576_10074568 | |||
| 2234 | Ga0316576_10184841 | |||
| 2235 | Ga0316576_10262497 | |||
| 2236 | Ga0316576_10373904 | |||
| 2237 | Ga0316576_10374916 | |||
| 2238 | Ga0316576_10488521 | |||
| 2239 | Ga0316576_10580138 | |||
| 2240 | Ga0316576_10681452 | |||
| 2241 | Ga0316576_11010482 | |||
| 2242 | Ga0316578_10004019 | |||
| 2243 | Ga0316578_10010761 | |||
| 2244 | Ga0316578_10018445 | |||
| 2245 | Ga0316578_10115712 | |||
| 2246 | Ga0316578_10349861 | |||
| 2247 | Ga0316578_10802502 | |||
| 2248 | Ga0316577_10042433 | |||
| 2249 | Ga0316577_10173854 | |||
| 2250 | Ga0316577_10325250 | |||
| 2251 | Ga0316577_10874150 | |||
| 2252 | Ga0307410_10747952 | |||
| 2253 | Ga0307407_10274700 | |||
| 2254 | Ga0307412_11098294 | |||
| 2255 | Ga0307409_102154263 | |||
| 2256 | Ga0307416_100175520 | |||
| 2257 | Ga0307416_100572741 | |||
| 2258 | Ga0307416_100896297 | |||
| 2259 | Ga0307416_102767757 | |||
| 2260 | Ga0307414_10546309 | |||
| 2261 | Ga0307415_100635752 | |||
| 2262 | Ga0316583_10031781 | |||
| 2263 | Ga0316583_10035505 | |||
| 2264 | Ga0316583_10154515 | |||
| 2265 | Ga0316585_10013644 | |||
| 2266 | Ga0316580_10003959 | |||
| 2267 | Ga0316580_10010860 | |||
| 2268 | Ga0316593_10013684 | |||
| 2269 | Ga0316593_10023357 | |||
| 2270 | Ga0316593_10153884 | |||
| 2271 | Ga0316592_1001361 | |||
| 2272 | Ga0316592_1002162 | |||
| 2273 | Ga0316592_1071258 | |||
| 2274 | Ga0316586_1001301 | |||
| 2275 | Ga0316588_1041192 | |||
| 2276 | Ga0316588_1087417 | |||
| 2277 | Ga0316587_1025310 | |||
| 2278 | Ga0316587_1118832 | |||
| 2279 | Ga0316596_1007171 | |||
| 2280 | Ga0373926_0037925 | |||
| 2281 | Ga0373928_0038880 | |||
| 2282 | Ga0373929_0034483 | |||
| 2283 | Ga0373934_0005630 | |||
| 2284 | Ga0373940_0133651 | |||
| 2285 | Ga0373944_0084426 | |||
| 2286 | Ga0373923_0000205 | |||
| 2287 | Ga0373923_0064846 | |||
| 2288 | Ga0373932_0269868 | |||
| 2289 | Ga0373941_0032001 | |||
| 2290 | Ga0373945_0024779 | |||
| 2291 | Ga0373945_0053249 | |||
| 2292 | Ga0373953_0006354 | |||
| 2293 | Ga0373954_0034165 | |||
| 2294 | Ga0373956_0022360 | |||
| 2295 | Ga0373956_0262443 | |||
| 2296 | Ga0373957_0004838 | |||
| 2297 | Ga0373957_0086871 | |||
| 2298 | Ga0373960_0183157 | |||
| 2299 | Ga0373960_0359710 | |||
| 2300 | Ga0373943_0013451 | |||
| 2301 | Ga0373943_0015517 | |||
| 2302 | Ga0373943_0018552 | |||
| 2303 | Ga0373943_0280165 | |||
| 2304 | Ga0373946_0228097 | |||
| 2305 | Ga0373955_0007175 | |||
| 2306 | Ga0373961_0119927 | |||
| 2307 | Ga0316574_0021624 | |||
| 2308 | Ga0316574_0270263 | |||
| 2309 | Ga0316574_0307057 | |||
| 2310 | Ga0316574_0546536 | |||
| 2311 | Ga0316574_0763097 | |||
| 2312 | Ga0373924_0019718 | |||
| 2313 | Ga0373924_0165142 | |||
| 2314 | Ga0373935_0003253 | |||
| 2315 | Ga0373935_0144651 | |||
| 2316 | Ga0373935_0930977 | |||
| 2317 | Ga0373935_1130457 | |||
| 2318 | Ga0373927_0045696 | |||
| 2319 | Ga0373927_0200717 | |||
| 2320 | Ga0373933_0130310 | |||
| 2321 | Ga0373933_0232935 | |||
| 2322 | Ga0373947_0003388 | |||
| 2323 | Ga0373947_0024078 | |||
| 2324 | Ga0373937_0043634 | |||
| 2325 | Ga0373937_0124881 | |||
| 2326 | Ga0373937_0182724 | |||
| 2327 | Ga0373937_0430849 | |||
| 2328 | Ga0373937_0752533 | |||
| 2329 | Ga0373937_1702718 | |||
| 2330 | Ga0372808_036355 | |||
| 2331 | Ga0316582_0022819 | |||
| 2332 | Ga0316582_0068727 | |||
| 2333 | Ga0316582_0082778 | |||
| 2334 | Ga0316582_0261484 | |||
| 2335 | Ga0316582_0297525 | |||
| 2336 | Ga0316584_0067900 | |||
| 2337 | Ga0316584_0194355 | |||
| 2338 | Ga0316584_0211657 | |||
| 2339 | Ga0373925_0041456 | |||
| 2340 | Ga0395899_0000139 | |||
| 2341 | Ga0395899_0000164 | |||
| 2342 | Ga0395899_0012593 | |||
| 2343 | Ga0395899_0122589 | |||
| 2344 | Ga0395899_0355320 | |||
| 2345 | Ga0395899_0403022 | |||
| 2346 | Ga0395899_0403406 | |||
| 2347 | Ga0395899_0492384 | |||
| 2348 | Ga0395900_0000217 | |||
| 2349 | Ga0395900_0002078 | |||
| 2350 | Ga0395900_0110837 | |||
| 2351 | Ga0395900_0135659 | |||
| 2352 | Ga0395900_0170772 | |||
| 2353 | Ga0395900_0208752 | |||
| 2354 | Ga0395900_0246371 | |||
| 2355 | Ga0395900_0263559 | |||
| 2356 | Ga0395900_0973125 | |||
| 2357 | Ga0395900_1199270 | |||
| 2358 | Ga0395898_0000029 | |||
| 2359 | Ga0395898_0246545 | |||
| 2360 | Ga0395898_0397878 | |||
| 2361 | Ga0395898_0503740 | |||
| 2362 | Ga0395898_0566588 | |||
