F495083

General Info

Members Datasets Scaffolds Average Seq Length
1621 475 1526 380

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0004331|Ga0496106_0004331_5791_7104
Length 437
Sequence MFDDAGLVIITMASHHPAKAGKRPLGVFFDAGFPVPRLSSGGSFMTGVRFGELDAASPTRIARIETFIVPPRWLFVRVETRDGAVGWGEASLEGHAEAVEGAFASLRERFVGADPDNIEDIWQVAYRGGFYRGGPVLMSALSGLDQALWDLKGRRLGVPVWQLLGGRVRDRVPVYAWIGGDRPHEVVEAAKARMDQGFKAVKMNATGETHWLDGTRVFDEALERVAAVKALGLDVAVDFHGRLHKPMAKQLAVALQLLEPLFIEEPLLSENIEAIVQLSRLTSVPIALGERLYSRWDFKPFFEAAAVDVIQPDLSHAGGLSECRRIAAMAEAYDVAIAPHCPLGPLALGACMQLALTTPNFVIQEMSLGIHYNVGHDLLSYMRNPEVFDVRDGMVDTLRGPGLGVEIDEDMVRAAAKDAPTWRNPIWRGEDGSVREW

Samples

Sample ID Description Type Environment
1 2512875024 Mesorhizobium loti R88b Isolate Nodule
2 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
3 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
4 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
5 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
6 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
7 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
8 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
9 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
10 2643221647 Streptomyces sp. Root369 Isolate Unclassified
11 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
12 2643221731 Bacillus sp. Root147 Isolate Unclassified
13 2643221732 Bacillus sp. Root239 Isolate Unclassified
14 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
15 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
16 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
17 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
18 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
19 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
20 2818991441 Niallia circulans 3243 Isolate Rhizosphere
21 2818991459 Paenibacillus sp. 597 Isolate Unclassified
22 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
23 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
24 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
25 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
26 2849560528 Caulobacter zeae 410 Isolate Unclassified
27 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
28 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
29 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
30 2857472729 Cohnella sp. R-74144 Isolate Unclassified
31 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
32 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
33 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
34 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
35 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
36 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
37 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
38 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
39 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
40 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
41 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
42 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
43 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
44 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
45 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
46 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
47 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
48 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
49 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
50 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
51 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
52 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
53 2919720352 Priestia megaterium 4340 Isolate Unclassified
54 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
55 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
56 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
57 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
58 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
59 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
60 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
61 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
62 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
63 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
64 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
65 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
66 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
67 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
68 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
69 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
70 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
71 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
72 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
73 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
74 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
75 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
76 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
77 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
78 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
79 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
80 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
81 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
82 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
83 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
84 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
85 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
86 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
87 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
88 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
89 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
90 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
91 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
92 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
93 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
94 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
95 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
96 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
97 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
98 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
100 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
101 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
102 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
103 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
104 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
105 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
106 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
109 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
110 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
111 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
112 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
113 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
114 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
115 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
116 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
117 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
118 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
119 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
120 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
121 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
122 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
123 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
124 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
125 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
126 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
127 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
128 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
129 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
130 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
131 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
132 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
133 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
134 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
135 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
136 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
137 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
138 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
139 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
140 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
141 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
142 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
143 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
144 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
145 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
146 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
147 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
148 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
149 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
150 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
151 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
152 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
153 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
154 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
155 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
156 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
157 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
158 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
159 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
160 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
161 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
162 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
163 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
164 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
165 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
166 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
167 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
168 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
169 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
170 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
171 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
172 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
173 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
174 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
175 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
176 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
177 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
178 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
179 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
180 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
181 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
182 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
183 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
184 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
197 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
198 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
209 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
210 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
211 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
212 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
213 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
214 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
215 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
216 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
217 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
218 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
220 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
221 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
222 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
223 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
228 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
229 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
230 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
232 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
295 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
299 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
300 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
301 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
302 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
303 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
304 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
305 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
306 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
307 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
308 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
309 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
312 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
313 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
314 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
315 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
316 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
317 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
318 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
319 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
320 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
321 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
322 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
323 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
324 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
325 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
326 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
327 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
328 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
331 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
332 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
333 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
334 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
335 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
338 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
339 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
340 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
341 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
342 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
343 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
344 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
345 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
346 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
347 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
348 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
349 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
350 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
351 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
352 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
353 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
354 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
355 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
356 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
357 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
358 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
359 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
360 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
361 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
362 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
363 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
364 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
365 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
366 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
369 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
370 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
371 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
372 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
373 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
374 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
375 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
376 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
377 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
378 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
379 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
380 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
381 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
382 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
383 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
384 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
385 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
386 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
387 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
388 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
391 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
392 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
393 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
394 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
395 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
396 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
397 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
398 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
399 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
400 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
401 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
402 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
403 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
406 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
407 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
408 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
409 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
410 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
411 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
412 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
413 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
414 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
415 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
418 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
419 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
420 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
437 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
438 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
439 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
440 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
441 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
442 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
443 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
444 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
447 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
448 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
452 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
453 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
454 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
455 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
456 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
457 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
458 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
459 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
460 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
461 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
462 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
463 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
464 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
465 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
466 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
467 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
468 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
469 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
470 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
471 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
472 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
473 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
474 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
475 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.77
Metatranscriptomes 0.37
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 1.97
Rhizoplane 5.12
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1007542 3300000549 Bacteria 1336
2 JGI24752J21851_1000015 3300001976 Bacteria 19272
3 JGI24740J21852_10001942 3300001979 Bacteria 9463
4 JGI24740J21852_10002481 3300001979 Bacteria 8344
5 JGI24740J21852_10030586 3300001979 Bacteria 1749
6 JGI24739J22299_10000129 3300001989 Bacteria 23885
7 JGI24739J22299_10001243 3300001989 Bacteria 9585
8 JGI24739J22299_10010594 3300001989 Bacteria 3420
9 JGI24737J22298_10000357 3300001990 Bacteria 15471
10 JGI24735J21928_10003791 3300002067 Bacteria 5127
11 JGI24735J21928_10004250 3300002067 Bacteria 4831
12 JGI24750J21931_1000434 3300002070 Bacteria 6806
13 JGI24748J21848_1000013 3300002074 Bacteria 149648
14 JGI24738J21930_10001003 3300002075 Bacteria 8082
15 JGI24034J26672_10000011 3300002239 Bacteria 148169
16 JGI25152J39213_1000138 3300002773 Bacteria 50113
17 JGI25406J46586_10023598 3300003203 Bacteria 2429
18 JGI25165J46597_1000210 3300003214 Bacteria 83572
19 rootH2_10050297 3300003320 Bacteria 7719
20 rootH2_10150611 3300003320 Bacteria 5362
21 rootL2_10101515 3300003322 Bacteria 5323
22 rootH1_10031917 3300003323 Bacteria 6022
23 rootH1_10148928 3300003323 Bacteria 4042
24 Ga0006562J51391_1009051 3300003578 Bacteria 3878
25 Ga0055538_1000322 3300003751 Bacteria 22149
26 Ga0055541_1003007 3300003841 Bacteria 3244
27 Ga0055541_1007684 3300003841 Bacteria 1757
28 Ga0065714_10004129 3300005288 Bacteria 6178
29 Ga0065704_10000326 3300005289 Bacteria 76230
30 Ga0065712_10075748 3300005290 Bacteria 3797
31 Ga0065707_10081772 3300005295 Bacteria 43824
32 Ga0070658_10000029 3300005327 Bacteria 156910
33 Ga0070658_10015513 3300005327 Bacteria 6093
34 Ga0070658_10019049 3300005327 Bacteria 5497
35 Ga0070658_10035022 3300005327 Bacteria 4042
36 Ga0070658_10046977 3300005327 Bacteria 3493
37 Ga0070658_10050553 3300005327 Bacteria 3369
38 Ga0070658_10056234 3300005327 Bacteria 3197
39 Ga0070658_10093432 3300005327 Bacteria 2481
40 Ga0070658_10134521 3300005327 Bacteria 2062
41 Ga0070658_10136067 3300005327 Bacteria 2050
42 Ga0070658_10168122 3300005327 Bacteria 1842
43 Ga0070676_10013130 3300005328 Bacteria 4538
44 Ga0070676_10048337 3300005328 Bacteria 2487
45 Ga0070676_10095230 3300005328 Bacteria 1830
46 Ga0070676_10103857 3300005328 Bacteria 1760
47 Ga0070683_100000209 3300005329 Bacteria 39666
48 Ga0070683_100054521 3300005329 Bacteria 3707
49 Ga0070690_100000015 3300005330 Bacteria 86483
50 Ga0070690_100012081 3300005330 Bacteria 5071
51 Ga0070670_100000265 3300005331 Bacteria 46560
52 Ga0070670_100000333 3300005331 Bacteria 39598
53 Ga0070670_100010774 3300005331 Bacteria 7810
54 Ga0070670_100011548 3300005331 Bacteria 7552
55 Ga0070670_100014114 3300005331 Bacteria 6852
56 Ga0070670_100056692 3300005331 Bacteria 3363
57 Ga0070670_100066739 3300005331 Bacteria 3087
58 Ga0070670_100098713 3300005331 Bacteria 2513
59 Ga0070670_100116628 3300005331 Bacteria 2302
60 Ga0070670_100201606 3300005331 Bacteria 1729
61 Ga0070677_10044276 3300005333 Bacteria 1770
62 Ga0068869_100000331 3300005334 Bacteria 25170
63 Ga0070666_10000059 3300005335 Bacteria 86483
64 Ga0070666_10000822 3300005335 Bacteria 18838
65 Ga0070666_10000924 3300005335 Bacteria 17819
66 Ga0070666_10001749 3300005335 Bacteria 13256
67 Ga0070666_10026371 3300005335 Bacteria 3796
68 Ga0070666_10026417 3300005335 Bacteria 3793
69 Ga0070666_10056586 3300005335 Bacteria 2649
70 Ga0070666_10090125 3300005335 Bacteria 2106
71 Ga0070680_100001008 3300005336 Bacteria 20096
72 Ga0070680_100001026 3300005336 Bacteria 19977
73 Ga0070680_100013601 3300005336 Bacteria 6343
