F494952

General Info

Members Datasets Scaffolds Average Seq Length
1593 397 3186 235

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0374444|Ga0495600_0374444_29_874
Length 281
Sequence MGATSPWKVSRKRVVSSRSRYQSIRLTEQELHSHDRLGPPAISRFSLFREGEFMGVTRILIVEDEPNMVAGLRDNFEYEGFQVATALDGVDGLERALEDSPDLVILDVMMPRMSGLDVCKQLKAKRPSIPIIMLTARGQEVDKVVGLELGADDYVTKPFSIRELLARVKAVLRRTQTLPKEMDRYAFGDVEVDLRSYQVLRGGNPVELSGKEFELLKHFLCHSGQTLSRDRLLDEVWGYENYPTTRTVDTHIVRIRQKLEPVPEEPRYFLTVHGIGYKFVG

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
140 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
141 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
250 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
324 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
325 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
326 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
327 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
328 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
329 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
330 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
331 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
344 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
345 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
346 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
347 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
348 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
349 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
350 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
351 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
352 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
353 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
354 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
355 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
356 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
357 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
358 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
359 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
360 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
361 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
362 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
363 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
364 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
365 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
366 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
367 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
368 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
369 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
374 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
375 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
376 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
377 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
380 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
383 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
384 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
385 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
386 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
387 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
388 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
389 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
390 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.65
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0374444 3300046809 Bacteria 889
2 CNAas_1001291 3300000532 Unclassified 2186
3 LJNas_1000830 3300000546 Bacteria 5085
4 JGI24743J22301_10001093 3300001991 Bacteria 3613
5 JGI24748J21848_1000019 3300002074 Bacteria 120384
6 JGI24748J21848_1001990 3300002074 Bacteria 2277
7 JGI24034J26672_10000003 3300002239 Bacteria 501747
8 JGI24751J29686_10001293 3300002459 Bacteria 5285
9 rootH2_10123433 3300003320 Bacteria 1656
10 Ga0065704_10083421 3300005289 Bacteria 3468
11 Ga0065712_10005182 3300005290 Bacteria 2970
12 Ga0065712_10022915 3300005290 Bacteria 1575
13 Ga0065712_10033054 3300005290 Bacteria 1361
14 Ga0065712_10070904 3300005290 Bacteria 5612
15 Ga0065712_10161590 3300005290 Bacteria 1298
16 Ga0065715_10013764 3300005293 Bacteria 2022
17 Ga0065715_10111941 3300005293 Bacteria 2552
18 Ga0065715_10321232 3300005293 Bacteria 1001
19 Ga0065715_10324098 3300005293 Bacteria 996
20 Ga0065715_10350384 3300005293 Bacteria 952
21 Ga0065715_10500547 3300005293 Bacteria 769
22 Ga0065707_10003411 3300005295 Bacteria 4567
23 Ga0065707_10017326 3300005295 Bacteria 1967
24 Ga0065707_10022069 3300005295 Bacteria 5572
25 Ga0065707_10027156 3300005295 Unclassified 1393
26 Ga0065707_10102526 3300005295 Bacteria 2800
27 Ga0065707_10126446 3300005295 Bacteria 2003
28 Ga0065707_10177129 3300005295 Bacteria 1411
29 Ga0065707_10488284 3300005295 Bacteria 767
30 Ga0065707_10512683 3300005295 Bacteria 748
31 Ga0070658_10818289 3300005327 Bacteria 809
32 Ga0070683_100019378 3300005329 Bacteria 6042
33 Ga0070683_100052975 3300005329 Bacteria 3760
34 Ga0070683_100141516 3300005329 Bacteria 2279
35 Ga0070683_100187232 3300005329 Bacteria 1965
36 Ga0070690_100003539 3300005330 Bacteria 8562
37 Ga0070690_100022593 3300005330 Bacteria 3849
38 Ga0070690_100025472 3300005330 Bacteria 3644
39 Ga0070690_100047447 3300005330 Bacteria 2733
40 Ga0070670_100023345 3300005331 Bacteria 5324
41 Ga0070670_100060302 3300005331 Bacteria 3257
42 Ga0070670_100259457 3300005331 Bacteria 1515
43 Ga0068869_100001750 3300005334 Bacteria 12978
44 Ga0068869_100007562 3300005334 Bacteria 6954
45 Ga0068869_100015071 3300005334 Bacteria 5176
46 Ga0068869_100037588 3300005334 Bacteria 3443
47 Ga0068869_100094473 3300005334 Bacteria 2254
48 Ga0068869_100146538 3300005334 Bacteria 1828
49 Ga0068869_100222316 3300005334 Bacteria 1497
50 Ga0070666_10009297 3300005335 Bacteria 6124
51 Ga0070680_100027092 3300005336 Bacteria 4589
52 Ga0070682_100003672 3300005337 Bacteria 8518
53 Ga0070682_100032918 3300005337 Bacteria 3146
54 Ga0070682_100135945 3300005337 Bacteria 1670
55 Ga0068868_100001505 3300005338 Bacteria 16028
56 Ga0068868_100018523 3300005338 Bacteria 5207
57 Ga0068868_100023843 3300005338 Bacteria 4635
58 Ga0068868_100025112 3300005338 Bacteria 4527
59 Ga0068868_100030623 3300005338 Bacteria 4126
60 Ga0068868_100057945 3300005338 Bacteria 3061
61 Ga0068868_100068950 3300005338 Bacteria 2817
62 Ga0068868_100158129 3300005338 Bacteria 1870
63 Ga0070660_100002927 3300005339 Bacteria 11748
64 Ga0070689_100008202 3300005340 Bacteria 7343
65 Ga0070689_100278355 3300005340 Unclassified 1387
66 Ga0070687_100059840 3300005343 Bacteria 2007
67 Ga0070661_100004876 3300005344 Bacteria 9239
68 Ga0070661_100016232 3300005344 Bacteria 5261
69 Ga0070661_100038658 3300005344 Bacteria 3475
70 Ga0070692_10084232 3300005345 Bacteria 1718
71 Ga0070692_10221863 3300005345 Bacteria 1118
72 Ga0070692_10285605 3300005345 Bacteria 1002
73 Ga0070692_10306795 3300005345 Bacteria 971
74 Ga0070692_10325146 3300005345 Bacteria 947
75 Ga0070668_100008545 3300005347 Bacteria 7604
76 Ga0070668_100009793 3300005347 Bacteria 7105
77 Ga0070668_100059917 3300005347 Bacteria 2947
78 Ga0070668_100276317 3300005347 Bacteria 1402
79 Ga0070669_100004924 3300005353 Bacteria 9646
80 Ga0070669_100006566 3300005353 Bacteria 8370
81 Ga0070669_100008631 3300005353 Bacteria 7270
82 Ga0070669_100135956 3300005353 Bacteria 1891
83 Ga0070669_100314157 3300005353 Bacteria 1264
84 Ga0070669_100494673 3300005353 Bacteria 1014
85 Ga0070675_100002720 3300005354 Bacteria 13284
86 Ga0070675_100257995 3300005354 Bacteria 1527
87 Ga0070675_100336998 3300005354 Bacteria 1335
88 Ga0070671_100027588 3300005355 Bacteria 4675
89 Ga0070671_100124043 3300005355 Bacteria 2174
90 Ga0070671_100210666 3300005355 Bacteria 1648
91 Ga0070671_100715019 3300005355 Bacteria 869
92 Ga0070673_100037931 3300005364 Bacteria 3676
93 Ga0070673_100109694 3300005364 Bacteria 2287
94 Ga0070673_100193292 3300005364 Bacteria 1749
95 Ga0070673_100281592 3300005364 Bacteria 1459
96 Ga0070673_100633224 3300005364 Bacteria 978
97 Ga0070688_100219098 3300005365 Unclassified 1340
98 Ga0070659_100006734 3300005366 Bacteria 8305
99 Ga0070659_100010812 3300005366 Bacteria 6730
100 Ga0070659_100018254 3300005366 Bacteria 5294
101 Ga0070659_100029013 3300005366 Bacteria 4275