| 2363 | Ga0395898_1621798 | |||
| 2364 | Ga0395905_0114628 | |||
| 2365 | Ga0395905_0162138 | |||
| 2366 | Ga0395905_0322941 | |||
| 2367 | Ga0395905_0369994 | |||
| 2368 | Ga0395905_0724389 | |||
| 2369 | Ga0395905_0984124 | |||
| 2370 | Ga0395905_1274934 | |||
| 2371 | Ga0395905_1312554 | |||
| 2372 | Ga0316581_0002998 | |||
| 2373 | Ga0316581_0063326 | |||
| 2374 | Ga0436364_0212987 | |||
| 2375 | Ga0436364_1367044 | |||
| 2376 | Ga0395901_0000250 | |||
| 2377 | Ga0395901_0055988 | |||
| 2378 | Ga0395901_0072336 | |||
| 2379 | Ga0395901_0110229 | |||
| 2380 | Ga0395901_0112883 | |||
| 2381 | Ga0395901_0262727 | |||
| 2382 | Ga0395901_0293924 | |||
| 2383 | Ga0395901_0321392 | |||
| 2384 | Ga0395901_0343309 | |||
| 2385 | Ga0395901_0598481 | |||
| 2386 | Ga0395901_1005584 | |||
| 2387 | Ga0436365_0226758 | |||
| 2388 | Ga0436365_0449353 | |||
| 2389 | Ga0436360_0389060 | |||
| 2390 | Ga0436360_0670138 | |||
| 2391 | Ga0436360_0806326 | |||
| 2392 | Ga0436360_1097396 | |||
| 2393 | Ga0436361_1118974 | |||
| 2394 | Ga0439436_0000974 | |||
| 2395 | Ga0439438_000863 | |||
| 2396 | Ga0439447_000231 | |||
| 2397 | Ga0439461_0121310 | |||
| 2398 | Ga0439466_0000756 | |||
| 2399 | Ga0439466_0003886 | |||
| 2400 | Ga0439465_0069610 | |||
| 2401 | Ga0439465_0126301 | |||
| 2402 | Ga0451789_0506225 | |||
| 2403 | Ga0451837_1132506 | |||
| 2404 | Ga0451853_0378017 | |||
| 2405 | Ga0451853_3305277 | |||
| 2406 | Ga0439431_0046627 | |||
| 2407 | Ga0439431_0072732 | |||
| 2408 | Ga0439432_003631 | |||
| 2409 | Ga0439449_0070651 | |||
| 2410 | Ga0439452_008966 | |||
| 2411 | Ga0450919_024118 | |||
| 2412 | Ga0450923_029321 | |||
| 2413 | Ga0450904_001054 | |||
| 2414 | Ga0439446_0008571 | |||
| 2415 | Ga0439458_0181330 | |||
| 2416 | Ga0450908_076159 | |||
| 2417 | Ga0450909_013992 | |||
| 2418 | Ga0450909_069802 | |||
| 2419 | Ga0439434_0001105 | |||
| 2420 | Ga0439435_0030933 | |||
| 2421 | Ga0439459_0033904 | |||
| 2422 | Ga0439460_0223280 | |||
| 2423 | Ga0451577_0025900 | |||
| 2424 | Ga0451577_0246518 | |||
| 2425 | Ga0451577_0268084 | |||
| 2426 | Ga0451577_0273041 | |||
| 2427 | Ga0451577_1672257 | |||
| 2428 | Ga0466969_0008322 | |||
| 2429 | Ga0466969_0117745 | |||
| 2430 | Ga0466969_0159867 | |||
| 2431 | Ga0466969_0410834 | |||
| 2432 | Ga0466972_0061569 | |||
| 2433 | Ga0466976_0329296 | |||
| 2434 | Ga0453683_0579476 | |||
| 2435 | Ga0466965_0022239 | |||
| 2436 | Ga0466965_0207337 | |||
| 2437 | Ga0466965_0395558 | |||
| 2438 | Ga0466966_0001633 | |||
| 2439 | Ga0466966_0059034 | |||
| 2440 | Ga0466961_0001504 | |||
| 2441 | Ga0466963_0281149 | |||
| 2442 | Ga0466964_0014915 | |||
| 2443 | Ga0466964_0113483 | |||
| 2444 | Ga0453684_0000204 | |||
| 2445 | Ga0453684_0000395 | |||
| 2446 | Ga0453684_0004787 | |||
| 2447 | Ga0453684_0148792 | |||
| 2448 | Ga0453684_0568746 | |||
| 2449 | Ga0453684_2288871 | |||
| 2450 | Ga0466971_0050778 | |||
| 2451 | Ga0466968_0655917 | |||
| 2452 | Ga0466970_0152245 | |||
| 2453 | Ga0466970_0239282 | |||
| 2454 | Ga0466957_0000385 | |||
| 2455 | Ga0466957_0233804 | |||
| 2456 | Ga0466959_0000563 | |||
| 2457 | Ga0466959_0002207 | |||
| 2458 | Ga0466959_0020697 | |||
| 2459 | Ga0466959_0970227 | |||
| 2460 | Ga0451576_0005710 | |||
| 2461 | Ga0451576_1266021 | |||
| 2462 | Ga0451576_2420617 | |||
| 2463 | Ga0466958_0081536 | |||
| 2464 | Ga0466958_0166802 | |||
| 2465 | Ga0466958_0603932 | |||
| 2466 | Ga0466967_0378134 | |||
| 2467 | Ga0466967_0528181 | |||
| 2468 | Ga0466967_0677750 | |||
| 2469 | Ga0466967_2128418 | |||
| 2470 | Ga0495617_000216 | |||
| 2471 | Ga0495627_005158 | |||
| 2472 | Ga0495592_0000054 | |||
| 2473 | Ga0495592_0122817 | |||
| 2474 | Ga0495603_0052705 | |||
| 2475 | Ga0495603_0115160 | |||
| 2476 | Ga0495603_0297199 | |||
| 2477 | Ga0495590_0000077 | |||
| 2478 | Ga0495590_0003554 | |||
| 2479 | Ga0495590_0018501 | |||
| 2480 | Ga0495629_0049667 | |||
| 2481 | Ga0495629_0067752 | |||
| 2482 | Ga0495629_0081556 | |||
| 2483 | Ga0495629_0104214 | |||
| 2484 | Ga0495638_0046686 | |||
| 2485 | Ga0495638_0297327 | |||
| 2486 | Ga0495651_0294344 | |||
| 2487 | Ga0495653_0042427 | |||
| 2488 | Ga0495653_0052385 | |||
| 2489 | Ga0495653_0073375 | |||
| 2490 | Ga0495653_0292562 | |||
| 2491 | Ga0495650_0025459 | |||
| 2492 | Ga0495580_0046916 | |||
| 2493 | Ga0495580_0343830 | |||
| 2494 | Ga0495582_0005646 | |||