74 Ga0070680_100041386 3300005336 Bacteria 3736
75 Ga0070680_100123252 3300005336 Bacteria 2165
76 Ga0070680_100208480 3300005336 Bacteria 1649
77 Ga0070682_100000911 3300005337 Bacteria 17294
78 Ga0070682_100006572 3300005337 Bacteria 6522
79 Ga0070682_100056759 3300005337 Bacteria 2464
80 Ga0070682_100132525 3300005337 Bacteria 1688
81 Ga0068868_100000156 3300005338 Bacteria 44526
82 Ga0068868_100002559 3300005338 Bacteria 12640
83 Ga0068868_100044269 3300005338 Bacteria 3480
84 Ga0068868_100124156 3300005338 Bacteria 2107
85 Ga0070660_100002984 3300005339 Bacteria 11653
86 Ga0070660_100002991 3300005339 Bacteria 11638
87 Ga0070660_100004528 3300005339 Bacteria 9606
88 Ga0070660_100011417 3300005339 Bacteria 6308
89 Ga0070660_100012339 3300005339 Bacteria 6099
90 Ga0070660_100018362 3300005339 Bacteria 5109
91 Ga0070660_100019062 3300005339 Bacteria 5023
92 Ga0070660_100026651 3300005339 Bacteria 4306
93 Ga0070660_100034110 3300005339 Bacteria 3843
94 Ga0070660_100046442 3300005339 Bacteria 3329
95 Ga0070660_100068479 3300005339 Bacteria 2767
96 Ga0070660_100071425 3300005339 Bacteria 2710
97 Ga0070660_100075563 3300005339 Bacteria 2638
98 Ga0070660_100082431 3300005339 Bacteria 2525
99 Ga0070660_100108282 3300005339 Bacteria 2208
100 Ga0070660_100185182 3300005339 Bacteria 1686
101 Ga0070660_100245582 3300005339 Bacteria 1459
102 Ga0070691_10004057 3300005341 Bacteria 6635
103 Ga0070691_10043237 3300005341 Bacteria 2134
104 Ga0070661_100000055 3300005344 Bacteria 88266
105 Ga0070661_100000452 3300005344 Bacteria 31380
106 Ga0070661_100003453 3300005344 Bacteria 10905
107 Ga0070661_100005269 3300005344 Bacteria 8906
108 Ga0070661_100007519 3300005344 Bacteria 7515
109 Ga0070661_100032834 3300005344 Bacteria 3758
110 Ga0070661_100041781 3300005344 Bacteria 3346
111 Ga0070661_100060605 3300005344 Bacteria 2776
112 Ga0070661_100067281 3300005344 Bacteria 2632
113 Ga0070661_100072538 3300005344 Bacteria 2533
114 Ga0070661_100091640 3300005344 Bacteria 2251
115 Ga0070661_100107098 3300005344 Bacteria 2084
116 Ga0070661_100142069 3300005344 Bacteria 1809
117 Ga0070692_10001859 3300005345 Bacteria 7937
118 Ga0070692_10003716 3300005345 Bacteria 6261
119 Ga0070692_10006583 3300005345 Bacteria 5054
120 Ga0070692_10011780 3300005345 Bacteria 4028
121 Ga0070692_10016014 3300005345 Bacteria 3559
122 Ga0070692_10027252 3300005345 Bacteria 2831
123 Ga0070692_10028647 3300005345 Bacteria 2770
124 Ga0070668_100000208 3300005347 Bacteria 38503
125 Ga0070668_100000591 3300005347 Bacteria 24275
126 Ga0070668_100007660 3300005347 Bacteria 8014
127 Ga0070668_100036966 3300005347 Bacteria 3727
128 Ga0070668_100116817 3300005347 Bacteria 2128
129 Ga0070669_100000014 3300005353 Bacteria 206875
130 Ga0070669_100000018 3300005353 Bacteria 195789
131 Ga0070669_100000383 3300005353 Bacteria 33931
132 Ga0070669_100000547 3300005353 Bacteria 27940
133 Ga0070669_100025265 3300005353 Bacteria 4266
134 Ga0070669_100037421 3300005353 Bacteria 3520
135 Ga0070669_100165980 3300005353 Bacteria 1719
136 Ga0070675_100025854 3300005354 Bacteria 4707
137 Ga0070675_100051525 3300005354 Bacteria 3382
138 Ga0070675_100147595 3300005354 Bacteria 2015
139 Ga0070675_100244746 3300005354 Bacteria 1568
140 Ga0070671_100000011 3300005355 Bacteria 202057
141 Ga0070671_100000138 3300005355 Bacteria 46941
142 Ga0070671_100002540 3300005355 Bacteria 14140
143 Ga0070671_100003224 3300005355 Bacteria 12714
144 Ga0070671_100003249 3300005355 Bacteria 12681
145 Ga0070671_100003781 3300005355 Bacteria 11876
146 Ga0070671_100008552 3300005355 Bacteria 8206
147 Ga0070671_100022349 3300005355 Bacteria 5165
148 Ga0070671_100023574 3300005355 Bacteria 5038
149 Ga0070671_100025830 3300005355 Bacteria 4822
150 Ga0070671_100042370 3300005355 Bacteria 3783
151 Ga0070671_100125996 3300005355 Bacteria 2156
152 Ga0070671_100151273 3300005355 Bacteria 1960
153 Ga0070674_100004496 3300005356 Bacteria 7955
154 Ga0070674_100059472 3300005356 Bacteria 2660
155 Ga0070673_100000249 3300005364 Bacteria 27281
156 Ga0070673_100003351 3300005364 Bacteria 9957
157 Ga0070673_100004608 3300005364 Bacteria 8741
158 Ga0070673_100006422 3300005364 Bacteria 7641
159 Ga0070673_100011717 3300005364 Bacteria 5995
160 Ga0070673_100016074 3300005364 Bacteria 5281
161 Ga0070673_100020978 3300005364 Bacteria 4724
162 Ga0070673_100050456 3300005364 Bacteria 3254
163 Ga0070673_100155268 3300005364 Bacteria 1942
164 Ga0070673_100180969 3300005364 Bacteria 1805
165 Ga0070688_100001575 3300005365 Bacteria 11401
166 Ga0070659_100000138 3300005366 Bacteria 56073
167 Ga0070659_100000814 3300005366 Bacteria 22773
168 Ga0070659_100001062 3300005366 Bacteria 20090
169 Ga0070659_100001635 3300005366 Bacteria 16140
170 Ga0070659_100003157 3300005366 Bacteria 11739
171 Ga0070659_100043899 3300005366 Bacteria 3497
172 Ga0070659_100064535 3300005366 Bacteria 2898
173 Ga0070659_100085565 3300005366 Bacteria 2522
174 Ga0070659_100104108 3300005366 Bacteria 2286
175 Ga0070659_100135631 3300005366 Bacteria 2001
176 Ga0070667_100001760 3300005367 Bacteria 19301
177 Ga0070667_100001996 3300005367 Bacteria 18084
178 Ga0070667_100003528 3300005367 Bacteria 13330
179 Ga0070667_100005828 3300005367 Bacteria 10276
180 Ga0070667_100006388 3300005367 Bacteria 9794
181 Ga0070667_100014945 3300005367 Bacteria 6413
182 Ga0070667_100026953 3300005367 Bacteria 4780
183 Ga0070667_100035104 3300005367 Bacteria 4200
184 Ga0070667_100059501 3300005367 Bacteria 3232
185 Ga0070667_100061428 3300005367 Bacteria 3181
186 Ga0070667_100080608 3300005367 Bacteria 2784
187 Ga0070667_100089958 3300005367 Bacteria 2637
188 Ga0070667_100097262 3300005367 Bacteria 2539
189 Ga0070667_100235258 3300005367 Bacteria 1634
190 Ga0070714_100139803 3300005435 Bacteria 2172
191 Ga0070714_100267670 3300005435 Bacteria 1584
192 Ga0070714_100318743 3300005435 Bacteria 1453
193 Ga0070713_100005721 3300005436 Bacteria 8537
194 Ga0070713_100033460 3300005436 Bacteria 4118
195 Ga0070713_100139352 3300005436 Bacteria 2147
196 Ga0070710_10016872 3300005437 Bacteria 3727
197 Ga0070705_100016857 3300005440 Bacteria 3804
198 Ga0070694_100003977 3300005444 Bacteria 8844
199 Ga0070694_100018841 3300005444 Bacteria 4385
200 Ga0070708_100019568 3300005445 Bacteria 5692
201 Ga0070663_100001943 3300005455 Bacteria 11539
202 Ga0070663_100005160 3300005455 Bacteria 7733
203 Ga0070663_100009792 3300005455 Bacteria 5953
204 Ga0070663_100015781 3300005455 Bacteria 4886
205 Ga0070663_100070917 3300005455 Bacteria 2534
206 Ga0070663_100085961 3300005455 Bacteria 2322
207 Ga0070663_100111925 3300005455 Bacteria 2052
208 Ga0070663_100163391 3300005455 Bacteria 1716
209 Ga0070678_100002527 3300005456 Bacteria 10025
210 Ga0070678_100040203 3300005456 Bacteria 3307
211 Ga0070662_100000410 3300005457 Bacteria 25434
212 Ga0070662_100001186 3300005457 Bacteria 15980
213 Ga0070662_100001575 3300005457 Bacteria 14101
214 Ga0070662_100005039 3300005457 Bacteria 8406
215 Ga0070662_100017550 3300005457 Bacteria 4827
216 Ga0070662_100034654 3300005457 Bacteria 3561
217 Ga0070662_100167063 3300005457 Bacteria 1725
218 Ga0070662_100215002 3300005457 Bacteria 1531
219 Ga0070681_10001014 3300005458 Bacteria 23751
220 Ga0070681_10010375 3300005458 Bacteria 9199
221 Ga0070681_10102557 3300005458 Bacteria 2806
222 Ga0070681_10124855 3300005458 Bacteria 2506
223 Ga0068867_100007188 3300005459 Bacteria 7869
224 Ga0068867_100014158 3300005459 Bacteria 5649
225 Ga0068867_100028424 3300005459 Bacteria 4026
226 Ga0070685_10000034 3300005466 Bacteria 81799
227 Ga0070706_100000486 3300005467 Bacteria 46746
228 Ga0070706_100061886 3300005467 Bacteria 3457
229 Ga0070698_100027244 3300005471 Bacteria 5946
230 Ga0070698_100215516 3300005471 Bacteria 1854
231 Ga0070699_100215973 3300005518 Unclassified 1708
232 Ga0070679_100000027 3300005530 Bacteria 114873
233 Ga0070679_100016295 3300005530 Bacteria 7162
234 Ga0070679_100035208 3300005530 Bacteria 4967
235 Ga0070679_100037121 3300005530 Bacteria 4838
236 Ga0070679_100072968 3300005530 Bacteria 3424
237 Ga0070684_100004466 3300005535 Bacteria 10652
238 Ga0070697_100155128 3300005536 Bacteria 1932
239 Ga0068853_100000479 3300005539 Bacteria 27267
240 Ga0068853_100001793 3300005539 Bacteria 15788
241 Ga0068853_100015391 3300005539 Bacteria 6283
242 Ga0068853_100015680 3300005539 Bacteria 6223
243 Ga0068853_100023329 3300005539 Bacteria 5178
244 Ga0068853_100027977 3300005539 Bacteria 4741
245 Ga0068853_100099081 3300005539 Bacteria 2574
246 Ga0068853_100166964 3300005539 Bacteria 1989
247 Ga0068853_100267374 3300005539 Bacteria 1574
248 Ga0070672_100006526 3300005543 Bacteria 7843
249 Ga0070672_100016187 3300005543 Bacteria 5334
250 Ga0070672_100055472 3300005543 Bacteria 3104
251 Ga0070672_100077915 3300005543 Bacteria 2651
252 Ga0070672_100129659 3300005543 Bacteria 2072
253 Ga0070672_100216691 3300005543 Bacteria 1605
254 Ga0070686_100000023 3300005544 Bacteria 130174
255 Ga0070695_100116778 3300005545 Bacteria 1820
256 Ga0070696_100006403 3300005546 Bacteria 7881
257 Ga0070693_100019343 3300005547 Bacteria 3567
258 Ga0070693_100088625 3300005547 Bacteria 1861
259 Ga0070693_100112654 3300005547 Bacteria 1676
260 Ga0070665_100000019 3300005548 Bacteria 413972
261 Ga0070665_100011777 3300005548 Bacteria 8833
262 Ga0070665_100014723 3300005548 Bacteria 7847
263 Ga0070665_100016127 3300005548 Bacteria 7497
264 Ga0070665_100046267 3300005548 Bacteria 4371
265 Ga0070665_100063123 3300005548 Bacteria 3714
266 Ga0070665_100065942 3300005548 Bacteria 3631
267 Ga0070665_100068081 3300005548 Bacteria 3569
268 Ga0070665_100153459 3300005548 Bacteria 2305
269 Ga0070665_100168006 3300005548 Bacteria 2195
270 Ga0070665_100205763 3300005548 Bacteria 1969
271 Ga0070665_100344960 3300005548 Bacteria 1494
272 Ga0068855_100000163 3300005563 Bacteria 85587
273 Ga0068855_100004220 3300005563 Bacteria 17542
274 Ga0068855_100014035 3300005563 Bacteria 9657
275 Ga0068855_100017460 3300005563 Bacteria 8631
276 Ga0068855_100035645 3300005563 Bacteria 5926
277 Ga0068855_100058082 3300005563 Bacteria 4532
278 Ga0068855_100133095 3300005563 Bacteria 2838
279 Ga0068855_100154414 3300005563 Bacteria 2609
280 Ga0068855_100449656 3300005563 Bacteria 1406
281 Ga0068855_100472127 3300005563 Bacteria 1366
282 Ga0070664_100000544 3300005564 Bacteria 28761
283 Ga0070664_100001299 3300005564 Bacteria 19974
284 Ga0070664_100002185 3300005564 Bacteria 15712
285 Ga0070664_100009697 3300005564 Bacteria 7811
286 Ga0070664_100013307 3300005564 Bacteria 6700
287 Ga0070664_100014974 3300005564 Bacteria 6329
288 Ga0070664_100025960 3300005564 Bacteria 4856
289 Ga0070664_100026091 3300005564 Bacteria 4844
290 Ga0070664_100062360 3300005564 Bacteria 3178
291 Ga0070664_100069993 3300005564 Bacteria 3003
292 Ga0070664_100152282 3300005564 Bacteria 2042
293 Ga0068857_100000282 3300005577 Bacteria 34844
294 Ga0068857_100002754 3300005577 Bacteria 14445
295 Ga0068857_100002765 3300005577 Bacteria 14412
296 Ga0068857_100010471 3300005577 Bacteria 8060
297 Ga0068857_100017928 3300005577 Bacteria 6209
298 Ga0068857_100027407 3300005577 Bacteria 5026
299 Ga0068857_100055403 3300005577 Bacteria 3519
300 Ga0068857_100081064 3300005577 Bacteria 2898
301 Ga0068854_100001188 3300005578 Bacteria 15628
302 Ga0068854_100001438 3300005578 Bacteria 14407
303 Ga0068854_100004579 3300005578 Bacteria 8720
304 Ga0068854_100005135 3300005578 Bacteria 8253
305 Ga0068854_100007835 3300005578 Bacteria 6834
306 Ga0068854_100034460 3300005578 Bacteria 3536
307 Ga0068854_100039635 3300005578 Bacteria 3320
308 Ga0068854_100052257 3300005578 Bacteria 2930
309 Ga0068854_100057710 3300005578 Bacteria 2800
310 Ga0068856_100000829 3300005614 Bacteria 33313
311 Ga0068856_100008781 3300005614 Bacteria 9830
312 Ga0068856_100015666 3300005614 Bacteria 7329
313 Ga0068856_100258308 3300005614 Bacteria 1757
314 Ga0068852_100001212 3300005616 Bacteria 17137
315 Ga0068852_100005039 3300005616 Bacteria 9392
316 Ga0068852_100022025 3300005616 Bacteria 5101
317 Ga0068852_100042999 3300005616 Bacteria 3829
318 Ga0068852_100045754 3300005616 Bacteria 3725
319 Ga0068852_100114387 3300005616 Bacteria 2458
320 Ga0068852_100120257 3300005616 Bacteria 2403
321 Ga0068852_100204035 3300005616 Bacteria 1872
322 Ga0068852_100235157 3300005616 Bacteria 1748
323 Ga0068859_100003915 3300005617 Bacteria 15202
324 Ga0068859_100005794 3300005617 Bacteria 12552
325 Ga0068859_100023456 3300005617 Bacteria 6192
326 Ga0068859_100036132 3300005617 Bacteria 4959
327 Ga0068859_100046411 3300005617 Bacteria 4362
328 Ga0068859_100093009 3300005617 Bacteria 3067
329 Ga0068859_100134443 3300005617 Bacteria 2545
330 Ga0068859_100140264 3300005617 Bacteria 2491
331 Ga0068859_100206557 3300005617 Bacteria 2049
332 Ga0068859_100424013 3300005617 Bacteria 1427
333 Ga0068864_100000173 3300005618 Bacteria 59516
334 Ga0068864_100001720 3300005618 Bacteria 17993
335 Ga0068864_100006305 3300005618 Bacteria 9731
336 Ga0068864_100006342 3300005618 Bacteria 9700
337 Ga0068864_100006905 3300005618 Bacteria 9309
338 Ga0068864_100012818 3300005618 Bacteria 6932
339 Ga0068864_100031578 3300005618 Bacteria 4495
340 Ga0068864_100077173 3300005618 Bacteria 2913
341 Ga0068864_100114965 3300005618 Bacteria 2400
342 Ga0068864_100230990 3300005618 Bacteria 1711
343 Ga0068866_10009444 3300005718 Bacteria 4142
344 Ga0068861_100002173 3300005719 Bacteria 12731
345 Ga0068861_100002954 3300005719 Bacteria 11229
346 Ga0068861_100327675 3300005719 Bacteria 1336
347 Ga0068851_10013555 3300005834 Bacteria 3858
348 Ga0068851_10019101 3300005834 Bacteria 3310
349 Ga0068851_10020603 3300005834 Bacteria 3194
350 Ga0068851_10098791 3300005834 Bacteria 1546
351 Ga0068863_100000044 3300005841 Bacteria 149959
352 Ga0068863_100000131 3300005841 Bacteria 79059
353 Ga0068863_100000816 3300005841 Bacteria 31200
354 Ga0068863_100000921 3300005841 Bacteria 29492
355 Ga0068863_100003770 3300005841 Bacteria 14990
356 Ga0068863_100010883 3300005841 Bacteria 8821
357 Ga0068863_100055996 3300005841 Bacteria 3733
358 Ga0068863_100056031 3300005841 Bacteria 3732
359 Ga0068863_100093128 3300005841 Bacteria 2860
360 Ga0068863_100098332 3300005841 Bacteria 2779
361 Ga0068858_100001349 3300005842 Bacteria 25309
362 Ga0068858_100002655 3300005842 Bacteria 18004
363 Ga0068858_100003690 3300005842 Bacteria 15171
364 Ga0068858_100003884 3300005842 Bacteria 14758
365 Ga0068858_100005521 3300005842 Bacteria 12381
366 Ga0068858_100009461 3300005842 Bacteria 9296
367 Ga0068858_100017613 3300005842 Bacteria 6696
368 Ga0068858_100045120 3300005842 Bacteria 4084
369 Ga0068858_100048457 3300005842 Bacteria 3937
370 Ga0068858_100060194 3300005842 Bacteria 3510
371 Ga0068858_100069382 3300005842 Bacteria 3267
372 Ga0068858_100104431 3300005842 Bacteria 2643
373 Ga0068858_100118044 3300005842 Bacteria 2480
374 Ga0068860_100000229 3300005843 Bacteria 86483
375 Ga0068860_100001926 3300005843 Bacteria 21977
376 Ga0068860_100003370 3300005843 Bacteria 16440
377 Ga0068860_100006472 3300005843 Bacteria 11762
378 Ga0068860_100009386 3300005843 Bacteria 9725
379 Ga0068860_100014106 3300005843 Bacteria 7840
380 Ga0068860_100017319 3300005843 Bacteria 7020
381 Ga0068860_100042596 3300005843 Bacteria 4334
382 Ga0068860_100056062 3300005843 Bacteria 3747
383 Ga0068860_100189540 3300005843 Bacteria 1990
384 Ga0068860_100228587 3300005843 Bacteria 1808
385 Ga0068860_100411876 3300005843 Bacteria 1339
386 Ga0068862_100000097 3300005844 Bacteria 104686
387 Ga0068862_100001102 3300005844 Bacteria 25644
388 Ga0068862_100001850 3300005844 Bacteria 19179
389 Ga0068862_100022798 3300005844 Bacteria 5239
390 Ga0068862_100038167 3300005844 Bacteria 4073
391 Ga0068862_100039098 3300005844 Bacteria 4027
392 Ga0068862_100048277 3300005844 Bacteria 3634
393 Ga0068862_100052452 3300005844 Bacteria 3489
394 Ga0068862_100072551 3300005844 Bacteria 2974
395 Ga0068862_100177959 3300005844 Bacteria 1908
396 Ga0068862_100374489 3300005844 Bacteria 1326
397 Ga0081455_10000675 3300005937 Bacteria 44142
398 Ga0081539_10004604 3300005985 Bacteria 15046
399 Ga0081539_10005951 3300005985 Bacteria 12026
400 Ga0081539_10040287 3300005985 Bacteria 2743
401 Ga0070717_10123685 3300006028 Bacteria 2219
402 Ga0070712_100022944 3300006175 Bacteria 4115
403 Ga0097621_100002177 3300006237 Bacteria 13408
404 Ga0097621_100161811 3300006237 Bacteria 1924
405 Ga0097621_100280209 3300006237 Bacteria 1467
406 Ga0068871_100012935 3300006358 Bacteria 6180
407 Ga0068871_100027524 3300006358 Bacteria 4448
408 Ga0068871_100150555 3300006358 Bacteria 1984
409 Ga0068871_100192329 3300006358 Bacteria 1758
410 Ga0075428_100301389 3300006844 Bacteria 1723
411 Ga0075428_100522712 3300006844 Unclassified 1269
412 Ga0075431_100007044 3300006847 Bacteria 11168
413 Ga0068865_100016371 3300006881 Bacteria 4744
414 Ga0068865_100016787 3300006881 Bacteria 4692
415 Ga0068865_100035927 3300006881 Bacteria 3336
416 Ga0075436_100267541 3300006914 Bacteria 1220
417 Ga0097620_100003915 3300006931 Bacteria 15202
418 Ga0097620_100005794 3300006931 Bacteria 12552
419 Ga0097620_100023456 3300006931 Bacteria 6192
420 Ga0097620_100036130 3300006931 Bacteria 4959
421 Ga0097620_100046410 3300006931 Bacteria 4362
422 Ga0097620_100093006 3300006931 Bacteria 3067
423 Ga0097620_100134449 3300006931 Bacteria 2545
424 Ga0097620_100140269 3300006931 Bacteria 2491
425 Ga0097620_100206567 3300006931 Bacteria 2049
426 Ga0097620_100423982 3300006931 Bacteria 1427
427 Ga0099795_10000020 3300007788 Bacteria 59011
428 Ga0099795_10000692 3300007788 Bacteria 6512
429 Ga0105240_10000022 3300009093 Bacteria 387911
430 Ga0105240_10000078 3300009093 Bacteria 196646
431 Ga0105240_10007481 3300009093 Bacteria 15848
432 Ga0105240_10010752 3300009093 Bacteria 12836
433 Ga0105240_10020736 3300009093 Bacteria 8756
434 Ga0105240_10056203 3300009093 Bacteria 4925
435 Ga0105240_10065379 3300009093 Bacteria 4515
436 Ga0105240_10134814 3300009093 Bacteria 2958
437 Ga0105240_10148929 3300009093 Bacteria 2789
438 Ga0105240_10430218 3300009093 Bacteria 1481
439 Ga0111539_10006409 3300009094 Bacteria 15174
440 Ga0111539_10008489 3300009094 Bacteria 13056
441 Ga0111539_10225985 3300009094 Bacteria 2180
442 Ga0111539_10311352 3300009094 Bacteria 1832
443 Ga0111539_10364437 3300009094 Unclassified 1682
444 Ga0105245_10000326 3300009098 Bacteria 44899
445 Ga0105245_10024639 3300009098 Bacteria 5285
446 Ga0105245_10166850 3300009098 Bacteria 2093
447 Ga0105245_10291403 3300009098 Bacteria 1599
448 Ga0105247_10000542 3300009101 Bacteria 30686
449 Ga0105247_10009282 3300009101 Bacteria 5975
450 Ga0105247_10020569 3300009101 Bacteria 3967
451 Ga0114129_10535955 3300009147 Bacteria 1524
452 Ga0105243_10039135 3300009148 Bacteria 3696
453 Ga0105243_10095518 3300009148 Bacteria 2457
454 Ga0105243_10097864 3300009148 Bacteria 2429
455 Ga0105241_10086910 3300009174 Bacteria 2460
456 Ga0105242_10007725 3300009176 Bacteria 8273
457 Ga0105242_10023363 3300009176 Bacteria 4871
458 Ga0105248_10000123 3300009177 Bacteria 89301
459 Ga0105248_10000159 3300009177 Bacteria 78504
460 Ga0105248_10000516 3300009177 Bacteria 43895
461 Ga0105248_10002100 3300009177 Bacteria 22075
462 Ga0105248_10003349 3300009177 Bacteria 17812
463 Ga0105248_10005569 3300009177 Bacteria 13842
464 Ga0105248_10024334 3300009177 Bacteria 6733
465 Ga0105248_10027345 3300009177 Bacteria 6349
466 Ga0105248_10027972 3300009177 Bacteria 6279
467 Ga0105248_10047942 3300009177 Bacteria 4791
468 Ga0105248_10059878 3300009177 Bacteria 4277
469 Ga0105248_10088061 3300009177 Bacteria 3494
470 Ga0105248_10092200 3300009177 Bacteria 3412
471 Ga0105248_10094165 3300009177 Bacteria 3373
472 Ga0105248_10099492 3300009177 Bacteria 3277
473 Ga0105248_10120666 3300009177 Bacteria 2958
474 Ga0105237_10000135 3300009545 Bacteria 103384
475 Ga0105237_10004469 3300009545 Bacteria 16167
476 Ga0105237_10004941 3300009545 Bacteria 15231
477 Ga0105237_10007089 3300009545 Bacteria 12323
478 Ga0105237_10009195 3300009545 Bacteria 10606
479 Ga0105237_10097071 3300009545 Bacteria 2937
480 Ga0105237_10132866 3300009545 Bacteria 2483
481 Ga0105237_10336500 3300009545 Bacteria 1514
482 Ga0105238_10011703 3300009551 Bacteria 8844
483 Ga0105238_10013560 3300009551 Bacteria 8229
484 Ga0105238_10066511 3300009551 Bacteria 3606
485 Ga0105238_10080446 3300009551 Bacteria 3248
486 Ga0105238_10158169 3300009551 Bacteria 2241
487 Ga0105238_10187212 3300009551 Bacteria 2046
488 Ga0105249_10000153 3300009553 Bacteria 86563
489 Ga0105249_10016978 3300009553 Bacteria 6458
490 Ga0105249_10020199 3300009553 Bacteria 5953
491 Ga0105249_10029974 3300009553 Bacteria 4915
492 Ga0105249_10053810 3300009553 Bacteria 3680
493 Ga0105249_10090407 3300009553 Bacteria 2862
494 Ga0105249_10416107 3300009553 Bacteria 1377
495 Ga0099796_10000070 3300010159 Bacteria 18048
496 Ga0099796_10000802 3300010159 Bacteria 5694
497 Ga0105239_10000524 3300010375 Bacteria 55447
498 Ga0105239_10007408 3300010375 Bacteria 12590
499 Ga0105239_10054164 3300010375 Bacteria 4399
500 Ga0105239_10056053 3300010375 Bacteria 4323
501 Ga0105239_10159582 3300010375 Bacteria 2519
502 Ga0105239_10162157 3300010375 Bacteria 2498
503 Ga0105246_10043877 3300011119 Bacteria 3036
504 Ga0105246_10175373 3300011119 Bacteria 1646
505 Ga0157373_10003162 3300013100 Bacteria 12438
506 Ga0157373_10036632 3300013100 Bacteria 3520
507 Ga0157373_10041283 3300013100 Bacteria 3300
508 Ga0157373_10052037 3300013100 Bacteria 2915
509 Ga0157373_10069239 3300013100 Bacteria 2495
510 Ga0157371_10000784 3300013102 Bacteria 36573
511 Ga0157371_10016692 3300013102 Bacteria 5471
512 Ga0157370_10025359 3300013104 Bacteria 5869
513 Ga0157370_10124617 3300013104 Bacteria 2405
514 Ga0157369_10001983 3300013105 Bacteria 24647
515 Ga0157369_10014639 3300013105 Bacteria 8849
516 Ga0157369_10015070 3300013105 Bacteria 8727
517 Ga0157369_10092231 3300013105 Bacteria 3232
518 Ga0157369_10133424 3300013105 Bacteria 2630
519 Ga0157369_10291505 3300013105 Bacteria 1699
520 Ga0157369_10306261 3300013105 Bacteria 1652
521 Ga0157374_10017801 3300013296 Bacteria 6260
522 Ga0157374_10024724 3300013296 Bacteria 5385
523 Ga0157374_10071031 3300013296 Bacteria 3282
524 Ga0157374_10100360 3300013296 Bacteria 2774
525 Ga0157378_10054398 3300013297 Bacteria 3564
526 Ga0157378_10057561 3300013297 Bacteria 3464
527 Ga0157378_10135898 3300013297 Bacteria 2280
528 Ga0163162_10000839 3300013306 Bacteria 28555
529 Ga0163162_10001101 3300013306 Bacteria 25084
530 Ga0163162_10005580 3300013306 Bacteria 12174
531 Ga0163162_10015905 3300013306 Bacteria 7353
532 Ga0163162_10024415 3300013306 Bacteria 5967
533 Ga0163162_10035863 3300013306 Bacteria 4941
534 Ga0163162_10099221 3300013306 Bacteria 3003
535 Ga0163162_10218967 3300013306 Bacteria 2034
536 Ga0157372_10008989 3300013307 Bacteria 10620
537 Ga0157372_10031832 3300013307 Bacteria 5780
538 Ga0157372_10063213 3300013307 Bacteria 4150
539 Ga0157372_10129234 3300013307 Bacteria 2906
540 Ga0157372_10210723 3300013307 Bacteria 2252
541 Ga0157372_10462526 3300013307 Bacteria 1478
542 Ga0157372_10518107 3300013307 Bacteria 1390
543 Ga0157375_10003764 3300013308 Bacteria 13151
544 Ga0157375_10030040 3300013308 Bacteria 5118
545 Ga0157375_10070892 3300013308 Bacteria 3497
546 Ga0163163_10006126 3300014325 Bacteria 10476
547 Ga0163163_10090908 3300014325 Bacteria 3066
548 Ga0163163_10094372 3300014325 Bacteria 3010
549 Ga0163163_10128307 3300014325 Bacteria 2575
550 Ga0157380_10000123 3300014326 Bacteria 43134
551 Ga0157380_10000671 3300014326 Bacteria 21193
552 Ga0182008_10015296 3300014497 Bacteria 4005
553 Ga0182008_10020642 3300014497 Bacteria 3389
554 Ga0157379_10000867 3300014968 Bacteria 24465
555 Ga0157379_10001552 3300014968 Bacteria 18894
556 Ga0157379_10002249 3300014968 Bacteria 16076
557 Ga0157379_10014455 3300014968 Bacteria 6927
558 Ga0157379_10141285 3300014968 Bacteria 2170
559 Ga0157379_10158189 3300014968 Bacteria 2044
560 Ga0157379_10230079 3300014968 Bacteria 1680
561 Ga0157376_10144587 3300014969 Bacteria 2137
562 Ga0157376_10443936 3300014969 Bacteria 1264
563 Ga0182006_1008348 3300015261 Bacteria 4693
564 Ga0163161_10000096 3300017792 Bacteria 86993
565 Ga0163161_10004455 3300017792 Bacteria 9757
566 Ga0206356_10423425 3300020070 Bacteria 1484
567 Ga0206356_11302048 3300020070 Bacteria 4031
568 Ga0206353_10148542 3300020082 Bacteria 3068