102 Ga0070659_100281988 3300005366 Bacteria 1382
103 Ga0070667_100092243 3300005367 Bacteria 2605
104 Ga0070667_100239971 3300005367 Bacteria 1618
105 Ga0070703_10000128 3300005406 Bacteria 39400
106 Ga0070703_10005045 3300005406 Bacteria 3686
107 Ga0070703_10030848 3300005406 Bacteria 1618
108 Ga0070709_10018148 3300005434 Bacteria 4047
109 Ga0070709_10087551 3300005434 Bacteria 2047
110 Ga0070709_10158090 3300005434 Bacteria 1573
111 Ga0070709_10188917 3300005434 Bacteria 1452
112 Ga0070709_10206873 3300005434 Bacteria 1393
113 Ga0070714_100154683 3300005435 Bacteria 2069
114 Ga0070713_100001624 3300005436 Bacteria 14413
115 Ga0070713_100011353 3300005436 Bacteria 6485
116 Ga0070713_100095967 3300005436 Unclassified 2559
117 Ga0070713_100164403 3300005436 Bacteria 1983
118 Ga0070713_100328159 3300005436 Bacteria 1415
119 Ga0070713_100518391 3300005436 Bacteria 1126
120 Ga0070713_100665763 3300005436 Bacteria 992
121 Ga0070713_100860445 3300005436 Bacteria 871
122 Ga0070713_101109972 3300005436 Bacteria 764
123 Ga0070710_10095356 3300005437 Bacteria 1762
124 Ga0070710_10565889 3300005437 Bacteria 787
125 Ga0070701_10134409 3300005438 Bacteria 1408
126 Ga0070701_10159014 3300005438 Bacteria 1307
127 Ga0070701_10348263 3300005438 Bacteria 925
128 Ga0070711_100000802 3300005439 Bacteria 16444
129 Ga0070711_100067389 3300005439 Bacteria 2511
130 Ga0070711_100112976 3300005439 Bacteria 1997
131 Ga0070711_100115002 3300005439 Bacteria 1981
132 Ga0070711_100207960 3300005439 Bacteria 1514
133 Ga0070705_100137736 3300005440 Bacteria 1602
134 Ga0070705_100154851 3300005440 Bacteria 1525
135 Ga0070705_100236996 3300005440 Bacteria 1273
136 Ga0070705_100328786 3300005440 Bacteria 1106
137 Ga0070700_100000264 3300005441 Bacteria 28021
138 Ga0070700_100006788 3300005441 Bacteria 6137
139 Ga0070700_100018438 3300005441 Bacteria 4012
140 Ga0070700_100022274 3300005441 Bacteria 3692
141 Ga0070700_100062685 3300005441 Bacteria 2350
142 Ga0070700_100071749 3300005441 Bacteria 2212
143 Ga0070700_100330386 3300005441 Bacteria 1123
144 Ga0070694_100008254 3300005444 Bacteria 6369
145 Ga0070694_100008946 3300005444 Bacteria 6134
146 Ga0070694_100011642 3300005444 Bacteria 5447
147 Ga0070694_100055163 3300005444 Bacteria 2694
148 Ga0070694_100089741 3300005444 Bacteria 2154
149 Ga0070694_100156932 3300005444 Bacteria 1666
150 Ga0070694_100239131 3300005444 Bacteria 1369
151 Ga0070708_100000715 3300005445 Bacteria 25219
152 Ga0070708_100003240 3300005445 Bacteria 12700
153 Ga0070708_100006607 3300005445 Bacteria 9231
154 Ga0070708_100011368 3300005445 Bacteria 7240
155 Ga0070708_100013504 3300005445 Bacteria 6691
156 Ga0070708_100015142 3300005445 Bacteria 6360
157 Ga0070708_100021328 3300005445 Bacteria 5476
158 Ga0070708_100035750 3300005445 Bacteria 4330
159 Ga0070708_100055179 3300005445 Bacteria 3533
160 Ga0070708_100077917 3300005445 Bacteria 2996
161 Ga0070708_100080789 3300005445 Bacteria 2942
162 Ga0070708_100101352 3300005445 Bacteria 2637
163 Ga0070708_100115869 3300005445 Bacteria 2467
164 Ga0070708_100154442 3300005445 Bacteria 2136
165 Ga0070708_100234420 3300005445 Bacteria 1723
166 Ga0070663_100008038 3300005455 Bacteria 6467
167 Ga0070663_100150266 3300005455 Bacteria 1785
168 Ga0070663_100153744 3300005455 Bacteria 1766
169 Ga0070663_100742383 3300005455 Unclassified 837
170 Ga0070678_100037536 3300005456 Bacteria 3403
171 Ga0070678_100052688 3300005456 Bacteria 2956
172 Ga0070678_100215697 3300005456 Bacteria 1593
173 Ga0070678_100286349 3300005456 Bacteria 1395
174 Ga0070662_100045970 3300005457 Bacteria 3135
175 Ga0070662_100083318 3300005457 Bacteria 2387
176 Ga0070662_100156777 3300005457 Bacteria 1778
177 Ga0070662_100559838 3300005457 Bacteria 959
178 Ga0070681_10000182 3300005458 Bacteria 48293
179 Ga0070681_10000285 3300005458 Bacteria 40740
180 Ga0070681_10020377 3300005458 Bacteria 6646
181 Ga0070681_10028784 3300005458 Bacteria 5584
182 Ga0070681_10033936 3300005458 Bacteria 5123
183 Ga0070681_10088295 3300005458 Bacteria 3052
184 Ga0070681_10102689 3300005458 Bacteria 2804
185 Ga0070681_10216331 3300005458 Bacteria 1832
186 Ga0070681_10595864 3300005458 Bacteria 1019
187 Ga0068867_100003661 3300005459 Bacteria 10813
188 Ga0068867_100037163 3300005459 Bacteria 3539
189 Ga0068867_100137229 3300005459 Bacteria 1908
190 Ga0068867_100189432 3300005459 Unclassified 1641
191 Ga0068867_100332795 3300005459 Bacteria 1262
192 Ga0068867_100353313 3300005459 Bacteria 1227
193 Ga0070685_10017487 3300005466 Bacteria 3839
194 Ga0070685_10037392 3300005466 Bacteria 2749
195 Ga0070685_10044111 3300005466 Bacteria 2552
196 Ga0070706_100000023 3300005467 Bacteria 159966
197 Ga0070706_100014288 3300005467 Bacteria 7337
198 Ga0070706_100016887 3300005467 Bacteria 6742
199 Ga0070706_100018309 3300005467 Bacteria 6463
200 Ga0070706_100045829 3300005467 Unclassified 4037
201 Ga0070706_100066604 3300005467 Bacteria 3331
202 Ga0070706_100104851 3300005467 Bacteria 2630
203 Ga0070706_100115383 3300005467 Bacteria 2501
204 Ga0070706_100116795 3300005467 Bacteria 2485
205 Ga0070706_100121374 3300005467 Bacteria 2436
206 Ga0070706_100144304 3300005467 Bacteria 2223
207 Ga0070706_100156999 3300005467 Bacteria 2123
208 Ga0070706_100571222 3300005467 Bacteria 1051
209 Ga0070707_100000359 3300005468 Bacteria 44814
210 Ga0070707_100002913 3300005468 Bacteria 16246
211 Ga0070707_100014789 3300005468 Bacteria 7315
212 Ga0070707_100015729 3300005468 Bacteria 7103
213 Ga0070707_100016578 3300005468 Bacteria 6915
214 Ga0070707_100016924 3300005468 Bacteria 6849
215 Ga0070707_100024529 3300005468 Bacteria 5713
216 Ga0070707_100057727 3300005468 Bacteria 3724
217 Ga0070707_100093578 3300005468 Unclassified 2910
218 Ga0070707_100108531 3300005468 Bacteria 2692
219 Ga0070707_100109180 3300005468 Bacteria 2683
220 Ga0070707_100448775 3300005468 Bacteria 1250
221 Ga0070707_100544759 3300005468 Bacteria 1122
222 Ga0070707_100566301 3300005468 Bacteria 1098
223 Ga0070707_100796299 3300005468 Bacteria 909
224 Ga0070698_100000010 3300005471 Bacteria 117353
225 Ga0070698_100001116 3300005471 Bacteria 29622
226 Ga0070698_100001899 3300005471 Bacteria 23281
227 Ga0070698_100018496 3300005471 Bacteria 7337
228 Ga0070698_100019201 3300005471 Bacteria 7183
229 Ga0070698_100025809 3300005471 Bacteria 6123
230 Ga0070698_100027693 3300005471 Bacteria 5891
231 Ga0070698_100034303 3300005471 Bacteria 5254
232 Ga0070698_100065150 3300005471 Bacteria 3669
233 Ga0070698_100076560 3300005471 Bacteria 3347
234 Ga0070698_100115248 3300005471 Bacteria 2652
235 Ga0070698_100272191 3300005471 Bacteria 1625
236 Ga0070698_100438097 3300005471 Bacteria 1242
237 Ga0070698_100583919 3300005471 Bacteria 1057
238 Ga0070698_100780751 3300005471 Bacteria 899
239 Ga0070699_100007919 3300005518 Bacteria 9230
240 Ga0070699_100047752 3300005518 Bacteria 3704
241 Ga0070699_100063493 3300005518 Bacteria 3202
242 Ga0070699_100090074 3300005518 Bacteria 2681
243 Ga0070699_100122186 3300005518 Bacteria 2291
244 Ga0070699_100150737 3300005518 Bacteria 2056
245 Ga0070699_100206176 3300005518 Bacteria 1749
246 Ga0070699_100211838 3300005518 Bacteria 1725
247 Ga0070699_100274141 3300005518 Bacteria 1510
248 Ga0070699_100350452 3300005518 Bacteria 1330
249 Ga0070699_100401039 3300005518 Bacteria 1240
250 Ga0070699_100541605 3300005518 Bacteria 1059
251 Ga0070699_100571112 3300005518 Bacteria 1030
252 Ga0070679_100000348 3300005530 Bacteria 39245
253 Ga0070679_100016835 3300005530 Bacteria 7066
254 Ga0070679_100110471 3300005530 Bacteria 2735
255 Ga0070679_100322349 3300005530 Bacteria 1494
256 Ga0070684_100004868 3300005535 Bacteria 10257
257 Ga0070684_100114332 3300005535 Bacteria 2423
258 Ga0070697_100000231 3300005536 Bacteria 45307
259 Ga0070697_100000493 3300005536 Bacteria 29993
260 Ga0070697_100000512 3300005536 Bacteria 29346
261 Ga0070697_100001316 3300005536 Bacteria 18761
262 Ga0070697_100013677 3300005536 Bacteria 6368
263 Ga0070697_100016453 3300005536 Bacteria 5817
264 Ga0070697_100018179 3300005536 Bacteria 5541
265 Ga0070697_100028079 3300005536 Bacteria 4504
266 Ga0070697_100049782 3300005536 Bacteria 3400
267 Ga0070697_100062711 3300005536 Bacteria 3034
268 Ga0070697_100068883 3300005536 Bacteria 2897
269 Ga0070697_100104112 3300005536 Bacteria 2360
270 Ga0070697_100124987 3300005536 Bacteria 2154
271 Ga0070697_100156207 3300005536 Unclassified 1925