| 2495 | Ga0495582_0010469 | |||
| 2496 | Ga0495582_0018626 | |||
| 2497 | Ga0495605_0000325 | |||
| 2498 | Ga0495605_0114818 | |||
| 2499 | Ga0495605_0122472 | |||
| 2500 | Ga0495639_0013210 | |||
| 2501 | Ga0495662_0009572 | |||
| 2502 | Ga0495662_0010489 | |||
| 2503 | Ga0495664_0410564 | |||
| 2504 | Ga0495584_0000351 | |||
| 2505 | Ga0495584_0001690 | |||
| 2506 | Ga0495584_0001693 | |||
| 2507 | Ga0495584_0023105 | |||
| 2508 | Ga0495584_0023849 | |||
| 2509 | Ga0495584_0025577 | |||
| 2510 | Ga0495584_0050546 | |||
| 2511 | Ga0495584_0068022 | |||
| 2512 | Ga0495584_0170407 | |||
| 2513 | Ga0495584_0338320 | |||
| 2514 | Ga0495585_0000563 | |||
| 2515 | Ga0495585_0001619 | |||
| 2516 | Ga0495585_0002446 | |||
| 2517 | Ga0495585_0002476 | |||
| 2518 | Ga0495585_0003138 | |||
| 2519 | Ga0495585_0003417 | |||
| 2520 | Ga0495585_0027979 | |||
| 2521 | Ga0495585_0046466 | |||
| 2522 | Ga0495585_0123123 | |||
| 2523 | Ga0495585_0277366 | |||
| 2524 | Ga0495585_0344031 | |||
| 2525 | Ga0495585_0462800 | |||
| 2526 | Ga0495594_0039692 | |||
| 2527 | Ga0495594_0049418 | |||
| 2528 | Ga0495594_0060346 | |||
| 2529 | Ga0495596_0003192 | |||
| 2530 | Ga0495596_0048164 | |||
| 2531 | Ga0495596_0053296 | |||
| 2532 | Ga0495607_0009100 | |||
| 2533 | Ga0495607_0014486 | |||
| 2534 | Ga0495607_0092858 | |||
| 2535 | Ga0495583_0000424 | |||
| 2536 | Ga0495583_0003374 | |||
| 2537 | Ga0495583_0015810 | |||
| 2538 | Ga0495583_0029507 | |||
| 2539 | Ga0495583_0118069 | |||
| 2540 | Ga0495583_0154551 | |||
| 2541 | Ga0495583_0246348 | |||
| 2542 | Ga0495583_0349676 | |||
| 2543 | Ga0495606_0020317 | |||
| 2544 | Ga0495606_0056953 | |||
| 2545 | Ga0495606_0057127 | |||
| 2546 | Ga0495606_0148920 | |||
| 2547 | Ga0495606_0283613 | |||
| 2548 | Ga0495610_0000955 | |||
| 2549 | Ga0495610_0067078 | |||
| 2550 | Ga0495610_0081874 | |||
| 2551 | Ga0495616_0000316 | |||
| 2552 | Ga0495616_0001788 | |||
| 2553 | Ga0495616_0006596 | |||
| 2554 | Ga0495616_0016682 | |||
| 2555 | Ga0495616_0059927 | |||
| 2556 | Ga0495616_0095739 | |||
| 2557 | Ga0495616_0099042 | |||
| 2558 | Ga0495616_0180214 | |||
| 2559 | Ga0495616_0263104 | |||
| 2560 | Ga0495618_0002303 | |||
| 2561 | Ga0495618_0602385 | |||
| 2562 | Ga0495620_0023660 | |||
| 2563 | Ga0495628_0015266 | |||
| 2564 | Ga0495628_0048896 | |||
| 2565 | Ga0495628_0056377 | |||
| 2566 | Ga0495630_0070115 | |||
| 2567 | Ga0495630_0077443 | |||
| 2568 | Ga0495630_0093467 | |||
| 2569 | Ga0495630_0229291 | |||
| 2570 | Ga0495631_0000341 | |||
| 2571 | Ga0495631_0003191 | |||
| 2572 | Ga0495631_0012248 | |||
| 2573 | Ga0495631_0038854 | |||
| 2574 | Ga0495631_0203642 | |||
| 2575 | Ga0495632_0000081 | |||
| 2576 | Ga0495632_0032242 | |||
| 2577 | Ga0495632_0435046 | |||
| 2578 | Ga0495637_0000008 | |||
| 2579 | Ga0495637_0079214 | |||
| 2580 | Ga0495643_0003692 | |||
| 2581 | Ga0495643_0004226 | |||
| 2582 | Ga0495643_0028999 | |||
| 2583 | Ga0495644_0005571 | |||
| 2584 | Ga0495644_0010600 | |||
| 2585 | Ga0495644_0016582 | |||
| 2586 | Ga0495644_0029604 | |||
| 2587 | Ga0495644_0032762 | |||
| 2588 | Ga0495644_0294288 | |||
| 2589 | Ga0495648_0000722 | |||
| 2590 | Ga0495648_0063018 | |||
| 2591 | Ga0495648_0135865 | |||
| 2592 | Ga0495648_0145297 | |||
| 2593 | Ga0495648_0326474 | |||
| 2594 | Ga0495666_0012245 | |||
| 2595 | Ga0495666_0012371 | |||
| 2596 | Ga0495666_0048120 | |||
| 2597 | Ga0495666_0070145 | |||
| 2598 | Ga0495666_0120039 | |||
| 2599 | Ga0495666_0401230 | |||
| 2600 | Ga0495642_0005225 | |||
| 2601 | Ga0495642_0008145 | |||
| 2602 | Ga0495642_0015210 | |||
| 2603 | Ga0495642_0122653 | |||
| 2604 | Ga0495652_0017091 | |||
| 2605 | Ga0495654_0044609 | |||
| 2606 | Ga0495665_0008680 | |||
| 2607 | Ga0495665_0022929 | |||
| 2608 | Ga0495640_0090715 | |||
| 2609 | Ga0495640_0143271 | |||
| 2610 | Ga0495640_0320740 | |||
| 2611 | Ga0495586_0000670 | |||
| 2612 | Ga0495586_0008010 | |||
| 2613 | Ga0495586_0010132 | |||
| 2614 | Ga0495586_0011649 | |||
| 2615 | Ga0495586_0110158 | |||
| 2616 | Ga0495587_0022210 | |||
| 2617 | Ga0495587_0036803 | |||
| 2618 | Ga0495587_0074261 | |||
| 2619 | Ga0495587_0207037 | |||
| 2620 | Ga0495609_0000039 | |||
| 2621 | Ga0495609_0002266 | |||
| 2622 | Ga0495609_0038762 | |||
| 2623 | Ga0495609_0048087 | |||
| 2624 | Ga0495609_0137391 | |||
| 2625 | Ga0495609_0174146 | |||