569 Ga0213873_10000006 3300021358 Bacteria 408723
570 Ga0213872_10003007 3300021361 Bacteria 9531
571 Ga0213876_10000004 3300021384 Bacteria 943822
572 Ga0213876_10001088 3300021384 Bacteria 17439
573 Ga0213876_10001093 3300021384 Bacteria 17409
574 Ga0213876_10012133 3300021384 Bacteria 4591
575 Ga0213876_10081864 3300021384 Bacteria 1708
576 Ga0213875_10000061 3300021388 Bacteria 133623
577 Ga0213875_10000398 3300021388 Bacteria 38328
578 Ga0213875_10002425 3300021388 Bacteria 11172
579 Ga0213875_10010098 3300021388 Bacteria 4746
580 Ga0213875_10012927 3300021388 Bacteria 4111
581 Ga0224712_10003352 3300022467 Bacteria 4150
582 Ga0209784_100335 3300025224 Bacteria 23545
583 Ga0209566_100046 3300025225 Bacteria 247053
584 Ga0209566_100166 3300025225 Bacteria 71875
585 Ga0209674_100975 3300025226 Bacteria 8945
586 Ga0209026_1000050 3300025250 Bacteria 254994
587 Ga0209026_1000214 3300025250 Bacteria 80595
588 Ga0209026_1001506 3300025250 Bacteria 10204
589 Ga0209759_1000229 3300025256 Bacteria 83575
590 Ga0209759_1007916 3300025256 Bacteria 3364
591 Ga0209233_1000003 3300025261 Bacteria 1607366
592 Ga0209676_1001179 3300025292 Bacteria 28285
593 Ga0209025_1012628 3300025294 Bacteria 5394
594 Ga0209025_1033697 3300025294 Bacteria 2360
595 Ga0209257_1000245 3300025304 Bacteria 125987
596 Ga0207697_10000219 3300025315 Bacteria 30831
597 Ga0207697_10000584 3300025315 Bacteria 20797
598 Ga0207656_10006275 3300025321 Bacteria 4260
599 Ga0207656_10010407 3300025321 Bacteria 3484
600 Ga0207656_10029709 3300025321 Bacteria 2253
601 Ga0207656_10082146 3300025321 Bacteria 1450
602 Ga0207682_10002744 3300025893 Bacteria 7798
603 Ga0207682_10033762 3300025893 Bacteria 2061
604 Ga0207642_10004027 3300025899 Bacteria 4701
605 Ga0207710_10001754 3300025900 Bacteria 10467
606 Ga0207710_10011152 3300025900 Bacteria 3785
607 Ga0207688_10001613 3300025901 Bacteria 11897
608 Ga0207688_10007152 3300025901 Bacteria 6069
609 Ga0207680_10000020 3300025903 Bacteria 89630
610 Ga0207680_10000027 3300025903 Bacteria 79852
611 Ga0207680_10001404 3300025903 Bacteria 11397
612 Ga0207680_10003774 3300025903 Bacteria 7133
613 Ga0207680_10010476 3300025903 Bacteria 4639
614 Ga0207680_10013386 3300025903 Bacteria 4212
615 Ga0207680_10026060 3300025903 Bacteria 3235
616 Ga0207680_10074110 3300025903 Bacteria 2119
617 Ga0207647_10000575 3300025904 Bacteria 28658
618 Ga0207647_10002145 3300025904 Bacteria 15075
619 Ga0207647_10007590 3300025904 Bacteria 7816
620 Ga0207647_10019789 3300025904 Bacteria 4520
621 Ga0207647_10032408 3300025904 Bacteria 3357
622 Ga0207647_10071623 3300025904 Bacteria 2091
623 Ga0207647_10092157 3300025904 Bacteria 1806
624 Ga0207699_10024944 3300025906 Bacteria 3277
625 Ga0207645_10001233 3300025907 Bacteria 21061
626 Ga0207645_10023613 3300025907 Bacteria 3993
627 Ga0207645_10085526 3300025907 Bacteria 2025
628 Ga0207705_10000002 3300025909 Bacteria 2046852
629 Ga0207705_10000260 3300025909 Bacteria 51366
630 Ga0207705_10000673 3300025909 Bacteria 28381
631 Ga0207705_10004275 3300025909 Bacteria 10816
632 Ga0207705_10005171 3300025909 Bacteria 9780
633 Ga0207705_10006422 3300025909 Bacteria 8707
634 Ga0207705_10007630 3300025909 Bacteria 7956
635 Ga0207705_10016552 3300025909 Bacteria 5283
636 Ga0207705_10016829 3300025909 Bacteria 5236
637 Ga0207705_10019940 3300025909 Bacteria 4796
638 Ga0207705_10024723 3300025909 Bacteria 4286
639 Ga0207705_10040672 3300025909 Bacteria 3335
640 Ga0207705_10042478 3300025909 Bacteria 3264
641 Ga0207705_10043677 3300025909 Bacteria 3220
642 Ga0207705_10061232 3300025909 Bacteria 2719
643 Ga0207705_10067128 3300025909 Bacteria 2595
644 Ga0207705_10068045 3300025909 Bacteria 2578
645 Ga0207705_10097094 3300025909 Bacteria 2163
646 Ga0207705_10121203 3300025909 Bacteria 1941
647 Ga0207705_10153453 3300025909 Bacteria 1727
648 Ga0207705_10153878 3300025909 Bacteria 1724
649 Ga0207684_10000732 3300025910 Bacteria 38532
650 Ga0207684_10100166 3300025910 Unclassified 2476
651 Ga0207654_10000540 3300025911 Bacteria 21648
652 Ga0207707_10004278 3300025912 Bacteria 12632
653 Ga0207707_10033033 3300025912 Bacteria 4529
654 Ga0207695_10000022 3300025913 Bacteria 659090
655 Ga0207695_10000064 3300025913 Bacteria 346010
656 Ga0207695_10029739 3300025913 Bacteria 6028
657 Ga0207695_10042320 3300025913 Bacteria 4866
658 Ga0207695_10052908 3300025913 Bacteria 4251
659 Ga0207695_10118832 3300025913 Bacteria 2614
660 Ga0207695_10247946 3300025913 Bacteria 1681
661 Ga0207671_10000089 3300025914 Bacteria 140114
662 Ga0207671_10005075 3300025914 Bacteria 12297
663 Ga0207671_10005664 3300025914 Bacteria 11427
664 Ga0207671_10016587 3300025914 Bacteria 5719
665 Ga0207671_10028364 3300025914 Bacteria 4182
666 Ga0207671_10030779 3300025914 Bacteria 4000
667 Ga0207671_10033487 3300025914 Bacteria 3822
668 Ga0207693_10053329 3300025915 Bacteria 3173
669 Ga0207693_10060938 3300025915 Bacteria 2956
670 Ga0207660_10000787 3300025917 Bacteria 21077
671 Ga0207660_10001023 3300025917 Bacteria 18531
672 Ga0207660_10007267 3300025917 Bacteria 7167
673 Ga0207660_10137346 3300025917 Bacteria 1866
674 Ga0207657_10000031 3300025919 Bacteria 132167
675 Ga0207657_10000267 3300025919 Bacteria 55426
676 Ga0207657_10000625 3300025919 Bacteria 37604
677 Ga0207657_10002051 3300025919 Bacteria 21802
678 Ga0207657_10003334 3300025919 Bacteria 17170
679 Ga0207657_10003748 3300025919 Bacteria 16154
680 Ga0207657_10003760 3300025919 Bacteria 16129
681 Ga0207657_10006383 3300025919 Bacteria 12243
682 Ga0207657_10006861 3300025919 Bacteria 11748
683 Ga0207657_10007939 3300025919 Bacteria 10823
684 Ga0207657_10018947 3300025919 Bacteria 6551
685 Ga0207657_10052752 3300025919 Bacteria 3528
686 Ga0207657_10060914 3300025919 Bacteria 3238
687 Ga0207657_10070000 3300025919 Bacteria 2974
688 Ga0207657_10094032 3300025919 Bacteria 2496
689 Ga0207657_10105581 3300025919 Bacteria 2331
690 Ga0207657_10108643 3300025919 Bacteria 2293
691 Ga0207657_10134143 3300025919 Bacteria 2027
692 Ga0207657_10172243 3300025919 Bacteria 1753
693 Ga0207649_10000103 3300025920 Bacteria 69885
694 Ga0207649_10000394 3300025920 Bacteria 32788
695 Ga0207649_10008644 3300025920 Bacteria 5561
696 Ga0207649_10009140 3300025920 Bacteria 5420
697 Ga0207649_10012162 3300025920 Bacteria 4766
698 Ga0207649_10027244 3300025920 Bacteria 3352
699 Ga0207652_10000001 3300025921 Bacteria 1006643
700 Ga0207652_10014570 3300025921 Bacteria 6373
701 Ga0207652_10017973 3300025921 Bacteria 5793
702 Ga0207652_10053697 3300025921 Bacteria 3461
703 Ga0207652_10090491 3300025921 Bacteria 2689
704 Ga0207652_10108075 3300025921 Bacteria 2464
705 Ga0207652_10126353 3300025921 Bacteria 2278
706 Ga0207681_10000008 3300025923 Bacteria 414329
707 Ga0207681_10000082 3300025923 Bacteria 84963
708 Ga0207681_10000528 3300025923 Bacteria 26417
709 Ga0207681_10001333 3300025923 Bacteria 15917
710 Ga0207681_10004527 3300025923 Bacteria 8560
711 Ga0207681_10029309 3300025923 Bacteria 3573
712 Ga0207694_10003458 3300025924 Bacteria 12548
713 Ga0207694_10014139 3300025924 Bacteria 6017
714 Ga0207694_10071498 3300025924 Bacteria 2711
715 Ga0207694_10208302 3300025924 Bacteria 1592
716 Ga0207650_10001366 3300025925 Bacteria 17614
717 Ga0207650_10007278 3300025925 Bacteria 7536
718 Ga0207650_10008924 3300025925 Bacteria 6851
719 Ga0207650_10040021 3300025925 Bacteria 3428
720 Ga0207650_10068709 3300025925 Bacteria 2661
721 Ga0207650_10088225 3300025925 Bacteria 2365
722 Ga0207650_10122566 3300025925 Bacteria 2026
723 Ga0207650_10206569 3300025925 Bacteria 1576
724 Ga0207659_10007983 3300025926 Bacteria 6542
725 Ga0207659_10034085 3300025926 Bacteria 3509
726 Ga0207687_10002526 3300025927 Bacteria 12416
727 Ga0207687_10143672 3300025927 Bacteria 1813
728 Ga0207700_10028720 3300025928 Bacteria 3916
729 Ga0207700_10074976 3300025928 Bacteria 2620
730 Ga0207664_10000041 3300025929 Bacteria 154806
731 Ga0207664_10021648 3300025929 Bacteria 4786
732 Ga0207644_10000005 3300025931 Bacteria 441948
733 Ga0207644_10000006 3300025931 Bacteria 408793
734 Ga0207644_10000153 3300025931 Bacteria 49585
735 Ga0207644_10000220 3300025931 Bacteria 39427
736 Ga0207644_10000593 3300025931 Bacteria 23108
737 Ga0207644_10000941 3300025931 Bacteria 18539
738 Ga0207644_10002867 3300025931 Bacteria 11114
739 Ga0207644_10004200 3300025931 Bacteria 9349
740 Ga0207644_10018705 3300025931 Bacteria 4689
741 Ga0207644_10040253 3300025931 Bacteria 3303
742 Ga0207644_10250097 3300025931 Bacteria 1414
743 Ga0207690_10000382 3300025932 Bacteria 29300
744 Ga0207690_10002417 3300025932 Bacteria 11291
745 Ga0207690_10003206 3300025932 Bacteria 9816
746 Ga0207690_10003550 3300025932 Bacteria 9290
747 Ga0207690_10016632 3300025932 Bacteria 4481
748 Ga0207690_10035870 3300025932 Bacteria 3208
749 Ga0207690_10051785 3300025932 Bacteria 2747
750 Ga0207690_10067190 3300025932 Bacteria 2458
751 Ga0207690_10135662 3300025932 Bacteria 1806
752 Ga0207690_10138240 3300025932 Bacteria 1792
753 Ga0207706_10000028 3300025933 Bacteria 149092
754 Ga0207706_10000171 3300025933 Bacteria 72122
755 Ga0207706_10000285 3300025933 Bacteria 55179
756 Ga0207706_10000475 3300025933 Bacteria 42955
757 Ga0207706_10004574 3300025933 Bacteria 12984
758 Ga0207706_10005076 3300025933 Bacteria 12297
759 Ga0207706_10006857 3300025933 Bacteria 10531
760 Ga0207706_10010395 3300025933 Bacteria 8502
761 Ga0207706_10023541 3300025933 Bacteria 5529
762 Ga0207706_10027086 3300025933 Bacteria 5127
763 Ga0207706_10040257 3300025933 Bacteria 4141
764 Ga0207706_10062849 3300025933 Bacteria 3270
765 Ga0207706_10064292 3300025933 Bacteria 3230
766 Ga0207706_10169145 3300025933 Bacteria 1921
767 Ga0207706_10237757 3300025933 Bacteria 1593
768 Ga0207706_10268345 3300025933 Bacteria 1489
769 Ga0207709_10118340 3300025935 Bacteria 1784
770 Ga0207670_10101115 3300025936 Bacteria 2059
771 Ga0207669_10025408 3300025937 Bacteria 3201
772 Ga0207669_10030752 3300025937 Bacteria 2988
773 Ga0207704_10033427 3300025938 Bacteria 2924
774 Ga0207704_10068058 3300025938 Bacteria 2243
775 Ga0207704_10152191 3300025938 Bacteria 1634
776 Ga0207665_10023959 3300025939 Bacteria 4022
777 Ga0207691_10003885 3300025940 Bacteria 14507
778 Ga0207691_10004037 3300025940 Bacteria 14227
779 Ga0207691_10007857 3300025940 Bacteria 10275
780 Ga0207691_10013013 3300025940 Bacteria 7967
781 Ga0207691_10073175 3300025940 Bacteria 3091
782 Ga0207691_10127774 3300025940 Bacteria 2247
783 Ga0207691_10230668 3300025940 Bacteria 1603
784 Ga0207691_10307923 3300025940 Unclassified 1360
785 Ga0207711_10000100 3300025941 Bacteria 91024
786 Ga0207711_10000500 3300025941 Bacteria 40435
787 Ga0207711_10001375 3300025941 Bacteria 22908
788 Ga0207711_10001810 3300025941 Bacteria 19532
789 Ga0207711_10002836 3300025941 Bacteria 15230
790 Ga0207711_10005966 3300025941 Bacteria 10298
791 Ga0207711_10006042 3300025941 Bacteria 10232
792 Ga0207711_10009820 3300025941 Bacteria 7960
793 Ga0207711_10014697 3300025941 Bacteria 6505
794 Ga0207711_10017324 3300025941 Bacteria 5986
795 Ga0207711_10044099 3300025941 Bacteria 3806
796 Ga0207711_10048152 3300025941 Bacteria 3647
797 Ga0207711_10048787 3300025941 Bacteria 3622
798 Ga0207711_10049600 3300025941 Bacteria 3594
799 Ga0207711_10101010 3300025941 Bacteria 2552
800 Ga0207711_10353204 3300025941 Bacteria 1361
801 Ga0207689_10000092 3300025942 Bacteria 73254
802 Ga0207689_10023842 3300025942 Bacteria 5133
803 Ga0207661_10003597 3300025944 Bacteria 10780
804 Ga0207661_10107187 3300025944 Bacteria 2356
805 Ga0207679_10000129 3300025945 Bacteria 61477
806 Ga0207679_10004617 3300025945 Bacteria 8575
807 Ga0207679_10007146 3300025945 Bacteria 7071
808 Ga0207679_10007159 3300025945 Bacteria 7065
809 Ga0207679_10045221 3300025945 Bacteria 3183
810 Ga0207679_10301087 3300025945 Bacteria 1382
811 Ga0207667_10000357 3300025949 Bacteria 62034
812 Ga0207667_10007813 3300025949 Bacteria 12784
813 Ga0207667_10019487 3300025949 Bacteria 7571
814 Ga0207667_10020146 3300025949 Bacteria 7426
815 Ga0207667_10025870 3300025949 Bacteria 6420
816 Ga0207667_10039064 3300025949 Bacteria 5060
817 Ga0207667_10042463 3300025949 Bacteria 4833
818 Ga0207667_10123085 3300025949 Bacteria 2672
819 Ga0207667_10130473 3300025949 Bacteria 2589
820 Ga0207667_10238040 3300025949 Bacteria 1863
821 Ga0207651_10000176 3300025960 Bacteria 27858
822 Ga0207651_10006875 3300025960 Bacteria 6006
823 Ga0207651_10009081 3300025960 Bacteria 5412
824 Ga0207651_10009881 3300025960 Bacteria 5251
825 Ga0207651_10014015 3300025960 Bacteria 4613
826 Ga0207651_10167567 3300025960 Bacteria 1729
827 Ga0207651_10275756 3300025960 Bacteria 1387
828 Ga0207712_10000115 3300025961 Bacteria 86728
829 Ga0207712_10000269 3300025961 Bacteria 50416
830 Ga0207712_10001847 3300025961 Bacteria 13973
831 Ga0207712_10059784 3300025961 Bacteria 2699
832 Ga0207712_10136770 3300025961 Bacteria 1875
833 Ga0207712_10218852 3300025961 Bacteria 1521
834 Ga0207668_10000080 3300025972 Bacteria 72198
835 Ga0207668_10000293 3300025972 Bacteria 32843
836 Ga0207668_10002630 3300025972 Bacteria 10509
837 Ga0207668_10033158 3300025972 Bacteria 3419
838 Ga0207668_10089910 3300025972 Bacteria 2252
839 Ga0207668_10195295 3300025972 Bacteria 1607
840 Ga0207640_10000922 3300025981 Bacteria 16485
841 Ga0207640_10001385 3300025981 Bacteria 13123
842 Ga0207640_10036504 3300025981 Bacteria 3086
843 Ga0207640_10050441 3300025981 Bacteria 2700
844 Ga0207640_10081024 3300025981 Bacteria 2218
845 Ga0207658_10002645 3300025986 Bacteria 12976
846 Ga0207658_10003348 3300025986 Bacteria 11367
847 Ga0207658_10006798 3300025986 Bacteria 7792
848 Ga0207658_10007421 3300025986 Bacteria 7477
849 Ga0207658_10010339 3300025986 Bacteria 6340
850 Ga0207658_10014800 3300025986 Bacteria 5345
851 Ga0207658_10015585 3300025986 Bacteria 5215
852 Ga0207658_10016561 3300025986 Bacteria 5073
853 Ga0207658_10020445 3300025986 Bacteria 4583
854 Ga0207658_10028031 3300025986 Bacteria 3963
855 Ga0207658_10037108 3300025986 Bacteria 3498
856 Ga0207658_10175015 3300025986 Bacteria 1771
857 Ga0207677_10001622 3300026023 Bacteria 11935
858 Ga0207677_10007300 3300026023 Bacteria 6102
859 Ga0207677_10008848 3300026023 Bacteria 5644
860 Ga0207677_10079597 3300026023 Bacteria 2344
861 Ga0207703_10000515 3300026035 Bacteria 39972
862 Ga0207703_10001781 3300026035 Bacteria 19226
863 Ga0207703_10001798 3300026035 Bacteria 19132
864 Ga0207703_10002682 3300026035 Bacteria 15276
865 Ga0207703_10003524 3300026035 Bacteria 13094
866 Ga0207703_10004783 3300026035 Bacteria 11034
867 Ga0207703_10004802 3300026035 Bacteria 11007
868 Ga0207703_10009105 3300026035 Bacteria 7817
869 Ga0207703_10016679 3300026035 Bacteria 5730
870 Ga0207703_10067108 3300026035 Bacteria 2952
871 Ga0207703_10096257 3300026035 Bacteria 2499
872 Ga0207703_10148827 3300026035 Bacteria 2039
873 Ga0207639_10000131 3300026041 Bacteria 54681
874 Ga0207639_10005418 3300026041 Bacteria 8625
875 Ga0207639_10005686 3300026041 Bacteria 8438
876 Ga0207639_10042457 3300026041 Bacteria 3408
877 Ga0207639_10072666 3300026041 Bacteria 2694
878 Ga0207639_10084269 3300026041 Bacteria 2525
879 Ga0207678_10000198 3300026067 Bacteria 52573
880 Ga0207678_10000740 3300026067 Bacteria 29953
881 Ga0207678_10004259 3300026067 Bacteria 12829
882 Ga0207678_10005020 3300026067 Bacteria 11873
883 Ga0207678_10005050 3300026067 Bacteria 11841
884 Ga0207678_10015898 3300026067 Bacteria 6611
885 Ga0207678_10026121 3300026067 Bacteria 5095
886 Ga0207678_10057378 3300026067 Bacteria 3350
887 Ga0207678_10072445 3300026067 Bacteria 2952
888 Ga0207678_10155377 3300026067 Bacteria 1953
889 Ga0207678_10188928 3300026067 Bacteria 1760
890 Ga0207702_10000247 3300026078 Bacteria 62873
891 Ga0207702_10004072 3300026078 Bacteria 13122
892 Ga0207702_10011956 3300026078 Bacteria 7220
893 Ga0207702_10127922 3300026078 Bacteria 2283
894 Ga0207702_10140116 3300026078 Bacteria 2187
895 Ga0207702_10159744 3300026078 Bacteria 2057
896 Ga0207702_10197262 3300026078 Bacteria 1864
897 Ga0207702_10254257 3300026078 Bacteria 1651
898 Ga0207702_10344167 3300026078 Bacteria 1425
899 Ga0207641_10000004 3300026088 Bacteria 481088
900 Ga0207641_10000073 3300026088 Bacteria 149989
901 Ga0207641_10000221 3300026088 Bacteria 74390
902 Ga0207641_10001038 3300026088 Bacteria 28176
903 Ga0207641_10002527 3300026088 Bacteria 16854
904 Ga0207641_10005042 3300026088 Bacteria 11314
905 Ga0207641_10005367 3300026088 Bacteria 10945
906 Ga0207641_10013846 3300026088 Bacteria 6616
907 Ga0207641_10030273 3300026088 Bacteria 4483
908 Ga0207641_10030321 3300026088 Bacteria 4480
909 Ga0207641_10031905 3300026088 Bacteria 4371
910 Ga0207641_10037367 3300026088 Bacteria 4055
911 Ga0207648_10006196 3300026089 Bacteria 11911
912 Ga0207648_10008887 3300026089 Bacteria 9672
913 Ga0207648_10034392 3300026089 Bacteria 4467
914 Ga0207648_10036146 3300026089 Bacteria 4351
915 Ga0207648_10138313 3300026089 Bacteria 2146
916 Ga0207676_10002026 3300026095 Bacteria 14724
917 Ga0207676_10002161 3300026095 Bacteria 14204
918 Ga0207676_10003162 3300026095 Bacteria 11751
919 Ga0207676_10004385 3300026095 Bacteria 9979
920 Ga0207676_10017908 3300026095 Bacteria 5141
921 Ga0207676_10034087 3300026095 Bacteria 3852
922 Ga0207676_10086231 3300026095 Bacteria 2564
923 Ga0207674_10000289 3300026116 Bacteria 63604
924 Ga0207674_10002023 3300026116 Bacteria 25726
925 Ga0207674_10002652 3300026116 Bacteria 22343
926 Ga0207674_10006972 3300026116 Bacteria 13225
927 Ga0207674_10008981 3300026116 Bacteria 11487
928 Ga0207674_10012168 3300026116 Bacteria 9633
929 Ga0207674_10014969 3300026116 Bacteria 8544
930 Ga0207674_10016447 3300026116 Bacteria 8097
931 Ga0207674_10018937 3300026116 Bacteria 7464
932 Ga0207674_10025465 3300026116 Bacteria 6309
933 Ga0207674_10086035 3300026116 Bacteria 3138
934 Ga0207674_10109608 3300026116 Bacteria 2737
935 Ga0207675_100000135 3300026118 Bacteria 62501
936 Ga0207675_100000172 3300026118 Bacteria 58085
937 Ga0207675_100069152 3300026118 Bacteria 3300
938 Ga0207683_10032416 3300026121 Bacteria 4539
939 Ga0207683_10043045 3300026121 Bacteria 3944
940 Ga0207683_10073999 3300026121 Bacteria 3014
941 Ga0207683_10191977 3300026121 Bacteria 1855
942 Ga0207683_10213962 3300026121 Bacteria 1755
943 Ga0207698_10000944 3300026142 Bacteria 16887
944 Ga0207698_10001888 3300026142 Bacteria 12271
945 Ga0207698_10015158 3300026142 Bacteria 5154
946 Ga0207698_10015356 3300026142 Bacteria 5125
947 Ga0207698_10016046 3300026142 Bacteria 5038
948 Ga0207698_10018337 3300026142 Bacteria 4766
949 Ga0207698_10047184 3300026142 Bacteria 3260
950 Ga0207698_10063200 3300026142 Bacteria 2896
951 Ga0207698_10091820 3300026142 Bacteria 2487
952 Ga0209179_1000001 3300027512 Bacteria 128813
953 Ga0209974_10002244 3300027876 Bacteria 7026
954 Ga0207428_10090158 3300027907 Bacteria 2382
955 Ga0268266_10000025 3300028379 Bacteria 477143
956 Ga0268266_10000433 3300028379 Bacteria 62887
957 Ga0268266_10003150 3300028379 Bacteria 16743
958 Ga0268266_10012368 3300028379 Bacteria 7378
959 Ga0268266_10016623 3300028379 Bacteria 6287
960 Ga0268266_10018141 3300028379 Bacteria 5999
961 Ga0268266_10029989 3300028379 Bacteria 4622
962 Ga0268266_10031756 3300028379 Bacteria 4487
963 Ga0268266_10047737 3300028379 Bacteria 3669
964 Ga0268266_10069687 3300028379 Bacteria 3047
965 Ga0268266_10107736 3300028379 Bacteria 2464
966 Ga0268266_10149854 3300028379 Bacteria 2101
967 Ga0268266_10163828 3300028379 Bacteria 2013
968 Ga0268266_10293443 3300028379 Bacteria 1515
969 Ga0268265_10000064 3300028380 Bacteria 144164
970 Ga0268265_10000107 3300028380 Bacteria 104685
971 Ga0268265_10020623 3300028380 Bacteria 4603
972 Ga0268265_10027327 3300028380 Bacteria 4071
973 Ga0268265_10038539 3300028380 Bacteria 3516
974 Ga0268265_10055694 3300028380 Bacteria 3005
975 Ga0268265_10204665 3300028380 Bacteria 1715
976 Ga0268265_10276386 3300028380 Bacteria 1501
977 Ga0268264_10000010 3300028381 Bacteria 596543
978 Ga0268264_10000278 3300028381 Bacteria 86729
979 Ga0268264_10000567 3300028381 Bacteria 45270
980 Ga0268264_10002045 3300028381 Bacteria 18020
981 Ga0268264_10002177 3300028381 Bacteria 17427
982 Ga0268264_10005259 3300028381 Bacteria 10956
983 Ga0268264_10006022 3300028381 Bacteria 10262
984 Ga0268264_10019845 3300028381 Bacteria 5491
985 Ga0268264_10022226 3300028381 Bacteria 5178
986 Ga0268264_10053564 3300028381 Bacteria 3366
987 Ga0268264_10066545 3300028381 Bacteria 3039
988 Ga0268264_10105302 3300028381 Bacteria 2460
989 Ga0268264_10143582 3300028381 Bacteria 2132
990 Ga0268264_10281275 3300028381 Bacteria 1559
991 Ga0265319_1012169 3300028563 Bacteria 3488
992 Ga0265318_10011502 3300028577 Bacteria 3807
993 Ga0307515_10000027 3300028794 Bacteria 371624
994 Ga0307515_10039280 3300028794 Bacteria 7534
995 Ga0307515_10205377 3300028794 Bacteria 1832
996 Ga0265324_10041286 3300029957 Bacteria 1597
997 Ga0316177_1100564 3300030731 Bacteria 2389
998 Ga0316182_1189875 3300030745 Bacteria 2743
999 Ga0316182_1433154 3300030745 Bacteria 2123
1000 Ga0265320_10015009 3300031240 Bacteria 4389
1001 Ga0265327_10022856 3300031251 Bacteria 3721
1002 Ga0307513_10000001 3300031456 Bacteria 1660464
1003 Ga0307509_10000002 3300031507 Bacteria 607551
1004 Ga0307408_100002898 3300031548 Bacteria 11892
1005 Ga0307408_100002967 3300031548 Bacteria 11753
1006 Ga0307408_100012582 3300031548 Bacteria 5608
1007 Ga0307408_100015521 3300031548 Bacteria 5072
1008 Ga0307408_100029940 3300031548 Bacteria 3776
1009 Ga0307408_100048260 3300031548 Bacteria 3053
1010 Ga0307408_100188248 3300031548 Bacteria 1661
1011 Ga0307508_10002405 3300031616 Bacteria 19765
1012 Ga0307516_10001732 3300031730 Bacteria 29952
1013 Ga0307405_10001334 3300031731 Bacteria 10338
1014 Ga0307405_10005492 3300031731 Bacteria 6120
1015 Ga0307405_10011011 3300031731 Bacteria 4717
1016 Ga0307405_10012904 3300031731 Bacteria 4441
1017 Ga0307405_10016071 3300031731 Bacteria 4071
1018 Ga0307405_10016186 3300031731 Bacteria 4060
1019 Ga0307405_10034756 3300031731 Bacteria 3003
1020 Ga0307405_10090788 3300031731 Bacteria 2022
1021 Ga0307413_10000144 3300031824 Bacteria 19106
1022 Ga0307413_10000917 3300031824 Bacteria 10465
1023 Ga0307413_10005133 3300031824 Bacteria 5800
1024 Ga0307413_10034618 3300031824 Bacteria 2888
1025 Ga0307413_10114955 3300031824 Bacteria 1810
1026 Ga0307413_10115966 3300031824 Bacteria 1803
1027 Ga0307413_10119379 3300031824 Bacteria 1782
1028 Ga0307410_10009720 3300031852 Bacteria 5409
1029 Ga0307410_10010793 3300031852 Bacteria 5197
1030 Ga0307410_10012347 3300031852 Bacteria 4936
1031 Ga0307410_10014542 3300031852 Bacteria 4635
1032 Ga0307410_10015716 3300031852 Bacteria 4497
1033 Ga0307410_10041040 3300031852 Bacteria 3049
1034 Ga0307410_10057891 3300031852 Bacteria 2640
1035 Ga0307410_10094198 3300031852 Bacteria 2132
1036 Ga0307410_10173421 3300031852 Bacteria 1627
1037 Ga0307406_10000061 3300031901 Bacteria 60128
1038 Ga0307406_10000444 3300031901 Bacteria 24155
1039 Ga0307406_10005150 3300031901 Bacteria 7131
1040 Ga0307406_10008769 3300031901 Bacteria 5652
1041 Ga0307406_10022911 3300031901 Bacteria 3710
1042 Ga0307406_10058341 3300031901 Bacteria 2480
1043 Ga0307406_10126422 3300031901 Bacteria 1787
1044 Ga0307407_10006018 3300031903 Bacteria 5342
1045 Ga0307407_10006801 3300031903 Bacteria 5123
1046 Ga0307407_10007023 3300031903 Bacteria 5067
1047 Ga0307407_10007706 3300031903 Bacteria 4890
1048 Ga0307407_10025564 3300031903 Bacteria 3113
1049 Ga0307407_10068031 3300031903 Bacteria 2108
1050 Ga0307407_10076812 3300031903 Bacteria 2006
1051 Ga0307407_10110060 3300031903 Bacteria 1727
1052 Ga0307407_10112357 3300031903 Bacteria 1712
1053 Ga0307407_10113471 3300031903 Bacteria 1705
1054 Ga0307407_10136476 3300031903 Bacteria 1577
1055 Ga0307412_10000004 3300031911 Bacteria 544053
1056 Ga0307412_10016666 3300031911 Bacteria 4382
1057 Ga0307412_10028016 3300031911 Bacteria 3520
1058 Ga0307412_10029004 3300031911 Bacteria 3469
1059 Ga0307412_10034105 3300031911 Bacteria 3241
1060 Ga0307412_10045681 3300031911 Bacteria 2865
1061 Ga0307412_10061860 3300031911 Bacteria 2518
1062 Ga0307412_10078776 3300031911 Bacteria 2271
1063 Ga0307412_10183444 3300031911 Bacteria 1576
1064 Ga0307409_100000049 3300031995 Bacteria 42215
1065 Ga0307409_100001231 3300031995 Bacteria 12332
1066 Ga0307409_100006386 3300031995 Bacteria 6921
1067 Ga0307409_100010794 3300031995 Bacteria 5708