272 Ga0070697_100156570 3300005536 Bacteria 1923
273 Ga0070697_100159582 3300005536 Bacteria 1905
274 Ga0070697_100170342 3300005536 Bacteria 1843
275 Ga0070697_100172216 3300005536 Bacteria 1833
276 Ga0070697_100535994 3300005536 Bacteria 1026
277 Ga0070697_100711130 3300005536 Bacteria 887
278 Ga0070697_100857001 3300005536 Bacteria 805
279 Ga0068853_100008464 3300005539 Bacteria 8265
280 Ga0068853_100009149 3300005539 Bacteria 7978
281 Ga0068853_100136200 3300005539 Bacteria 2202
282 Ga0068853_100268733 3300005539 Bacteria 1570
283 Ga0070672_100008678 3300005543 Bacteria 6969
284 Ga0070672_100024316 3300005543 Bacteria 4475
285 Ga0070672_100304344 3300005543 Bacteria 1352
286 Ga0070686_100010598 3300005544 Bacteria 5204
287 Ga0070686_100037599 3300005544 Bacteria 3003
288 Ga0070686_100067677 3300005544 Bacteria 2328
289 Ga0070686_100155742 3300005544 Bacteria 1604
290 Ga0070686_100158817 3300005544 Bacteria 1590
291 Ga0070686_100180050 3300005544 Bacteria 1501
292 Ga0070686_100257160 3300005544 Bacteria 1278
293 Ga0070695_100004975 3300005545 Bacteria 7835
294 Ga0070695_100013827 3300005545 Bacteria 4856
295 Ga0070695_100030421 3300005545 Bacteria 3362
296 Ga0070695_100036040 3300005545 Bacteria 3112
297 Ga0070695_100076476 3300005545 Bacteria 2205
298 Ga0070695_100081897 3300005545 Bacteria 2136
299 Ga0070695_100120926 3300005545 Bacteria 1791
300 Ga0070695_100121834 3300005545 Bacteria 1785
301 Ga0070695_100179258 3300005545 Bacteria 1500
302 Ga0070695_100191144 3300005545 Bacteria 1457
303 Ga0070695_100281609 3300005545 Bacteria 1222
304 Ga0070695_100409554 3300005545 Bacteria 1030
305 Ga0070695_100463055 3300005545 Bacteria 974
306 Ga0070696_100002714 3300005546 Bacteria 11745
307 Ga0070696_100011204 3300005546 Bacteria 6002
308 Ga0070696_100038410 3300005546 Bacteria 3304
309 Ga0070696_100064212 3300005546 Bacteria 2572
310 Ga0070696_100078897 3300005546 Bacteria 2329
311 Ga0070696_100080082 3300005546 Bacteria 2312
312 Ga0070696_100142444 3300005546 Bacteria 1753
313 Ga0070696_100201820 3300005546 Bacteria 1485
314 Ga0070696_100245932 3300005546 Bacteria 1351
315 Ga0070696_100328264 3300005546 Bacteria 1179
316 Ga0070696_100330924 3300005546 Bacteria 1175
317 Ga0070696_100384256 3300005546 Bacteria 1095
318 Ga0070696_100493797 3300005546 Bacteria 973
319 Ga0070693_100000854 3300005547 Bacteria 13591
320 Ga0070693_100011704 3300005547 Bacteria 4423
321 Ga0070693_100017081 3300005547 Bacteria 3766
322 Ga0070693_100023234 3300005547 Bacteria 3311
323 Ga0070693_100054692 3300005547 Bacteria 2297
324 Ga0070693_100165125 3300005547 Bacteria 1413
325 Ga0070693_100209086 3300005547 Bacteria 1272
326 Ga0070693_100213963 3300005547 Bacteria 1259
327 Ga0070665_100001090 3300005548 Bacteria 33685
328 Ga0070665_100147039 3300005548 Bacteria 2359
329 Ga0070665_100445123 3300005548 Bacteria 1305
330 Ga0070704_100028948 3300005549 Bacteria 3692
331 Ga0070704_100064891 3300005549 Bacteria 2626
332 Ga0070704_100067426 3300005549 Bacteria 2584
333 Ga0070704_100264624 3300005549 Bacteria 1418
334 Ga0070704_100269754 3300005549 Unclassified 1405
335 Ga0070704_100307390 3300005549 Bacteria 1323
336 Ga0068855_100000603 3300005563 Bacteria 44012
337 Ga0068855_100002829 3300005563 Bacteria 21347
338 Ga0068855_100048495 3300005563 Bacteria 5012
339 Ga0068855_100223333 3300005563 Bacteria 2111
340 Ga0068855_100261262 3300005563 Bacteria 1928
341 Ga0068855_100734304 3300005563 Bacteria 1054
342 Ga0070664_100009593 3300005564 Bacteria 7852
343 Ga0070664_100009943 3300005564 Bacteria 7710
344 Ga0070664_100019016 3300005564 Bacteria 5648
345 Ga0070664_100023109 3300005564 Bacteria 5132
346 Ga0070664_100322886 3300005564 Bacteria 1399
347 Ga0070664_100343703 3300005564 Bacteria 1356
348 Ga0070664_100593440 3300005564 Bacteria 1027
349 Ga0070664_100772320 3300005564 Bacteria 898
350 Ga0068857_100002023 3300005577 Bacteria 16447
351 Ga0068857_100004405 3300005577 Bacteria 11902
352 Ga0068857_100013633 3300005577 Bacteria 7082
353 Ga0068857_100060506 3300005577 Bacteria 3364
354 Ga0068857_100091540 3300005577 Bacteria 2722
355 Ga0068857_100133644 3300005577 Bacteria 2239
356 Ga0068854_100007128 3300005578 Bacteria 7137
357 Ga0068854_100019968 3300005578 Bacteria 4523
358 Ga0068854_100025889 3300005578 Bacteria 4026
359 Ga0068854_100083895 3300005578 Bacteria 2356
360 Ga0068854_100093516 3300005578 Bacteria 2241
361 Ga0068854_100107166 3300005578 Bacteria 2103
362 Ga0068854_100129211 3300005578 Bacteria 1927
363 Ga0068856_100000859 3300005614 Bacteria 32657
364 Ga0068856_100006882 3300005614 Bacteria 11121
365 Ga0068856_100054561 3300005614 Bacteria 3942
366 Ga0068856_100070719 3300005614 Bacteria 3453
367 Ga0068856_100080505 3300005614 Bacteria 3230
368 Ga0068856_100128052 3300005614 Bacteria 2542
369 Ga0068856_100168099 3300005614 Bacteria 2204
370 Ga0068856_100239972 3300005614 Bacteria 1828
371 Ga0070702_100018517 3300005615 Bacteria 3615
372 Ga0070702_100038764 3300005615 Bacteria 2656
373 Ga0070702_100081516 3300005615 Unclassified 1939
374 Ga0070702_100118005 3300005615 Bacteria 1656
375 Ga0070702_100126506 3300005615 Bacteria 1608
376 Ga0070702_100466403 3300005615 Bacteria 919
377 Ga0068852_100011750 3300005616 Bacteria 6611
378 Ga0068852_100120902 3300005616 Bacteria 2397
379 Ga0068852_100207790 3300005616 Bacteria 1856
380 Ga0068852_100217594 3300005616 Bacteria 1815
381 Ga0068852_100222172 3300005616 Bacteria 1797
382 Ga0068859_100014366 3300005617 Bacteria 7943
383 Ga0068859_100019485 3300005617 Bacteria 6815
384 Ga0068859_100022936 3300005617 Bacteria 6259
385 Ga0068859_100040391 3300005617 Bacteria 4683
386 Ga0068859_100045082 3300005617 Bacteria 4431
387 Ga0068859_100046922 3300005617 Bacteria 4338
388 Ga0068859_100058628 3300005617 Bacteria 3878
389 Ga0068859_100063756 3300005617 Bacteria 3716
390 Ga0068859_100112693 3300005617 Bacteria 2783
391 Ga0068859_100242515 3300005617 Bacteria 1892
392 Ga0068859_100298946 3300005617 Bacteria 1703
393 Ga0068859_100638749 3300005617 Bacteria 1157
394 Ga0068864_100015016 3300005618 Bacteria 6437
395 Ga0068864_100022965 3300005618 Bacteria 5234
396 Ga0068864_100060980 3300005618 Bacteria 3266
397 Ga0068864_100074844 3300005618 Bacteria 2955
398 Ga0068864_100079700 3300005618 Bacteria 2868
399 Ga0068864_100138218 3300005618 Bacteria 2195
400 Ga0068864_100148116 3300005618 Bacteria 2124
401 Ga0068864_100158855 3300005618 Bacteria 2054
402 Ga0068864_100463657 3300005618 Bacteria 1213
403 Ga0068864_100610021 3300005618 Bacteria 1060
404 Ga0068866_10002818 3300005718 Bacteria 7160
405 Ga0068866_10026477 3300005718 Bacteria 2739
406 Ga0068861_100028832 3300005719 Bacteria 4053
407 Ga0068861_100057782 3300005719 Bacteria 2964
408 Ga0068861_100109346 3300005719 Bacteria 2213
409 Ga0068861_100119738 3300005719 Bacteria 2122
410 Ga0068861_100135753 3300005719 Bacteria 2002
411 Ga0068861_100169352 3300005719 Bacteria 1809
412 Ga0068861_100292680 3300005719 Bacteria 1407
413 Ga0068861_100650785 3300005719 Bacteria 973
414 Ga0068851_10001253 3300005834 Bacteria 11052
415 Ga0068851_10003656 3300005834 Bacteria 6865
416 Ga0068851_10009328 3300005834 Bacteria 4558
417 Ga0068851_10078723 3300005834 Bacteria 1718
418 Ga0068870_10314209 3300005840 Bacteria 993
419 Ga0068863_100002776 3300005841 Bacteria 17340
420 Ga0068863_100036461 3300005841 Bacteria 4684
421 Ga0068863_100045027 3300005841 Bacteria 4187
422 Ga0068863_100060166 3300005841 Bacteria 3592
423 Ga0068863_100107739 3300005841 Bacteria 2652
424 Ga0068863_100141911 3300005841 Bacteria 2296
425 Ga0068863_100144576 3300005841 Bacteria 2274
426 Ga0068863_100159832 3300005841 Bacteria 2158
427 Ga0068863_100187421 3300005841 Bacteria 1987
428 Ga0068863_100591086 3300005841 Bacteria 1098
429 Ga0068863_100723651 3300005841 Bacteria 990
430 Ga0068863_100751678 3300005841 Bacteria 971
431 Ga0068858_100001045 3300005842 Bacteria 28584
432 Ga0068858_100008341 3300005842 Bacteria 9970
433 Ga0068858_100016629 3300005842 Bacteria 6908
434 Ga0068858_100017625 3300005842 Bacteria 6694
435 Ga0068858_100031742 3300005842 Bacteria 4908
436 Ga0068858_100079803 3300005842 Bacteria 3040
437 Ga0068858_100093732 3300005842 Bacteria 2796
438 Ga0068858_100143568 3300005842 Bacteria 2242
439 Ga0068858_100315152 3300005842 Bacteria 1494
440 Ga0068858_100550207 3300005842 Unclassified 1117