| 2626 | Ga0495609_0186161 | |||
| 2627 | Ga0495609_0308053 | |||
| 2628 | Ga0495621_0020476 | |||
| 2629 | Ga0495597_0001889 | |||
| 2630 | Ga0495597_0002795 | |||
| 2631 | Ga0495597_0003774 | |||
| 2632 | Ga0495597_0008819 | |||
| 2633 | Ga0495597_0112372 | |||
| 2634 | Ga0495597_0235810 | |||
| 2635 | Ga0495597_0295419 | |||
| 2636 | Ga0495645_0049898 | |||
| 2637 | Ga0495645_0065571 | |||
| 2638 | Ga0495622_0012056 | |||
| 2639 | Ga0495622_0027422 | |||
| 2640 | Ga0495622_0043674 | |||
| 2641 | Ga0495633_0002942 | |||
| 2642 | Ga0495633_0025172 | |||
| 2643 | Ga0495633_0052084 | |||
| 2644 | Ga0495633_0069481 | |||
| 2645 | Ga0495633_0103571 | |||
| 2646 | Ga0495633_0107701 | |||
| 2647 | Ga0495633_0203495 | |||
| 2648 | Ga0495633_0262437 | |||
| 2649 | Ga0495633_0392988 | |||
| 2650 | Ga0495667_0504629 | |||
| 2651 | Ga0495656_0000102 | |||
| 2652 | Ga0495656_0000738 | |||
| 2653 | Ga0495668_0003757 | |||
| 2654 | Ga0495668_0012553 | |||
| 2655 | Ga0495668_0018088 | |||
| 2656 | Ga0495668_0020416 | |||
| 2657 | Ga0495668_0035554 | |||
| 2658 | Ga0495668_0037951 | |||
| 2659 | Ga0495668_0065580 | |||
| 2660 | Ga0495668_0263264 | |||
| 2661 | Ga0495634_0046550 | |||
| 2662 | Ga0495634_0069764 | |||
| 2663 | Ga0495634_0137156 | |||
| 2664 | Ga0495611_0000988 | |||
| 2665 | Ga0495611_0087497 | |||
| 2666 | Ga0495611_0134895 | |||
| 2667 | Ga0495611_0408306 | |||
| 2668 | Ga0495625_0025398 | |||
| 2669 | Ga0495625_0110308 | |||
| 2670 | Ga0495625_0169738 | |||
| 2671 | Ga0495625_0294821 | |||
| 2672 | Ga0495625_0386839 | |||
| 2673 | Ga0495625_0411907 | |||
| 2674 | Ga0495625_0447111 | |||
| 2675 | Ga0495625_0759142 | |||
| 2676 | Ga0495635_0006609 | |||
| 2677 | Ga0495635_0020293 | |||
| 2678 | Ga0495635_0241798 | |||
| 2679 | Ga0495635_0351197 | |||
| 2680 | Ga0495635_0600174 | |||
| 2681 | Ga0495659_0176953 | |||
| 2682 | Ga0495659_0294743 | |||
| 2683 | Ga0495661_0002040 | |||
| 2684 | Ga0495661_0002400 | |||
| 2685 | Ga0495661_0008359 | |||
| 2686 | Ga0495661_0013653 | |||
| 2687 | Ga0495661_0030978 | |||
| 2688 | Ga0495661_0053310 | |||
| 2689 | Ga0495661_0066947 | |||
| 2690 | Ga0495661_0103416 | |||
| 2691 | Ga0495588_0045372 | |||
| 2692 | Ga0495588_0064086 | |||
| 2693 | Ga0495588_0175820 | |||
| 2694 | Ga0495588_0189138 | |||
| 2695 | Ga0495588_0302716 | |||
| 2696 | Ga0495588_0325695 | |||
| 2697 | Ga0495588_0474960 | |||
| 2698 | Ga0495588_0494278 | |||
| 2699 | Ga0495588_0640182 | |||
| 2700 | Ga0495599_0081489 | |||
| 2701 | Ga0495623_0007763 | |||
| 2702 | Ga0495623_0142828 | |||
| 2703 | Ga0495623_0554568 | |||
| 2704 | Ga0495646_0083899 | |||
| 2705 | Ga0495646_0145809 | |||
| 2706 | Ga0495647_0054424 | |||
| 2707 | Ga0495658_0184385 | |||
| 2708 | Ga0495669_0000062 | |||
| 2709 | Ga0495669_0137072 | |||
| 2710 | Ga0495669_0167178 | |||
| 2711 | Ga0495613_0045553 | |||
| 2712 | Ga0495613_0123631 | |||
| 2713 | Ga0495613_0207884 | |||
| 2714 | Ga0495624_0022904 | |||
| 2715 | Ga0495624_0063884 | |||
| 2716 | Ga0495624_0166871 | |||
| 2717 | Ga0495670_0001891 | |||
| 2718 | Ga0495670_0005171 | |||
| 2719 | Ga0495670_0016227 | |||
| 2720 | Ga0495670_0076623 | |||
| 2721 | Ga0495670_0303648 | |||
| 2722 | Ga0495670_0350486 | |||
| 2723 | Ga0495671_0020871 | |||
| 2724 | Ga0495671_0119136 | |||
| 2725 | Ga0495671_0198487 | |||
| 2726 | Ga0495649_0097556 | |||
| 2727 | Ga0495589_0000019 | |||
| 2728 | Ga0495589_0000265 | |||
| 2729 | Ga0495589_0004722 | |||
| 2730 | Ga0495589_0022072 | |||
| 2731 | Ga0495589_0022653 | |||
| 2732 | Ga0495589_0038942 | |||
| 2733 | Ga0495589_0054681 | |||
| 2734 | Ga0495589_0076983 | |||
| 2735 | Ga0495589_0080044 | |||
| 2736 | Ga0495589_0152931 | |||
| 2737 | Ga0495600_0008649 | |||
| 2738 | Ga0495600_0027223 | |||
| 2739 | Ga0495600_0036735 | |||
| 2740 | Ga0495600_0614316 | |||
| 2741 | Ga0495660_0000354 | |||
| 2742 | Ga0495660_0002057 | |||
| 2743 | Ga0495660_0008891 | |||
| 2744 | Ga0495660_0097749 | |||
| 2745 | Ga0495660_0099745 | |||
| 2746 | Ga0495660_0210163 | |||
| 2747 | Ga0495581_0008985 | |||
| 2748 | Ga0495581_0016928 | |||
| 2749 | Ga0495581_0043052 | |||
| 2750 | Ga0495581_0169778 | |||
| 2751 | Ga0495581_0719232 | |||
| 2752 | Ga0495604_0011342 | |||
| 2753 | Ga0495604_0102230 | |||
| 2754 | Ga0495604_0178030 | |||
| 2755 | Ga0495604_0186383 | |||
| 2756 | Ga0495636_0167189 | |||