1068 Ga0307409_100015511 3300031995 Bacteria 5004
1069 Ga0307409_100034116 3300031995 Bacteria 3712
1070 Ga0307409_100061997 3300031995 Bacteria 2925
1071 Ga0307409_100094881 3300031995 Bacteria 2456
1072 Ga0307409_100116482 3300031995 Bacteria 2252
1073 Ga0307409_100118363 3300031995 Bacteria 2237
1074 Ga0307409_100120849 3300031995 Bacteria 2218
1075 Ga0307409_100196347 3300031995 Bacteria 1801
1076 Ga0307409_100220149 3300031995 Bacteria 1713
1077 Ga0307409_100314232 3300031995 Bacteria 1463
1078 Ga0307409_100340461 3300031995 Bacteria 1411
1079 Ga0307416_100000186 3300032002 Bacteria 33626
1080 Ga0307416_100006793 3300032002 Bacteria 7195
1081 Ga0307416_100019803 3300032002 Bacteria 4781
1082 Ga0307416_100050457 3300032002 Bacteria 3316
1083 Ga0307416_100068874 3300032002 Bacteria 2926
1084 Ga0307416_100069177 3300032002 Bacteria 2920
1085 Ga0307416_100071508 3300032002 Bacteria 2882
1086 Ga0307416_100072245 3300032002 Bacteria 2871
1087 Ga0307416_100092662 3300032002 Bacteria 2600
1088 Ga0307416_100099156 3300032002 Bacteria 2529
1089 Ga0307416_100112469 3300032002 Bacteria 2403
1090 Ga0307416_100149906 3300032002 Bacteria 2137
1091 Ga0307416_100203850 3300032002 Bacteria 1879
1092 Ga0307416_100276184 3300032002 Bacteria 1653
1093 Ga0307414_10000735 3300032004 Bacteria 16778
1094 Ga0307414_10001265 3300032004 Bacteria 13028
1095 Ga0307414_10001794 3300032004 Bacteria 11117
1096 Ga0307414_10003339 3300032004 Bacteria 8571
1097 Ga0307414_10005567 3300032004 Bacteria 6946
1098 Ga0307414_10032847 3300032004 Bacteria 3422
1099 Ga0307414_10033122 3300032004 Bacteria 3411
1100 Ga0307414_10074773 3300032004 Bacteria 2456
1101 Ga0307414_10169784 3300032004 Bacteria 1742
1102 Ga0307414_10176017 3300032004 Bacteria 1716
1103 Ga0307414_10358068 3300032004 Bacteria 1254
1104 Ga0307411_10000702 3300032005 Bacteria 12290
1105 Ga0307411_10002909 3300032005 Bacteria 7754
1106 Ga0307411_10007368 3300032005 Bacteria 5597
1107 Ga0307411_10012009 3300032005 Bacteria 4704
1108 Ga0307411_10013476 3300032005 Bacteria 4512
1109 Ga0307411_10015098 3300032005 Bacteria 4325
1110 Ga0307411_10030014 3300032005 Bacteria 3328
1111 Ga0307411_10067594 3300032005 Bacteria 2405
1112 Ga0307411_10073382 3300032005 Bacteria 2327
1113 Ga0307411_10088051 3300032005 Bacteria 2158
1114 Ga0307411_10109607 3300032005 Bacteria 1972
1115 Ga0307411_10129419 3300032005 Bacteria 1842
1116 Ga0307411_10150533 3300032005 Bacteria 1728
1117 Ga0307411_10179750 3300032005 Bacteria 1604
1118 Ga0307411_10195169 3300032005 Bacteria 1549
1119 Ga0307415_100000244 3300032126 Bacteria 23531
1120 Ga0307415_100003494 3300032126 Bacteria 8010
1121 Ga0307415_100007694 3300032126 Bacteria 5916
1122 Ga0307415_100009878 3300032126 Bacteria 5379
1123 Ga0307415_100020451 3300032126 Bacteria 4042
1124 Ga0307415_100026196 3300032126 Bacteria 3674
1125 Ga0307415_100045062 3300032126 Bacteria 2954
1126 Ga0307415_100045109 3300032126 Bacteria 2953
1127 Ga0307415_100090284 3300032126 Bacteria 2215
1128 Ga0307415_100091220 3300032126 Bacteria 2206
1129 Ga0307415_100096547 3300032126 Bacteria 2154
1130 Ga0307415_100135320 3300032126 Bacteria 1873
1131 Ga0307415_100198478 3300032126 Bacteria 1590
1132 Ga0307415_100242435 3300032126 Bacteria 1459
1133 Ga0307507_10002651 3300033179 Bacteria 36900
1134 Ga0307510_10000003 3300033180 Bacteria 756654
1135 Ga0307510_10019979 3300033180 Bacteria 7844
1136 Ga0316212_1003469 3300033547 Bacteria 2278
1137 Ga0373950_0000001 3300034818 Bacteria 1001987
1138 Ga0373950_0001111 3300034818 Bacteria 3445
1139 Ga0373934_0044959 3300035086 Bacteria 1746
1140 Ga0373941_0008202 3300035115 Bacteria 2587
1141 Ga0373943_0035022 3300035170 Bacteria 2397
1142 Ga0373955_0004423 3300035172 Bacteria 6225
1143 Ga0373942_0000076 3300035207 Bacteria 21156
1144 Ga0373962_0062408 3300035242 Bacteria 1097
1145 Ga0373935_0002341 3300035692 Bacteria 10815
1146 Ga0373927_0093474 3300035695 Bacteria 1954
1147 Ga0373933_0006446 3300035724 Bacteria 6393
1148 Ga0373947_0009709 3300035725 Bacteria 5522
1149 Ga0373937_0004086 3300036401 Bacteria 12375
1150 Ga0373925_0000053 3300037068 Bacteria 125353
1151 Ga0395899_0000588 3300037312 Bacteria 38318
1152 Ga0395899_0004324 3300037312 Bacteria 11091
1153 Ga0395899_0005357 3300037312 Bacteria 9967
1154 Ga0395899_0010317 3300037312 Bacteria 7162
1155 Ga0395899_0025601 3300037312 Bacteria 4453
1156 Ga0395899_0033919 3300037312 Bacteria 3833
1157 Ga0395899_0059202 3300037312 Bacteria 2823
1158 Ga0395899_0074408 3300037312 Bacteria 2481
1159 Ga0395899_0097235 3300037312 Bacteria 2128
1160 Ga0395899_0150288 3300037312 Bacteria 1651
1161 Ga0395899_0157944 3300037312 Bacteria 1603
1162 Ga0395900_0000447 3300037418 Bacteria 59069
1163 Ga0395900_0001237 3300037418 Bacteria 31404
1164 Ga0395900_0003293 3300037418 Bacteria 17476
1165 Ga0395900_0008912 3300037418 Bacteria 10293
1166 Ga0395900_0010430 3300037418 Bacteria 9503
1167 Ga0395900_0012370 3300037418 Bacteria 8733
1168 Ga0395900_0014134 3300037418 Bacteria 8151
1169 Ga0395900_0023784 3300037418 Bacteria 6268
1170 Ga0395900_0031449 3300037418 Bacteria 5453
1171 Ga0395900_0031981 3300037418 Bacteria 5408
1172 Ga0395900_0043530 3300037418 Bacteria 4627
1173 Ga0395900_0060690 3300037418 Bacteria 3890
1174 Ga0395900_0078347 3300037418 Bacteria 3396
1175 Ga0395900_0090264 3300037418 Bacteria 3149
1176 Ga0395900_0093241 3300037418 Bacteria 3093
1177 Ga0395900_0149452 3300037418 Bacteria 2387
1178 Ga0395900_0153780 3300037418 Bacteria 2350
1179 Ga0395900_0215182 3300037418 Bacteria 1939
1180 Ga0395898_0000978 3300037466 Bacteria 44946
1181 Ga0395898_0005900 3300037466 Bacteria 13169
1182 Ga0395898_0010805 3300037466 Bacteria 9538
1183 Ga0395898_0013212 3300037466 Bacteria 8506
1184 Ga0395898_0019019 3300037466 Bacteria 6995
1185 Ga0395898_0026042 3300037466 Bacteria 5889
1186 Ga0395898_0027768 3300037466 Bacteria 5675
1187 Ga0395898_0069451 3300037466 Bacteria 3408
1188 Ga0395898_0079598 3300037466 Bacteria 3161
1189 Ga0395898_0120402 3300037466 Bacteria 2515
1190 Ga0395898_0130858 3300037466 Bacteria 2404
1191 Ga0395898_0141896 3300037466 Bacteria 2299
1192 Ga0395905_0000104 3300037471 Bacteria 141965
1193 Ga0395905_0000974 3300037471 Bacteria 36725
1194 Ga0395905_0001255 3300037471 Bacteria 31369
1195 Ga0395905_0001886 3300037471 Bacteria 24164
1196 Ga0395905_0004314 3300037471 Bacteria 14817
1197 Ga0395905_0005211 3300037471 Bacteria 13309
1198 Ga0395905_0008284 3300037471 Bacteria 10261
1199 Ga0395905_0009884 3300037471 Bacteria 9297
1200 Ga0395905_0014108 3300037471 Bacteria 7639
1201 Ga0395905_0016029 3300037471 Bacteria 7123
1202 Ga0395905_0016902 3300037471 Bacteria 6930
1203 Ga0395905_0023848 3300037471 Bacteria 5776
1204 Ga0395905_0026200 3300037471 Bacteria 5498
1205 Ga0395905_0026869 3300037471 Bacteria 5428
1206 Ga0395905_0038225 3300037471 Bacteria 4503
1207 Ga0395905_0039669 3300037471 Bacteria 4418
1208 Ga0395905_0064932 3300037471 Bacteria 3416
1209 Ga0395905_0070210 3300037471 Bacteria 3281
1210 Ga0395905_0073786 3300037471 Bacteria 3198
1211 Ga0395905_0077640 3300037471 Bacteria 3111
1212 Ga0395905_0088810 3300037471 Bacteria 2896
1213 Ga0395905_0094324 3300037471 Bacteria 2807
1214 Ga0395905_0095012 3300037471 Bacteria 2797
1215 Ga0395905_0097272 3300037471 Bacteria 2764
1216 Ga0395905_0137704 3300037471 Bacteria 2297
1217 Ga0395905_0168475 3300037471 Bacteria 2058
1218 Ga0395905_0206485 3300037471 Bacteria 1841
1219 Ga0395905_0309360 3300037471 Bacteria 1468
1220 Ga0395905_0325408 3300037471 Bacteria 1427
1221 Ga0395905_0353352 3300037471 Bacteria 1362
1222 Ga0436364_0086296 3300037853 Bacteria 8589
1223 Ga0436364_0331782 3300037853 Bacteria 57289
1224 Ga0436364_0430514 3300037853 Bacteria 4239
1225 Ga0436364_0454096 3300037853 Bacteria 3613
1226 Ga0436364_0584120 3300037853 Bacteria 7267
1227 Ga0436364_1449597 3300037853 Bacteria 171227
1228 Ga0395901_0000276 3300038443 Bacteria 63580
1229 Ga0395901_0000324 3300038443 Bacteria 59134
1230 Ga0395901_0000702 3300038443 Bacteria 38241
1231 Ga0395901_0001229 3300038443 Bacteria 27314
1232 Ga0395901_0003633 3300038443 Bacteria 15561
1233 Ga0395901_0010013 3300038443 Bacteria 9610
1234 Ga0395901_0020870 3300038443 Bacteria 6709
1235 Ga0395901_0023392 3300038443 Bacteria 6333
1236 Ga0395901_0038736 3300038443 Bacteria 4931
1237 Ga0395901_0039030 3300038443 Bacteria 4912
1238 Ga0395901_0040045 3300038443 Bacteria 4851
1239 Ga0395901_0060689 3300038443 Bacteria 3935
1240 Ga0395901_0068820 3300038443 Bacteria 3687
1241 Ga0395901_0081320 3300038443 Bacteria 3384
1242 Ga0395901_0088892 3300038443 Bacteria 3232
1243 Ga0395901_0121313 3300038443 Bacteria 2747
1244 Ga0395901_0153861 3300038443 Bacteria 2415
1245 Ga0395901_0196084 3300038443 Bacteria 2117
1246 Ga0395901_0199360 3300038443 Bacteria 2098
1247 Ga0395901_0204822 3300038443 Bacteria 2067
1248 Ga0395901_0272156 3300038443 Bacteria 1761
1249 Ga0395901_0363701 3300038443 Bacteria 1491
1250 Ga0436365_0329501 3300039437 Bacteria 19789
1251 Ga0436365_0490562 3300039437 Bacteria 7472
1252 Ga0436365_0862833 3300039437 Bacteria 88455
1253 Ga0436365_1291448 3300039437 Bacteria 25345
1254 Ga0436365_1796505 3300039437 Bacteria 4604
1255 Ga0436365_1804902 3300039437 Bacteria 3443
1256 Ga0436360_1263027 3300039438 Bacteria 4036
1257 Ga0436361_0272150 3300039447 Bacteria 6822
1258 Ga0436361_0553665 3300039447 Bacteria 3660
1259 Ga0436361_0749976 3300039447 Unclassified 3133
1260 Ga0436363_1089207 3300039450 Bacteria 10918
1261 Ga0436363_1565021 3300039450 Bacteria 1778
1262 Ga0436362_0949954 3300039453 Bacteria 89092
1263 Ga0439465_0000100 3300041413 Bacteria 19698
1264 Ga0451853_1298320 3300041512 Bacteria 2587
1265 Ga0439445_0001968 3300042004 Bacteria 4533
1266 Ga0439445_0007987 3300042004 Bacteria 2468
1267 Ga0439432_002208 3300042006 Bacteria 7351
1268 Ga0439432_004034 3300042006 Bacteria 5386
1269 Ga0439449_0000021 3300042007 Bacteria 46082
1270 Ga0439463_008450 3300042016 Bacteria 2539
1271 Ga0450920_005478 3300042122 Bacteria 2256
1272 Ga0450889_000635 3300042144 Bacteria 3884
1273 Ga0439464_0000318 3300042439 Bacteria 9184
1274 Ga0466969_0002544 3300044656 Bacteria 9741
1275 Ga0466969_0003603 3300044656 Bacteria 8241
1276 Ga0466972_0066638 3300044658 Bacteria 1721
1277 Ga0466966_0000701 3300044684 Bacteria 21320
1278 Ga0466966_0016093 3300044684 Bacteria 4945
1279 Ga0466966_0100131 3300044684 Bacteria 1793
1280 Ga0466961_0003965 3300044693 Bacteria 9260
1281 Ga0466961_0043703 3300044693 Bacteria 2869
1282 Ga0466963_0009670 3300044694 Bacteria 5813
1283 Ga0466963_0051756 3300044694 Bacteria 2723
1284 Ga0466963_0169622 3300044694 Bacteria 1521
1285 Ga0466971_0003466 3300044719 Bacteria 6736
1286 Ga0466971_0018889 3300044719 Bacteria 3057
1287 Ga0466968_0016441 3300044735 Bacteria 2946
1288 Ga0466970_0021751 3300044765 Bacteria 3344
1289 Ga0466957_0076075 3300044842 Unclassified 2084
1290 Ga0466957_0106689 3300044842 Bacteria 1772
1291 Ga0466959_0000100 3300045049 Bacteria 54979
1292 Ga0466959_0003665 3300045049 Bacteria 10132
1293 Ga0466959_0215466 3300045049 Bacteria 1333
1294 Ga0466958_0015261 3300045836 Bacteria 4399
1295 Ga0466958_0048253 3300045836 Bacteria 2572
1296 Ga0466967_0119767 3300045976 Bacteria 2430
1297 Ga0466967_0132000 3300045976 Bacteria 2319
1298 Ga0466967_0136099 3300045976 Bacteria 2284
1299 Ga0466967_0162923 3300045976 Bacteria 2094
1300 Ga0466967_0282317 3300045976 Bacteria 1593
1301 Ga0466967_0308310 3300045976 Bacteria 1524
1302 Ga0466967_0385353 3300045976 Bacteria 1362
1303 Ga0495592_0051368 3300046454 Bacteria 3062
1304 Ga0495603_0002224 3300046455 Bacteria 11404
1305 Ga0495638_0004735 3300046460 Bacteria 10267
1306 Ga0495638_0071311 3300046460 Bacteria 2126
1307 Ga0495582_0008247 3300046473 Bacteria 5748
1308 Ga0495605_0006156 3300046474 Bacteria 6916
1309 Ga0495610_0001199 3300046512 Bacteria 23439
1310 Ga0495616_0020759 3300046513 Bacteria 3568
1311 Ga0495616_0025365 3300046513 Bacteria 3168
1312 Ga0495628_0038869 3300046516 Bacteria 3807
1313 Ga0495637_0060578 3300046520 Bacteria 1554
1314 Ga0495648_0076783 3300046524 Bacteria 1917
1315 Ga0495663_0000528 3300046525 Bacteria 13699
1316 Ga0495663_0000927 3300046525 Bacteria 9803
1317 Ga0495652_0060253 3300046529 Bacteria 3208
1318 Ga0495665_0005801 3300046531 Bacteria 6665
1319 Ga0495598_0002187 3300046537 Bacteria 4008
1320 Ga0495598_0010308 3300046537 Bacteria 2236
1321 Ga0495621_0000065 3300046539 Bacteria 20486
1322 Ga0495621_0000800 3300046539 Bacteria 7954
1323 Ga0495621_0014727 3300046539 Bacteria 2481
1324 Ga0495633_0002388 3300046558 Bacteria 13292
1325 Ga0495656_0112979 3300046615 Bacteria 1273
1326 Ga0495668_0000034 3300046616 Bacteria 254171
1327 Ga0495668_0000079 3300046616 Bacteria 157703
1328 Ga0495661_0006794 3300046665 Bacteria 8019
1329 Ga0495657_0000862 3300046675 Bacteria 26723
1330 Ga0495623_0024603 3300046679 Bacteria 3878
1331 Ga0495669_0002616 3300046684 Bacteria 7364
1332 Ga0495669_0004574 3300046684 Bacteria 5727
1333 Ga0495669_0006311 3300046684 Bacteria 4951
1334 Ga0495669_0006914 3300046684 Bacteria 4752
1335 Ga0495669_0064756 3300046684 Bacteria 1658
1336 Ga0495613_0001217 3300046689 Bacteria 19682
1337 Ga0495624_0158504 3300046690 Bacteria 1383
1338 Ga0495670_0000467 3300046691 Bacteria 19301
1339 Ga0495670_0023273 3300046691 Bacteria 3058
1340 Ga0495671_0005011 3300046692 Bacteria 7801
1341 Ga0495649_0025286 3300046694 Bacteria 3307
1342 Ga0495660_0004360 3300046810 Bacteria 8568
1343 Ga0495675_0012835 3300047444 Bacteria 5278
1344 Ga0495677_0003352 3300047445 Bacteria 6233
1345 Ga0495677_0005915 3300047445 Bacteria 4634
1346 Ga0495685_061071 3300047447 Bacteria 1270
1347 Ga0495686_0000164 3300047472 Bacteria 126101
1348 Ga0495686_0025665 3300047472 Bacteria 3862
1349 Ga0495686_0061585 3300047472 Bacteria 2330
1350 Ga0496100_0003792 3300048903 Bacteria 7913
1351 Ga0496100_0037167 3300048903 Bacteria 3076
1352 Ga0496101_0001530 3300048904 Bacteria 13854
1353 Ga0496101_0021951 3300048904 Bacteria 4388
1354 Ga0496101_0022269 3300048904 Bacteria 4361
1355 Ga0496101_0030191 3300048904 Bacteria 3798
1356 Ga0496101_0047686 3300048904 Bacteria 3077
1357 Ga0496101_0099624 3300048904 Bacteria 2173
1358 Ga0496102_0001739 3300048905 Bacteria 19070
1359 Ga0496102_0014406 3300048905 Bacteria 6870
1360 Ga0496102_0032814 3300048905 Unclassified 4666
1361 Ga0496102_0123882 3300048905 Bacteria 2415
1362 Ga0496102_0192597 3300048905 Bacteria 1921
1363 Ga0496102_0221408 3300048905 Bacteria 1784
1364 Ga0496103_0002913 3300048906 Bacteria 10609
1365 Ga0496103_0011702 3300048906 Bacteria 5204
1366 Ga0496103_0012986 3300048906 Bacteria 4938
1367 Ga0496103_0029807 3300048906 Bacteria 3317
1368 Ga0496103_0052039 3300048906 Bacteria 2536
1369 Ga0496104_0001296 3300048907 Bacteria 21566
1370 Ga0496104_0015717 3300048907 Bacteria 6865
1371 Ga0496104_0078080 3300048907 Bacteria 3155
1372 Ga0496104_0286449 3300048907 Bacteria 1560
1373 Ga0496105_0000695 3300048908 Bacteria 22689
1374 Ga0496105_0000932 3300048908 Bacteria 19921
1375 Ga0496105_0022358 3300048908 Bacteria 5121
1376 Ga0496105_0275116 3300048908 Bacteria 1359
1377 Ga0496106_0000685 3300048909 Bacteria 24284
1378 Ga0496106_0004331 3300048909 Bacteria 10539
1379 Ga0496106_0017079 3300048909 Bacteria 5371
1380 Ga0496106_0018321 3300048909 Bacteria 5174
1381 Ga0496106_0055678 3300048909 Bacteria 2990
1382 Ga0496106_0117567 3300048909 Bacteria 2075
1383 Ga0496107_0000057 3300048910 Bacteria 57260
1384 Ga0496107_0001610 3300048910 Bacteria 14069
1385 Ga0496107_0002088 3300048910 Bacteria 12791
1386 Ga0496107_0002535 3300048910 Bacteria 11898
1387 Ga0496107_0003034 3300048910 Bacteria 11130
1388 Ga0496107_0144163 3300048910 Bacteria 1761
1389 Ga0496107_0168901 3300048910 Bacteria 1623
1390 Ga0496107_0174638 3300048910 Bacteria 1595
1391 Ga0496108_0004255 3300048911 Bacteria 11525
1392 Ga0496108_0006866 3300048911 Bacteria 9210
1393 Ga0496108_0013082 3300048911 Bacteria 6763
1394 Ga0496108_0022113 3300048911 Bacteria 5228
1395 Ga0496108_0029034 3300048911 Bacteria 4577
1396 Ga0496108_0049189 3300048911 Bacteria 3526
1397 Ga0496108_0086212 3300048911 Bacteria 2666
1398 Ga0496109_0000521 3300048912 Bacteria 32573
1399 Ga0496109_0010536 3300048912 Bacteria 7902
1400 Ga0496109_0013067 3300048912 Bacteria 7182
1401 Ga0496109_0138588 3300048912 Bacteria 2274
1402 Ga0496110_0000847 3300048913 Bacteria 21521
1403 Ga0496110_0012913 3300048913 Bacteria 6887
1404 Ga0496110_0029506 3300048913 Bacteria 4721
1405 Ga0496110_0038466 3300048913 Bacteria 4163
1406 Ga0496110_0058135 3300048913 Bacteria 3405
1407 Ga0496110_0089550 3300048913 Bacteria 2750
1408 Ga0496110_0336969 3300048913 Bacteria 1374
1409 Ga0496111_0000782 3300048914 Bacteria 16994
1410 Ga0496111_0003138 3300048914 Bacteria 10164
1411 Ga0496111_0005026 3300048914 Bacteria 8411
1412 Ga0496111_0006263 3300048914 Bacteria 7714
1413 Ga0496111_0014601 3300048914 Bacteria 5371
1414 Ga0496111_0074700 3300048914 Bacteria 2469
1415 Ga0496112_0005760 3300048915 Bacteria 10774
1416 Ga0496112_0005909 3300048915 Bacteria 10673
1417 Ga0496112_0008648 3300048915 Bacteria 9128
1418 Ga0496112_0014514 3300048915 Bacteria 7315
1419 Ga0496112_0072844 3300048915 Bacteria 3396
1420 Ga0496112_0256623 3300048915 Bacteria 1698
1421 Ga0496113_0002271 3300048916 Bacteria 11088
1422 Ga0496113_0042465 3300048916 Bacteria 3360
1423 Ga0496113_0049295 3300048916 Bacteria 3135
1424 Ga0496113_0061068 3300048916 Bacteria 2843
1425 Ga0496113_0129310 3300048916 Bacteria 1980
1426 Ga0496114_0000109 3300048917 Bacteria 59733
1427 Ga0496114_0001315 3300048917 Bacteria 18828
1428 Ga0496114_0021294 3300048917 Bacteria 5273
1429 Ga0496114_0056792 3300048917 Bacteria 3267
1430 Ga0496115_0000691 3300048918 Bacteria 25050
1431 Ga0496115_0029126 3300048918 Bacteria 4334
1432 Ga0496115_0144925 3300048918 Bacteria 1960
1433 Ga0496116_0006891 3300048919 Bacteria 10203
1434 Ga0496117_0000316 3300048920 Bacteria 84475
1435 Ga0496117_0007881 3300048920 Bacteria 10241
1436 Ga0496118_0000003 3300048921 Bacteria 773148
1437 Ga0496118_0011358 3300048921 Bacteria 8705
1438 Ga0496118_0021325 3300048921 Bacteria 5707
1439 Ga0496118_0058208 3300048921 Bacteria 2890
1440 Ga0496119_0035935 3300048922 Bacteria 3239
1441 Ga0496120_0053834 3300048923 Bacteria 2284
1442 Ga0496121_0000078 3300048924 Bacteria 233455
1443 Ga0496121_0000293 3300048924 Bacteria 103372
1444 Ga0496121_0000520 3300048924 Bacteria 73411
1445 Ga0496121_0001591 3300048924 Bacteria 37770
1446 Ga0496121_0032025 3300048924 Bacteria 4788
1447 Ga0496121_0120858 3300048924 Bacteria 1978
1448 Ga0496123_0001205 3300048926 Bacteria 37836
1449 Ga0496125_0000743 3300048928 Bacteria 53879
1450 Ga0496125_0049656 3300048928 Bacteria 3483
1451 Ga0496126_0002855 3300048929 Bacteria 22592
1452 Ga0496126_0024757 3300048929 Bacteria 5789
1453 Ga0496126_0131367 3300048929 Bacteria 2163
1454 Ga0501344_00458 3300049133 Bacteria 1700
1455 Ga0501033_0003807 3300049570 Bacteria 12270
1456 Ga0501033_0164138 3300049570 Bacteria 1598
1457 Ga0501034_0001823 3300049571 Bacteria 27089
1458 Ga0501034_0032213 3300049571 Bacteria 5325
1459 Ga0501034_0058147 3300049571 Bacteria 3886
1460 Ga0501034_0066987 3300049571 Unclassified 3604
1461 Ga0501034_0078002 3300049571 Bacteria 3318
1462 Ga0501034_0112927 3300049571 Bacteria 2707
1463 Ga0501034_0206973 3300049571 Bacteria 1918
1464 Ga0501034_0274715 3300049571 Bacteria 1625
1465 Ga0501037_0052873 3300049573 Bacteria 2970
1466 Ga0501037_0098195 3300049573 Bacteria 2116
1467 Ga0501037_0137414 3300049573 Bacteria 1750
1468 Ga0501038_0072611 3300049574 Bacteria 2916
1469 Ga0501040_0001111 3300049576 Archaea 17023
1470 Ga0501043_0015010 3300049579 Bacteria 6066
1471 Ga0501043_0048773 3300049579 Bacteria 3328
1472 Ga0501046_0059507 3300049580 Archaea 2992
1473 Ga0501047_0000495 3300049581 Bacteria 42674
1474 Ga0501047_0031886 3300049581 Bacteria 5085
1475 Ga0501047_0051112 3300049581 Bacteria 3992
1476 Ga0501047_0065590 3300049581 Archaea 3500
1477 Ga0501047_0162834 3300049581 Bacteria 2102
1478 Ga0501067_0000020 3300049583 Bacteria 99898
1479 Ga0501067_0035347 3300049583 Bacteria 2775
1480 Ga0501067_0036455 3300049583 Unclassified 2730
1481 Ga0501068_0007993 3300049584 Bacteria 5865
1482 Ga0501069_0059272 3300049585 Bacteria 2136
1483 Ga0501070_0196199 3300049586 Bacteria 1658
1484 Ga0501070_0226721 3300049586 Bacteria 1531
1485 Ga0501072_0110194 3300049588 Bacteria 2191
1486 Ga0501073_0000969 3300049589 Bacteria 20678
1487 Ga0501073_0002061 3300049589 Bacteria 15026
1488 Ga0501073_0034893 3300049589 Bacteria 3577
1489 Ga0501074_0028679 3300049590 Bacteria 4034
1490 Ga0501257_000008 3300049686 Bacteria 54624
1491 Ga0501225_0002546 3300049705 Bacteria 5626
1492 Ga0501080_0026026 3300049742 Bacteria 5435
1493 Ga0501080_0055953 3300049742 Bacteria 3674
1494 Ga0501080_0109957 3300049742 Unclassified 2554
1495 Ga0501080_0113436 3300049742 Bacteria 2513
1496 Ga0501080_0218200 3300049742 Bacteria 1746
1497 Ga0501083_0000016 3300049744 Bacteria 156309
1498 Ga0501083_0007007 3300049744 Bacteria 8001
1499 Ga0501083_0032268 3300049744 Bacteria 3593
1500 Ga0501241_003362 3300049758 Unclassified 3019
1501 Ga0501280_001017 3300049776 Bacteria 5802
1502 Ga0501035_0003147 3300049822 Bacteria 15853
1503 Ga0501035_0073610 3300049822 Bacteria 3023
1504 Ga0501035_0128836 3300049822 Bacteria 2207
1505 Ga0501044_0004599 3300049823 Bacteria 15432
1506 Ga0501044_0025812 3300049823 Bacteria 6228
1507 Ga0501044_0243772 3300049823 Bacteria 1740
1508 nmdc:mga00v17_40517_c1 3300050491 Bacteria 2794
1509 nmdc:mga06r32_4357_c1 3300050510 Bacteria 12660
1510 nmdc:mga08y16_309658_c1 3300050511 Bacteria 1626
1511 nmdc:mga08y16_5569_c1 3300050511 Bacteria 13191
1512 nmdc:mga08x19_112903_c1 3300050514 Bacteria 1242
1513 nmdc:mga0a205_54162_c1 3300050515 Bacteria 3873
1514 Ga0500610_0001905 3300053079 Bacteria 7411
1515 Ga0500643_001292 3300053087 Bacteria 14753
1516 Ga0500595_013270 3300053119 Bacteria 3160
1517 Ga0500658_0001563 3300053134 Bacteria 9136
1518 Ga0500559_0000752 3300053136 Bacteria 21274
1519 Ga0500616_0000209 3300053153 Bacteria 94705
1520 Ga0500620_005002 3300053155 Bacteria 3021
1521 Ga0500622_0026058 3300053156 Bacteria 3088
1522 Ga0500636_0009880 3300053177 Bacteria 5554
1523 Ga0501084_0002756 3300054114 Bacteria 14186
1524 Ga0501082_0246015 3300060353 Bacteria 1556
1525 Ga0466962_0002025 3300061719 Bacteria 9565
1526 Ga0466962_0120631 3300061719 Bacteria 1265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10012904 Ga0307405_100129042 316
2 iso_pu_bacteria 2906378014 2906379059 327
3 3300026078 Ga0207702_10197262 Ga0207702_101972622 328
4 3300035242 Ga0373962_0062408 Ga0373962_0062408_32_1033 329
5 3300028794 Ga0307515_10000027 Ga0307515_1000002750 336
6 3300005844 Ga0068862_100072551 Ga0068862_1000725512 344
7 3300031995 Ga0307409_100010794 Ga0307409_1000107943 345
8 3300031995 Ga0307409_100116482 Ga0307409_1001164822 345
9 3300032002 Ga0307416_100069177 Ga0307416_1000691772 345
10 3300032002 Ga0307416_100112469 Ga0307416_1001124692 345
11 3300032004 Ga0307414_10003339 Ga0307414_100033393 345
12 3300032005 Ga0307411_10179750 Ga0307411_101797502 345
13 3300021388 Ga0213875_10012927 Ga0213875_100129273 347
14 3300037853 Ga0436364_0454096 Ga0436364_0454096_1856_3013 347
15 3300005327 Ga0070658_10093432 Ga0070658_100934323 349
16 3300005345 Ga0070692_10028647 Ga0070692_100286472 349
17 3300025919 Ga0207657_10000267 Ga0207657_100002676 349
18 3300037312 Ga0395899_0005357 Ga0395899_0005357_5604_6743 349
19 3300037418 Ga0395900_0000447 Ga0395900_0000447_55371_56510 349
20 3300037466 Ga0395898_0005900 Ga0395898_0005900_4176_5315 349
21 3300037471 Ga0395905_0137704 Ga0395905_0137704_1122_2261 349
22 3300038443 Ga0395901_0000324 Ga0395901_0000324_55403_56542 349
23 3300010375 Ga0105239_10159582 Ga0105239_101595823 351
24 3300025893 Ga0207682_10002744 Ga0207682_100027444 351
25 3300005331 Ga0070670_100056692 Ga0070670_1000566924 352
26 3300025925 Ga0207650_10122566 Ga0207650_101225662 352
27 3300025933 Ga0207706_10027086 Ga0207706_100270864 352
28 3300006881 Ga0068865_100035927 Ga0068865_1000359272 353
29 3300025933 Ga0207706_10010395 Ga0207706_100103958 353
30 3300046473 Ga0495582_0008247 Ga0495582_0008247_4273_5421 353
31 3300046474 Ga0495605_0006156 Ga0495605_0006156_4009_5157 353
32 3300046531 Ga0495665_0005801 Ga0495665_0005801_3161_4309 353