441 Ga0068858_100735601 3300005842 Bacteria 961
442 Ga0068860_100008952 3300005843 Bacteria 9971
443 Ga0068860_100016241 3300005843 Bacteria 7258
444 Ga0068860_100020140 3300005843 Bacteria 6464
445 Ga0068860_100028605 3300005843 Bacteria 5366
446 Ga0068860_100055048 3300005843 Bacteria 3781
447 Ga0068860_100370768 3300005843 Bacteria 1412
448 Ga0068860_100505412 3300005843 Bacteria 1207
449 Ga0068862_100031830 3300005844 Bacteria 4455
450 Ga0068862_100050216 3300005844 Bacteria 3564
451 Ga0068862_100098708 3300005844 Bacteria 2551
452 Ga0068862_100160883 3300005844 Bacteria 2004
453 Ga0068862_100224261 3300005844 Bacteria 1703
454 Ga0068862_100813519 3300005844 Bacteria 913
455 Ga0081455_10183442 3300005937 Bacteria 1582
456 Ga0081539_10005776 3300005985 Bacteria 12336
457 Ga0070717_10001889 3300006028 Bacteria 14654
458 Ga0070717_10009585 3300006028 Bacteria 7284
459 Ga0070717_10012714 3300006028 Bacteria 6425
460 Ga0070717_10029726 3300006028 Bacteria 4387
461 Ga0070717_10042987 3300006028 Bacteria 3687
462 Ga0070717_10093948 3300006028 Bacteria 2536
463 Ga0070717_10116195 3300006028 Bacteria 2287
464 Ga0070717_10204177 3300006028 Bacteria 1732
465 Ga0070717_10243138 3300006028 Bacteria 1588
466 Ga0075432_10047823 3300006058 Bacteria 1504
467 Ga0070715_10000030 3300006163 Bacteria 88060
468 Ga0070715_10003144 3300006163 Bacteria 5194
469 Ga0070715_10232145 3300006163 Bacteria 955
470 Ga0070715_10423952 3300006163 Bacteria 745
471 Ga0070716_100001574 3300006173 Bacteria 10249
472 Ga0070716_100004264 3300006173 Bacteria 6811
473 Ga0070716_100018680 3300006173 Bacteria 3615
474 Ga0070716_100043757 3300006173 Bacteria 2505
475 Ga0070716_100070266 3300006173 Bacteria 2055
476 Ga0070716_100099030 3300006173 Bacteria 1783
477 Ga0070716_100243573 3300006173 Bacteria 1221
478 Ga0070716_100258290 3300006173 Bacteria 1191
479 Ga0070712_100000044 3300006175 Bacteria 66245
480 Ga0070712_100087332 3300006175 Bacteria 2275
481 Ga0070712_100144372 3300006175 Bacteria 1820
482 Ga0070712_100229839 3300006175 Bacteria 1472
483 Ga0097621_100000110 3300006237 Bacteria 46251
484 Ga0097621_100000799 3300006237 Bacteria 22174
485 Ga0097621_100004133 3300006237 Bacteria 10066
486 Ga0097621_100010677 3300006237 Bacteria 6729
487 Ga0097621_100017819 3300006237 Bacteria 5407
488 Ga0097621_100022380 3300006237 Bacteria 4906
489 Ga0097621_100024499 3300006237 Bacteria 4713
490 Ga0097621_100070105 3300006237 Bacteria 2894
491 Ga0097621_100139802 3300006237 Bacteria 2068
492 Ga0097621_100867377 3300006237 Bacteria 839
493 Ga0068871_100000095 3300006358 Bacteria 52396
494 Ga0068871_100000179 3300006358 Bacteria 43000
495 Ga0068871_100001333 3300006358 Bacteria 16531
496 Ga0068871_100001824 3300006358 Bacteria 14373
497 Ga0068871_100002061 3300006358 Bacteria 13623
498 Ga0068871_100017557 3300006358 Bacteria 5418
499 Ga0068871_100037795 3300006358 Bacteria 3852
500 Ga0068871_100047817 3300006358 Bacteria 3451
501 Ga0068871_100088349 3300006358 Bacteria 2579
502 Ga0068871_100273503 3300006358 Bacteria 1476
503 Ga0068871_100344205 3300006358 Bacteria 1317
504 Ga0068871_100376240 3300006358 Bacteria 1261
505 Ga0068871_100697905 3300006358 Bacteria 929
506 Ga0075428_100060878 3300006844 Bacteria 4134
507 Ga0075428_100327563 3300006844 Bacteria 1645
508 Ga0075428_100363559 3300006844 Bacteria 1552
509 Ga0075428_100555070 3300006844 Bacteria 1228
510 Ga0075428_100786582 3300006844 Bacteria 1012
511 Ga0075430_100010936 3300006846 Bacteria 7689
512 Ga0075430_100032237 3300006846 Bacteria 4449
513 Ga0075430_100176237 3300006846 Bacteria 1779
514 Ga0075430_100440027 3300006846 Bacteria 1076
515 Ga0075431_100074275 3300006847 Bacteria 3508
516 Ga0075431_100077941 3300006847 Bacteria 3420
517 Ga0075431_100287831 3300006847 Bacteria 1663
518 Ga0075431_100298125 3300006847 Bacteria 1629
519 Ga0075431_100773885 3300006847 Bacteria 934
520 Ga0075433_10007401 3300006852 Bacteria 8715
521 Ga0075433_10011084 3300006852 Bacteria 7251
522 Ga0075433_10035385 3300006852 Bacteria 4294
523 Ga0075433_10039871 3300006852 Bacteria 4062
524 Ga0075433_10043705 3300006852 Bacteria 3890
525 Ga0075433_10048421 3300006852 Bacteria 3695
526 Ga0075433_10154244 3300006852 Bacteria 2043
527 Ga0075433_10196945 3300006852 Bacteria 1792
528 Ga0075433_10363896 3300006852 Bacteria 1277
529 Ga0075434_100012224 3300006871 Bacteria 8134
530 Ga0075434_100012301 3300006871 Bacteria 8108
531 Ga0075434_100013214 3300006871 Bacteria 7847
532 Ga0075434_100015196 3300006871 Bacteria 7375
533 Ga0075434_100018130 3300006871 Bacteria 6794
534 Ga0075434_100031511 3300006871 Bacteria 5228
535 Ga0075434_100034364 3300006871 Bacteria 5006
536 Ga0075434_100053388 3300006871 Bacteria 4016
537 Ga0075434_100109139 3300006871 Bacteria 2777
538 Ga0075434_100144938 3300006871 Bacteria 2395
539 Ga0075434_100395584 3300006871 Bacteria 1403
540 Ga0075434_100396800 3300006871 Bacteria 1400
541 Ga0075434_100433542 3300006871 Bacteria 1335
542 Ga0075434_101212653 3300006871 Bacteria 766
543 Ga0075429_100035408 3300006880 Bacteria 4342
544 Ga0075429_100267597 3300006880 Bacteria 1497
545 Ga0075429_100357350 3300006880 Bacteria 1279
546 Ga0068865_100004716 3300006881 Bacteria 8234
547 Ga0068865_100013417 3300006881 Bacteria 5177
548 Ga0068865_100046614 3300006881 Bacteria 2974
549 Ga0068865_100105127 3300006881 Bacteria 2073
550 Ga0068865_100123542 3300006881 Bacteria 1929
551 Ga0068865_100180956 3300006881 Bacteria 1623
552 Ga0068865_100492886 3300006881 Bacteria 1020
553 Ga0068865_100694409 3300006881 Bacteria 869
554 Ga0068865_100802532 3300006881 Bacteria 812
555 Ga0075436_100000016 3300006914 Bacteria 167300
556 Ga0075436_100015841 3300006914 Bacteria 5161
557 Ga0075436_100024761 3300006914 Bacteria 4127
558 Ga0075436_100039293 3300006914 Bacteria 3266
559 Ga0075436_100148928 3300006914 Bacteria 1646
560 Ga0075436_100238466 3300006914 Bacteria 1293
561 Ga0075436_100337613 3300006914 Bacteria 1084
562 Ga0075436_100486821 3300006914 Bacteria 901
563 Ga0075436_100570491 3300006914 Bacteria 832
564 Ga0097620_100014367 3300006931 Bacteria 7943
565 Ga0097620_100019485 3300006931 Bacteria 6815
566 Ga0097620_100022940 3300006931 Bacteria 6259
567 Ga0097620_100040393 3300006931 Bacteria 4683
568 Ga0097620_100045083 3300006931 Bacteria 4431
569 Ga0097620_100046921 3300006931 Bacteria 4338
570 Ga0097620_100058629 3300006931 Bacteria 3878
571 Ga0097620_100063756 3300006931 Bacteria 3716
572 Ga0097620_100112701 3300006931 Bacteria 2783
573 Ga0097620_100242532 3300006931 Bacteria 1892
574 Ga0097620_100298926 3300006931 Bacteria 1703
575 Ga0097620_100638690 3300006931 Bacteria 1157
576 Ga0075435_100000338 3300007076 Bacteria 28823
577 Ga0075435_100001387 3300007076 Bacteria 15640
578 Ga0075435_100007411 3300007076 Bacteria 7814
579 Ga0075435_100014098 3300007076 Bacteria 5963
580 Ga0075435_100076051 3300007076 Bacteria 2751
581 Ga0075435_100076057 3300007076 Bacteria 2751
582 Ga0075435_100315033 3300007076 Bacteria 1339
583 Ga0075435_100387962 3300007076 Bacteria 1200
584 Ga0099794_10039545 3300007265 Bacteria 2239
585 Ga0099794_10053300 3300007265 Bacteria 1950
586 Ga0099794_10249620 3300007265 Bacteria 915
587 Ga0099795_10036803 3300007788 Bacteria 1719
588 Ga0105251_10111849 3300009011 Bacteria 1243
589 Ga0105240_10054913 3300009093 Bacteria 4989
590 Ga0105240_10070056 3300009093 Bacteria 4339
591 Ga0105240_10317413 3300009093 Bacteria 1777
592 Ga0111539_10005605 3300009094 Bacteria 16234
593 Ga0111539_10008723 3300009094 Bacteria 12862
594 Ga0111539_10039526 3300009094 Bacteria 5684
595 Ga0111539_10058001 3300009094 Bacteria 4595
596 Ga0111539_10065032 3300009094 Bacteria 4312
597 Ga0111539_10137517 3300009094 Bacteria 2861
598 Ga0111539_10642736 3300009094 Bacteria 1235
599 Ga0111539_10815430 3300009094 Bacteria 1086
600 Ga0105245_10005699 3300009098 Bacteria 10939
601 Ga0105245_10005818 3300009098 Bacteria 10822
602 Ga0105245_10033917 3300009098 Bacteria 4524
603 Ga0105245_10143890 3300009098 Bacteria 2248
604 Ga0105245_10158450 3300009098 Bacteria 2146
605 Ga0105245_10447279 3300009098 Bacteria 1300
606 Ga0105247_10000003 3300009101 Bacteria 694517
607 Ga0105247_10003978 3300009101 Bacteria 9513
608 Ga0105247_10119597 3300009101 Bacteria 1705
609 Ga0105247_10151626 3300009101 Bacteria 1528
610 Ga0105247_10221040 3300009101 Bacteria 1282
611 Ga0114129_10003333 3300009147 Bacteria 22577