| 2757 | Ga0495636_0659447 | |||
| 2758 | Ga0495674_0028557 | |||
| 2759 | Ga0495674_0083471 | |||
| 2760 | Ga0495674_0162200 | |||
| 2761 | Ga0495674_0415038 | |||
| 2762 | Ga0495672_0000296 | |||
| 2763 | Ga0495672_0003026 | |||
| 2764 | Ga0495672_0004452 | |||
| 2765 | Ga0495672_0010886 | |||
| 2766 | Ga0495672_0047594 | |||
| 2767 | Ga0495676_0000114 | |||
| 2768 | Ga0495676_0144768 | |||
| 2769 | Ga0495680_0024292 | |||
| 2770 | Ga0495680_0123052 | |||
| 2771 | Ga0495683_0000151 | |||
| 2772 | Ga0495683_0000783 | |||
| 2773 | Ga0495683_0058747 | |||
| 2774 | Ga0495683_0078107 | |||
| 2775 | Ga0495687_000002 | |||
| 2776 | Ga0495687_000007 | |||
| 2777 | Ga0495687_000059 | |||
| 2778 | Ga0495687_004997 | |||
| 2779 | Ga0495687_124166 | |||
| 2780 | Ga0495687_176299 | |||
| 2781 | Ga0495675_0021840 | |||
| 2782 | Ga0495675_0212261 | |||
| 2783 | Ga0495677_0000006 | |||
| 2784 | Ga0495677_0003632 | |||
| 2785 | Ga0495677_0006321 | |||
| 2786 | Ga0495677_0012922 | |||
| 2787 | Ga0495677_0029121 | |||
| 2788 | Ga0495679_012484 | |||
| 2789 | Ga0495679_074338 | |||
| 2790 | Ga0495679_098007 | |||
| 2791 | Ga0495685_007399 | |||
| 2792 | Ga0495685_054110 | |||
| 2793 | Ga0495685_080198 | |||
| 2794 | Ga0495685_158216 | |||
| 2795 | Ga0495685_207016 | |||
| 2796 | Ga0495681_0013904 | |||
| 2797 | Ga0495681_0018418 | |||
| 2798 | Ga0495681_0053880 | |||
| 2799 | Ga0495681_0082542 | |||
| 2800 | Ga0495681_0088444 | |||
| 2801 | Ga0495681_0221978 | |||
| 2802 | Ga0495684_0041822 | |||
| 2803 | Ga0495686_0000797 | |||
| 2804 | Ga0495593_0007642 | |||
| 2805 | Ga0495593_0052150 | |||
| 2806 | Ga0495593_0067683 | |||
| 2807 | Ga0495593_0172516 | |||
| 2808 | Ga0495593_0264094 | |||
| 2809 | Ga0495602_0020385 | |||
| 2810 | Ga0495602_0123482 | |||
| 2811 | Ga0495614_0010515 | |||
| 2812 | Ga0495614_0013242 | |||
| 2813 | Ga0495614_0017760 | |||
| 2814 | Ga0495626_0000103 | |||
| 2815 | Ga0495626_0002196 | |||
| 2816 | Ga0495626_0002740 | |||
| 2817 | Ga0495626_0043676 | |||
| 2818 | Ga0495626_0044975 | |||
| 2819 | Ga0495626_0047598 | |||
| 2820 | Ga0495626_0166905 | |||
| 2821 | Ga0495626_0354504 | |||
| 2822 | Ga0496100_0135118 | |||
| 2823 | Ga0496100_0249929 | |||
| 2824 | Ga0496101_0003635 | |||
| 2825 | Ga0496101_0041474 | |||
| 2826 | Ga0496101_0690581 | |||
| 2827 | Ga0496102_0000939 | |||
| 2828 | Ga0496102_0222801 | |||
| 2829 | Ga0496102_1054810 | |||
| 2830 | Ga0496102_1246871 | |||
| 2831 | Ga0496103_0194271 | |||
| 2832 | Ga0496103_0474941 | |||
| 2833 | Ga0496103_0515617 | |||
| 2834 | Ga0496103_0601194 | |||
| 2835 | Ga0496104_0005181 | |||
| 2836 | Ga0496105_0136044 | |||
| 2837 | Ga0496106_0007554 | |||
| 2838 | Ga0496106_0282133 | |||
| 2839 | Ga0496106_0425229 | |||
| 2840 | Ga0496107_0039446 | |||
| 2841 | Ga0496109_0125473 | |||
| 2842 | Ga0496109_0167037 | |||
| 2843 | Ga0496109_0182761 | |||
| 2844 | Ga0496109_0739142 | |||
| 2845 | Ga0496110_0102527 | |||
| 2846 | Ga0496110_0156934 | |||
| 2847 | Ga0496110_0185775 | |||
| 2848 | Ga0496110_0950188 | |||
| 2849 | Ga0496111_0423021 | |||
| 2850 | Ga0496111_0797879 | |||
| 2851 | Ga0496112_0003934 | |||
| 2852 | Ga0496112_0227089 | |||
| 2853 | Ga0496112_0280272 | |||
| 2854 | Ga0496112_0300660 | |||
| 2855 | Ga0496112_0408344 | |||
| 2856 | Ga0496112_0963591 | |||
| 2857 | Ga0496113_0038902 | |||
| 2858 | Ga0496113_0336642 | |||
| 2859 | Ga0496114_0000134 | |||
| 2860 | Ga0496114_0966575 | |||
| 2861 | Ga0496115_0022204 | |||
| 2862 | Ga0496115_0110002 | |||
| 2863 | Ga0496115_0114680 | |||
| 2864 | Ga0496115_0136155 | |||
| 2865 | Ga0496115_0288325 | |||
| 2866 | Ga0496115_0518997 | |||
| 2867 | Ga0496118_0429425 | |||
| 2868 | Ga0496119_0038726 | |||
| 2869 | Ga0496120_0000863 | |||
| 2870 | Ga0496120_0034227 | |||
| 2871 | Ga0496120_0442227 | |||
| 2872 | Ga0496121_0388607 | |||
| 2873 | Ga0496122_0000727 | |||
| 2874 | Ga0496123_0000791 | |||
| 2875 | Ga0496123_0443427 | |||
| 2876 | Ga0496124_0000313 | |||
| 2877 | Ga0496124_0000314 | |||
| 2878 | Ga0496124_0048155 | |||
| 2879 | Ga0496124_0104859 | |||
| 2880 | Ga0496124_0631296 | |||
| 2881 | Ga0496125_0019499 | |||
| 2882 | Ga0496125_0143910 | |||
| 2883 | Ga0496125_0304433 | |||
| 2884 | Ga0496125_0749729 | |||
| 2885 | Ga0496126_0337892 | |||
| 2886 | Ga0495678_004280 | |||
| 2887 | Ga0495678_004747 | |||