33 3300046539 Ga0495621_0014727 Ga0495621_0014727_926_2077 353
34 3300047444 Ga0495675_0012835 Ga0495675_0012835_326_1474 353
35 3300005345 Ga0070692_10016014 Ga0070692_100160142 354
36 3300005455 Ga0070663_100015781 Ga0070663_1000157816 354
37 3300005458 Ga0070681_10124855 Ga0070681_101248552 354
38 3300025921 Ga0207652_10090491 Ga0207652_100904912 354
39 3300026067 Ga0207678_10000740 Ga0207678_1000074025 354
40 3300031995 Ga0307409_100094881 Ga0307409_1000948813 354
41 3300037466 Ga0395898_0000978 Ga0395898_0000978_43364_44497 354
42 3300037466 Ga0395898_0010805 Ga0395898_0010805_1781_2920 354
43 3300037471 Ga0395905_0088810 Ga0395905_0088810_410_1549 354
44 3300038443 Ga0395901_0000702 Ga0395901_0000702_10868_12001 354
45 3300042006 Ga0439432_004034 Ga0439432_004034_1710_2849 354
46 3300037471 Ga0395905_0038225 Ga0395905_0038225_3125_4267 355
47 3300038443 Ga0395901_0038736 Ga0395901_0038736_2344_3486 355
48 3300038443 Ga0395901_0060689 Ga0395901_0060689_204_1364 355
49 3300050491 nmdc:mga00v17_40517_c1 nmdc:mga00v17_40517_c1_12_1109 355
50 3300005539 Ga0068853_100099081 Ga0068853_1000990812 356
51 3300005616 Ga0068852_100235157 Ga0068852_1002351572 356
52 3300013307 Ga0157372_10518107 Ga0157372_105181072 356
53 3300020070 Ga0206356_11302048 Ga0206356_113020484 356
54 3300005290 Ga0065712_10075748 Ga0065712_100757483 358
55 3300005328 Ga0070676_10048337 Ga0070676_100483372 358
56 3300005331 Ga0070670_100000333 Ga0070670_10000033327 358
57 3300005335 Ga0070666_10026371 Ga0070666_100263712 358
58 3300005339 Ga0070660_100046442 Ga0070660_1000464422 358
59 3300005355 Ga0070671_100023574 Ga0070671_1000235746 358
60 3300005364 Ga0070673_100011717 Ga0070673_1000117173 358
61 3300005367 Ga0070667_100026953 Ga0070667_1000269532 358
62 3300005455 Ga0070663_100009792 Ga0070663_1000097925 358
63 3300005564 Ga0070664_100069993 Ga0070664_1000699932 358
64 3300005618 Ga0068864_100114965 Ga0068864_1001149653 358
65 3300009177 Ga0105248_10002100 Ga0105248_1000210012 358
66 3300025909 Ga0207705_10153878 Ga0207705_101538781 358
67 3300025919 Ga0207657_10052752 Ga0207657_100527523 358
68 3300025920 Ga0207649_10009140 Ga0207649_100091404 358
69 3300025926 Ga0207659_10007983 Ga0207659_100079835 358
70 3300025931 Ga0207644_10000941 Ga0207644_1000094119 358
71 3300025940 Ga0207691_10004037 Ga0207691_1000403714 358
72 3300025960 Ga0207651_10009881 Ga0207651_100098813 358
73 3300026095 Ga0207676_10034087 Ga0207676_100340873 358
74 3300046684 Ga0495669_0006914 Ga0495669_0006914_382_1524 358
75 3300048913 Ga0496110_0058135 Ga0496110_0058135_1510_2652 358
76 3300048914 Ga0496111_0000782 Ga0496111_0000782_754_1896 358
77 3300005328 Ga0070676_10103857 Ga0070676_101038571 359
78 3300005355 Ga0070671_100025830 Ga0070671_1000258304 359
79 3300005457 Ga0070662_100005039 Ga0070662_1000050393 359
80 3300005616 Ga0068852_100120257 Ga0068852_1001202572 359
81 3300009177 Ga0105248_10092200 Ga0105248_100922004 359
82 3300013100 Ga0157373_10003162 Ga0157373_100031622 359
83 3300025932 Ga0207690_10138240 Ga0207690_101382402 359
84 3300025933 Ga0207706_10000475 Ga0207706_1000047539 359
85 3300025941 Ga0207711_10049600 Ga0207711_100496002 359
86 3300032126 Ga0307415_100135320 Ga0307415_1001353202 359
87 3300037471 Ga0395905_0168475 Ga0395905_0168475_146_1285 359
88 3300048915 Ga0496112_0014514 Ga0496112_0014514_5059_6210 359
89 3300005354 Ga0070675_100147595 Ga0070675_1001475951 360
90 3300007788 Ga0099795_10000692 Ga0099795_100006926 360
91 3300010159 Ga0099796_10000802 Ga0099796_100008024 360
92 3300025981 Ga0207640_10081024 Ga0207640_100810242 360
93 3300032002 Ga0307416_100099156 Ga0307416_1000991562 360
94 3300032005 Ga0307411_10195169 Ga0307411_101951692 360
95 3300032126 Ga0307415_100242435 Ga0307415_1002424351 360
96 3300037418 Ga0395900_0008912 Ga0395900_0008912_3317_4468 360
97 3300037471 Ga0395905_0000104 Ga0395905_0000104_1891_3042 360
98 3300042122 Ga0450920_005478 Ga0450920_005478_983_2122 360
99 3300031852 Ga0307410_10173421 Ga0307410_101734212 361
100 3300031901 Ga0307406_10058341 Ga0307406_100583412 361
101 3300032002 Ga0307416_100276184 Ga0307416_1002761842 361
102 3300049570 Ga0501033_0003807 Ga0501033_0003807_1977_3134 361
103 3300049571 Ga0501034_0078002 Ga0501034_0078002_1552_2709 361
104 3300049579 Ga0501043_0048773 Ga0501043_0048773_266_1423 361
105 3300013307 Ga0157372_10210723 Ga0157372_102107232 364
106 3300031995 Ga0307409_100015511 Ga0307409_1000155113 364
107 3300037312 Ga0395899_0150288 Ga0395899_0150288_535_1632 364
108 3300049744 Ga0501083_0000016 Ga0501083_0000016_14596_15729 364
109 3300005543 Ga0070672_100216691 Ga0070672_1002166912 366
110 3300006847 Ga0075431_100007044 Ga0075431_1000070441 366
111 3300017792 Ga0163161_10004455 Ga0163161_100044555 366
112 3300025925 Ga0207650_10206569 Ga0207650_102065692 366
113 3300025940 Ga0207691_10127774 Ga0207691_101277741 366
114 3300050510 nmdc:mga06r32_4357_c1 nmdc:mga06r32_4357_c1_9949_11121 366
115 3300031731 Ga0307405_10016186 Ga0307405_100161864 367
116 3300031824 Ga0307413_10005133 Ga0307413_100051332 367
117 3300031852 Ga0307410_10012347 Ga0307410_100123473 367
118 3300031903 Ga0307407_10006018 Ga0307407_100060185 367
119 3300031911 Ga0307412_10045681 Ga0307412_100456812 367
120 3300031995 Ga0307409_100034116 Ga0307409_1000341162 367
121 3300032002 Ga0307416_100068874 Ga0307416_1000688742 367
122 3300032002 Ga0307416_100203850 Ga0307416_1002038502 367
123 3300032004 Ga0307414_10001794 Ga0307414_100017949 367
124 3300032005 Ga0307411_10002909 Ga0307411_100029095 367
125 3300032126 Ga0307415_100000244 Ga0307415_10000024424 367
126 3300032126 Ga0307415_100096547 Ga0307415_1000965472 367
127 iso_pu_bacteria 2958092219 2958098880 367
128 3300005617 Ga0068859_100134443 Ga0068859_1001344432 368
129 3300005618 Ga0068864_100077173 Ga0068864_1000771732 368
130 3300005844 Ga0068862_100052452 Ga0068862_1000524523 368
131 3300005937 Ga0081455_10000675 Ga0081455_1000067512 368
132 3300006931 Ga0097620_100134449 Ga0097620_1001344492 368
133 3300028381 Ga0268264_10019845 Ga0268264_100198452 368
134 3300048916 Ga0496113_0061068 Ga0496113_0061068_1712_2830 368
135 3300050511 nmdc:mga08y16_309658_c1 nmdc:mga08y16_309658_c1_387_1538 368
136 iso_pu_bacteria 2935890801 2935893635 368
137 3300003320 rootH2_10150611 rootH2_101506113 369
138 3300031852 Ga0307410_10094198 Ga0307410_100941982 369
139 3300031901 Ga0307406_10005150 Ga0307406_100051506 369
140 3300031911 Ga0307412_10029004 Ga0307412_100290043 369
141 3300032005 Ga0307411_10073382 Ga0307411_100733822 369
142 3300047472 Ga0495686_0061585 Ga0495686_0061585_522_1634 369
143 3300005295 Ga0065707_10081772 Ga0065707_1008177223 370
144 3300005543 Ga0070672_100129659 Ga0070672_1001296592 371
145 3300009094 Ga0111539_10225985 Ga0111539_102259852 371
146 3300026121 Ga0207683_10191977 Ga0207683_101919771 371
147 3300005333 Ga0070677_10044276 Ga0070677_100442762 372
148 3300005353 Ga0070669_100037421 Ga0070669_1000374214 372
149 3300005355 Ga0070671_100125996 Ga0070671_1001259963 372
150 3300005364 Ga0070673_100155268 Ga0070673_1001552682 372
151 3300005457 Ga0070662_100167063 Ga0070662_1001670632 372
152 3300025893 Ga0207682_10033762 Ga0207682_100337622 372
153 3300025931 Ga0207644_10250097 Ga0207644_102500971 372
154 3300025960 Ga0207651_10275756 Ga0207651_102757562 372
155 3300028794 Ga0307515_10039280 Ga0307515_100392804 372
156 3300031901 Ga0307406_10000444 Ga0307406_1000044424 372
157 3300048921 Ga0496118_0058208 Ga0496118_0058208_418_1566 372
158 3300049571 Ga0501034_0058147 Ga0501034_0058147_2580_3728 372
159 iso_pu_bacteria 2862705112 2862709330 372
160 iso_pu_bacteria 8008485437 8008487660 372
161 iso_pu_bacteria 8025524527 8025526821 372
162 3300006175 Ga0070712_100022944 Ga0070712_1000229442 373
163 3300009094 Ga0111539_10364437 Ga0111539_103644372 373
164 3300009553 Ga0105249_10416107 Ga0105249_104161071 373
165 3300013297 Ga0157378_10135898 Ga0157378_101358982 373
166 3300021388 Ga0213875_10000061 Ga0213875_1000006174 373
167 3300025915 Ga0207693_10060938 Ga0207693_100609382 373
168 3300037312 Ga0395899_0097235 Ga0395899_0097235_479_1612 373
169 3300037418 Ga0395900_0149452 Ga0395900_0149452_503_1654 373
170 3300037471 Ga0395905_0206485 Ga0395905_0206485_379_1530 373
171 3300038443 Ga0395901_0272156 Ga0395901_0272156_447_1598 373
172 3300048905 Ga0496102_0001739 Ga0496102_0001739_16031_17203 373
173 3300048906 Ga0496103_0029807 Ga0496103_0029807_1588_2760 373
174 3300048907 Ga0496104_0001296 Ga0496104_0001296_5229_6401 373
175 3300048908 Ga0496105_0000695 Ga0496105_0000695_8025_9197 373
176 3300048910 Ga0496107_0001610 Ga0496107_0001610_4629_5801 373
177 3300048911 Ga0496108_0029034 Ga0496108_0029034_3001_4173 373
178 3300048912 Ga0496109_0000521 Ga0496109_0000521_16219_17391 373
179 3300048915 Ga0496112_0072844 Ga0496112_0072844_1124_2296 373
180 3300048917 Ga0496114_0001315 Ga0496114_0001315_534_1706 373
181 3300048918 Ga0496115_0029126 Ga0496115_0029126_1062_2234 373
182 3300053153 Ga0500616_0000209 Ga0500616_0000209_18201_19346 373
183 iso_pu_bacteria 2551306166 2552114059 373
184 iso_pu_bacteria 2582581313 2585307976 373
185 iso_pu_bacteria 2643221647 2644270501 373
186 iso_pu_bacteria 2816332119 2816424314 373
187 iso_pu_bacteria 2818991472 2819745704 373
188 iso_pu_bacteria 2837268691 2837271733 373
189 iso_pu_bacteria 2852632344 2852633712 373
190 iso_pu_bacteria 2862290372 2862293481 373
191 iso_pu_bacteria 2866612099 2866616696 373
192 iso_pu_bacteria 2899359706 2899361453 373
193 iso_pu_bacteria 2918501144 2918507924 373
194 iso_pu_bacteria 2922151315 2922158346 373
195 iso_pu_bacteria 2997600082 2997605507 373
196 iso_pu_bacteria 8047710418 8047710846 373
197 3300005339 Ga0070660_100011417 Ga0070660_1000114173 374
198 3300005347 Ga0070668_100000591 Ga0070668_10000059119 374
199 3300005455 Ga0070663_100070917 Ga0070663_1000709172 374
200 3300005539 Ga0068853_100267374 Ga0068853_1002673742 374
201 3300006914 Ga0075436_100267541 Ga0075436_1002675411 374
202 3300013100 Ga0157373_10041283 Ga0157373_100412832 374
203 3300021384 Ga0213876_10012133 Ga0213876_100121335 374
204 3300025904 Ga0207647_10092157 Ga0207647_100921572 374
205 3300025909 Ga0207705_10016829 Ga0207705_100168295 374
206 3300025919 Ga0207657_10003334 Ga0207657_1000333418 374
207 3300025945 Ga0207679_10301087 Ga0207679_103010871 374
208 3300026041 Ga0207639_10042457 Ga0207639_100424573 374
209 3300026067 Ga0207678_10026121 Ga0207678_100261212 374
210 3300026067 Ga0207678_10072445 Ga0207678_100724453 374
211 3300028563 Ga0265319_1012169 Ga0265319_10121692 374
212 3300028577 Ga0265318_10011502 Ga0265318_100115023 374
213 3300031240 Ga0265320_10015009 Ga0265320_100150093 374
214 3300037418 Ga0395900_0001237 Ga0395900_0001237_26810_27961 374
215 3300037466 Ga0395898_0026042 Ga0395898_0026042_3132_4283 374
216 3300037471 Ga0395905_0001255 Ga0395905_0001255_29366_30517 374
217 3300038443 Ga0395901_0023392 Ga0395901_0023392_1813_2964 374
218 3300039437 Ga0436365_1804902 Ga0436365_1804902_197_1348 374
219 3300049571 Ga0501034_0274715 Ga0501034_0274715_217_1368 374
220 3300049581 Ga0501047_0051112 Ga0501047_0051112_341_1492 374
221 3300049822 Ga0501035_0128836 Ga0501035_0128836_366_1517 374
222 3300050514 nmdc:mga08x19_112903_c1 nmdc:mga08x19_112903_c1_58_1206 374
223 iso_pu_bacteria 2512875024 2512962544 374
224 iso_pu_bacteria 2513237164 2514038625 374
225 iso_pu_bacteria 2585428059 2587741855 374
226 iso_pu_bacteria 2643221676 2644424714 374
227 iso_pu_bacteria 2643221731 2644716654 374
228 iso_pu_bacteria 2643221732 2644722682 374
229 iso_pu_bacteria 2687453392 2688595614 374
230 iso_pu_bacteria 2791355123 2792746798 374
231 iso_pu_bacteria 2816332295 2817482147 374
232 iso_pu_bacteria 2818991441 2819567143 374
233 iso_pu_bacteria 2818991459 2819674182 374
234 iso_pu_bacteria 2840677318 2840678409 374
235 iso_pu_bacteria 2857453340 2857457643 374
236 iso_pu_bacteria 2857465823 2857470485 374
237 iso_pu_bacteria 2857472729 2857476157 374
238 iso_pu_bacteria 2857591370 2857596877 374
239 iso_pu_bacteria 2857604169 2857608160 374
240 iso_pu_bacteria 2864997549 2865000746 374
241 iso_pu_bacteria 2869278585 2869280102 374
242 iso_pu_bacteria 2874139085 2874143346 374
243 iso_pu_bacteria 2874168670 2874172002 374
244 iso_pu_bacteria 2878738818 2878740585 374
245 iso_pu_bacteria 2883068021 2883068479 374
246 iso_pu_bacteria 2888337043 2888342955 374
247 iso_pu_bacteria 2889295896 2889298590 374
248 iso_pu_bacteria 2904524088 2904525411 374
249 iso_pu_bacteria 2904755435 2904762516 374
250 iso_pu_bacteria 2916971899 2916974015 374
251 iso_pu_bacteria 2919425241 2919431797 374
252 iso_pu_bacteria 2919720352 2919722273 374
253 iso_pu_bacteria 2924718760 2924721744 374
254 iso_pu_bacteria 2924776078 2924778186 374
255 iso_pu_bacteria 2925326138 2925328487 374
256 iso_pu_bacteria 2937822353 2937824309 374
257 iso_pu_bacteria 2937877337 2937877984 374
258 iso_pu_bacteria 2937972304 2937973971 374
259 iso_pu_bacteria 2939611941 2939615303 374
260 iso_pu_bacteria 2958034702 2958035968 374
261 iso_pu_bacteria 2958041894 2958045274 374
262 iso_pu_bacteria 2958084443 2958085095 374
263 iso_pu_bacteria 2958144490 2958147362 374
264 iso_pu_bacteria 2960319331 2960324589 374
265 iso_pu_bacteria 2965110997 2965115385 374
266 iso_pu_bacteria 2968016561 2968017055 374
267 iso_pu_bacteria 2968138860 2968146089 374
268 iso_pu_bacteria 2970469710 2970470212 374
269 iso_pu_bacteria 2970593180 2970594699 374
270 iso_pu_bacteria 2979793036 2979796775 374
271 iso_pu_bacteria 2980125574 2980130617 374
272 iso_pu_bacteria 2980182181 2980186566 374
273 iso_pu_bacteria 2980182181 2980188806 374
274 iso_pu_bacteria 2981284811 2981289056 374
275 iso_pu_bacteria 2981289755 2981293807 374
276 iso_pu_bacteria 2981980479 2981984662 374
277 iso_pu_bacteria 2981985349 2981989523 374
278 iso_pu_bacteria 2987673487 2987674316 374
279 iso_pu_bacteria 2996348954 2996349001 374
280 iso_pu_bacteria 3004268573 3004272591 374
281 iso_pu_bacteria 3004275668 3004275713 374
282 iso_pu_bacteria 3006858327 3006862578 374
283 iso_pu_bacteria 8022893055 8022896719 374
284 iso_pu_bacteria 8022914991 8022916360 374
285 iso_pu_bacteria 8054795415 8054802387 374
286 iso_pu_bacteria 8057132660 8057133497 374
287 iso_pu_bacteria 8057977335 8057981202 374
288 3300031995 Ga0307409_100120849 Ga0307409_1001208492 375
289 3300035086 Ga0373934_0044959 Ga0373934_0044959_330_1490 375
290 iso_pu_bacteria 2524023250 2524612328 375
291 iso_pu_bacteria 2835312727 2835318484 375
292 iso_pu_bacteria 2894232714 2894235901 375
293 3300021384 Ga0213876_10001093 Ga0213876_100010939 376
294 3300021384 Ga0213876_10081864 Ga0213876_100818643 376
295 3300039437 Ga0436365_0329501 Ga0436365_0329501_7356_8498 376
296 3300039437 Ga0436365_1796505 Ga0436365_1796505_1535_2677 376
297 3300006844 Ga0075428_100301389 Ga0075428_1003013892 377
298 3300009094 Ga0111539_10311352 Ga0111539_103113523 377
299 3300009147 Ga0114129_10535955 Ga0114129_105359551 377
300 3300009148 Ga0105243_10097864 Ga0105243_100978643 377
301 3300013105 Ga0157369_10133424 Ga0157369_101334242 377
302 3300013307 Ga0157372_10462526 Ga0157372_104625261 377
303 3300021388 Ga0213875_10000398 Ga0213875_1000039823 377
304 3300025935 Ga0207709_10118340 Ga0207709_101183402 377
305 3300031456 Ga0307513_10000001 Ga0307513_10000001616 377
306 3300031616 Ga0307508_10002405 Ga0307508_100024059 377
307 3300037853 Ga0436364_0331782 Ga0436364_0331782_28443_29588 377
308 3300044693 Ga0466961_0043703 Ga0466961_0043703_717_1862 377
309 3300044694 Ga0466963_0051756 Ga0466963_0051756_61_1206 377
310 3300044719 Ga0466971_0018889 Ga0466971_0018889_508_1653 377
311 3300044765 Ga0466970_0021751 Ga0466970_0021751_1955_3100 377
312 3300045976 Ga0466967_0119767 Ga0466967_0119767_231_1388 377
313 3300045976 Ga0466967_0385353 Ga0466967_0385353_16_1173 377
314 3300046454 Ga0495592_0051368 Ga0495592_0051368_1642_2787 377
315 3300046516 Ga0495628_0038869 Ga0495628_0038869_975_2120 377
316 3300046529 Ga0495652_0060253 Ga0495652_0060253_881_2026 377
317 3300046675 Ga0495657_0000862 Ga0495657_0000862_7042_8187 377
318 3300046689 Ga0495613_0001217 Ga0495613_0001217_14799_15944 377
319 3300046690 Ga0495624_0158504 Ga0495624_0158504_188_1333 377
320 3300049581 Ga0501047_0031886 Ga0501047_0031886_1275_2420 377
321 3300049585 Ga0501069_0059272 Ga0501069_0059272_169_1326 377
322 3300049742 Ga0501080_0218200 Ga0501080_0218200_526_1683 377
323 3300049823 Ga0501044_0243772 Ga0501044_0243772_311_1459 377
324 3300053087 Ga0500643_001292 Ga0500643_001292_2102_3238 377
325 iso_pu_bacteria 2675903059 2676479782 377
326 3300001976 JGI24752J21851_1000015 JGI24752J21851_10000154 378
327 3300001979 JGI24740J21852_10002481 JGI24740J21852_100024814 378
328 3300001989 JGI24739J22299_10001243 JGI24739J22299_100012433 378
329 3300002070 JGI24750J21931_1000434 JGI24750J21931_10004345 378
330 3300002074 JGI24748J21848_1000013 JGI24748J21848_100001355 378
331 3300002239 JGI24034J26672_10000011 JGI24034J26672_1000001149 378
332 3300002773 JGI25152J39213_1000138 JGI25152J39213_100013850 378
333 3300003203 JGI25406J46586_10023598 JGI25406J46586_100235982 378
334 3300003322 rootL2_10101515 rootL2_101015152 378
335 3300003323 rootH1_10031917 rootH1_100319171 378
336 3300003578 Ga0006562J51391_1009051 Ga0006562J51391_10090512 378
337 3300003751 Ga0055538_1000322 Ga0055538_100032214 378
338 3300003841 Ga0055541_1003007 Ga0055541_10030074 378
339 3300003841 Ga0055541_1007684 Ga0055541_10076842 378
340 3300005288 Ga0065714_10004129 Ga0065714_100041292 378
341 3300005289 Ga0065704_10000326 Ga0065704_100003262 378
342 3300005327 Ga0070658_10046977 Ga0070658_100469772 378
343 3300005327 Ga0070658_10056234 Ga0070658_100562342 378
344 3300005329 Ga0070683_100054521 Ga0070683_1000545212 378
345 3300005330 Ga0070690_100000015 Ga0070690_1000000157 378
346 3300005331 Ga0070670_100201606 Ga0070670_1002016062 378
347 3300005335 Ga0070666_10000059 Ga0070666_100000597 378
348 3300005336 Ga0070680_100001026 Ga0070680_10000102610 378
349 3300005336 Ga0070680_100208480 Ga0070680_1002084802 378
350 3300005337 Ga0070682_100000911 Ga0070682_1000009118 378
351 3300005337 Ga0070682_100056759 Ga0070682_1000567591 378
352 3300005339 Ga0070660_100075563 Ga0070660_1000755632 378
353 3300005341 Ga0070691_10004057 Ga0070691_100040574 378
354 3300005341 Ga0070691_10043237 Ga0070691_100432372 378
355 3300005344 Ga0070661_100003453 Ga0070661_1000034537 378
356 3300005344 Ga0070661_100032834 Ga0070661_1000328343 378
357 3300005345 Ga0070692_10001859 Ga0070692_100018592 378
358 3300005353 Ga0070669_100000014 Ga0070669_10000001477 378
359 3300005355 Ga0070671_100002540 Ga0070671_10000254012 378
360 3300005365 Ga0070688_100001575 Ga0070688_1000015752 378
361 3300005367 Ga0070667_100035104 Ga0070667_1000351042 378
362 3300005367 Ga0070667_100080608 Ga0070667_1000806083 378
363 3300005435 Ga0070714_100139803 Ga0070714_1001398032 378
364 3300005436 Ga0070713_100005721 Ga0070713_1000057218 378
365 3300005437 Ga0070710_10016872 Ga0070710_100168724 378
366 3300005455 Ga0070663_100005160 Ga0070663_1000051605 378
367 3300005457 Ga0070662_100017550 Ga0070662_1000175503 378
368 3300005458 Ga0070681_10001014 Ga0070681_1000101412 378
369 3300005466 Ga0070685_10000034 Ga0070685_1000003458 378
370 3300005467 Ga0070706_100000486 Ga0070706_10000048613 378
371 3300005467 Ga0070706_100061886 Ga0070706_1000618862 378
372 3300005471 Ga0070698_100027244 Ga0070698_1000272444 378
373 3300005518 Ga0070699_100215973 Ga0070699_1002159731 378
374 3300005530 Ga0070679_100016295 Ga0070679_1000162954 378
375 3300005530 Ga0070679_100035208 Ga0070679_1000352082 378
376 3300005530 Ga0070679_100072968 Ga0070679_1000729682 378
377 3300005536 Ga0070697_100155128 Ga0070697_1001551281 378
378 3300005539 Ga0068853_100015680 Ga0068853_1000156806 378
379 3300005539 Ga0068853_100023329 Ga0068853_1000233293 378
380 3300005539 Ga0068853_100027977 Ga0068853_1000279774 378
381 3300005544 Ga0070686_100000023 Ga0070686_10000002342 378
382 3300005548 Ga0070665_100000019 Ga0070665_100000019428 378
383 3300005548 Ga0070665_100153459 Ga0070665_1001534592 378
384 3300005548 Ga0070665_100344960 Ga0070665_1003449602 378
385 3300005564 Ga0070664_100025960 Ga0070664_1000259604 378
386 3300005577 Ga0068857_100002765 Ga0068857_10000276512 378
387 3300005577 Ga0068857_100055403 Ga0068857_1000554033 378
388 3300005578 Ga0068854_100039635 Ga0068854_1000396353 378
389 3300005614 Ga0068856_100258308 Ga0068856_1002583082 378
390 3300005616 Ga0068852_100042999 Ga0068852_1000429992 378
391 3300005617 Ga0068859_100206557 Ga0068859_1002065573 378
392 3300005618 Ga0068864_100006342 Ga0068864_1000063427 378
393 3300005719 Ga0068861_100002173 Ga0068861_10000217311 378
394 3300005834 Ga0068851_10013555 Ga0068851_100135552 378
395 3300005841 Ga0068863_100000044 Ga0068863_10000004478 378
396 3300005841 Ga0068863_100093128 Ga0068863_1000931282 378
397 3300005842 Ga0068858_100060194 Ga0068858_1000601942 378
398 3300005842 Ga0068858_100118044 Ga0068858_1001180443 378
399 3300005843 Ga0068860_100000229 Ga0068860_1000002297 378
400 3300005844 Ga0068862_100000097 Ga0068862_10000009727 378
401 3300005844 Ga0068862_100038167 Ga0068862_1000381672 378
402 3300006844 Ga0075428_100522712 Ga0075428_1005227121 378
403 3300006931 Ga0097620_100206567 Ga0097620_1002065673 378
404 3300007788 Ga0099795_10000020 Ga0099795_1000002015 378
405 3300009093 Ga0105240_10000022 Ga0105240_10000022124 378
406 3300009093 Ga0105240_10000078 Ga0105240_10000078154 378
407 3300009093 Ga0105240_10056203 Ga0105240_100562033 378
408 3300009093 Ga0105240_10134814 Ga0105240_101348142 378
409 3300009094 Ga0111539_10006409 Ga0111539_100064092 378
410 3300009094 Ga0111539_10008489 Ga0111539_100084895 378
411 3300009101 Ga0105247_10009282 Ga0105247_100092824 378
412 3300009177 Ga0105248_10027972 Ga0105248_100279728 378
413 3300009545 Ga0105237_10000135 Ga0105237_1000013542 378
414 3300009545 Ga0105237_10004941 Ga0105237_100049412 378
415 3300009545 Ga0105237_10007089 Ga0105237_100070898 378
416 3300009545 Ga0105237_10097071 Ga0105237_100970713 378
417 3300009551 Ga0105238_10013560 Ga0105238_100135607 378
418 3300009551 Ga0105238_10187212 Ga0105238_101872122 378
419 3300009553 Ga0105249_10000153 Ga0105249_100001536 378
420 3300010159 Ga0099796_10000070 Ga0099796_1000007011 378
421 3300013104 Ga0157370_10025359 Ga0157370_100253593 378
422 3300013306 Ga0163162_10001101 Ga0163162_1000110112 378
423 3300013306 Ga0163162_10015905 Ga0163162_100159053 378
424 3300013307 Ga0157372_10129234 Ga0157372_101292343 378
425 3300014325 Ga0163163_10090908 Ga0163163_100909082 378
426 3300014326 Ga0157380_10000123 Ga0157380_1000012329 378
427 3300014326 Ga0157380_10000671 Ga0157380_1000067110 378
428 3300014497 Ga0182008_10020642 Ga0182008_100206422 378
429 3300014968 Ga0157379_10014455 Ga0157379_100144555 378
430 3300014968 Ga0157379_10141285 Ga0157379_101412851 378
431 3300014969 Ga0157376_10144587 Ga0157376_101445872 378
432 3300014969 Ga0157376_10443936 Ga0157376_104439361 378
433 3300015261 Ga0182006_1008348 Ga0182006_10083484 378
434 3300017792 Ga0163161_10000096 Ga0163161_100000966 378
435 3300021361 Ga0213872_10003007 Ga0213872_100030073 378
436 3300022467 Ga0224712_10003352 Ga0224712_100033522 378
437 3300025224 Ga0209784_100335 Ga0209784_10033516 378
438 3300025225 Ga0209566_100046 Ga0209566_100046176 378
439 3300025225 Ga0209566_100166 Ga0209566_10016617 378
440 3300025226 Ga0209674_100975 Ga0209674_1009758 378
441 3300025250 Ga0209026_1000050 Ga0209026_100005053 378
442 3300025250 Ga0209026_1000214 Ga0209026_10002149 378
443 3300025256 Ga0209759_1000229 Ga0209759_100022954 378
444 3300025256 Ga0209759_1007916 Ga0209759_10079163 378
445 3300025294 Ga0209025_1012628 Ga0209025_10126283 378
446 3300025294 Ga0209025_1033697 Ga0209025_10336972 378
447 3300025903 Ga0207680_10000020 Ga0207680_1000002074 378
448 3300025909 Ga0207705_10042478 Ga0207705_100424783 378
449 3300025909 Ga0207705_10061232 Ga0207705_100612323 378
450 3300025909 Ga0207705_10067128 Ga0207705_100671282 378
451 3300025910 Ga0207684_10000732 Ga0207684_1000073234 378
452 3300025910 Ga0207684_10100166 Ga0207684_101001661 378
453 3300025911 Ga0207654_10000540 Ga0207654_1000054011 378
454 3300025912 Ga0207707_10004278 Ga0207707_1000427810 378
455 3300025913 Ga0207695_10000022 Ga0207695_10000022396 378