612 Ga0114129_10026237 3300009147 Bacteria 8252
613 Ga0114129_10035650 3300009147 Bacteria 7028
614 Ga0114129_10042482 3300009147 Bacteria 6402
615 Ga0114129_10125128 3300009147 Bacteria 3535
616 Ga0114129_10148398 3300009147 Bacteria 3211
617 Ga0114129_10215384 3300009147 Bacteria 2594
618 Ga0114129_10240153 3300009147 Bacteria 2435
619 Ga0114129_10327037 3300009147 Bacteria 2037
620 Ga0114129_10335986 3300009147 Bacteria 2005
621 Ga0114129_10370086 3300009147 Bacteria 1894
622 Ga0114129_10479064 3300009147 Bacteria 1628
623 Ga0114129_10656864 3300009147 Bacteria 1353
624 Ga0114129_10665340 3300009147 Bacteria 1342
625 Ga0114129_11255491 3300009147 Bacteria 920
626 Ga0105243_10001017 3300009148 Bacteria 25946
627 Ga0105243_10001623 3300009148 Bacteria 19565
628 Ga0105243_10031851 3300009148 Bacteria 4068
629 Ga0105243_10095386 3300009148 Bacteria 2458
630 Ga0105243_10171063 3300009148 Bacteria 1881
631 Ga0105243_10522532 3300009148 Bacteria 1129
632 Ga0105243_11062656 3300009148 Bacteria 816
633 Ga0105241_10011232 3300009174 Bacteria 6566
634 Ga0105241_10020081 3300009174 Bacteria 4935
635 Ga0105241_10045071 3300009174 Bacteria 3344
636 Ga0105241_10287741 3300009174 Bacteria 1406
637 Ga0105241_10295445 3300009174 Bacteria 1388
638 Ga0105241_10368730 3300009174 Bacteria 1251
639 Ga0105242_10004591 3300009176 Bacteria 10708
640 Ga0105242_10004959 3300009176 Bacteria 10299
641 Ga0105242_10042621 3300009176 Bacteria 3666
642 Ga0105242_10084217 3300009176 Bacteria 2664
643 Ga0105242_10092458 3300009176 Bacteria 2548
644 Ga0105242_10116265 3300009176 Bacteria 2288
645 Ga0105242_10233855 3300009176 Bacteria 1648
646 Ga0105242_10245701 3300009176 Bacteria 1611
647 Ga0105242_10247731 3300009176 Bacteria 1604
648 Ga0105248_10004304 3300009177 Bacteria 15751
649 Ga0105248_10013845 3300009177 Bacteria 8873
650 Ga0105248_10015241 3300009177 Bacteria 8473
651 Ga0105248_10017846 3300009177 Bacteria 7832
652 Ga0105248_10028453 3300009177 Bacteria 6226
653 Ga0105248_10049267 3300009177 Bacteria 4724
654 Ga0105248_10072083 3300009177 Bacteria 3882
655 Ga0105248_10090746 3300009177 Unclassified 3441
656 Ga0105248_10096225 3300009177 Bacteria 3335
657 Ga0105248_10239696 3300009177 Bacteria 2041
658 Ga0105248_10294011 3300009177 Bacteria 1829
659 Ga0105248_11093526 3300009177 Bacteria 901
660 Ga0105237_10007450 3300009545 Bacteria 11975
661 Ga0105237_10030647 3300009545 Bacteria 5462
662 Ga0105237_10039275 3300009545 Bacteria 4779
663 Ga0105237_10069980 3300009545 Bacteria 3504
664 Ga0105237_10075970 3300009545 Bacteria 3350
665 Ga0105237_10293887 3300009545 Bacteria 1627
666 Ga0105238_10000057 3300009551 Bacteria 134757
667 Ga0105238_10014415 3300009551 Bacteria 7990
668 Ga0105238_10085055 3300009551 Bacteria 3152
669 Ga0105238_10096972 3300009551 Bacteria 2934
670 Ga0105238_10226771 3300009551 Bacteria 1845
671 Ga0105238_10305596 3300009551 Bacteria 1575
672 Ga0105249_10014285 3300009553 Bacteria 7022
673 Ga0105249_10055733 3300009553 Bacteria 3618
674 Ga0105249_10108318 3300009553 Bacteria 2623
675 Ga0105249_10131992 3300009553 Bacteria 2385
676 Ga0105249_10566848 3300009553 Bacteria 1188
677 Ga0105249_10688881 3300009553 Bacteria 1081
678 Ga0105249_11001868 3300009553 Bacteria 904
679 Ga0099796_10012563 3300010159 Bacteria 2395
680 Ga0099796_10020260 3300010159 Bacteria 2030
681 Ga0105239_10011785 3300010375 Bacteria 9758
682 Ga0105239_10013320 3300010375 Bacteria 9137
683 Ga0105239_10013519 3300010375 Bacteria 9062
684 Ga0105239_10015435 3300010375 Bacteria 8460
685 Ga0105239_10026134 3300010375 Bacteria 6426
686 Ga0105239_10105008 3300010375 Bacteria 3128
687 Ga0105239_10122436 3300010375 Bacteria 2890
688 Ga0105239_10130113 3300010375 Bacteria 2799
689 Ga0105239_10227650 3300010375 Bacteria 2092
690 Ga0105239_10600608 3300010375 Bacteria 1255
691 Ga0105239_10710756 3300010375 Bacteria 1149
692 Ga0105246_10004521 3300011119 Bacteria 8460
693 Ga0105246_10535204 3300011119 Bacteria 1001
694 Ga0157373_10009538 3300013100 Bacteria 7165
695 Ga0157373_10045613 3300013100 Bacteria 3128
696 Ga0157373_10112120 3300013100 Bacteria 1917
697 Ga0157373_10206925 3300013100 Bacteria 1383
698 Ga0157373_10227812 3300013100 Bacteria 1316
699 Ga0157373_10232273 3300013100 Bacteria 1303
700 Ga0157371_10003920 3300013102 Bacteria 13236
701 Ga0157371_10004155 3300013102 Bacteria 12760
702 Ga0157371_10006746 3300013102 Bacteria 9387
703 Ga0157371_10206415 3300013102 Bacteria 1409
704 Ga0157369_10001318 3300013105 Bacteria 30822
705 Ga0157369_10047308 3300013105 Bacteria 4672
706 Ga0157369_10061052 3300013105 Bacteria 4064
707 Ga0157369_10205928 3300013105 Bacteria 2063
708 Ga0157369_10756103 3300013105 Bacteria 1000
709 Ga0157374_10000094 3300013296 Bacteria 83875
710 Ga0157374_10000218 3300013296 Bacteria 52826
711 Ga0157374_10008962 3300013296 Bacteria 8575
712 Ga0157374_10009681 3300013296 Bacteria 8276
713 Ga0157374_10036210 3300013296 Bacteria 4519
714 Ga0157374_10117634 3300013296 Bacteria 2562
715 Ga0157374_10137800 3300013296 Bacteria 2367
716 Ga0157374_10187830 3300013296 Bacteria 2021
717 Ga0157374_10194877 3300013296 Bacteria 1983
718 Ga0157374_10278421 3300013296 Bacteria 1651
719 Ga0157374_10485121 3300013296 Bacteria 1239
720 Ga0157374_10525068 3300013296 Bacteria 1190
721 Ga0157378_10000028 3300013297 Bacteria 128346
722 Ga0157378_10000059 3300013297 Bacteria 95905
723 Ga0157378_10000660 3300013297 Bacteria 32524
724 Ga0157378_10001487 3300013297 Bacteria 21167
725 Ga0157378_10012197 3300013297 Bacteria 7528
726 Ga0157378_10019547 3300013297 Bacteria 5955
727 Ga0157378_10030173 3300013297 Bacteria 4790
728 Ga0157378_10039356 3300013297 Bacteria 4194
729 Ga0157378_10041448 3300013297 Bacteria 4084
730 Ga0157378_10093119 3300013297 Bacteria 2743
731 Ga0157378_10138876 3300013297 Bacteria 2255
732 Ga0157378_10143230 3300013297 Bacteria 2221
733 Ga0157378_10191100 3300013297 Bacteria 1931
734 Ga0157378_10210121 3300013297 Bacteria 1845
735 Ga0157378_10218513 3300013297 Bacteria 1811
736 Ga0157378_10251674 3300013297 Bacteria 1692
737 Ga0157378_10327960 3300013297 Bacteria 1489
738 Ga0157378_10329929 3300013297 Bacteria 1485
739 Ga0157378_10820515 3300013297 Bacteria 957
740 Ga0163162_10000147 3300013306 Bacteria 64948
741 Ga0163162_10001573 3300013306 Bacteria 21327
742 Ga0163162_10004857 3300013306 Bacteria 12973
743 Ga0163162_10009091 3300013306 Bacteria 9659
744 Ga0163162_10027759 3300013306 Bacteria 5598
745 Ga0163162_10058457 3300013306 Bacteria 3885
746 Ga0163162_10106827 3300013306 Bacteria 2894
747 Ga0163162_10206909 3300013306 Bacteria 2091
748 Ga0163162_10728490 3300013306 Bacteria 1112
749 Ga0163162_11301330 3300013306 Bacteria 826
750 Ga0157372_10000679 3300013307 Bacteria 37412
751 Ga0157372_10000736 3300013307 Bacteria 35691
752 Ga0157372_10003980 3300013307 Bacteria 15870
753 Ga0157372_10013069 3300013307 Bacteria 8856
754 Ga0157372_10071799 3300013307 Bacteria 3900
755 Ga0157372_10159954 3300013307 Bacteria 2602
756 Ga0157372_10283541 3300013307 Bacteria 1926
757 Ga0157372_10724869 3300013307 Bacteria 1156
758 Ga0157372_10904862 3300013307 Bacteria 1024
759 Ga0157375_10002987 3300013308 Bacteria 14691
760 Ga0157375_10033040 3300013308 Bacteria 4912
761 Ga0157375_10035155 3300013308 Bacteria 4780
762 Ga0157375_10069493 3300013308 Bacteria 3528
763 Ga0157375_10224387 3300013308 Bacteria 2038
764 Ga0157375_10279606 3300013308 Bacteria 1832
765 Ga0157375_10463006 3300013308 Bacteria 1433
766 Ga0157375_11062900 3300013308 Bacteria 946
767 Ga0163163_10018820 3300014325 Bacteria 6475
768 Ga0163163_10023437 3300014325 Bacteria 5859
769 Ga0163163_10146336 3300014325 Bacteria 2407
770 Ga0163163_10172022 3300014325 Bacteria 2213
771 Ga0163163_10230998 3300014325 Bacteria 1899
772 Ga0163163_10567764 3300014325 Bacteria 1197
773 Ga0163163_10648524 3300014325 Bacteria 1119
774 Ga0163163_11100970 3300014325 Bacteria 857
775 Ga0157380_10013428 3300014326 Bacteria 5971
776 Ga0157380_10044190 3300014326 Bacteria 3490
777 Ga0157380_10095518 3300014326 Bacteria 2463
778 Ga0157380_10354419 3300014326 Bacteria 1374
779 Ga0182008_10042067 3300014497 Bacteria 2277
780 Ga0157377_10001949 3300014745 Bacteria 9026
781 Ga0157377_10009963 3300014745 Bacteria 4687
782 Ga0157379_10003382 3300014968 Bacteria 13502
783 Ga0157379_10007448 3300014968 Bacteria 9475