| 2888 | Ga0495678_035328 | |||
| 2889 | Ga0495678_215603 | |||
| 2890 | Ga0495682_0003596 | |||
| 2891 | Ga0495682_0067660 | |||
| 2892 | Ga0495682_0106446 | |||
| 2893 | Ga0501320_071114 | |||
| 2894 | Ga0501032_0000117 | |||
| 2895 | Ga0501032_0006793 | |||
| 2896 | Ga0501033_0000623 | |||
| 2897 | Ga0501033_0217104 | |||
| 2898 | Ga0501034_0000556 | |||
| 2899 | Ga0501034_0005112 | |||
| 2900 | Ga0501034_0124643 | |||
| 2901 | Ga0501034_0922152 | |||
| 2902 | Ga0501036_0000102 | |||
| 2903 | Ga0501037_0000296 | |||
| 2904 | Ga0501037_0092362 | |||
| 2905 | Ga0501038_0003768 | |||
| 2906 | Ga0501039_0000003 | |||
| 2907 | Ga0501039_0538879 | |||
| 2908 | Ga0501039_0725080 | |||
| 2909 | Ga0501039_1004021 | |||
| 2910 | Ga0501040_0000498 | |||
| 2911 | Ga0501040_0054182 | |||
| 2912 | Ga0501040_0077549 | |||
| 2913 | Ga0501040_0755715 | |||
| 2914 | Ga0501041_0125087 | |||
| 2915 | Ga0501042_0003681 | |||
| 2916 | Ga0501042_0127956 | |||
| 2917 | Ga0501043_0000068 | |||
| 2918 | Ga0501046_0028892 | |||
| 2919 | Ga0501046_0198412 | |||
| 2920 | Ga0501046_0216812 | |||
| 2921 | Ga0501047_0012297 | |||
| 2922 | Ga0501047_0235955 | |||
| 2923 | Ga0501047_0428209 | |||
| 2924 | Ga0501047_0626755 | |||
| 2925 | Ga0501048_0122889 | |||
| 2926 | Ga0501067_0033268 | |||
| 2927 | Ga0501067_0292143 | |||
| 2928 | Ga0501068_0849685 | |||
| 2929 | Ga0501069_0000877 | |||
| 2930 | Ga0501070_0000831 | |||
| 2931 | Ga0501070_0403017 | |||
| 2932 | Ga0501070_0524892 | |||
| 2933 | Ga0501072_0051143 | |||
| 2934 | Ga0501073_0003992 | |||
| 2935 | Ga0501074_0049521 | |||
| 2936 | Ga0501075_0507878 | |||
| 2937 | Ga0501076_0155238 | |||
| 2938 | Ga0501076_1288561 | |||
| 2939 | Ga0501235_220994 | |||
| 2940 | Ga0501079_0015904 | |||
| 2941 | Ga0501079_0630421 | |||
| 2942 | Ga0501079_0791288 | |||
| 2943 | Ga0501079_0891070 | |||
| 2944 | Ga0501080_0012533 | |||
| 2945 | Ga0501081_0122066 | |||
| 2946 | Ga0501083_0004385 | |||
| 2947 | Ga0501035_0000032 | |||
| 2948 | Ga0501035_0013083 | |||
| 2949 | Ga0501035_0468159 | |||
| 2950 | Ga0501044_0081509 | |||
| 2951 | Ga0501044_0254919 | |||
| 2952 | Ga0501044_0570042 | |||
| 2953 | Ga0501045_0452317 | |||
| 2954 | nmdc:mga03683_153934_c1 | |||
| 2955 | nmdc:mga03683_181958_c1 | |||
| 2956 | nmdc:mga03n38_196633_c1 | |||
| 2957 | nmdc:mga03n38_203557_c1 | |||
| 2958 | nmdc:mga03n38_71205_c1 | |||
| 2959 | nmdc:mga03n38_960649_c1 | |||
| 2960 | nmdc:mga00v17_136978_c1 | |||
| 2961 | nmdc:mga00v17_180199_c1 | |||
| 2962 | nmdc:mga00v17_531685_c1 | |||
| 2963 | nmdc:mga00v17_538272_c1 | |||
| 2964 | nmdc:mga0yw44_100254_c1 | |||
| 2965 | nmdc:mga0yw44_1146_c1 | |||
| 2966 | nmdc:mga0yw44_223453_c1 | |||
| 2967 | nmdc:mga0yw44_328994_c1 | |||
| 2968 | nmdc:mga0yw44_43625_c1 | |||
| 2969 | nmdc:mga0yw44_83422_c1 | |||
| 2970 | nmdc:mga0yw44_972727_c1 | |||
| 2971 | nmdc:mga0k408_109436_c1 | |||
| 2972 | nmdc:mga0k408_133169_c1 | |||
| 2973 | nmdc:mga0k408_499912_c1 | |||
| 2974 | nmdc:mga0k408_881944_c1 | |||
| 2975 | nmdc:mga06z11_135991_c1 | |||
| 2976 | nmdc:mga06z11_143135_c1 | |||
| 2977 | nmdc:mga06z11_149909_c1 | |||
| 2978 | nmdc:mga06z11_6352_c1 | |||
| 2979 | nmdc:mga04h51_116979_c1 | |||
| 2980 | nmdc:mga04h51_241241_c1 | |||
| 2981 | nmdc:mga04h51_309069_c1 | |||
| 2982 | nmdc:mga04h51_350908_c1 | |||
| 2983 | nmdc:mga04h51_62207_c1 | |||
| 2984 | nmdc:mga07m45_308232_c1 | |||
| 2985 | nmdc:mga07m45_369704_c1 | |||
| 2986 | nmdc:mga07m45_43067_c1 | |||
| 2987 | nmdc:mga07m45_623799_c1 | |||
| 2988 | nmdc:mga06r32_201443_c1 | |||
| 2989 | nmdc:mga08y16_12_c1 | |||
| 2990 | nmdc:mga08y16_148583_c1 | |||
| 2991 | nmdc:mga08y16_858433_c1 | |||
| 2992 | nmdc:mga0n895_213386_c1 | |||
| 2993 | nmdc:mga0rr50_1022361_c1 | |||
| 2994 | nmdc:mga0rr50_1511783_c1 | |||
| 2995 | nmdc:mga0rr50_356859_c1 | |||
| 2996 | nmdc:mga0rr50_398223_c1 | |||
| 2997 | nmdc:mga08x19_117937_c1 | |||
| 2998 | nmdc:mga0a205_290952_c1 | |||
| 2999 | nmdc:mga0a205_62875_c1 | |||
| 3000 | nmdc:mga0sz30_110001_c1 | |||
| 3001 | nmdc:mga0sz30_140867_c1 | |||
| 3002 | nmdc:mga0sz30_41551_c1 | |||
| 3003 | Ga0495601_0083953 | |||
| 3004 | Ga0495601_0316216 | |||
| 3005 | Ga0495601_0582321 | |||
| 3006 | Ga0495655_0251909 | |||
| 3007 | Ga0495595_0240802 | |||
| 3008 | Ga0495619_0032650 | |||
| 3009 | Ga0500644_0036255 | |||
| 3010 | Ga0500650_0443934 | |||