456 3300025913 Ga0207695_10000064 Ga0207695_1000006449 378
457 3300025913 Ga0207695_10029739 Ga0207695_100297392 378
458 3300025914 Ga0207671_10000089 Ga0207671_1000008949 378
459 3300025914 Ga0207671_10005664 Ga0207671_100056644 378
460 3300025914 Ga0207671_10016587 Ga0207671_100165874 378
461 3300025914 Ga0207671_10028364 Ga0207671_100283642 378
462 3300025917 Ga0207660_10000787 Ga0207660_100007876 378
463 3300025919 Ga0207657_10003748 Ga0207657_100037485 378
464 3300025919 Ga0207657_10006861 Ga0207657_100068617 378
465 3300025919 Ga0207657_10094032 Ga0207657_100940322 378
466 3300025921 Ga0207652_10053697 Ga0207652_100536972 378
467 3300025921 Ga0207652_10126353 Ga0207652_101263532 378
468 3300025923 Ga0207681_10000082 Ga0207681_1000008219 378
469 3300025924 Ga0207694_10071498 Ga0207694_100714983 378
470 3300025925 Ga0207650_10008924 Ga0207650_100089242 378
471 3300025928 Ga0207700_10028720 Ga0207700_100287203 378
472 3300025929 Ga0207664_10000041 Ga0207664_1000004148 378
473 3300025931 Ga0207644_10000593 Ga0207644_1000059314 378
474 3300025932 Ga0207690_10067190 Ga0207690_100671902 378
475 3300025933 Ga0207706_10004574 Ga0207706_100045749 378
476 3300025933 Ga0207706_10006857 Ga0207706_100068573 378
477 3300025939 Ga0207665_10023959 Ga0207665_100239592 378
478 3300025940 Ga0207691_10307923 Ga0207691_103079231 378
479 3300025941 Ga0207711_10014697 Ga0207711_100146971 378
480 3300025949 Ga0207667_10238040 Ga0207667_102380402 378
481 3300025961 Ga0207712_10000115 Ga0207712_1000011572 378
482 3300025961 Ga0207712_10218852 Ga0207712_102188521 378
483 3300025986 Ga0207658_10002645 Ga0207658_1000264512 378
484 3300025986 Ga0207658_10028031 Ga0207658_100280312 378
485 3300026035 Ga0207703_10002682 Ga0207703_1000268212 378
486 3300026041 Ga0207639_10005418 Ga0207639_100054183 378
487 3300026041 Ga0207639_10084269 Ga0207639_100842691 378
488 3300026067 Ga0207678_10004259 Ga0207678_100042599 378
489 3300026078 Ga0207702_10254257 Ga0207702_102542572 378
490 3300026078 Ga0207702_10344167 Ga0207702_103441671 378
491 3300026088 Ga0207641_10000073 Ga0207641_1000007353 378
492 3300026095 Ga0207676_10002161 Ga0207676_100021613 378
493 3300026116 Ga0207674_10008981 Ga0207674_100089813 378
494 3300026116 Ga0207674_10025465 Ga0207674_100254654 378
495 3300026118 Ga0207675_100000172 Ga0207675_10000017239 378
496 3300026142 Ga0207698_10015158 Ga0207698_100151582 378
497 3300027512 Ga0209179_1000001 Ga0209179_1000001100 378
498 3300027907 Ga0207428_10090158 Ga0207428_100901582 378
499 3300028379 Ga0268266_10000025 Ga0268266_1000002577 378
500 3300028379 Ga0268266_10293443 Ga0268266_102934432 378
501 3300028380 Ga0268265_10000107 Ga0268265_1000010725 378
502 3300028381 Ga0268264_10000278 Ga0268264_1000027872 378
503 3300028794 Ga0307515_10205377 Ga0307515_102053772 378
504 3300030745 Ga0316182_1189875 Ga0316182_11898752 378
505 3300031548 Ga0307408_100002898 Ga0307408_1000028989 378
506 3300031548 Ga0307408_100015521 Ga0307408_1000155212 378
507 3300031548 Ga0307408_100188248 Ga0307408_1001882482 378
508 3300031730 Ga0307516_10001732 Ga0307516_1000173225 378
509 3300031731 Ga0307405_10001334 Ga0307405_100013349 378
510 3300031824 Ga0307413_10000917 Ga0307413_100009178 378
511 3300031901 Ga0307406_10000061 Ga0307406_1000006128 378
512 3300031901 Ga0307406_10008769 Ga0307406_100087694 378
513 3300031903 Ga0307407_10007706 Ga0307407_100077062 378
514 3300031903 Ga0307407_10112357 Ga0307407_101123572 378
515 3300031903 Ga0307407_10136476 Ga0307407_101364761 378
516 3300031911 Ga0307412_10000004 Ga0307412_10000004286 378
517 3300031995 Ga0307409_100001231 Ga0307409_10000123110 378
518 3300032002 Ga0307416_100000186 Ga0307416_10000018617 378
519 3300032002 Ga0307416_100050457 Ga0307416_1000504574 378
520 3300032002 Ga0307416_100092662 Ga0307416_1000926622 378
521 3300032004 Ga0307414_10001265 Ga0307414_100012659 378
522 3300032004 Ga0307414_10005567 Ga0307414_100055671 378
523 3300032004 Ga0307414_10074773 Ga0307414_100747732 378
524 3300032005 Ga0307411_10015098 Ga0307411_100150985 378
525 3300032005 Ga0307411_10067594 Ga0307411_100675942 378
526 3300032005 Ga0307411_10109607 Ga0307411_101096072 378
527 3300032126 Ga0307415_100003494 Ga0307415_1000034944 378
528 3300032126 Ga0307415_100007694 Ga0307415_1000076943 378
529 3300033179 Ga0307507_10002651 Ga0307507_1000265121 378
530 3300033547 Ga0316212_1003469 Ga0316212_10034693 378
531 3300034818 Ga0373950_0000001 Ga0373950_0000001_393754_394902 378
532 3300034818 Ga0373950_0001111 Ga0373950_0001111_1589_2737 378
533 3300035115 Ga0373941_0008202 Ga0373941_0008202_1088_2236 378
534 3300035207 Ga0373942_0000076 Ga0373942_0000076_2728_3876 378
535 3300037068 Ga0373925_0000053 Ga0373925_0000053_86927_88075 378
536 3300037312 Ga0395899_0010317 Ga0395899_0010317_2157_3305 378
537 3300037418 Ga0395900_0043530 Ga0395900_0043530_1870_3018 378
538 3300037418 Ga0395900_0078347 Ga0395900_0078347_331_1479 378
539 3300037471 Ga0395905_0001886 Ga0395905_0001886_18032_19180 378
540 3300037853 Ga0436364_0086296 Ga0436364_0086296_6024_7172 378
541 3300037853 Ga0436364_1449597 Ga0436364_1449597_74262_75419 378
542 3300038443 Ga0395901_0003633 Ga0395901_0003633_6909_8057 378
543 3300039438 Ga0436360_1263027 Ga0436360_1263027_637_1785 378
544 3300039447 Ga0436361_0553665 Ga0436361_0553665_529_1677 378
545 3300039447 Ga0436361_0749976 Ga0436361_0749976_1818_2966 378
546 3300039450 Ga0436363_1089207 Ga0436363_1089207_3028_4176 378
547 3300039450 Ga0436363_1565021 Ga0436363_1565021_183_1331 378
548 3300041413 Ga0439465_0000100 Ga0439465_0000100_17428_18576 378
549 3300041512 Ga0451853_1298320 Ga0451853_1298320_1131_2279 378
550 3300042004 Ga0439445_0001968 Ga0439445_0001968_3058_4206 378
551 3300042004 Ga0439445_0007987 Ga0439445_0007987_570_1718 378
552 3300042006 Ga0439432_002208 Ga0439432_002208_2337_3485 378
553 3300042007 Ga0439449_0000021 Ga0439449_0000021_36868_38016 378
554 3300042016 Ga0439463_008450 Ga0439463_008450_350_1495 378
555 3300044656 Ga0466969_0003603 Ga0466969_0003603_728_1882 378
556 3300044735 Ga0466968_0016441 Ga0466968_0016441_1009_2163 378
557 3300044842 Ga0466957_0076075 Ga0466957_0076075_56_1207 378
558 3300045049 Ga0466959_0003665 Ga0466959_0003665_4064_5218 378
559 3300046455 Ga0495603_0002224 Ga0495603_0002224_6399_7547 378
560 3300046513 Ga0495616_0020759 Ga0495616_0020759_1965_3113 378
561 3300046513 Ga0495616_0025365 Ga0495616_0025365_1544_2692 378
562 3300046520 Ga0495637_0060578 Ga0495637_0060578_267_1415 378
563 3300046525 Ga0495663_0000528 Ga0495663_0000528_1381_2529 378
564 3300046615 Ga0495656_0112979 Ga0495656_0112979_77_1225 378
565 3300046665 Ga0495661_0006794 Ga0495661_0006794_6557_7705 378
566 3300046692 Ga0495671_0005011 Ga0495671_0005011_5073_6221 378
567 3300047445 Ga0495677_0005915 Ga0495677_0005915_3002_4150 378
568 3300048905 Ga0496102_0014406 Ga0496102_0014406_3155_4303 378
569 3300048905 Ga0496102_0221408 Ga0496102_0221408_177_1325 378
570 3300048906 Ga0496103_0002913 Ga0496103_0002913_3454_4590 378
571 3300048906 Ga0496103_0012986 Ga0496103_0012986_3073_4221 378
572 3300048908 Ga0496105_0275116 Ga0496105_0275116_64_1260 378
573 3300048909 Ga0496106_0117567 Ga0496106_0117567_328_1464 378
574 3300048910 Ga0496107_0144163 Ga0496107_0144163_331_1479 378
575 3300048913 Ga0496110_0336969 Ga0496110_0336969_59_1207 378
576 3300048920 Ga0496117_0007881 Ga0496117_0007881_3343_4479 378
577 3300048921 Ga0496118_0021325 Ga0496118_0021325_3315_4451 378
578 3300049133 Ga0501344_00458 Ga0501344_00458_39_1193 378
579 3300049570 Ga0501033_0164138 Ga0501033_0164138_13_1161 378
580 3300049571 Ga0501034_0001823 Ga0501034_0001823_2592_3746 378
581 3300049571 Ga0501034_0066987 Ga0501034_0066987_1695_2870 378
582 3300049571 Ga0501034_0112927 Ga0501034_0112927_426_1574 378
583 3300049573 Ga0501037_0052873 Ga0501037_0052873_656_1807 378
584 3300049573 Ga0501037_0098195 Ga0501037_0098195_381_1586 378
585 3300049573 Ga0501037_0137414 Ga0501037_0137414_303_1451 378
586 3300049574 Ga0501038_0072611 Ga0501038_0072611_1535_2686 378
587 3300049576 Ga0501040_0001111 Ga0501040_0001111_12464_13615 378
588 3300049579 Ga0501043_0015010 Ga0501043_0015010_4396_5601 378
589 3300049580 Ga0501046_0059507 Ga0501046_0059507_395_1570 378
590 3300049581 Ga0501047_0000495 Ga0501047_0000495_18362_19567 378
591 3300049581 Ga0501047_0065590 Ga0501047_0065590_937_2112 378
592 3300049581 Ga0501047_0162834 Ga0501047_0162834_415_1563 378
593 3300049583 Ga0501067_0000020 Ga0501067_0000020_91690_92838 378
594 3300049583 Ga0501067_0035347 Ga0501067_0035347_1098_2246 378
595 3300049583 Ga0501067_0036455 Ga0501067_0036455_26_1174 378
596 3300049584 Ga0501068_0007993 Ga0501068_0007993_1711_2859 378
597 3300049586 Ga0501070_0226721 Ga0501070_0226721_174_1322 378
598 3300049588 Ga0501072_0110194 Ga0501072_0110194_157_1305 378
599 3300049589 Ga0501073_0000969 Ga0501073_0000969_1725_2873 378
600 3300049589 Ga0501073_0002061 Ga0501073_0002061_6804_7952 378
601 3300049589 Ga0501073_0034893 Ga0501073_0034893_1477_2625 378
602 3300049590 Ga0501074_0028679 Ga0501074_0028679_1119_2267 378
603 3300049705 Ga0501225_0002546 Ga0501225_0002546_814_1962 378
604 3300049742 Ga0501080_0026026 Ga0501080_0026026_1112_2260 378
605 3300049742 Ga0501080_0109957 Ga0501080_0109957_1381_2529 378
606 3300049742 Ga0501080_0113436 Ga0501080_0113436_829_1977 378
607 3300049744 Ga0501083_0007007 Ga0501083_0007007_1922_3070 378
608 3300049744 Ga0501083_0032268 Ga0501083_0032268_482_1630 378
609 3300049758 Ga0501241_003362 Ga0501241_003362_1011_2159 378
610 3300049822 Ga0501035_0003147 Ga0501035_0003147_12109_13314 378
611 3300049822 Ga0501035_0073610 Ga0501035_0073610_1661_2836 378
612 3300049823 Ga0501044_0004599 Ga0501044_0004599_11687_12892 378
613 3300049823 Ga0501044_0025812 Ga0501044_0025812_2300_3451 378
614 3300050511 nmdc:mga08y16_5569_c1 nmdc:mga08y16_5569_c1_10907_12055 378
615 3300053079 Ga0500610_0001905 Ga0500610_0001905_2739_3887 378
616 3300053155 Ga0500620_005002 Ga0500620_005002_543_1691 378
617 3300054114 Ga0501084_0002756 Ga0501084_0002756_11721_12869 378
618 3300060353 Ga0501082_0246015 Ga0501082_0246015_54_1202 378
619 iso_pu_bacteria 2739367756 2739790688 378
620 3300000549 LJQas_1007542 LJQas_10075421 379
621 3300001979 JGI24740J21852_10001942 JGI24740J21852_100019425 379
622 3300001979 JGI24740J21852_10030586 JGI24740J21852_100305861 379
623 3300001989 JGI24739J22299_10000129 JGI24739J22299_1000012914 379
624 3300001989 JGI24739J22299_10010594 JGI24739J22299_100105942 379
625 3300001990 JGI24737J22298_10000357 JGI24737J22298_100003575 379
626 3300002067 JGI24735J21928_10003791 JGI24735J21928_100037913 379
627 3300002067 JGI24735J21928_10004250 JGI24735J21928_100042505 379
628 3300002075 JGI24738J21930_10001003 JGI24738J21930_100010036 379
629 3300003214 JGI25165J46597_1000210 JGI25165J46597_100021083 379
630 3300003320 rootH2_10050297 rootH2_100502976 379
631 3300003323 rootH1_10148928 rootH1_101489283 379
632 3300005327 Ga0070658_10000029 Ga0070658_100000292 379
633 3300005327 Ga0070658_10015513 Ga0070658_100155132 379
634 3300005327 Ga0070658_10019049 Ga0070658_100190496 379
635 3300005327 Ga0070658_10035022 Ga0070658_100350223 379
636 3300005327 Ga0070658_10050553 Ga0070658_100505533 379
637 3300005327 Ga0070658_10134521 Ga0070658_101345212 379
638 3300005327 Ga0070658_10136067 Ga0070658_101360672 379
639 3300005327 Ga0070658_10168122 Ga0070658_101681222 379
640 3300005328 Ga0070676_10013130 Ga0070676_100131304 379
641 3300005328 Ga0070676_10095230 Ga0070676_100952302 379
642 3300005329 Ga0070683_100000209 Ga0070683_10000020938 379
643 3300005330 Ga0070690_100012081 Ga0070690_1000120813 379
644 3300005331 Ga0070670_100000265 Ga0070670_10000026532 379
645 3300005331 Ga0070670_100010774 Ga0070670_1000107744 379
646 3300005331 Ga0070670_100011548 Ga0070670_1000115483 379
647 3300005331 Ga0070670_100014114 Ga0070670_1000141145 379
648 3300005331 Ga0070670_100066739 Ga0070670_1000667392 379
649 3300005331 Ga0070670_100098713 Ga0070670_1000987132 379
650 3300005331 Ga0070670_100116628 Ga0070670_1001166282 379
651 3300005334 Ga0068869_100000331 Ga0068869_1000003317 379
652 3300005335 Ga0070666_10000822 Ga0070666_1000082213 379
653 3300005335 Ga0070666_10000924 Ga0070666_1000092414 379
654 3300005335 Ga0070666_10001749 Ga0070666_100017497 379
655 3300005335 Ga0070666_10026417 Ga0070666_100264172 379
656 3300005335 Ga0070666_10056586 Ga0070666_100565862 379
657 3300005335 Ga0070666_10090125 Ga0070666_100901252 379
658 3300005336 Ga0070680_100001008 Ga0070680_10000100818 379
659 3300005336 Ga0070680_100013601 Ga0070680_1000136016 379
660 3300005336 Ga0070680_100041386 Ga0070680_1000413862 379
661 3300005336 Ga0070680_100123252 Ga0070680_1001232522 379
662 3300005337 Ga0070682_100006572 Ga0070682_1000065723 379
663 3300005337 Ga0070682_100132525 Ga0070682_1001325252 379
664 3300005338 Ga0068868_100000156 Ga0068868_10000015629 379
665 3300005338 Ga0068868_100002559 Ga0068868_1000025596 379
666 3300005338 Ga0068868_100044269 Ga0068868_1000442693 379
667 3300005338 Ga0068868_100124156 Ga0068868_1001241562 379
668 3300005339 Ga0070660_100002984 Ga0070660_10000298410 379
669 3300005339 Ga0070660_100002991 Ga0070660_1000029912 379
670 3300005339 Ga0070660_100004528 Ga0070660_1000045289 379
671 3300005339 Ga0070660_100012339 Ga0070660_1000123396 379
672 3300005339 Ga0070660_100018362 Ga0070660_1000183624 379
673 3300005339 Ga0070660_100019062 Ga0070660_1000190626 379
674 3300005339 Ga0070660_100026651 Ga0070660_1000266514 379
675 3300005339 Ga0070660_100034110 Ga0070660_1000341105 379
676 3300005339 Ga0070660_100068479 Ga0070660_1000684792 379
677 3300005339 Ga0070660_100071425 Ga0070660_1000714253 379
678 3300005339 Ga0070660_100082431 Ga0070660_1000824313 379
679 3300005339 Ga0070660_100108282 Ga0070660_1001082822 379
680 3300005339 Ga0070660_100185182 Ga0070660_1001851822 379
681 3300005339 Ga0070660_100245582 Ga0070660_1002455822 379
682 3300005344 Ga0070661_100000055 Ga0070661_10000005546 379
683 3300005344 Ga0070661_100000452 Ga0070661_1000004526 379
684 3300005344 Ga0070661_100005269 Ga0070661_10000526911 379
685 3300005344 Ga0070661_100007519 Ga0070661_1000075196 379
686 3300005344 Ga0070661_100041781 Ga0070661_1000417812 379
687 3300005344 Ga0070661_100060605 Ga0070661_1000606053 379
688 3300005344 Ga0070661_100067281 Ga0070661_1000672812 379
689 3300005344 Ga0070661_100072538 Ga0070661_1000725382 379
690 3300005344 Ga0070661_100091640 Ga0070661_1000916402 379
691 3300005344 Ga0070661_100107098 Ga0070661_1001070983 379
692 3300005344 Ga0070661_100142069 Ga0070661_1001420692 379
693 3300005345 Ga0070692_10003716 Ga0070692_100037166 379
694 3300005345 Ga0070692_10006583 Ga0070692_100065832 379
695 3300005345 Ga0070692_10011780 Ga0070692_100117803 379
696 3300005345 Ga0070692_10027252 Ga0070692_100272522 379
697 3300005347 Ga0070668_100000208 Ga0070668_10000020826 379
698 3300005347 Ga0070668_100007660 Ga0070668_1000076605 379
699 3300005347 Ga0070668_100036966 Ga0070668_1000369664 379
700 3300005347 Ga0070668_100116817 Ga0070668_1001168172 379
701 3300005353 Ga0070669_100000018 Ga0070669_100000018150 379
702 3300005353 Ga0070669_100000383 Ga0070669_10000038332 379
703 3300005353 Ga0070669_100000547 Ga0070669_10000054710 379
704 3300005353 Ga0070669_100025265 Ga0070669_1000252654 379
705 3300005353 Ga0070669_100165980 Ga0070669_1001659802 379
706 3300005354 Ga0070675_100025854 Ga0070675_1000258545 379
707 3300005354 Ga0070675_100051525 Ga0070675_1000515252 379
708 3300005354 Ga0070675_100244746 Ga0070675_1002447462 379
709 3300005355 Ga0070671_100000011 Ga0070671_10000001148 379
710 3300005355 Ga0070671_100000138 Ga0070671_1000001388 379
711 3300005355 Ga0070671_100003224 Ga0070671_10000322414 379
712 3300005355 Ga0070671_100003249 Ga0070671_10000324911 379
713 3300005355 Ga0070671_100003781 Ga0070671_10000378111 379
714 3300005355 Ga0070671_100008552 Ga0070671_1000085528 379
715 3300005355 Ga0070671_100022349 Ga0070671_1000223493 379
716 3300005355 Ga0070671_100042370 Ga0070671_1000423705 379
717 3300005355 Ga0070671_100151273 Ga0070671_1001512732 379
718 3300005356 Ga0070674_100004496 Ga0070674_1000044968 379
719 3300005356 Ga0070674_100059472 Ga0070674_1000594722 379
720 3300005364 Ga0070673_100000249 Ga0070673_10000024919 379
721 3300005364 Ga0070673_100003351 Ga0070673_1000033516 379
722 3300005364 Ga0070673_100004608 Ga0070673_1000046084 379
723 3300005364 Ga0070673_100006422 Ga0070673_1000064222 379
724 3300005364 Ga0070673_100016074 Ga0070673_1000160745 379
725 3300005364 Ga0070673_100020978 Ga0070673_1000209783 379
726 3300005364 Ga0070673_100050456 Ga0070673_1000504563 379
727 3300005364 Ga0070673_100180969 Ga0070673_1001809692 379
728 3300005366 Ga0070659_100000138 Ga0070659_10000013834 379
729 3300005366 Ga0070659_100000814 Ga0070659_10000081411 379
730 3300005366 Ga0070659_100001062 Ga0070659_1000010624 379
731 3300005366 Ga0070659_100001635 Ga0070659_10000163511 379
732 3300005366 Ga0070659_100003157 Ga0070659_10000315712 379
733 3300005366 Ga0070659_100043899 Ga0070659_1000438992 379
734 3300005366 Ga0070659_100064535 Ga0070659_1000645351 379
735 3300005366 Ga0070659_100085565 Ga0070659_1000855652 379
736 3300005366 Ga0070659_100104108 Ga0070659_1001041081 379
737 3300005366 Ga0070659_100135631 Ga0070659_1001356312 379
738 3300005367 Ga0070667_100001760 Ga0070667_10000176020 379
739 3300005367 Ga0070667_100001996 Ga0070667_1000019963 379
740 3300005367 Ga0070667_100003528 Ga0070667_1000035284 379
741 3300005367 Ga0070667_100005828 Ga0070667_1000058283 379
742 3300005367 Ga0070667_100006388 Ga0070667_1000063883 379
743 3300005367 Ga0070667_100014945 Ga0070667_1000149454 379
744 3300005367 Ga0070667_100059501 Ga0070667_1000595012 379
745 3300005367 Ga0070667_100061428 Ga0070667_1000614281 379
746 3300005367 Ga0070667_100089958 Ga0070667_1000899583 379
747 3300005367 Ga0070667_100097262 Ga0070667_1000972622 379
748 3300005367 Ga0070667_100235258 Ga0070667_1002352582 379
749 3300005435 Ga0070714_100267670 Ga0070714_1002676702 379
750 3300005435 Ga0070714_100318743 Ga0070714_1003187432 379
751 3300005436 Ga0070713_100033460 Ga0070713_1000334602 379
752 3300005436 Ga0070713_100139352 Ga0070713_1001393522 379
753 3300005440 Ga0070705_100016857 Ga0070705_1000168572 379
754 3300005444 Ga0070694_100003977 Ga0070694_1000039772 379
755 3300005444 Ga0070694_100018841 Ga0070694_1000188413 379
756 3300005445 Ga0070708_100019568 Ga0070708_1000195681 379
757 3300005455 Ga0070663_100001943 Ga0070663_1000019432 379
758 3300005455 Ga0070663_100085961 Ga0070663_1000859612 379
759 3300005455 Ga0070663_100111925 Ga0070663_1001119253 379
760 3300005455 Ga0070663_100163391 Ga0070663_1001633912 379
761 3300005456 Ga0070678_100002527 Ga0070678_10000252712 379
762 3300005456 Ga0070678_100040203 Ga0070678_1000402033 379
763 3300005457 Ga0070662_100000410 Ga0070662_1000004101 379
764 3300005457 Ga0070662_100001186 Ga0070662_10000118616 379
765 3300005457 Ga0070662_100001575 Ga0070662_10000157511 379
766 3300005457 Ga0070662_100034654 Ga0070662_1000346543 379
767 3300005457 Ga0070662_100215002 Ga0070662_1002150021 379
768 3300005458 Ga0070681_10010375 Ga0070681_100103758 379
769 3300005458 Ga0070681_10102557 Ga0070681_101025572 379
770 3300005459 Ga0068867_100007188 Ga0068867_1000071882 379
771 3300005459 Ga0068867_100014158 Ga0068867_1000141585 379
772 3300005459 Ga0068867_100028424 Ga0068867_1000284242 379
773 3300005471 Ga0070698_100215516 Ga0070698_1002155162 379
774 3300005530 Ga0070679_100000027 Ga0070679_10000002750 379
775 3300005530 Ga0070679_100037121 Ga0070679_1000371213 379
776 3300005535 Ga0070684_100004466 Ga0070684_1000044668 379
777 3300005539 Ga0068853_100000479 Ga0068853_1000004792 379
778 3300005539 Ga0068853_100001793 Ga0068853_10000179312 379
779 3300005539 Ga0068853_100015391 Ga0068853_1000153917 379
780 3300005539 Ga0068853_100166964 Ga0068853_1001669641 379
781 3300005543 Ga0070672_100006526 Ga0070672_1000065268 379
782 3300005543 Ga0070672_100016187 Ga0070672_1000161873 379
783 3300005543 Ga0070672_100055472 Ga0070672_1000554724 379
784 3300005543 Ga0070672_100077915 Ga0070672_1000779152 379
785 3300005545 Ga0070695_100116778 Ga0070695_1001167782 379
786 3300005546 Ga0070696_100006403 Ga0070696_1000064038 379
787 3300005547 Ga0070693_100019343 Ga0070693_1000193432 379
788 3300005547 Ga0070693_100088625 Ga0070693_1000886251 379
789 3300005547 Ga0070693_100112654 Ga0070693_1001126542 379
790 3300005548 Ga0070665_100011777 Ga0070665_10001177711 379
791 3300005548 Ga0070665_100014723 Ga0070665_1000147238 379
792 3300005548 Ga0070665_100016127 Ga0070665_1000161272 379
793 3300005548 Ga0070665_100046267 Ga0070665_1000462674 379
794 3300005548 Ga0070665_100063123 Ga0070665_1000631232 379
795 3300005548 Ga0070665_100065942 Ga0070665_1000659422 379
796 3300005548 Ga0070665_100068081 Ga0070665_1000680814 379
797 3300005548 Ga0070665_100168006 Ga0070665_1001680062 379
798 3300005548 Ga0070665_100205763 Ga0070665_1002057632 379
799 3300005563 Ga0068855_100000163 Ga0068855_10000016322 379
800 3300005563 Ga0068855_100004220 Ga0068855_10000422017 379
801 3300005563 Ga0068855_100014035 Ga0068855_1000140359 379
802 3300005563 Ga0068855_100017460 Ga0068855_1000174603 379
803 3300005563 Ga0068855_100035645 Ga0068855_1000356453 379
804 3300005563 Ga0068855_100058082 Ga0068855_1000580822 379
805 3300005563 Ga0068855_100133095 Ga0068855_1001330954 379
806 3300005563 Ga0068855_100154414 Ga0068855_1001544142 379
807 3300005563 Ga0068855_100449656 Ga0068855_1004496561 379
808 3300005563 Ga0068855_100472127 Ga0068855_1004721272 379
809 3300005564 Ga0070664_100000544 Ga0070664_1000005442 379
810 3300005564 Ga0070664_100001299 Ga0070664_10000129920 379
811 3300005564 Ga0070664_100002185 Ga0070664_1000021853 379
812 3300005564 Ga0070664_100009697 Ga0070664_1000096976 379
813 3300005564 Ga0070664_100013307 Ga0070664_1000133074 379
814 3300005564 Ga0070664_100014974 Ga0070664_1000149743 379
815 3300005564 Ga0070664_100026091 Ga0070664_1000260912 379
816 3300005564 Ga0070664_100062360 Ga0070664_1000623601 379
817 3300005564 Ga0070664_100152282 Ga0070664_1001522823 379
818 3300005577 Ga0068857_100000282 Ga0068857_10000028231 379
819 3300005577 Ga0068857_100002754 Ga0068857_10000275413 379
820 3300005577 Ga0068857_100010471 Ga0068857_1000104716 379
821 3300005577 Ga0068857_100017928 Ga0068857_1000179286 379
822 3300005577 Ga0068857_100027407 Ga0068857_1000274075 379
823 3300005577 Ga0068857_100081064 Ga0068857_1000810643 379
824 3300005578 Ga0068854_100001188 Ga0068854_1000011889 379
825 3300005578 Ga0068854_100001438 Ga0068854_10000143811 379
826 3300005578 Ga0068854_100004579 Ga0068854_1000045792 379
827 3300005578 Ga0068854_100005135 Ga0068854_1000051354 379
828 3300005578 Ga0068854_100007835 Ga0068854_1000078354 379
829 3300005578 Ga0068854_100034460 Ga0068854_1000344603 379
830 3300005578 Ga0068854_100052257 Ga0068854_1000522574 379
831 3300005578 Ga0068854_100057710 Ga0068854_1000577102 379
832 3300005614 Ga0068856_100000829 Ga0068856_10000082932 379
833 3300005614 Ga0068856_100008781 Ga0068856_1000087815 379
834 3300005614 Ga0068856_100015666 Ga0068856_1000156662 379
835 3300005616 Ga0068852_100001212 Ga0068852_1000012122 379
836 3300005616 Ga0068852_100005039 Ga0068852_1000050394 379
837 3300005616 Ga0068852_100022025 Ga0068852_1000220253 379
838 3300005616 Ga0068852_100045754 Ga0068852_1000457542 379
839 3300005616 Ga0068852_100114387 Ga0068852_1001143873 379
840 3300005616 Ga0068852_100204035 Ga0068852_1002040352 379
841 3300005617 Ga0068859_100003915 Ga0068859_1000039158 379
842 3300005617 Ga0068859_100005794 Ga0068859_1000057948 379
843 3300005617 Ga0068859_100023456 Ga0068859_1000234562 379
844 3300005617 Ga0068859_100036132 Ga0068859_1000361326 379
845 3300005617 Ga0068859_100046411 Ga0068859_1000464112 379
846 3300005617 Ga0068859_100093009 Ga0068859_1000930092 379
847 3300005617 Ga0068859_100140264 Ga0068859_1001402643 379
848 3300005617 Ga0068859_100424013 Ga0068859_1004240131 379
849 3300005618 Ga0068864_100000173 Ga0068864_10000017349 379
850 3300005618 Ga0068864_100001720 Ga0068864_10000172016 379
851 3300005618 Ga0068864_100006305 Ga0068864_10000630510 379
852 3300005618 Ga0068864_100006905 Ga0068864_1000069057 379
853 3300005618 Ga0068864_100012818 Ga0068864_10001281811 379