784 Ga0157379_10017596 3300014968 Bacteria 6292
785 Ga0157379_10044069 3300014968 Bacteria 3984
786 Ga0157379_10095001 3300014968 Bacteria 2675
787 Ga0157379_10119789 3300014968 Bacteria 2367
788 Ga0157376_10000010 3300014969 Bacteria 311693
789 Ga0157376_10002726 3300014969 Bacteria 12040
790 Ga0157376_10009165 3300014969 Bacteria 7179
791 Ga0157376_10010018 3300014969 Bacteria 6914
792 Ga0157376_10010882 3300014969 Bacteria 6680
793 Ga0157376_10015244 3300014969 Bacteria 5800
794 Ga0157376_10021027 3300014969 Bacteria 5062
795 Ga0157376_10032306 3300014969 Bacteria 4201
796 Ga0157376_10054330 3300014969 Bacteria 3338
797 Ga0182005_1005871 3300015265 Bacteria 3803
798 Ga0163161_10004485 3300017792 Bacteria 9717
799 Ga0163161_10058354 3300017792 Bacteria 2806
800 Ga0213872_10002569 3300021361 Bacteria 10580
801 Ga0213872_10018718 3300021361 Bacteria 3192
802 Ga0213872_10043965 3300021361 Bacteria 2034
803 Ga0213872_10067608 3300021361 Bacteria 1612
804 Ga0213875_10067715 3300021388 Bacteria 1668
805 Ga0213871_10001017 3300021441 Bacteria 4404
806 Ga0213871_10012862 3300021441 Bacteria 1954
807 Ga0228598_1000016 3300024227 Bacteria 23615
808 Ga0228598_1005001 3300024227 Bacteria 2787
809 Ga0207672_1000052 3300025223 Bacteria 15428
810 Ga0207697_10003483 3300025315 Bacteria 7770
811 Ga0207697_10068354 3300025315 Bacteria 1486
812 Ga0207656_10002208 3300025321 Bacteria 6520
813 Ga0207656_10026433 3300025321 Bacteria 2366
814 Ga0207656_10059851 3300025321 Bacteria 1668
815 Ga0207653_10000019 3300025885 Bacteria 138019
816 Ga0207653_10001726 3300025885 Bacteria 6981
817 Ga0207653_10010775 3300025885 Bacteria 2852
818 Ga0207692_10082654 3300025898 Bacteria 1721
819 Ga0207642_10001161 3300025899 Bacteria 8124
820 Ga0207642_10122002 3300025899 Bacteria 1346
821 Ga0207710_10000001 3300025900 Bacteria 1797433
822 Ga0207710_10014739 3300025900 Bacteria 3300
823 Ga0207710_10115431 3300025900 Bacteria 1278
824 Ga0207688_10087321 3300025901 Bacteria 1788
825 Ga0207688_10222072 3300025901 Bacteria 1138
826 Ga0207680_10005969 3300025903 Bacteria 5851
827 Ga0207680_10017559 3300025903 Bacteria 3783
828 Ga0207680_10111773 3300025903 Bacteria 1773
829 Ga0207647_10000659 3300025904 Bacteria 26975
830 Ga0207647_10003313 3300025904 Bacteria 12095
831 Ga0207647_10010726 3300025904 Bacteria 6454
832 Ga0207647_10133936 3300025904 Bacteria 1455
833 Ga0207647_10176315 3300025904 Bacteria 1243
834 Ga0207647_10260097 3300025904 Bacteria 994
835 Ga0207685_10000009 3300025905 Bacteria 242842
836 Ga0207685_10155226 3300025905 Bacteria 1040
837 Ga0207699_10017682 3300025906 Bacteria 3761
838 Ga0207699_10089677 3300025906 Bacteria 1928
839 Ga0207699_10194263 3300025906 Bacteria 1371
840 Ga0207645_10004308 3300025907 Bacteria 10557
841 Ga0207643_10004919 3300025908 Bacteria 7144
842 Ga0207643_10192061 3300025908 Bacteria 1240
843 Ga0207643_10368009 3300025908 Bacteria 904
844 Ga0207705_10236393 3300025909 Bacteria 1391
845 Ga0207684_10000146 3300025910 Bacteria 125829
846 Ga0207684_10000445 3300025910 Bacteria 54460
847 Ga0207684_10002533 3300025910 Bacteria 18367
848 Ga0207684_10003671 3300025910 Bacteria 14896
849 Ga0207684_10020822 3300025910 Bacteria 5603
850 Ga0207684_10022812 3300025910 Bacteria 5344
851 Ga0207684_10041725 3300025910 Bacteria 3889
852 Ga0207684_10047581 3300025910 Bacteria 3637
853 Ga0207684_10070972 3300025910 Bacteria 2960
854 Ga0207684_10111961 3300025910 Bacteria 2336
855 Ga0207684_10113379 3300025910 Bacteria 2321
856 Ga0207684_10114478 3300025910 Bacteria 2309
857 Ga0207684_10130246 3300025910 Bacteria 2159
858 Ga0207684_10166231 3300025910 Bacteria 1901
859 Ga0207684_10216389 3300025910 Bacteria 1653
860 Ga0207684_10476446 3300025910 Bacteria 1071
861 Ga0207684_10496702 3300025910 Bacteria 1046
862 Ga0207654_10009567 3300025911 Bacteria 4927
863 Ga0207654_10022867 3300025911 Bacteria 3341
864 Ga0207654_10052146 3300025911 Bacteria 2357
865 Ga0207654_10055559 3300025911 Bacteria 2293
866 Ga0207654_10064481 3300025911 Bacteria 2154
867 Ga0207707_10000004 3300025912 Bacteria 391281
868 Ga0207707_10000673 3300025912 Bacteria 33856
869 Ga0207707_10007101 3300025912 Bacteria 9758
870 Ga0207707_10023892 3300025912 Bacteria 5345
871 Ga0207707_10040622 3300025912 Bacteria 4063
872 Ga0207707_10106503 3300025912 Bacteria 2451
873 Ga0207707_10360711 3300025912 Bacteria 1251
874 Ga0207707_10381044 3300025912 Bacteria 1212
875 Ga0207695_10053584 3300025913 Bacteria 4218
876 Ga0207695_10222483 3300025913 Bacteria 1794
877 Ga0207695_10304724 3300025913 Bacteria 1484
878 Ga0207671_10002213 3300025914 Bacteria 21097
879 Ga0207671_10083713 3300025914 Bacteria 2395
880 Ga0207671_10088118 3300025914 Bacteria 2335
881 Ga0207671_10190526 3300025914 Bacteria 1599
882 Ga0207671_10208486 3300025914 Bacteria 1528
883 Ga0207693_10000230 3300025915 Bacteria 51238
884 Ga0207693_10019599 3300025915 Bacteria 5379
885 Ga0207693_10052392 3300025915 Bacteria 3201
886 Ga0207693_10109077 3300025915 Bacteria 2171
887 Ga0207693_10150577 3300025915 Bacteria 1830
888 Ga0207693_10493484 3300025915 Bacteria 956
889 Ga0207663_10002820 3300025916 Bacteria 8387
890 Ga0207663_10035994 3300025916 Bacteria 2974
891 Ga0207663_10082817 3300025916 Bacteria 2106
892 Ga0207663_10100820 3300025916 Bacteria 1939
893 Ga0207663_10127329 3300025916 Bacteria 1754
894 Ga0207663_10206167 3300025916 Bacteria 1422
895 Ga0207663_10275053 3300025916 Bacteria 1249
896 Ga0207663_10298439 3300025916 Bacteria 1203
897 Ga0207663_10558548 3300025916 Bacteria 895
898 Ga0207660_10004602 3300025917 Bacteria 8988
899 Ga0207660_10023082 3300025917 Bacteria 4197
900 Ga0207660_10079013 3300025917 Bacteria 2412
901 Ga0207660_10172848 3300025917 Bacteria 1673
902 Ga0207660_10182091 3300025917 Bacteria 1632
903 Ga0207660_10578087 3300025917 Bacteria 914
904 Ga0207662_10011852 3300025918 Bacteria 4846
905 Ga0207662_10021705 3300025918 Bacteria 3673
906 Ga0207662_10101195 3300025918 Bacteria 1785
907 Ga0207662_10110776 3300025918 Bacteria 1711
908 Ga0207662_10220449 3300025918 Bacteria 1235
909 Ga0207657_10003001 3300025919 Bacteria 18081
910 Ga0207657_10005454 3300025919 Bacteria 13280
911 Ga0207657_10016288 3300025919 Bacteria 7174
912 Ga0207657_10362120 3300025919 Bacteria 1143
913 Ga0207649_10000368 3300025920 Bacteria 33617
914 Ga0207649_10023259 3300025920 Bacteria 3587
915 Ga0207652_10000330 3300025921 Bacteria 49046
916 Ga0207652_10060491 3300025921 Bacteria 3268
917 Ga0207652_10107490 3300025921 Bacteria 2471
918 Ga0207646_10000651 3300025922 Bacteria 44822
919 Ga0207646_10002173 3300025922 Bacteria 23409
920 Ga0207646_10002290 3300025922 Bacteria 22746
921 Ga0207646_10005487 3300025922 Bacteria 13333
922 Ga0207646_10006026 3300025922 Bacteria 12629
923 Ga0207646_10012131 3300025922 Bacteria 8295
924 Ga0207646_10096340 3300025922 Bacteria 2651
925 Ga0207646_10099182 3300025922 Bacteria 2611
926 Ga0207646_10112669 3300025922 Bacteria 2442
927 Ga0207646_10149503 3300025922 Bacteria 2106
928 Ga0207646_10219665 3300025922 Bacteria 1717
929 Ga0207646_10234654 3300025922 Bacteria 1657
930 Ga0207646_10281779 3300025922 Bacteria 1502
931 Ga0207646_10316607 3300025922 Bacteria 1410
932 Ga0207646_10596537 3300025922 Bacteria 992
933 Ga0207646_10722827 3300025922 Bacteria 890
934 Ga0207646_10742489 3300025922 Bacteria 876
935 Ga0207646_10793631 3300025922 Bacteria 843
936 Ga0207681_10020258 3300025923 Bacteria 4211
937 Ga0207681_10034865 3300025923 Bacteria 3312
938 Ga0207681_10424449 3300025923 Bacteria 1078
939 Ga0207694_10001387 3300025924 Bacteria 20814
940 Ga0207694_10208501 3300025924 Bacteria 1591
941 Ga0207694_10472418 3300025924 Bacteria 1048
942 Ga0207650_10000042 3300025925 Bacteria 191592
943 Ga0207659_10008333 3300025926 Bacteria 6428
944 Ga0207659_10066762 3300025926 Bacteria 2611
945 Ga0207659_10146942 3300025926 Bacteria 1837
946 Ga0207659_10172618 3300025926 Bacteria 1707
947 Ga0207687_10001106 3300025927 Bacteria 18319
948 Ga0207687_10005532 3300025927 Bacteria 8355
949 Ga0207687_10007448 3300025927 Bacteria 7206
950 Ga0207687_10091278 3300025927 Bacteria 2221
951 Ga0207687_10268248 3300025927 Bacteria 1363
952 Ga0207700_10010190 3300025928 Bacteria 5913
953 Ga0207700_10059185 3300025928 Unclassified 2897
954 Ga0207700_10073583 3300025928 Bacteria 2639
955 Ga0207700_10085585 3300025928 Unclassified 2475
956 Ga0207700_10104965 3300025928 Bacteria 2262