| 3011 | Ga0500595_011249 | |||
| 3012 | Ga0500595_080771 | |||
| 3013 | Ga0500628_061402 | |||
| 3014 | Ga0500642_0148074 | |||
| 3015 | Ga0500588_0000160 | |||
| 3016 | Ga0501084_0285955 | |||
| 3017 | Ga0590075_079850 | |||
| 3018 | Ga0587082_123775 | |||
| 3019 | Ga0587083_0106630 | |||
| 3020 | Ga0587088_009150 | |||
| 3021 | Ga0587088_160033 | |||
| 3022 | Ga0587062_017899 | |||
| 3023 | Ga0587067_021806 | |||
| 3024 | Ga0587069_060719 | |||
| 3025 | Ga0587072_046400 | |||
| 3026 | Ga0587075_015894 | |||
| 3027 | Ga0587104_004120 | |||
| 3028 | Ga0587105_002691 | |||
| 3029 | Ga0587107_045183 | |||
| 3030 | Ga0587124_006915 | |||
| 3031 | Ga0587071_038705 | |||
| 3032 | Ga0587071_133895 | |||
| 3033 | Ga0587111_0102544 | |||
| 3034 | Ga0501082_1842569 | |||
| 3035 | 2509373386 | |||
| 3036 | 2510285363 | |||
| 3037 | 2510311375 | |||
| 3038 | 2510317604 | |||
| 3039 | 2512930985 | |||
| 3040 | 2512958717 | |||
| 3041 | 2513611068 | |||
| 3042 | 2514034868 | |||
| 3043 | 2514418508 | |||
| 3044 | 2548847635 | |||
| 3045 | 2588516674 | |||
| 3046 | 2599940448 | |||
| 3047 | 2643799876 | |||
| 3048 | 2643840504 | |||
| 3049 | 2643989283 | |||
| 3050 | 2644152856 | |||
| 3051 | 2644474876 | |||
| 3052 | 2688599534 | |||
| 3053 | 2694629732 | |||
| 3054 | 2694636395 | |||
| 3055 | 2723575872 | |||
| 3056 | 2729146746 | |||
| 3057 | 2756677250 | |||
| 3058 | 2774129613 | |||
| 3059 | 2792749867 | |||
| 3060 | 2795786503 | |||
| 3061 | 2809146783 | |||
| 3062 | 2828306718 | |||
| 3063 | 2838056618 | |||
| 3064 | 2844006330 | |||
| 3065 | 2844014809 | |||
| 3066 | 2847676065 | |||
| 3067 | 2847692707 | |||
| 3068 | 2856315852 | |||
| 3069 | 2856334052 | |||
| 3070 | 2856341279 | |||
| 3071 | 2856355262 | |||
| 3072 | 2856361103 | |||
| 3073 | 2856370624 | |||
| 3074 | 2857350544 | |||
| 3075 | 2857372817 | |||
| 3076 | 2869171425 | |||
| 3077 | 2869235123 | |||
| 3078 | 2869248067 | |||
| 3079 | 2869251384 | |||
| 3080 | 2869260540 | |||
| 3081 | 2869267095 | |||
| 3082 | 2869274911 | |||
| 3083 | 2869291648 | |||
| 3084 | 2871434858 | |||
| 3085 | 2871443414 | |||
| 3086 | 2871447774 | |||
| 3087 | 2871452772 | |||
| 3088 | 2871460495 | |||
| 3089 | 2871470858 | |||
| 3090 | 2871487103 | |||
| 3091 | 2871495481 | |||
| 3092 | 2871502751 | |||
| 3093 | 2874103897 | |||
| 3094 | 2874110085 | |||
| 3095 | 2874119714 | |||
| 3096 | 2874130979 | |||
| 3097 | 2874135031 | |||
| 3098 | 2874149247 | |||
| 3099 | 2874157512 | |||
| 3100 | 2874165530 | |||
| 3101 | 2874176099 | |||
| 3102 | 2876365864 | |||
| 3103 | 2876377563 | |||
| 3104 | 2876384737 | |||
| 3105 | 2876391667 | |||
| 3106 | 2876394713 | |||
| 3107 | 2876402210 | |||
| 3108 | 2876413579 | |||
| 3109 | 2876415714 | |||
| 3110 | 2876425035 | |||
| 3111 | 2878040120 | |||
| 3112 | 2878733601 | |||
| 3113 | 2878751992 | |||
| 3114 | 2878757895 | |||
| 3115 | 2878766643 | |||
| 3116 | 2878773840 | |||
| 3117 | 2878775418 | |||
| 3118 | 2878783977 | |||
| 3119 | 2881152065 | |||
| 3120 | 2881155787 | |||
| 3121 | 2881168042 | |||
| 3122 | 2881850866 | |||
| 3123 | 2881860291 | |||
| 3124 | 2881867465 | |||
| 3125 | 2882637090 | |||
| 3126 | 2882916591 | |||
| 3127 | 2885309926 | |||
| 3128 | 2885317012 | |||
| 3129 | 2885324934 | |||
| 3130 | 2885326933 | |||
| 3131 | 2885336051 | |||
| 3132 | 2885350497 | |||
| 3133 | 2885352730 | |||
| 3134 | 2888356291 | |||
| 3135 | 2889011215 | |||
| 3136 | 2889017060 | |||
| 3137 | 2894657464 | |||
| 3138 | 2903493449 | |||
| 3139 | 2903506641 | |||
| 3140 | 2903517332 | |||
| 3141 | 2903523812 | |||
| 3142 | 2903534327 | |||
| 3143 | 2903547890 | |||
| 3144 | 2904661345 | |||
| 3145 | 2906314386 | |||
| 3146 | 2906327555 | |||
| 3147 | 2906329410 | |||
| 3148 | 2906355938 | |||
| 3149 | 2906369130 | |||
| 3150 | 2906376577 | |||
| 3151 | 2906380163 | |||
| 3152 | 2906387057 | |||
| 3153 | 2906395976 | |||
| 3154 | 2906407137 | |||
| 3155 | 2906410659 | |||
| 3156 | 2906415989 | |||
| 3157 | 2906432640 | |||
| 3158 | 2917834581 | |||
| 3159 | 2919127225 | |||
| 3160 | 2919406581 | |||
| 3161 | 2922131987 | |||
| 3162 | 2922152585 | |||
| 3163 | 2922160098 | |||
| 3164 | 2922175959 | |||
| 3165 | 2922191098 | |||
| 3166 | 2924711439 | |||
| 3167 | 2924728055 | |||
| 3168 | 2924744929 | |||
| 3169 | 2924750967 | |||
| 3170 | 2924766926 | |||