854 3300005618 Ga0068864_100031578 Ga0068864_1000315782 379
855 3300005618 Ga0068864_100230990 Ga0068864_1002309902 379
856 3300005718 Ga0068866_10009444 Ga0068866_100094444 379
857 3300005719 Ga0068861_100002954 Ga0068861_1000029543 379
858 3300005719 Ga0068861_100327675 Ga0068861_1003276751 379
859 3300005834 Ga0068851_10019101 Ga0068851_100191013 379
860 3300005834 Ga0068851_10020603 Ga0068851_100206032 379
861 3300005834 Ga0068851_10098791 Ga0068851_100987912 379
862 3300005841 Ga0068863_100000131 Ga0068863_10000013139 379
863 3300005841 Ga0068863_100000816 Ga0068863_10000081622 379
864 3300005841 Ga0068863_100000921 Ga0068863_10000092125 379
865 3300005841 Ga0068863_100003770 Ga0068863_1000037704 379
866 3300005841 Ga0068863_100010883 Ga0068863_1000108839 379
867 3300005841 Ga0068863_100055996 Ga0068863_1000559962 379
868 3300005841 Ga0068863_100056031 Ga0068863_1000560313 379
869 3300005841 Ga0068863_100098332 Ga0068863_1000983322 379
870 3300005842 Ga0068858_100001349 Ga0068858_10000134916 379
871 3300005842 Ga0068858_100002655 Ga0068858_1000026552 379
872 3300005842 Ga0068858_100003690 Ga0068858_1000036904 379
873 3300005842 Ga0068858_100003884 Ga0068858_10000388412 379
874 3300005842 Ga0068858_100005521 Ga0068858_1000055214 379
875 3300005842 Ga0068858_100009461 Ga0068858_1000094614 379
876 3300005842 Ga0068858_100017613 Ga0068858_1000176139 379
877 3300005842 Ga0068858_100045120 Ga0068858_1000451202 379
878 3300005842 Ga0068858_100048457 Ga0068858_1000484573 379
879 3300005842 Ga0068858_100069382 Ga0068858_1000693822 379
880 3300005842 Ga0068858_100104431 Ga0068858_1001044312 379
881 3300005843 Ga0068860_100001926 Ga0068860_10000192613 379
882 3300005843 Ga0068860_100003370 Ga0068860_1000033706 379
883 3300005843 Ga0068860_100006472 Ga0068860_10000647210 379
884 3300005843 Ga0068860_100009386 Ga0068860_1000093865 379
885 3300005843 Ga0068860_100014106 Ga0068860_1000141065 379
886 3300005843 Ga0068860_100017319 Ga0068860_1000173194 379
887 3300005843 Ga0068860_100042596 Ga0068860_1000425964 379
888 3300005843 Ga0068860_100056062 Ga0068860_1000560623 379
889 3300005843 Ga0068860_100189540 Ga0068860_1001895402 379
890 3300005843 Ga0068860_100228587 Ga0068860_1002285872 379
891 3300005843 Ga0068860_100411876 Ga0068860_1004118762 379
892 3300005844 Ga0068862_100001102 Ga0068862_1000011025 379
893 3300005844 Ga0068862_100001850 Ga0068862_1000018502 379
894 3300005844 Ga0068862_100022798 Ga0068862_1000227984 379
895 3300005844 Ga0068862_100039098 Ga0068862_1000390984 379
896 3300005844 Ga0068862_100048277 Ga0068862_1000482773 379
897 3300005844 Ga0068862_100177959 Ga0068862_1001779592 379
898 3300005844 Ga0068862_100374489 Ga0068862_1003744891 379
899 3300005985 Ga0081539_10004604 Ga0081539_1000460413 379
900 3300005985 Ga0081539_10005951 Ga0081539_1000595110 379
901 3300005985 Ga0081539_10040287 Ga0081539_100402871 379
902 3300006028 Ga0070717_10123685 Ga0070717_101236852 379
903 3300006237 Ga0097621_100002177 Ga0097621_10000217714 379
904 3300006237 Ga0097621_100161811 Ga0097621_1001618112 379
905 3300006237 Ga0097621_100280209 Ga0097621_1002802092 379
906 3300006358 Ga0068871_100012935 Ga0068871_1000129354 379
907 3300006358 Ga0068871_100027524 Ga0068871_1000275245 379
908 3300006358 Ga0068871_100150555 Ga0068871_1001505553 379
909 3300006358 Ga0068871_100192329 Ga0068871_1001923291 379
910 3300006881 Ga0068865_100016371 Ga0068865_1000163714 379
911 3300006881 Ga0068865_100016787 Ga0068865_1000167875 379
912 3300006931 Ga0097620_100003915 Ga0097620_1000039154 379
913 3300006931 Ga0097620_100005794 Ga0097620_1000057948 379
914 3300006931 Ga0097620_100023456 Ga0097620_1000234562 379
915 3300006931 Ga0097620_100036130 Ga0097620_1000361302 379
916 3300006931 Ga0097620_100046410 Ga0097620_1000464104 379
917 3300006931 Ga0097620_100093006 Ga0097620_1000930062 379
918 3300006931 Ga0097620_100140269 Ga0097620_1001402693 379
919 3300006931 Ga0097620_100423982 Ga0097620_1004239821 379
920 3300009093 Ga0105240_10007481 Ga0105240_100074812 379
921 3300009093 Ga0105240_10010752 Ga0105240_100107523 379
922 3300009093 Ga0105240_10020736 Ga0105240_100207363 379
923 3300009093 Ga0105240_10065379 Ga0105240_100653794 379
924 3300009093 Ga0105240_10148929 Ga0105240_101489291 379
925 3300009093 Ga0105240_10430218 Ga0105240_104302182 379
926 3300009098 Ga0105245_10000326 Ga0105245_1000032614 379
927 3300009098 Ga0105245_10024639 Ga0105245_100246391 379
928 3300009098 Ga0105245_10166850 Ga0105245_101668502 379
929 3300009098 Ga0105245_10291403 Ga0105245_102914032 379
930 3300009101 Ga0105247_10000542 Ga0105247_1000054212 379
931 3300009101 Ga0105247_10020569 Ga0105247_100205692 379
932 3300009148 Ga0105243_10039135 Ga0105243_100391354 379
933 3300009148 Ga0105243_10095518 Ga0105243_100955182 379
934 3300009174 Ga0105241_10086910 Ga0105241_100869103 379
935 3300009176 Ga0105242_10007725 Ga0105242_1000772510 379
936 3300009176 Ga0105242_10023363 Ga0105242_100233635 379
937 3300009177 Ga0105248_10000123 Ga0105248_1000012324 379
938 3300009177 Ga0105248_10000159 Ga0105248_1000015964 379
939 3300009177 Ga0105248_10000516 Ga0105248_1000051633 379
940 3300009177 Ga0105248_10003349 Ga0105248_1000334919 379
941 3300009177 Ga0105248_10005569 Ga0105248_1000556916 379
942 3300009177 Ga0105248_10024334 Ga0105248_100243344 379
943 3300009177 Ga0105248_10027345 Ga0105248_100273454 379
944 3300009177 Ga0105248_10047942 Ga0105248_100479421 379
945 3300009177 Ga0105248_10059878 Ga0105248_100598784 379
946 3300009177 Ga0105248_10088061 Ga0105248_100880612 379
947 3300009177 Ga0105248_10094165 Ga0105248_100941652 379
948 3300009177 Ga0105248_10099492 Ga0105248_100994922 379
949 3300009177 Ga0105248_10120666 Ga0105248_101206663 379
950 3300009545 Ga0105237_10004469 Ga0105237_1000446910 379
951 3300009545 Ga0105237_10009195 Ga0105237_100091958 379
952 3300009545 Ga0105237_10132866 Ga0105237_101328663 379
953 3300009545 Ga0105237_10336500 Ga0105237_103365002 379
954 3300009551 Ga0105238_10011703 Ga0105238_100117036 379
955 3300009551 Ga0105238_10066511 Ga0105238_100665114 379
956 3300009551 Ga0105238_10080446 Ga0105238_100804461 379
957 3300009551 Ga0105238_10158169 Ga0105238_101581691 379
958 3300009553 Ga0105249_10016978 Ga0105249_100169784 379
959 3300009553 Ga0105249_10020199 Ga0105249_100201993 379
960 3300009553 Ga0105249_10029974 Ga0105249_100299742 379
961 3300009553 Ga0105249_10053810 Ga0105249_100538102 379
962 3300009553 Ga0105249_10090407 Ga0105249_100904072 379
963 3300010375 Ga0105239_10000524 Ga0105239_1000052441 379
964 3300010375 Ga0105239_10007408 Ga0105239_100074089 379
965 3300010375 Ga0105239_10054164 Ga0105239_100541645 379
966 3300010375 Ga0105239_10056053 Ga0105239_100560533 379
967 3300010375 Ga0105239_10162157 Ga0105239_101621572 379
968 3300011119 Ga0105246_10043877 Ga0105246_100438772 379
969 3300011119 Ga0105246_10175373 Ga0105246_101753732 379
970 3300013100 Ga0157373_10036632 Ga0157373_100366322 379
971 3300013100 Ga0157373_10052037 Ga0157373_100520373 379
972 3300013100 Ga0157373_10069239 Ga0157373_100692392 379
973 3300013102 Ga0157371_10000784 Ga0157371_1000078434 379
974 3300013102 Ga0157371_10016692 Ga0157371_100166925 379
975 3300013104 Ga0157370_10124617 Ga0157370_101246172 379
976 3300013105 Ga0157369_10001983 Ga0157369_100019832 379
977 3300013105 Ga0157369_10014639 Ga0157369_100146394 379
978 3300013105 Ga0157369_10015070 Ga0157369_100150709 379
979 3300013105 Ga0157369_10092231 Ga0157369_100922312 379
980 3300013105 Ga0157369_10291505 Ga0157369_102915052 379
981 3300013105 Ga0157369_10306261 Ga0157369_103062611 379
982 3300013296 Ga0157374_10017801 Ga0157374_100178015 379
983 3300013296 Ga0157374_10024724 Ga0157374_100247245 379
984 3300013296 Ga0157374_10071031 Ga0157374_100710312 379
985 3300013296 Ga0157374_10100360 Ga0157374_101003602 379
986 3300013297 Ga0157378_10054398 Ga0157378_100543983 379
987 3300013297 Ga0157378_10057561 Ga0157378_100575612 379
988 3300013306 Ga0163162_10000839 Ga0163162_100008393 379
989 3300013306 Ga0163162_10005580 Ga0163162_1000558012 379
990 3300013306 Ga0163162_10024415 Ga0163162_100244154 379
991 3300013306 Ga0163162_10035863 Ga0163162_100358632 379
992 3300013306 Ga0163162_10099221 Ga0163162_100992212 379
993 3300013306 Ga0163162_10218967 Ga0163162_102189672 379
994 3300013307 Ga0157372_10008989 Ga0157372_100089899 379
995 3300013307 Ga0157372_10031832 Ga0157372_100318325 379
996 3300013307 Ga0157372_10063213 Ga0157372_100632133 379
997 3300013308 Ga0157375_10003764 Ga0157375_100037648 379
998 3300013308 Ga0157375_10030040 Ga0157375_100300404 379
999 3300013308 Ga0157375_10070892 Ga0157375_100708923 379
1000 3300014325 Ga0163163_10006126 Ga0163163_1000612610 379
1001 3300014325 Ga0163163_10094372 Ga0163163_100943722 379
1002 3300014325 Ga0163163_10128307 Ga0163163_101283072 379
1003 3300014497 Ga0182008_10015296 Ga0182008_100152962 379
1004 3300014968 Ga0157379_10000867 Ga0157379_100008679 379
1005 3300014968 Ga0157379_10001552 Ga0157379_1000155219 379
1006 3300014968 Ga0157379_10002249 Ga0157379_100022494 379
1007 3300014968 Ga0157379_10158189 Ga0157379_101581892 379
1008 3300014968 Ga0157379_10230079 Ga0157379_102300792 379
1009 3300020070 Ga0206356_10423425 Ga0206356_104234251 379
1010 3300020082 Ga0206353_10148542 Ga0206353_101485423 379
1011 3300021358 Ga0213873_10000006 Ga0213873_10000006164 379
1012 3300021384 Ga0213876_10000004 Ga0213876_10000004670 379
1013 3300021384 Ga0213876_10001088 Ga0213876_1000108818 379
1014 3300021388 Ga0213875_10002425 Ga0213875_100024258 379
1015 3300021388 Ga0213875_10010098 Ga0213875_100100983 379
1016 3300025250 Ga0209026_1001506 Ga0209026_10015065 379
1017 3300025261 Ga0209233_1000003 Ga0209233_1000003174 379
1018 3300025292 Ga0209676_1001179 Ga0209676_10011795 379
1019 3300025304 Ga0209257_1000245 Ga0209257_100024589 379
1020 3300025315 Ga0207697_10000219 Ga0207697_100002192 379
1021 3300025315 Ga0207697_10000584 Ga0207697_1000058414 379
1022 3300025321 Ga0207656_10006275 Ga0207656_100062752 379
1023 3300025321 Ga0207656_10010407 Ga0207656_100104072 379
1024 3300025321 Ga0207656_10029709 Ga0207656_100297093 379
1025 3300025321 Ga0207656_10082146 Ga0207656_100821462 379
1026 3300025899 Ga0207642_10004027 Ga0207642_100040274 379
1027 3300025900 Ga0207710_10001754 Ga0207710_100017544 379
1028 3300025900 Ga0207710_10011152 Ga0207710_100111522 379
1029 3300025901 Ga0207688_10001613 Ga0207688_1000161313 379
1030 3300025901 Ga0207688_10007152 Ga0207688_100071523 379
1031 3300025903 Ga0207680_10000027 Ga0207680_1000002752 379
1032 3300025903 Ga0207680_10001404 Ga0207680_1000140412 379
1033 3300025903 Ga0207680_10003774 Ga0207680_100037745 379
1034 3300025903 Ga0207680_10010476 Ga0207680_100104763 379
1035 3300025903 Ga0207680_10013386 Ga0207680_100133862 379
1036 3300025903 Ga0207680_10026060 Ga0207680_100260603 379
1037 3300025903 Ga0207680_10074110 Ga0207680_100741103 379
1038 3300025904 Ga0207647_10000575 Ga0207647_1000057512 379
1039 3300025904 Ga0207647_10002145 Ga0207647_100021455 379
1040 3300025904 Ga0207647_10007590 Ga0207647_100075902 379
1041 3300025904 Ga0207647_10019789 Ga0207647_100197892 379
1042 3300025904 Ga0207647_10032408 Ga0207647_100324082 379
1043 3300025904 Ga0207647_10071623 Ga0207647_100716233 379
1044 3300025906 Ga0207699_10024944 Ga0207699_100249443 379
1045 3300025907 Ga0207645_10001233 Ga0207645_1000123322 379
1046 3300025907 Ga0207645_10023613 Ga0207645_100236134 379
1047 3300025907 Ga0207645_10085526 Ga0207645_100855261 379
1048 3300025909 Ga0207705_10000002 Ga0207705_10000002735 379
1049 3300025909 Ga0207705_10000260 Ga0207705_1000026030 379
1050 3300025909 Ga0207705_10000673 Ga0207705_100006736 379
1051 3300025909 Ga0207705_10004275 Ga0207705_100042755 379
1052 3300025909 Ga0207705_10005171 Ga0207705_100051719 379
1053 3300025909 Ga0207705_10006422 Ga0207705_100064229 379
1054 3300025909 Ga0207705_10007630 Ga0207705_100076306 379
1055 3300025909 Ga0207705_10016552 Ga0207705_100165522 379
1056 3300025909 Ga0207705_10019940 Ga0207705_100199405 379
1057 3300025909 Ga0207705_10024723 Ga0207705_100247234 379
1058 3300025909 Ga0207705_10040672 Ga0207705_100406724 379
1059 3300025909 Ga0207705_10043677 Ga0207705_100436772 379
1060 3300025909 Ga0207705_10068045 Ga0207705_100680452 379
1061 3300025909 Ga0207705_10097094 Ga0207705_100970942 379
1062 3300025909 Ga0207705_10121203 Ga0207705_101212032 379
1063 3300025909 Ga0207705_10153453 Ga0207705_101534532 379
1064 3300025912 Ga0207707_10033033 Ga0207707_100330335 379
1065 3300025913 Ga0207695_10042320 Ga0207695_100423203 379
1066 3300025913 Ga0207695_10052908 Ga0207695_100529083 379
1067 3300025913 Ga0207695_10118832 Ga0207695_101188322 379
1068 3300025913 Ga0207695_10247946 Ga0207695_102479462 379
1069 3300025914 Ga0207671_10005075 Ga0207671_100050753 379
1070 3300025914 Ga0207671_10030779 Ga0207671_100307792 379
1071 3300025914 Ga0207671_10033487 Ga0207671_100334874 379
1072 3300025915 Ga0207693_10053329 Ga0207693_100533293 379
1073 3300025917 Ga0207660_10001023 Ga0207660_1000102313 379
1074 3300025917 Ga0207660_10007267 Ga0207660_100072677 379
1075 3300025917 Ga0207660_10137346 Ga0207660_101373462 379
1076 3300025919 Ga0207657_10000031 Ga0207657_10000031124 379
1077 3300025919 Ga0207657_10000625 Ga0207657_1000062522 379
1078 3300025919 Ga0207657_10002051 Ga0207657_100020514 379
1079 3300025919 Ga0207657_10003760 Ga0207657_1000376014 379
1080 3300025919 Ga0207657_10006383 Ga0207657_100063834 379
1081 3300025919 Ga0207657_10007939 Ga0207657_100079398 379
1082 3300025919 Ga0207657_10018947 Ga0207657_100189473 379
1083 3300025919 Ga0207657_10060914 Ga0207657_100609142 379
1084 3300025919 Ga0207657_10070000 Ga0207657_100700002 379
1085 3300025919 Ga0207657_10105581 Ga0207657_101055813 379
1086 3300025919 Ga0207657_10108643 Ga0207657_101086432 379
1087 3300025919 Ga0207657_10134143 Ga0207657_101341433 379
1088 3300025919 Ga0207657_10172243 Ga0207657_101722431 379
1089 3300025920 Ga0207649_10000103 Ga0207649_1000010347 379
1090 3300025920 Ga0207649_10000394 Ga0207649_1000039425 379
1091 3300025920 Ga0207649_10008644 Ga0207649_100086445 379
1092 3300025920 Ga0207649_10012162 Ga0207649_100121622 379
1093 3300025920 Ga0207649_10027244 Ga0207649_100272444 379
1094 3300025921 Ga0207652_10000001 Ga0207652_10000001842 379
1095 3300025921 Ga0207652_10014570 Ga0207652_100145705 379
1096 3300025921 Ga0207652_10017973 Ga0207652_100179733 379
1097 3300025921 Ga0207652_10108075 Ga0207652_101080753 379
1098 3300025923 Ga0207681_10000008 Ga0207681_10000008373 379
1099 3300025923 Ga0207681_10000528 Ga0207681_1000052815 379
1100 3300025923 Ga0207681_10001333 Ga0207681_100013338 379
1101 3300025923 Ga0207681_10004527 Ga0207681_1000452710 379
1102 3300025923 Ga0207681_10029309 Ga0207681_100293094 379
1103 3300025924 Ga0207694_10003458 Ga0207694_1000345812 379
1104 3300025924 Ga0207694_10014139 Ga0207694_100141396 379
1105 3300025924 Ga0207694_10208302 Ga0207694_102083021 379
1106 3300025925 Ga0207650_10001366 Ga0207650_1000136618 379
1107 3300025925 Ga0207650_10007278 Ga0207650_100072786 379
1108 3300025925 Ga0207650_10040021 Ga0207650_100400213 379
1109 3300025925 Ga0207650_10068709 Ga0207650_100687091 379
1110 3300025925 Ga0207650_10088225 Ga0207650_100882253 379
1111 3300025926 Ga0207659_10034085 Ga0207659_100340853 379
1112 3300025927 Ga0207687_10002526 Ga0207687_100025262 379
1113 3300025927 Ga0207687_10143672 Ga0207687_101436722 379
1114 3300025928 Ga0207700_10074976 Ga0207700_100749764 379
1115 3300025929 Ga0207664_10021648 Ga0207664_100216485 379
1116 3300025931 Ga0207644_10000005 Ga0207644_10000005211 379
1117 3300025931 Ga0207644_10000006 Ga0207644_10000006364 379
1118 3300025931 Ga0207644_10000153 Ga0207644_1000015324 379
1119 3300025931 Ga0207644_10000220 Ga0207644_1000022021 379
1120 3300025931 Ga0207644_10002867 Ga0207644_100028679 379
1121 3300025931 Ga0207644_10004200 Ga0207644_100042005 379
1122 3300025931 Ga0207644_10018705 Ga0207644_100187052 379
1123 3300025931 Ga0207644_10040253 Ga0207644_100402533 379
1124 3300025932 Ga0207690_10000382 Ga0207690_1000038216 379
1125 3300025932 Ga0207690_10002417 Ga0207690_1000241711 379
1126 3300025932 Ga0207690_10003206 Ga0207690_100032067 379
1127 3300025932 Ga0207690_10003550 Ga0207690_100035502 379
1128 3300025932 Ga0207690_10016632 Ga0207690_100166322 379
1129 3300025932 Ga0207690_10035870 Ga0207690_100358702 379
1130 3300025932 Ga0207690_10051785 Ga0207690_100517852 379
1131 3300025932 Ga0207690_10135662 Ga0207690_101356622 379
1132 3300025933 Ga0207706_10000028 Ga0207706_10000028142 379
1133 3300025933 Ga0207706_10000171 Ga0207706_1000017166 379
1134 3300025933 Ga0207706_10000285 Ga0207706_1000028550 379
1135 3300025933 Ga0207706_10005076 Ga0207706_1000507611 379
1136 3300025933 Ga0207706_10023541 Ga0207706_100235413 379
1137 3300025933 Ga0207706_10040257 Ga0207706_100402572 379
1138 3300025933 Ga0207706_10062849 Ga0207706_100628492 379
1139 3300025933 Ga0207706_10064292 Ga0207706_100642922 379
1140 3300025933 Ga0207706_10169145 Ga0207706_101691452 379
1141 3300025933 Ga0207706_10237757 Ga0207706_102377572 379
1142 3300025933 Ga0207706_10268345 Ga0207706_102683452 379
1143 3300025936 Ga0207670_10101115 Ga0207670_101011151 379
1144 3300025937 Ga0207669_10025408 Ga0207669_100254083 379
1145 3300025937 Ga0207669_10030752 Ga0207669_100307524 379
1146 3300025938 Ga0207704_10033427 Ga0207704_100334272 379
1147 3300025938 Ga0207704_10068058 Ga0207704_100680582 379
1148 3300025938 Ga0207704_10152191 Ga0207704_101521912 379
1149 3300025940 Ga0207691_10003885 Ga0207691_1000388513 379
1150 3300025940 Ga0207691_10007857 Ga0207691_1000785712 379
1151 3300025940 Ga0207691_10013013 Ga0207691_100130133 379
1152 3300025940 Ga0207691_10073175 Ga0207691_100731752 379
1153 3300025940 Ga0207691_10230668 Ga0207691_102306682 379
1154 3300025941 Ga0207711_10000100 Ga0207711_1000010026 379
1155 3300025941 Ga0207711_10000500 Ga0207711_1000050012 379
1156 3300025941 Ga0207711_10001375 Ga0207711_1000137515 379
1157 3300025941 Ga0207711_10001810 Ga0207711_1000181016 379
1158 3300025941 Ga0207711_10002836 Ga0207711_100028365 379
1159 3300025941 Ga0207711_10005966 Ga0207711_100059667 379
1160 3300025941 Ga0207711_10006042 Ga0207711_1000604212 379
1161 3300025941 Ga0207711_10009820 Ga0207711_1000982010 379
1162 3300025941 Ga0207711_10017324 Ga0207711_100173243 379
1163 3300025941 Ga0207711_10044099 Ga0207711_100440991 379
1164 3300025941 Ga0207711_10048152 Ga0207711_100481522 379
1165 3300025941 Ga0207711_10048787 Ga0207711_100487872 379
1166 3300025941 Ga0207711_10101010 Ga0207711_101010102 379
1167 3300025941 Ga0207711_10353204 Ga0207711_103532041 379
1168 3300025942 Ga0207689_10000092 Ga0207689_1000009244 379
1169 3300025942 Ga0207689_10023842 Ga0207689_100238424 379
1170 3300025944 Ga0207661_10003597 Ga0207661_100035977 379
1171 3300025944 Ga0207661_10107187 Ga0207661_101071872 379
1172 3300025945 Ga0207679_10000129 Ga0207679_100001292 379
1173 3300025945 Ga0207679_10004617 Ga0207679_100046172 379
1174 3300025945 Ga0207679_10007146 Ga0207679_100071466 379
1175 3300025945 Ga0207679_10007159 Ga0207679_100071594 379
1176 3300025945 Ga0207679_10045221 Ga0207679_100452212 379
1177 3300025949 Ga0207667_10000357 Ga0207667_1000035771 379
1178 3300025949 Ga0207667_10007813 Ga0207667_100078132 379
1179 3300025949 Ga0207667_10019487 Ga0207667_100194872 379
1180 3300025949 Ga0207667_10020146 Ga0207667_100201468 379
1181 3300025949 Ga0207667_10025870 Ga0207667_100258702 379
1182 3300025949 Ga0207667_10039064 Ga0207667_100390642 379
1183 3300025949 Ga0207667_10042463 Ga0207667_100424632 379
1184 3300025949 Ga0207667_10123085 Ga0207667_101230853 379
1185 3300025949 Ga0207667_10130473 Ga0207667_101304733 379
1186 3300025960 Ga0207651_10000176 Ga0207651_1000017613 379
1187 3300025960 Ga0207651_10006875 Ga0207651_100068756 379
1188 3300025960 Ga0207651_10009081 Ga0207651_100090812 379
1189 3300025960 Ga0207651_10014015 Ga0207651_100140156 379
1190 3300025960 Ga0207651_10167567 Ga0207651_101675672 379
1191 3300025961 Ga0207712_10000269 Ga0207712_1000026923 379
1192 3300025961 Ga0207712_10001847 Ga0207712_100018474 379
1193 3300025961 Ga0207712_10059784 Ga0207712_100597843 379
1194 3300025961 Ga0207712_10136770 Ga0207712_101367702 379
1195 3300025972 Ga0207668_10000080 Ga0207668_1000008030 379
1196 3300025972 Ga0207668_10000293 Ga0207668_1000029336 379
1197 3300025972 Ga0207668_10002630 Ga0207668_100026303 379
1198 3300025972 Ga0207668_10033158 Ga0207668_100331582 379
1199 3300025972 Ga0207668_10089910 Ga0207668_100899102 379
1200 3300025972 Ga0207668_10195295 Ga0207668_101952952 379
1201 3300025981 Ga0207640_10000922 Ga0207640_100009228 379
1202 3300025981 Ga0207640_10001385 Ga0207640_1000138511 379
1203 3300025981 Ga0207640_10036504 Ga0207640_100365044 379
1204 3300025981 Ga0207640_10050441 Ga0207640_100504413 379
1205 3300025986 Ga0207658_10003348 Ga0207658_100033483 379
1206 3300025986 Ga0207658_10006798 Ga0207658_100067985 379
1207 3300025986 Ga0207658_10007421 Ga0207658_100074217 379
1208 3300025986 Ga0207658_10010339 Ga0207658_100103395 379
1209 3300025986 Ga0207658_10014800 Ga0207658_100148005 379
1210 3300025986 Ga0207658_10015585 Ga0207658_100155852 379
1211 3300025986 Ga0207658_10016561 Ga0207658_100165612 379
1212 3300025986 Ga0207658_10020445 Ga0207658_100204454 379
1213 3300025986 Ga0207658_10037108 Ga0207658_100371084 379
1214 3300025986 Ga0207658_10175015 Ga0207658_101750151 379
1215 3300026023 Ga0207677_10001622 Ga0207677_1000162212 379
1216 3300026023 Ga0207677_10007300 Ga0207677_100073005 379
1217 3300026023 Ga0207677_10008848 Ga0207677_100088483 379
1218 3300026023 Ga0207677_10079597 Ga0207677_100795973 379
1219 3300026035 Ga0207703_10000515 Ga0207703_1000051530 379
1220 3300026035 Ga0207703_10001781 Ga0207703_100017818 379
1221 3300026035 Ga0207703_10001798 Ga0207703_100017982 379
1222 3300026035 Ga0207703_10003524 Ga0207703_1000352413 379
1223 3300026035 Ga0207703_10004783 Ga0207703_100047834 379
1224 3300026035 Ga0207703_10004802 Ga0207703_1000480211 379
1225 3300026035 Ga0207703_10009105 Ga0207703_100091058 379
1226 3300026035 Ga0207703_10016679 Ga0207703_100166794 379
1227 3300026035 Ga0207703_10067108 Ga0207703_100671083 379
1228 3300026035 Ga0207703_10096257 Ga0207703_100962572 379
1229 3300026035 Ga0207703_10148827 Ga0207703_101488271 379
1230 3300026041 Ga0207639_10000131 Ga0207639_1000013126 379
1231 3300026041 Ga0207639_10005686 Ga0207639_1000568611 379
1232 3300026041 Ga0207639_10072666 Ga0207639_100726662 379
1233 3300026067 Ga0207678_10000198 Ga0207678_100001985 379
1234 3300026067 Ga0207678_10005020 Ga0207678_100050204 379
1235 3300026067 Ga0207678_10005050 Ga0207678_1000505011 379
1236 3300026067 Ga0207678_10015898 Ga0207678_100158985 379
1237 3300026067 Ga0207678_10057378 Ga0207678_100573784 379
1238 3300026067 Ga0207678_10155377 Ga0207678_101553772 379
1239 3300026067 Ga0207678_10188928 Ga0207678_101889282 379
1240 3300026078 Ga0207702_10000247 Ga0207702_1000024738 379
1241 3300026078 Ga0207702_10004072 Ga0207702_1000407213 379
1242 3300026078 Ga0207702_10011956 Ga0207702_100119562 379
1243 3300026078 Ga0207702_10127922 Ga0207702_101279222 379
1244 3300026078 Ga0207702_10140116 Ga0207702_101401162 379
1245 3300026078 Ga0207702_10159744 Ga0207702_101597442 379
1246 3300026088 Ga0207641_10000004 Ga0207641_10000004354 379
1247 3300026088 Ga0207641_10000221 Ga0207641_1000022125 379
1248 3300026088 Ga0207641_10001038 Ga0207641_100010389 379
1249 3300026088 Ga0207641_10002527 Ga0207641_100025273 379
1250 3300026088 Ga0207641_10005042 Ga0207641_100050425 379
1251 3300026088 Ga0207641_10005367 Ga0207641_100053673 379
1252 3300026088 Ga0207641_10013846 Ga0207641_100138463 379
1253 3300026088 Ga0207641_10030273 Ga0207641_100302732 379
1254 3300026088 Ga0207641_10030321 Ga0207641_100303215 379
1255 3300026088 Ga0207641_10031905 Ga0207641_100319055 379
1256 3300026088 Ga0207641_10037367 Ga0207641_100373674 379
1257 3300026089 Ga0207648_10006196 Ga0207648_1000619613 379
1258 3300026089 Ga0207648_10008887 Ga0207648_100088874 379
1259 3300026089 Ga0207648_10034392 Ga0207648_100343922 379
1260 3300026089 Ga0207648_10036146 Ga0207648_100361464 379
1261 3300026089 Ga0207648_10138313 Ga0207648_101383132 379
1262 3300026095 Ga0207676_10002026 Ga0207676_1000202614 379