957 Ga0207700_10339251 3300025928 Bacteria 1306
958 Ga0207700_10653318 3300025928 Bacteria 938
959 Ga0207664_10161356 3300025929 Bacteria 1912
960 Ga0207644_10024922 3300025931 Bacteria 4110
961 Ga0207644_10094313 3300025931 Bacteria 2235
962 Ga0207690_10015996 3300025932 Bacteria 4559
963 Ga0207690_10199607 3300025932 Bacteria 1518
964 Ga0207690_10244600 3300025932 Bacteria 1383
965 Ga0207706_10000938 3300025933 Bacteria 29806
966 Ga0207706_10001110 3300025933 Bacteria 27396
967 Ga0207706_10016398 3300025933 Bacteria 6690
968 Ga0207706_10032553 3300025933 Bacteria 4642
969 Ga0207706_10054474 3300025933 Bacteria 3530
970 Ga0207706_10298681 3300025933 Bacteria 1403
971 Ga0207706_10424762 3300025933 Bacteria 1151
972 Ga0207686_10001639 3300025934 Bacteria 12495
973 Ga0207686_10023949 3300025934 Bacteria 3530
974 Ga0207686_10100027 3300025934 Bacteria 1934
975 Ga0207686_10154540 3300025934 Bacteria 1601
976 Ga0207686_10177920 3300025934 Bacteria 1506
977 Ga0207686_10286310 3300025934 Bacteria 1218
978 Ga0207686_10537125 3300025934 Unclassified 912
979 Ga0207709_10000738 3300025935 Bacteria 25942
980 Ga0207709_10154206 3300025935 Bacteria 1594
981 Ga0207709_10353634 3300025935 Bacteria 1110
982 Ga0207709_10853942 3300025935 Bacteria 738
983 Ga0207670_10022310 3300025936 Bacteria 3921
984 Ga0207670_10031135 3300025936 Bacteria 3414
985 Ga0207670_10111404 3300025936 Bacteria 1973
986 Ga0207670_10212268 3300025936 Unclassified 1477
987 Ga0207669_10210078 3300025937 Bacteria 1420
988 Ga0207704_10008002 3300025938 Bacteria 5028
989 Ga0207704_10009498 3300025938 Bacteria 4696
990 Ga0207704_10010698 3300025938 Bacteria 4486
991 Ga0207704_10052096 3300025938 Bacteria 2479
992 Ga0207704_10058603 3300025938 Bacteria 2372
993 Ga0207704_10245218 3300025938 Bacteria 1341
994 Ga0207704_10669002 3300025938 Bacteria 857
995 Ga0207665_10003009 3300025939 Bacteria 11311
996 Ga0207665_10005483 3300025939 Bacteria 8467
997 Ga0207665_10026402 3300025939 Bacteria 3833
998 Ga0207665_10035816 3300025939 Bacteria 3296
999 Ga0207665_10060811 3300025939 Bacteria 2559
1000 Ga0207665_10087669 3300025939 Bacteria 2151
1001 Ga0207665_10117436 3300025939 Bacteria 1876
1002 Ga0207665_10162831 3300025939 Bacteria 1606
1003 Ga0207665_10352973 3300025939 Bacteria 1110
1004 Ga0207691_10025764 3300025940 Bacteria 5520
1005 Ga0207691_10026770 3300025940 Bacteria 5411
1006 Ga0207691_10311787 3300025940 Unclassified 1350
1007 Ga0207711_10007119 3300025941 Bacteria 9373
1008 Ga0207711_10010907 3300025941 Bacteria 7552
1009 Ga0207711_10024755 3300025941 Bacteria 5035
1010 Ga0207711_10059589 3300025941 Unclassified 3287
1011 Ga0207711_10160288 3300025941 Bacteria 2036
1012 Ga0207711_10340521 3300025941 Bacteria 1388
1013 Ga0207711_10445987 3300025941 Bacteria 1204
1014 Ga0207689_10004136 3300025942 Bacteria 13186
1015 Ga0207689_10007507 3300025942 Bacteria 9559
1016 Ga0207689_10009397 3300025942 Bacteria 8445
1017 Ga0207689_10015780 3300025942 Bacteria 6395
1018 Ga0207689_10069609 3300025942 Bacteria 2891
1019 Ga0207689_10095765 3300025942 Bacteria 2438
1020 Ga0207689_10127145 3300025942 Bacteria 2096
1021 Ga0207689_10212185 3300025942 Bacteria 1600
1022 Ga0207689_10282738 3300025942 Bacteria 1374
1023 Ga0207661_10000672 3300025944 Bacteria 22163
1024 Ga0207661_10039690 3300025944 Bacteria 3697
1025 Ga0207661_10842649 3300025944 Bacteria 844
1026 Ga0207679_10000989 3300025945 Bacteria 18241
1027 Ga0207679_10055021 3300025945 Bacteria 2932
1028 Ga0207679_10067818 3300025945 Bacteria 2678
1029 Ga0207667_10002030 3300025949 Bacteria 25360
1030 Ga0207667_10004332 3300025949 Bacteria 17375
1031 Ga0207667_10022254 3300025949 Bacteria 7006
1032 Ga0207667_10039376 3300025949 Bacteria 5038
1033 Ga0207651_10170473 3300025960 Bacteria 1716
1034 Ga0207651_10205259 3300025960 Bacteria 1582
1035 Ga0207651_10366171 3300025960 Bacteria 1218
1036 Ga0207651_10518324 3300025960 Bacteria 1033
1037 Ga0207712_10012463 3300025961 Bacteria 5433
1038 Ga0207712_10235348 3300025961 Bacteria 1473
1039 Ga0207712_10437979 3300025961 Bacteria 1106
1040 Ga0207712_10574730 3300025961 Bacteria 972
1041 Ga0207668_10017078 3300025972 Bacteria 4540
1042 Ga0207668_10033899 3300025972 Bacteria 3386
1043 Ga0207668_10355097 3300025972 Bacteria 1227
1044 Ga0207640_10003825 3300025981 Bacteria 8120
1045 Ga0207640_10055113 3300025981 Bacteria 2602
1046 Ga0207640_10077493 3300025981 Bacteria 2260
1047 Ga0207640_10087344 3300025981 Bacteria 2149
1048 Ga0207640_10170622 3300025981 Bacteria 1621
1049 Ga0207640_10194017 3300025981 Bacteria 1533
1050 Ga0207658_10026521 3300025986 Bacteria 4062
1051 Ga0207658_10280737 3300025986 Bacteria 1427
1052 Ga0207677_10002750 3300026023 Bacteria 9281
1053 Ga0207677_10003546 3300026023 Bacteria 8269
1054 Ga0207677_10037087 3300026023 Bacteria 3183
1055 Ga0207677_10081946 3300026023 Bacteria 2317
1056 Ga0207677_10270723 3300026023 Bacteria 1389
1057 Ga0207677_10280250 3300026023 Bacteria 1368
1058 Ga0207677_10462252 3300026023 Bacteria 1090
1059 Ga0207703_10001746 3300026035 Bacteria 19447
1060 Ga0207703_10008166 3300026035 Bacteria 8271
1061 Ga0207703_10013006 3300026035 Bacteria 6485
1062 Ga0207703_10015319 3300026035 Bacteria 5980
1063 Ga0207703_10071399 3300026035 Bacteria 2868
1064 Ga0207703_10186728 3300026035 Bacteria 1833
1065 Ga0207703_10256575 3300026035 Unclassified 1579
1066 Ga0207703_10286664 3300026035 Bacteria 1497
1067 Ga0207703_10572935 3300026035 Bacteria 1066
1068 Ga0207703_10906583 3300026035 Bacteria 844
1069 Ga0207639_10056720 3300026041 Bacteria 3003
1070 Ga0207639_10059613 3300026041 Bacteria 2941
1071 Ga0207639_10228386 3300026041 Bacteria 1612
1072 Ga0207639_11019921 3300026041 Bacteria 775
1073 Ga0207678_10001163 3300026067 Bacteria 24104
1074 Ga0207678_10021484 3300026067 Bacteria 5659
1075 Ga0207678_10169934 3300026067 Bacteria 1861
1076 Ga0207708_10000591 3300026075 Bacteria 27979
1077 Ga0207708_10007596 3300026075 Bacteria 8023
1078 Ga0207708_10009934 3300026075 Bacteria 7064
1079 Ga0207708_10013694 3300026075 Bacteria 6061
1080 Ga0207708_10022168 3300026075 Bacteria 4796
1081 Ga0207708_10114899 3300026075 Bacteria 2093
1082 Ga0207708_10153749 3300026075 Bacteria 1813
1083 Ga0207708_10257676 3300026075 Bacteria 1407
1084 Ga0207708_10630547 3300026075 Bacteria 911
1085 Ga0207702_10001368 3300026078 Bacteria 24297
1086 Ga0207702_10006408 3300026078 Bacteria 10152
1087 Ga0207702_10179796 3300026078 Bacteria 1947
1088 Ga0207702_10204553 3300026078 Bacteria 1832
1089 Ga0207702_10211725 3300026078 Bacteria 1802
1090 Ga0207702_10242295 3300026078 Bacteria 1690
1091 Ga0207702_10411917 3300026078 Bacteria 1305
1092 Ga0207641_10001156 3300026088 Bacteria 26503
1093 Ga0207641_10008612 3300026088 Bacteria 8420
1094 Ga0207641_10027191 3300026088 Bacteria 4724
1095 Ga0207641_10033569 3300026088 Bacteria 4263
1096 Ga0207641_10057371 3300026088 Bacteria 3311
1097 Ga0207641_10066019 3300026088 Bacteria 3097
1098 Ga0207641_10130728 3300026088 Bacteria 2254
1099 Ga0207641_10222739 3300026088 Bacteria 1750
1100 Ga0207641_10256459 3300026088 Bacteria 1635
1101 Ga0207641_10259527 3300026088 Bacteria 1626
1102 Ga0207641_10321789 3300026088 Bacteria 1467
1103 Ga0207641_10372116 3300026088 Bacteria 1366
1104 Ga0207641_10423733 3300026088 Bacteria 1282
1105 Ga0207648_10005527 3300026089 Bacteria 12739
1106 Ga0207648_10005955 3300026089 Bacteria 12200
1107 Ga0207648_10023043 3300026089 Bacteria 5585
1108 Ga0207648_10130027 3300026089 Bacteria 2216
1109 Ga0207648_10331587 3300026089 Bacteria 1369
1110 Ga0207648_10897288 3300026089 Bacteria 828
1111 Ga0207676_10015142 3300026095 Bacteria 5562
1112 Ga0207676_10016616 3300026095 Bacteria 5329
1113 Ga0207676_10024369 3300026095 Bacteria 4477
1114 Ga0207676_10042967 3300026095 Bacteria 3477
1115 Ga0207676_10059251 3300026095 Bacteria 3023
1116 Ga0207676_10079091 3300026095 Bacteria 2665
1117 Ga0207676_10294130 3300026095 Bacteria 1480
1118 Ga0207676_10700490 3300026095 Bacteria 981
1119 Ga0207674_10002642 3300026116 Bacteria 22397
1120 Ga0207674_10011157 3300026116 Bacteria 10102
1121 Ga0207674_10014083 3300026116 Bacteria 8835
1122 Ga0207674_10032433 3300026116 Bacteria 5479
1123 Ga0207674_10037486 3300026116 Bacteria 5042
1124 Ga0207674_10319491 3300026116 Bacteria 1502
1125 Ga0207674_10527124 3300026116 Bacteria 1141
1126 Ga0207674_10850883 3300026116 Bacteria 879