| 3171 | 2924784609 | |||
| 3172 | 2937816310 | |||
| 3173 | 2937854970 | |||
| 3174 | 2937865365 | |||
| 3175 | 2937870369 | |||
| 3176 | 2937896728 | |||
| 3177 | 2937985532 | |||
| 3178 | 2938001768 | |||
| 3179 | 2938015808 | |||
| 3180 | 2958103020 | |||
| 3181 | 2958111112 | |||
| 3182 | 2958118901 | |||
| 3183 | 2958124321 | |||
| 3184 | 2958136048 | |||
| 3185 | 2958140455 | |||
| 3186 | 2958159728 | |||
| 3187 | 2958171823 | |||
| 3188 | 2958174434 | |||
| 3189 | 2958185515 | |||
| 3190 | 2961083893 | |||
| 3191 | 2961116499 | |||
| 3192 | 2961135427 | |||
| 3193 | 2961141554 | |||
| 3194 | 2961170269 | |||
| 3195 | 2961174439 | |||
| 3196 | 2961190131 | |||
| 3197 | 2963648239 | |||
| 3198 | 2965025015 | |||
| 3199 | 2965027771 | |||
| 3200 | 2965035252 | |||
| 3201 | 2965041277 | |||
| 3202 | 2965051594 | |||
| 3203 | 2965069091 | |||
| 3204 | 2965096148 | |||
| 3205 | 2965108067 | |||
| 3206 | 2965123722 | |||
| 3207 | 2968000430 | |||
| 3208 | 2968003659 | |||
| 3209 | 2968095824 | |||
| 3210 | 2968101049 | |||
| 3211 | 2968112405 | |||
| 3212 | 2968121200 | |||
| 3213 | 2968132773 | |||
| 3214 | 2968146124 | |||
| 3215 | 2968178656 | |||
| 3216 | 2970490220 | |||
| 3217 | 2970507026 | |||
| 3218 | 2970513035 | |||
| 3219 | 2970533245 | |||
| 3220 | 2970549423 | |||
| 3221 | 2970561501 | |||
| 3222 | 2970626669 | |||
| 3223 | 2970633751 | |||
| 3224 | 2974301986 | |||
| 3225 | 2977822428 | |||
| 3226 | 2977833098 | |||
| 3227 | 2977846544 | |||
| 3228 | 2977855462 | |||
| 3229 | 2977861521 | |||
| 3230 | 2977865750 | |||
| 3231 | 2977876214 | |||
| 3232 | 2977907042 | |||
| 3233 | 2977908240 | |||
| 3234 | 2977922223 | |||
| 3235 | 2977929359 | |||
| 3236 | 2977936874 | |||
| 3237 | 2977947744 | |||
| 3238 | 2977955493 | |||
| 3239 | 2977962774 | |||
| 3240 | 2977972123 | |||
| 3241 | 2977992801 | |||
| 3242 | 2979714445 | |||
| 3243 | 2979747397 | |||
| 3244 | 2979766569 | |||
| 3245 | 2979776549 | |||
| 3246 | 2979784568 | |||
| 3247 | 2979800424 | |||
| 3248 | 2979812221 | |||
| 3249 | 2984500446 | |||
| 3250 | 2984506959 | |||
| 3251 | 2987637728 | |||
| 3252 | 2987646190 | |||
| 3253 | 2987652794 | |||
| 3254 | 2987666510 | |||
| 3255 | 2987668733 | |||
| 3256 | 2987679705 | |||
| 3257 | 2996341117 | |||
| 3258 | 2996346655 | |||
| 3259 | 2996393026 | |||
| 3260 | 3000140075 | |||
| 3261 | 3003933593 | |||
| 3262 | 3004195512 | |||
| 3263 | 3004197669 | |||
| 3264 | 3004205950 | |||
| 3265 | 3004211783 | |||
| 3266 | 3004219030 | |||
| 3267 | 3004235852 | |||
| 3268 | 3004241752 | |||
| 3269 | 3004251017 | |||
| 3270 | 3004274626 | |||
| 3271 | 637074027 | |||
| 3272 | 649874037 | |||
| 3273 | 8004302354 | |||
| 3274 | 8004365256 | |||
| 3275 | 8004379407 | |||
| 3276 | 8004394625 | |||
| 3277 | 8004447623 | |||
| 3278 | 8004640217 | |||
| 3279 | 8004702278 | |||
| 3280 | 8004709803 | |||
| 3281 | 8004720649 | |||
| 3282 | 8004728410 | |||
| 3283 | 8016730978 | |||
| 3284 | 8047673274 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9934 | 3 | 121 |
| 1zko-assembly1.cif.gz_A | crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution | 0.9907 | 1 | 120 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9865 | 3 | 121 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9706 | 1 | 119 |
| 2ka7-assembly1.cif.gz_A | nmr solution structure of tm0212 at 40 c | 0.9673 | 1 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9968 | 4 | 120 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9936 | 3 | 121 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9935 | 1 | 122 | 2.40.50.100 |
| af_Q9U616_24_160_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9872 | 3 | 122 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9855 | 1 | 122 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A5KCJ1-F1-model_v4 | Glycine cleavage system H protein | 1.005 | 1 | 122 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A090GV12-F1-model_v4 | Glycine cleavage system H protein | 1.004 | 1 | 122 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A440D7A1-F1-model_v4 | deleted | 1.004 | 1 | 122 |
|
| AF-A0A3S0HHE3-F1-model_v4 | Glycine cleavage system H protein | 1.004 | 1 | 122 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A5F2GW17-F1-model_v4 | Glycine cleavage system H protein | 1.004 | 1 | 122 |
GO:0005829
GO:0005960 GO:0019464 |