1263 3300026095 Ga0207676_10003162 Ga0207676_1000316210 379
1264 3300026095 Ga0207676_10004385 Ga0207676_100043857 379
1265 3300026095 Ga0207676_10017908 Ga0207676_100179083 379
1266 3300026095 Ga0207676_10086231 Ga0207676_100862312 379
1267 3300026116 Ga0207674_10000289 Ga0207674_1000028915 379
1268 3300026116 Ga0207674_10002023 Ga0207674_100020234 379
1269 3300026116 Ga0207674_10002652 Ga0207674_1000265212 379
1270 3300026116 Ga0207674_10006972 Ga0207674_100069729 379
1271 3300026116 Ga0207674_10012168 Ga0207674_100121688 379
1272 3300026116 Ga0207674_10014969 Ga0207674_100149695 379
1273 3300026116 Ga0207674_10016447 Ga0207674_100164477 379
1274 3300026116 Ga0207674_10018937 Ga0207674_100189375 379
1275 3300026116 Ga0207674_10086035 Ga0207674_100860353 379
1276 3300026116 Ga0207674_10109608 Ga0207674_101096083 379
1277 3300026118 Ga0207675_100000135 Ga0207675_10000013512 379
1278 3300026118 Ga0207675_100069152 Ga0207675_1000691521 379
1279 3300026121 Ga0207683_10032416 Ga0207683_100324165 379
1280 3300026121 Ga0207683_10043045 Ga0207683_100430453 379
1281 3300026121 Ga0207683_10073999 Ga0207683_100739992 379
1282 3300026121 Ga0207683_10213962 Ga0207683_102139622 379
1283 3300026142 Ga0207698_10000944 Ga0207698_100009442 379
1284 3300026142 Ga0207698_10001888 Ga0207698_1000188812 379
1285 3300026142 Ga0207698_10015356 Ga0207698_100153564 379
1286 3300026142 Ga0207698_10016046 Ga0207698_100160465 379
1287 3300026142 Ga0207698_10018337 Ga0207698_100183374 379
1288 3300026142 Ga0207698_10047184 Ga0207698_100471841 379
1289 3300026142 Ga0207698_10063200 Ga0207698_100632003 379
1290 3300026142 Ga0207698_10091820 Ga0207698_100918202 379
1291 3300027876 Ga0209974_10002244 Ga0209974_100022444 379
1292 3300028379 Ga0268266_10000433 Ga0268266_1000043327 379
1293 3300028379 Ga0268266_10003150 Ga0268266_1000315015 379
1294 3300028379 Ga0268266_10012368 Ga0268266_100123685 379
1295 3300028379 Ga0268266_10016623 Ga0268266_100166234 379
1296 3300028379 Ga0268266_10018141 Ga0268266_100181413 379
1297 3300028379 Ga0268266_10029989 Ga0268266_100299893 379
1298 3300028379 Ga0268266_10031756 Ga0268266_100317564 379
1299 3300028379 Ga0268266_10047737 Ga0268266_100477372 379
1300 3300028379 Ga0268266_10069687 Ga0268266_100696873 379
1301 3300028379 Ga0268266_10107736 Ga0268266_101077362 379
1302 3300028379 Ga0268266_10149854 Ga0268266_101498543 379
1303 3300028379 Ga0268266_10163828 Ga0268266_101638283 379
1304 3300028380 Ga0268265_10000064 Ga0268265_1000006445 379
1305 3300028380 Ga0268265_10020623 Ga0268265_100206232 379
1306 3300028380 Ga0268265_10027327 Ga0268265_100273272 379
1307 3300028380 Ga0268265_10038539 Ga0268265_100385393 379
1308 3300028380 Ga0268265_10055694 Ga0268265_100556942 379
1309 3300028380 Ga0268265_10204665 Ga0268265_102046652 379
1310 3300028380 Ga0268265_10276386 Ga0268265_102763861 379
1311 3300028381 Ga0268264_10000010 Ga0268264_10000010157 379
1312 3300028381 Ga0268264_10000567 Ga0268264_1000056745 379
1313 3300028381 Ga0268264_10002045 Ga0268264_100020455 379
1314 3300028381 Ga0268264_10002177 Ga0268264_100021772 379
1315 3300028381 Ga0268264_10005259 Ga0268264_100052597 379
1316 3300028381 Ga0268264_10006022 Ga0268264_100060222 379
1317 3300028381 Ga0268264_10022226 Ga0268264_100222266 379
1318 3300028381 Ga0268264_10053564 Ga0268264_100535642 379
1319 3300028381 Ga0268264_10066545 Ga0268264_100665452 379
1320 3300028381 Ga0268264_10105302 Ga0268264_101053022 379
1321 3300028381 Ga0268264_10143582 Ga0268264_101435823 379
1322 3300028381 Ga0268264_10281275 Ga0268264_102812752 379
1323 3300029957 Ga0265324_10041286 Ga0265324_100412862 379
1324 3300030731 Ga0316177_1100564 Ga0316177_11005643 379
1325 3300030745 Ga0316182_1433154 Ga0316182_14331542 379
1326 3300031251 Ga0265327_10022856 Ga0265327_100228562 379
1327 3300031507 Ga0307509_10000002 Ga0307509_10000002239 379
1328 3300031548 Ga0307408_100002967 Ga0307408_1000029673 379
1329 3300031548 Ga0307408_100012582 Ga0307408_1000125823 379
1330 3300031548 Ga0307408_100029940 Ga0307408_1000299403 379
1331 3300031548 Ga0307408_100048260 Ga0307408_1000482602 379
1332 3300031731 Ga0307405_10005492 Ga0307405_100054921 379
1333 3300031731 Ga0307405_10011011 Ga0307405_100110114 379
1334 3300031731 Ga0307405_10016071 Ga0307405_100160713 379
1335 3300031731 Ga0307405_10034756 Ga0307405_100347562 379
1336 3300031731 Ga0307405_10090788 Ga0307405_100907882 379
1337 3300031824 Ga0307413_10000144 Ga0307413_1000014412 379
1338 3300031824 Ga0307413_10034618 Ga0307413_100346182 379
1339 3300031824 Ga0307413_10114955 Ga0307413_101149552 379
1340 3300031824 Ga0307413_10115966 Ga0307413_101159662 379
1341 3300031824 Ga0307413_10119379 Ga0307413_101193792 379
1342 3300031852 Ga0307410_10009720 Ga0307410_100097202 379
1343 3300031852 Ga0307410_10010793 Ga0307410_100107932 379
1344 3300031852 Ga0307410_10014542 Ga0307410_100145423 379
1345 3300031852 Ga0307410_10015716 Ga0307410_100157163 379
1346 3300031852 Ga0307410_10041040 Ga0307410_100410404 379
1347 3300031852 Ga0307410_10057891 Ga0307410_100578912 379
1348 3300031901 Ga0307406_10022911 Ga0307406_100229113 379
1349 3300031901 Ga0307406_10126422 Ga0307406_101264222 379
1350 3300031903 Ga0307407_10006801 Ga0307407_100068015 379
1351 3300031903 Ga0307407_10007023 Ga0307407_100070237 379
1352 3300031903 Ga0307407_10025564 Ga0307407_100255643 379
1353 3300031903 Ga0307407_10068031 Ga0307407_100680311 379
1354 3300031903 Ga0307407_10076812 Ga0307407_100768122 379
1355 3300031903 Ga0307407_10110060 Ga0307407_101100602 379
1356 3300031903 Ga0307407_10113471 Ga0307407_101134712 379
1357 3300031911 Ga0307412_10016666 Ga0307412_100166663 379
1358 3300031911 Ga0307412_10028016 Ga0307412_100280162 379
1359 3300031911 Ga0307412_10034105 Ga0307412_100341053 379
1360 3300031911 Ga0307412_10061860 Ga0307412_100618602 379
1361 3300031911 Ga0307412_10078776 Ga0307412_100787762 379
1362 3300031911 Ga0307412_10183444 Ga0307412_101834442 379
1363 3300031995 Ga0307409_100000049 Ga0307409_10000004923 379
1364 3300031995 Ga0307409_100006386 Ga0307409_1000063865 379
1365 3300031995 Ga0307409_100061997 Ga0307409_1000619972 379
1366 3300031995 Ga0307409_100118363 Ga0307409_1001183632 379
1367 3300031995 Ga0307409_100196347 Ga0307409_1001963471 379
1368 3300031995 Ga0307409_100220149 Ga0307409_1002201492 379
1369 3300031995 Ga0307409_100314232 Ga0307409_1003142322 379
1370 3300031995 Ga0307409_100340461 Ga0307409_1003404611 379
1371 3300032002 Ga0307416_100006793 Ga0307416_10000679310 379
1372 3300032002 Ga0307416_100019803 Ga0307416_1000198035 379
1373 3300032002 Ga0307416_100071508 Ga0307416_1000715083 379
1374 3300032002 Ga0307416_100072245 Ga0307416_1000722452 379
1375 3300032002 Ga0307416_100149906 Ga0307416_1001499063 379
1376 3300032004 Ga0307414_10000735 Ga0307414_1000073510 379
1377 3300032004 Ga0307414_10032847 Ga0307414_100328473 379
1378 3300032004 Ga0307414_10033122 Ga0307414_100331223 379
1379 3300032004 Ga0307414_10169784 Ga0307414_101697842 379
1380 3300032004 Ga0307414_10176017 Ga0307414_101760172 379
1381 3300032004 Ga0307414_10358068 Ga0307414_103580681 379
1382 3300032005 Ga0307411_10000702 Ga0307411_100007026 379
1383 3300032005 Ga0307411_10007368 Ga0307411_100073685 379
1384 3300032005 Ga0307411_10012009 Ga0307411_100120095 379
1385 3300032005 Ga0307411_10013476 Ga0307411_100134762 379
1386 3300032005 Ga0307411_10030014 Ga0307411_100300142 379
1387 3300032005 Ga0307411_10088051 Ga0307411_100880512 379
1388 3300032005 Ga0307411_10129419 Ga0307411_101294192 379
1389 3300032005 Ga0307411_10150533 Ga0307411_101505332 379
1390 3300032126 Ga0307415_100009878 Ga0307415_1000098782 379
1391 3300032126 Ga0307415_100020451 Ga0307415_1000204514 379
1392 3300032126 Ga0307415_100026196 Ga0307415_1000261963 379
1393 3300032126 Ga0307415_100045062 Ga0307415_1000450622 379
1394 3300032126 Ga0307415_100045109 Ga0307415_1000451091 379
1395 3300032126 Ga0307415_100090284 Ga0307415_1000902842 379
1396 3300032126 Ga0307415_100091220 Ga0307415_1000912202 379
1397 3300032126 Ga0307415_100198478 Ga0307415_1001984782 379
1398 3300033180 Ga0307510_10000003 Ga0307510_10000003499 379
1399 3300033180 Ga0307510_10019979 Ga0307510_100199799 379
1400 3300035170 Ga0373943_0035022 Ga0373943_0035022_635_1786 379
1401 3300035172 Ga0373955_0004423 Ga0373955_0004423_2869_4020 379
1402 3300035692 Ga0373935_0002341 Ga0373935_0002341_1773_2924 379
1403 3300035695 Ga0373927_0093474 Ga0373927_0093474_392_1543 379
1404 3300035724 Ga0373933_0006446 Ga0373933_0006446_4492_5643 379
1405 3300035725 Ga0373947_0009709 Ga0373947_0009709_1721_2872 379
1406 3300036401 Ga0373937_0004086 Ga0373937_0004086_1442_2593 379
1407 3300037312 Ga0395899_0000588 Ga0395899_0000588_30676_31815 379
1408 3300037312 Ga0395899_0004324 Ga0395899_0004324_450_1598 379
1409 3300037312 Ga0395899_0025601 Ga0395899_0025601_2692_3843 379
1410 3300037312 Ga0395899_0033919 Ga0395899_0033919_1651_2793 379
1411 3300037312 Ga0395899_0059202 Ga0395899_0059202_437_1588 379
1412 3300037312 Ga0395899_0074408 Ga0395899_0074408_15_1166 379
1413 3300037312 Ga0395899_0157944 Ga0395899_0157944_313_1464 379
1414 3300037418 Ga0395900_0003293 Ga0395900_0003293_9760_10911 379
1415 3300037418 Ga0395900_0010430 Ga0395900_0010430_6303_7454 379
1416 3300037418 Ga0395900_0012370 Ga0395900_0012370_1042_2193 379
1417 3300037418 Ga0395900_0014134 Ga0395900_0014134_6101_7252 379
1418 3300037418 Ga0395900_0023784 Ga0395900_0023784_263_1414 379
1419 3300037418 Ga0395900_0031449 Ga0395900_0031449_2002_3150 379
1420 3300037418 Ga0395900_0031981 Ga0395900_0031981_2575_3726 379
1421 3300037418 Ga0395900_0060690 Ga0395900_0060690_313_1464 379
1422 3300037418 Ga0395900_0090264 Ga0395900_0090264_1616_2764 379
1423 3300037418 Ga0395900_0093241 Ga0395900_0093241_1644_2795 379
1424 3300037418 Ga0395900_0153780 Ga0395900_0153780_682_1824 379
1425 3300037418 Ga0395900_0215182 Ga0395900_0215182_272_1423 379
1426 3300037466 Ga0395898_0013212 Ga0395898_0013212_4757_5905 379
1427 3300037466 Ga0395898_0019019 Ga0395898_0019019_3303_4454 379
1428 3300037466 Ga0395898_0027768 Ga0395898_0027768_3914_5065 379
1429 3300037466 Ga0395898_0069451 Ga0395898_0069451_449_1600 379
1430 3300037466 Ga0395898_0079598 Ga0395898_0079598_258_1409 379
1431 3300037466 Ga0395898_0120402 Ga0395898_0120402_1248_2399 379
1432 3300037466 Ga0395898_0130858 Ga0395898_0130858_869_2017 379
1433 3300037466 Ga0395898_0141896 Ga0395898_0141896_604_1755 379
1434 3300037471 Ga0395905_0000974 Ga0395905_0000974_33753_34904 379
1435 3300037471 Ga0395905_0004314 Ga0395905_0004314_2842_3990 379
1436 3300037471 Ga0395905_0005211 Ga0395905_0005211_1570_2721 379
1437 3300037471 Ga0395905_0008284 Ga0395905_0008284_5366_6517 379
1438 3300037471 Ga0395905_0009884 Ga0395905_0009884_1187_2338 379
1439 3300037471 Ga0395905_0014108 Ga0395905_0014108_5121_6272 379
1440 3300037471 Ga0395905_0016029 Ga0395905_0016029_88_1239 379
1441 3300037471 Ga0395905_0016902 Ga0395905_0016902_1431_2582 379
1442 3300037471 Ga0395905_0023848 Ga0395905_0023848_2047_3198 379
1443 3300037471 Ga0395905_0026200 Ga0395905_0026200_1699_2850 379
1444 3300037471 Ga0395905_0026869 Ga0395905_0026869_3501_4643 379
1445 3300037471 Ga0395905_0039669 Ga0395905_0039669_2063_3214 379
1446 3300037471 Ga0395905_0064932 Ga0395905_0064932_545_1696 379
1447 3300037471 Ga0395905_0070210 Ga0395905_0070210_736_1935 379
1448 3300037471 Ga0395905_0073786 Ga0395905_0073786_1785_2936 379
1449 3300037471 Ga0395905_0077640 Ga0395905_0077640_481_1680 379
1450 3300037471 Ga0395905_0094324 Ga0395905_0094324_155_1303 379
1451 3300037471 Ga0395905_0095012 Ga0395905_0095012_1016_2155 379
1452 3300037471 Ga0395905_0097272 Ga0395905_0097272_1385_2527 379
1453 3300037471 Ga0395905_0309360 Ga0395905_0309360_117_1259 379
1454 3300037471 Ga0395905_0325408 Ga0395905_0325408_40_1191 379
1455 3300037471 Ga0395905_0353352 Ga0395905_0353352_169_1350 379
1456 3300037853 Ga0436364_0430514 Ga0436364_0430514_1419_2570 379
1457 3300037853 Ga0436364_0584120 Ga0436364_0584120_780_1922 379
1458 3300038443 Ga0395901_0000276 Ga0395901_0000276_37438_38589 379
1459 3300038443 Ga0395901_0001229 Ga0395901_0001229_19598_20749 379
1460 3300038443 Ga0395901_0010013 Ga0395901_0010013_8197_9348 379
1461 3300038443 Ga0395901_0020870 Ga0395901_0020870_2487_3638 379
1462 3300038443 Ga0395901_0039030 Ga0395901_0039030_800_1951 379
1463 3300038443 Ga0395901_0040045 Ga0395901_0040045_1781_2923 379
1464 3300038443 Ga0395901_0068820 Ga0395901_0068820_2432_3580 379
1465 3300038443 Ga0395901_0081320 Ga0395901_0081320_418_1569 379
1466 3300038443 Ga0395901_0088892 Ga0395901_0088892_137_1288 379
1467 3300038443 Ga0395901_0121313 Ga0395901_0121313_620_1768 379
1468 3300038443 Ga0395901_0153861 Ga0395901_0153861_711_1862 379
1469 3300038443 Ga0395901_0196084 Ga0395901_0196084_438_1589 379
1470 3300038443 Ga0395901_0199360 Ga0395901_0199360_783_1934 379
1471 3300038443 Ga0395901_0204822 Ga0395901_0204822_737_1876 379
1472 3300038443 Ga0395901_0363701 Ga0395901_0363701_272_1423 379
1473 3300039437 Ga0436365_0490562 Ga0436365_0490562_6035_7174 379
1474 3300039437 Ga0436365_0862833 Ga0436365_0862833_71280_72419 379
1475 3300039437 Ga0436365_1291448 Ga0436365_1291448_5809_6948 379
1476 3300039447 Ga0436361_0272150 Ga0436361_0272150_4766_5908 379
1477 3300039453 Ga0436362_0949954 Ga0436362_0949954_31483_32622 379
1478 3300042144 Ga0450889_000635 Ga0450889_000635_2547_3704 379
1479 3300042439 Ga0439464_0000318 Ga0439464_0000318_2234_3385 379
1480 3300044656 Ga0466969_0002544 Ga0466969_0002544_1941_3122 379
1481 3300044658 Ga0466972_0066638 Ga0466972_0066638_94_1245 379
1482 3300044684 Ga0466966_0000701 Ga0466966_0000701_10474_11655 379
1483 3300044684 Ga0466966_0016093 Ga0466966_0016093_1878_3029 379
1484 3300044684 Ga0466966_0100131 Ga0466966_0100131_417_1568 379
1485 3300044693 Ga0466961_0003965 Ga0466961_0003965_7124_8305 379
1486 3300044694 Ga0466963_0009670 Ga0466963_0009670_158_1309 379
1487 3300044694 Ga0466963_0169622 Ga0466963_0169622_32_1213 379
1488 3300044719 Ga0466971_0003466 Ga0466971_0003466_312_1493 379
1489 3300044842 Ga0466957_0106689 Ga0466957_0106689_253_1452 379
1490 3300045049 Ga0466959_0000100 Ga0466959_0000100_21555_22736 379
1491 3300045049 Ga0466959_0215466 Ga0466959_0215466_26_1177 379
1492 3300045836 Ga0466958_0015261 Ga0466958_0015261_2620_3771 379
1493 3300045836 Ga0466958_0048253 Ga0466958_0048253_551_1732 379
1494 3300045976 Ga0466967_0132000 Ga0466967_0132000_270_1421 379
1495 3300045976 Ga0466967_0136099 Ga0466967_0136099_495_1643 379
1496 3300045976 Ga0466967_0162923 Ga0466967_0162923_221_1372 379
1497 3300045976 Ga0466967_0282317 Ga0466967_0282317_314_1465 379
1498 3300045976 Ga0466967_0308310 Ga0466967_0308310_115_1266 379
1499 3300046460 Ga0495638_0004735 Ga0495638_0004735_8246_9478 379
1500 3300046460 Ga0495638_0071311 Ga0495638_0071311_273_1433 379
1501 3300046512 Ga0495610_0001199 Ga0495610_0001199_18660_19877 379
1502 3300046524 Ga0495648_0076783 Ga0495648_0076783_64_1209 379
1503 3300046525 Ga0495663_0000927 Ga0495663_0000927_1527_2669 379
1504 3300046537 Ga0495598_0002187 Ga0495598_0002187_1528_2670 379
1505 3300046537 Ga0495598_0010308 Ga0495598_0010308_802_1953 379
1506 3300046539 Ga0495621_0000065 Ga0495621_0000065_18130_19281 379
1507 3300046539 Ga0495621_0000800 Ga0495621_0000800_3132_4274 379
1508 3300046558 Ga0495633_0002388 Ga0495633_0002388_8982_10124 379
1509 3300046616 Ga0495668_0000034 Ga0495668_0000034_187859_189043 379
1510 3300046616 Ga0495668_0000079 Ga0495668_0000079_46214_47359 379
1511 3300046679 Ga0495623_0024603 Ga0495623_0024603_2542_3693 379
1512 3300046684 Ga0495669_0002616 Ga0495669_0002616_303_1454 379
1513 3300046684 Ga0495669_0004574 Ga0495669_0004574_568_1719 379
1514 3300046684 Ga0495669_0006311 Ga0495669_0006311_2007_3158 379
1515 3300046684 Ga0495669_0064756 Ga0495669_0064756_363_1514 379
1516 3300046691 Ga0495670_0000467 Ga0495670_0000467_10149_11300 379
1517 3300046691 Ga0495670_0023273 Ga0495670_0023273_464_1606 379
1518 3300046694 Ga0495649_0025286 Ga0495649_0025286_1251_2486 379
1519 3300046810 Ga0495660_0004360 Ga0495660_0004360_7206_8360 379
1520 3300047445 Ga0495677_0003352 Ga0495677_0003352_4179_5321 379
1521 3300047447 Ga0495685_061071 Ga0495685_061071_80_1231 379
1522 3300047472 Ga0495686_0000164 Ga0495686_0000164_74357_75502 379
1523 3300047472 Ga0495686_0025665 Ga0495686_0025665_62_1279 379
1524 3300048903 Ga0496100_0003792 Ga0496100_0003792_5680_6831 379
1525 3300048903 Ga0496100_0037167 Ga0496100_0037167_1665_2813 379
1526 3300048904 Ga0496101_0001530 Ga0496101_0001530_6557_7708 379
1527 3300048904 Ga0496101_0021951 Ga0496101_0021951_1217_2368 379
1528 3300048904 Ga0496101_0022269 Ga0496101_0022269_1090_2238 379
1529 3300048904 Ga0496101_0030191 Ga0496101_0030191_1814_2965 379
1530 3300048904 Ga0496101_0047686 Ga0496101_0047686_662_1813 379
1531 3300048904 Ga0496101_0099624 Ga0496101_0099624_92_1240 379
1532 3300048905 Ga0496102_0032814 Ga0496102_0032814_1434_2579 379
1533 3300048905 Ga0496102_0123882 Ga0496102_0123882_1045_2196 379
1534 3300048905 Ga0496102_0192597 Ga0496102_0192597_678_1835 379
1535 3300048906 Ga0496103_0011702 Ga0496103_0011702_934_2082 379
1536 3300048906 Ga0496103_0052039 Ga0496103_0052039_297_1445 379
1537 3300048907 Ga0496104_0015717 Ga0496104_0015717_3672_4817 379
1538 3300048907 Ga0496104_0078080 Ga0496104_0078080_1310_2461 379
1539 3300048907 Ga0496104_0286449 Ga0496104_0286449_40_1191 379
1540 3300048908 Ga0496105_0000932 Ga0496105_0000932_3833_4978 379
1541 3300048908 Ga0496105_0022358 Ga0496105_0022358_3759_4907 379
1542 3300048909 Ga0496106_0000685 Ga0496106_0000685_19834_20982 379
1543 3300048909 Ga0496106_0004331 Ga0496106_0004331_5791_7104 379
1544 3300048909 Ga0496106_0017079 Ga0496106_0017079_3801_4952 379
1545 3300048909 Ga0496106_0018321 Ga0496106_0018321_1526_2677 379
1546 3300048909 Ga0496106_0055678 Ga0496106_0055678_341_1492 379
1547 3300048910 Ga0496107_0000057 Ga0496107_0000057_55861_57174 379
1548 3300048910 Ga0496107_0002088 Ga0496107_0002088_1045_2196 379
1549 3300048910 Ga0496107_0002535 Ga0496107_0002535_6326_7477 379
1550 3300048910 Ga0496107_0003034 Ga0496107_0003034_8097_9245 379
1551 3300048910 Ga0496107_0168901 Ga0496107_0168901_150_1295 379
1552 3300048910 Ga0496107_0174638 Ga0496107_0174638_99_1250 379
1553 3300048911 Ga0496108_0004255 Ga0496108_0004255_9285_10436 379
1554 3300048911 Ga0496108_0006866 Ga0496108_0006866_3067_4218 379
1555 3300048911 Ga0496108_0013082 Ga0496108_0013082_935_2086 379
1556 3300048911 Ga0496108_0022113 Ga0496108_0022113_3738_4889 379
1557 3300048911 Ga0496108_0049189 Ga0496108_0049189_1069_2220 379
1558 3300048911 Ga0496108_0086212 Ga0496108_0086212_217_1365 379
1559 3300048912 Ga0496109_0010536 Ga0496109_0010536_6673_7824 379
1560 3300048912 Ga0496109_0013067 Ga0496109_0013067_4203_5354 379
1561 3300048912 Ga0496109_0138588 Ga0496109_0138588_1107_2258 379
1562 3300048913 Ga0496110_0000847 Ga0496110_0000847_6600_7751 379
1563 3300048913 Ga0496110_0012913 Ga0496110_0012913_58_1209 379
1564 3300048913 Ga0496110_0029506 Ga0496110_0029506_886_2034 379
1565 3300048913 Ga0496110_0038466 Ga0496110_0038466_467_1618 379
1566 3300048913 Ga0496110_0089550 Ga0496110_0089550_1215_2363 379
1567 3300048914 Ga0496111_0003138 Ga0496111_0003138_4102_5253 379
1568 3300048914 Ga0496111_0005026 Ga0496111_0005026_2396_3547 379
1569 3300048914 Ga0496111_0006263 Ga0496111_0006263_2237_3388 379
1570 3300048914 Ga0496111_0014601 Ga0496111_0014601_4117_5265 379
1571 3300048914 Ga0496111_0074700 Ga0496111_0074700_30_1181 379
1572 3300048915 Ga0496112_0005760 Ga0496112_0005760_5492_6643 379
1573 3300048915 Ga0496112_0005909 Ga0496112_0005909_7675_8826 379
1574 3300048915 Ga0496112_0008648 Ga0496112_0008648_4263_5411 379
1575 3300048915 Ga0496112_0256623 Ga0496112_0256623_54_1202 379
1576 3300048916 Ga0496113_0002271 Ga0496113_0002271_3936_5084 379
1577 3300048916 Ga0496113_0042465 Ga0496113_0042465_28_1179 379
1578 3300048916 Ga0496113_0049295 Ga0496113_0049295_1290_2438 379
1579 3300048916 Ga0496113_0129310 Ga0496113_0129310_485_1636 379
1580 3300048917 Ga0496114_0000109 Ga0496114_0000109_10171_11322 379
1581 3300048917 Ga0496114_0021294 Ga0496114_0021294_947_2095 379
1582 3300048917 Ga0496114_0056792 Ga0496114_0056792_1758_2909 379
1583 3300048918 Ga0496115_0000691 Ga0496115_0000691_6684_7835 379
1584 3300048918 Ga0496115_0144925 Ga0496115_0144925_328_1476 379
1585 3300048919 Ga0496116_0006891 Ga0496116_0006891_7606_8751 379
1586 3300048920 Ga0496117_0000316 Ga0496117_0000316_81594_82739 379
1587 3300048921 Ga0496118_0000003 Ga0496118_0000003_401480_402625 379
1588 3300048921 Ga0496118_0011358 Ga0496118_0011358_4243_5388 379
1589 3300048922 Ga0496119_0035935 Ga0496119_0035935_1927_3072 379
1590 3300048923 Ga0496120_0053834 Ga0496120_0053834_516_1661 379
1591 3300048924 Ga0496121_0000078 Ga0496121_0000078_123529_124674 379
1592 3300048924 Ga0496121_0000293 Ga0496121_0000293_10428_11573 379
1593 3300048924 Ga0496121_0000520 Ga0496121_0000520_9677_10822 379
1594 3300048924 Ga0496121_0001591 Ga0496121_0001591_18480_19793 379
1595 3300048924 Ga0496121_0032025 Ga0496121_0032025_3586_4731 379
1596 3300048924 Ga0496121_0120858 Ga0496121_0120858_592_1737 379
1597 3300048926 Ga0496123_0001205 Ga0496123_0001205_28643_29803 379
1598 3300048928 Ga0496125_0000743 Ga0496125_0000743_2513_3658 379
1599 3300048928 Ga0496125_0049656 Ga0496125_0049656_1430_2575 379
1600 3300048929 Ga0496126_0002855 Ga0496126_0002855_1339_2487 379
1601 3300048929 Ga0496126_0024757 Ga0496126_0024757_2877_4022 379
1602 3300048929 Ga0496126_0131367 Ga0496126_0131367_582_1727 379
1603 3300049571 Ga0501034_0032213 Ga0501034_0032213_1731_2912 379
1604 3300049571 Ga0501034_0206973 Ga0501034_0206973_646_1827 379
1605 3300049586 Ga0501070_0196199 Ga0501070_0196199_398_1552 379
1606 3300049686 Ga0501257_000008 Ga0501257_000008_16813_17952 379
1607 3300049742 Ga0501080_0055953 Ga0501080_0055953_2066_3217 379
1608 3300049776 Ga0501280_001017 Ga0501280_001017_3819_4958 379
1609 3300050515 nmdc:mga0a205_54162_c1 nmdc:mga0a205_54162_c1_2521_3672 379
1610 3300053119 Ga0500595_013270 Ga0500595_013270_1367_2509 379
1611 3300053134 Ga0500658_0001563 Ga0500658_0001563_7436_8629 379
1612 3300053136 Ga0500559_0000752 Ga0500559_0000752_15559_16701 379
1613 3300053156 Ga0500622_0026058 Ga0500622_0026058_88_1248 379
1614 3300053177 Ga0500636_0009880 Ga0500636_0009880_3698_4840 379
1615 3300061719 Ga0466962_0002025 Ga0466962_0002025_7557_8738 379
1616 3300061719 Ga0466962_0120631 Ga0466962_0120631_31_1215 379
1617 iso_pu_bacteria 2582581280 2585154249 379
1618 iso_pu_bacteria 2582581293 2585197868 379
1619 iso_pu_bacteria 2585428106 2587917817 379
1620 iso_pu_bacteria 2849560528 2849562923 379
1621 iso_pu_bacteria 2898329390 2898329748 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

185

411

0.97

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

48

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rra-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9492 2 379
3rr1-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9474 2 379
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9471 1 379
3rr1-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9439 2 379
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9373 1 379
ID Description Score Start End Superfamily
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9885 1 105 3.30.390.10
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9702 1 105 3.30.390.10
3rraA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9699 1 99 3.30.390.10
3s47B01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9537 2 98 3.30.390.10
4jn8A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9433 1 98 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A066WBJ3-F1-model_v4 deleted 0.9884 53 302
AF-A0A7H8QMT8-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.987 2 379 GO:0008869
GO:0009063
GO:0016491
GO:0034194
AF-A0A066WBJ3-F1-model_v4 deleted 0.9845 53 302
AF-A0A4Z1P4F4-F1-model_v4 Mandelate racemase/muconate lactonizing protein-like protein 0.9844 2 377 GO:0008869
GO:0009063
GO:0034194
AF-A0A2K0TNN2-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9837 2 379 GO:0008869
GO:0009063
GO:0034194

Feature Viewer

pLDDT pTM Quality
94.26 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map