1127 Ga0207674_11183014 3300026116 Bacteria 734
1128 Ga0207675_100003366 3300026118 Bacteria 15626
1129 Ga0207675_100021393 3300026118 Bacteria 6025
1130 Ga0207675_100031575 3300026118 Bacteria 4934
1131 Ga0207675_100037312 3300026118 Bacteria 4534
1132 Ga0207675_100053045 3300026118 Bacteria 3784
1133 Ga0207675_100060968 3300026118 Bacteria 3522
1134 Ga0207675_100241806 3300026118 Bacteria 1744
1135 Ga0207675_100466995 3300026118 Bacteria 1252
1136 Ga0207675_100777768 3300026118 Bacteria 970
1137 Ga0207683_10008274 3300026121 Bacteria 8896
1138 Ga0207683_10031496 3300026121 Bacteria 4603
1139 Ga0207683_10059195 3300026121 Bacteria 3365
1140 Ga0207698_10018984 3300026142 Bacteria 4695
1141 Ga0207698_10035965 3300026142 Bacteria 3629
1142 Ga0207698_10128165 3300026142 Bacteria 2163
1143 Ga0207698_10435295 3300026142 Bacteria 1262
1144 Ga0207698_10799628 3300026142 Bacteria 945
1145 Ga0209971_1028654 3300027682 Bacteria 1333
1146 Ga0207428_10003633 3300027907 Bacteria 14870
1147 Ga0207428_10023613 3300027907 Bacteria 5168
1148 Ga0207428_10092643 3300027907 Bacteria 2345
1149 Ga0207428_10145855 3300027907 Bacteria 1804
1150 Ga0207428_10275193 3300027907 Bacteria 1251
1151 Ga0268266_10000141 3300028379 Bacteria 138510
1152 Ga0268266_10016476 3300028379 Bacteria 6318
1153 Ga0268266_10034705 3300028379 Bacteria 4290
1154 Ga0268266_10184399 3300028379 Bacteria 1902
1155 Ga0268266_10422991 3300028379 Bacteria 1263
1156 Ga0268265_10023265 3300028380 Bacteria 4367
1157 Ga0268265_10034878 3300028380 Bacteria 3671
1158 Ga0268265_10047085 3300028380 Bacteria 3228
1159 Ga0268265_10139514 3300028380 Bacteria 2028
1160 Ga0268265_10536521 3300028380 Bacteria 1108
1161 Ga0268264_10013891 3300028381 Bacteria 6620
1162 Ga0268264_10020404 3300028381 Bacteria 5416
1163 Ga0268264_10038327 3300028381 Bacteria 3955
1164 Ga0268264_10043325 3300028381 Bacteria 3729
1165 Ga0268264_10082187 3300028381 Unclassified 2756
1166 Ga0268264_10184968 3300028381 Bacteria 1895
1167 Ga0268264_10194962 3300028381 Bacteria 1849
1168 Ga0268264_10577660 3300028381 Bacteria 1105
1169 Ga0265762_1002197 3300030760 Bacteria 3534
1170 Ga0265760_10010444 3300031090 Bacteria 2651
1171 Ga0265760_10019644 3300031090 Bacteria 1947
1172 Ga0307408_100339298 3300031548 Bacteria 1271
1173 Ga0307408_100435313 3300031548 Bacteria 1134
1174 Ga0307408_100493482 3300031548 Bacteria 1070
1175 Ga0307405_10049234 3300031731 Bacteria 2603
1176 Ga0307405_10183576 3300031731 Bacteria 1504
1177 Ga0307413_10301257 3300031824 Bacteria 1216
1178 Ga0307410_10036291 3300031852 Bacteria 3209
1179 Ga0307410_10113502 3300031852 Bacteria 1964
1180 Ga0307406_10032478 3300031901 Bacteria 3187
1181 Ga0307406_10068314 3300031901 Bacteria 2320
1182 Ga0307406_10332234 3300031901 Bacteria 1180
1183 Ga0307407_10076472 3300031903 Bacteria 2010
1184 Ga0307407_10281750 3300031903 Bacteria 1152
1185 Ga0307409_100668235 3300031995 Bacteria 1035
1186 Ga0307409_100754112 3300031995 Bacteria 977
1187 Ga0307416_100027725 3300032002 Bacteria 4200
1188 Ga0307416_100261954 3300032002 Bacteria 1690
1189 Ga0307416_100387636 3300032002 Bacteria 1430
1190 Ga0307416_100434633 3300032002 Bacteria 1361
1191 Ga0307414_10055378 3300032004 Bacteria 2776
1192 Ga0307414_10427643 3300032004 Bacteria 1156
1193 Ga0307411_10185985 3300032005 Bacteria 1581
1194 Ga0307415_100038555 3300032126 Bacteria 3150
1195 Ga0307415_100457167 3300032126 Bacteria 1105
1196 Ga0316593_10032707 3300032168 Bacteria 1700
1197 Ga0373958_0066373 3300034819 Bacteria 792
1198 Ga0373934_0000303 3300035086 Bacteria 17350
1199 Ga0373951_0063079 3300035091 Bacteria 931
1200 Ga0373936_0007666 3300035113 Bacteria 4054
1201 Ga0373939_0039554 3300035114 Bacteria 1412
1202 Ga0373953_0007065 3300035117 Bacteria 3738
1203 Ga0373954_0000123 3300035118 Bacteria 26172
1204 Ga0373956_0002972 3300035119 Bacteria 6864
1205 Ga0373957_0003740 3300035120 Bacteria 4553
1206 Ga0373955_0000328 3300035172 Bacteria 19745
1207 Ga0373962_0038019 3300035242 Bacteria 1346
1208 Ga0373931_0020003 3300035691 Bacteria 3346
1209 Ga0373931_0029346 3300035691 Bacteria 2823
1210 Ga0373931_0208824 3300035691 Bacteria 1170
1211 Ga0373931_0234454 3300035691 Bacteria 1110
1212 Ga0373927_0296861 3300035695 Bacteria 1063
1213 Ga0373927_0380583 3300035695 Bacteria 931
1214 Ga0373933_0001026 3300035724 Bacteria 16986
1215 Ga0373937_0002671 3300036401 Bacteria 14863
1216 Ga0373925_0107372 3300037068 Bacteria 2153
1217 Ga0373925_0120765 3300037068 Bacteria 2034
1218 Ga0395900_0048108 3300037418 Bacteria 4393
1219 Ga0395900_0123313 3300037418 Bacteria 2658
1220 Ga0395900_0550226 3300037418 Bacteria 1099
1221 Ga0395898_0058704 3300037466 Bacteria 3745
1222 Ga0395898_0186007 3300037466 Bacteria 1985
1223 Ga0395898_0535313 3300037466 Bacteria 1113
1224 Ga0395898_0759149 3300037466 Bacteria 911
1225 Ga0395905_0001854 3300037471 Bacteria 24357
1226 Ga0395905_0005241 3300037471 Bacteria 13267
1227 Ga0395905_0020578 3300037471 Bacteria 6247
1228 Ga0395905_0027989 3300037471 Bacteria 5314
1229 Ga0395905_0098421 3300037471 Bacteria 2747
1230 Ga0395905_0129986 3300037471 Bacteria 2369
1231 Ga0395905_0241266 3300037471 Bacteria 1689
1232 Ga0395905_0833437 3300037471 Bacteria 825
1233 Ga0436364_1092140 3300037853 Bacteria 2516
1234 Ga0436364_1445510 3300037853 Bacteria 1502
1235 Ga0395901_0079113 3300038443 Bacteria 3433
1236 Ga0395901_0518235 3300038443 Bacteria 1212
1237 Ga0242420_013587 3300038996 Bacteria 1389
1238 Ga0436360_1106412 3300039438 Bacteria 5322
1239 Ga0436360_1213990 3300039438 Bacteria 7244
1240 Ga0436361_0012325 3300039447 Bacteria 2088
1241 Ga0436361_0174660 3300039447 Bacteria 5976
1242 Ga0436361_0199066 3300039447 Bacteria 8065
1243 Ga0436361_1052230 3300039447 Bacteria 5614
1244 Ga0436363_0068179 3300039450 Bacteria 1024
1245 Ga0436363_0487536 3300039450 Bacteria 1034
1246 Ga0436363_1712977 3300039450 Bacteria 870
1247 Ga0436362_0328001 3300039453 Bacteria 1370
1248 Ga0436362_0356003 3300039453 Bacteria 1184
1249 Ga0439458_0004179 3300042157 Bacteria 3334
1250 Ga0439435_0032724 3300042436 Bacteria 1420
1251 Ga0439464_0094932 3300042439 Bacteria 902
1252 Ga0439460_0014373 3300042461 Bacteria 2081
1253 Ga0439460_0066188 3300042461 Bacteria 1111
1254 Ga0451577_0045301 3300042876 Bacteria 3938
1255 Ga0453683_0058841 3300044673 Bacteria 2403
1256 Ga0453683_0078796 3300044673 Bacteria 2063
1257 Ga0453683_0078962 3300044673 Bacteria 2061
1258 Ga0453683_0424731 3300044673 Bacteria 858
1259 Ga0453684_0081894 3300044712 Bacteria 4023
1260 Ga0451576_0320146 3300045051 Bacteria 1623
1261 Ga0451576_0986948 3300045051 Bacteria 883
1262 Ga0451576_1056516 3300045051 Bacteria 850
1263 Ga0466967_0001003 3300045976 Bacteria 15411
1264 Ga0466967_0496716 3300045976 Bacteria 1197
1265 Ga0495592_0042054 3300046454 Bacteria 3423
1266 Ga0495592_0233931 3300046454 Bacteria 1222
1267 Ga0495603_0064247 3300046455 Bacteria 2164
1268 Ga0495629_0006399 3300046459 Bacteria 8735
1269 Ga0495629_0151201 3300046459 Bacteria 1613
1270 Ga0495641_0168454 3300046461 Bacteria 980
1271 Ga0495653_0156099 3300046463 Bacteria 1589
1272 Ga0495580_0004639 3300046472 Bacteria 11536
1273 Ga0495580_0012852 3300046472 Bacteria 6416
1274 Ga0495580_0031791 3300046472 Bacteria 3812
1275 Ga0495580_0033089 3300046472 Bacteria 3726
1276 Ga0495580_0067424 3300046472 Bacteria 2504
1277 Ga0495580_0090882 3300046472 Bacteria 2125
1278 Ga0495580_0122419 3300046472 Bacteria 1806
1279 Ga0495580_0130935 3300046472 Bacteria 1740
1280 Ga0495582_0000263 3300046473 Bacteria 29269
1281 Ga0495639_0009972 3300046475 Bacteria 4082
1282 Ga0495662_0046855 3300046476 Bacteria 2087
1283 Ga0495664_0313585 3300046477 Bacteria 946
1284 Ga0495594_0002748 3300046499 Bacteria 9133
1285 Ga0495594_0048667 3300046499 Bacteria 2329
1286 Ga0495608_0045052 3300046511 Bacteria 2942
1287 Ga0495618_0100309 3300046514 Bacteria 1853
1288 Ga0495628_0122177 3300046516 Bacteria 1997
1289 Ga0495628_0149103 3300046516 Bacteria 1782
1290 Ga0495628_0244329 3300046516 Bacteria 1342
1291 Ga0495630_0040876 3300046517 Bacteria 3464
1292 Ga0495644_0000107 3300046523 Bacteria 39644
1293 Ga0495586_0125362 3300046535 Bacteria 1436
1294 Ga0495587_0013626 3300046536 Bacteria 5108
1295 Ga0495587_0018550 3300046536 Bacteria 4315
1296 Ga0495598_0093882 3300046537 Bacteria 983
1297 Ga0495609_0037073 3300046538 Bacteria 2200
1298 Ga0495609_0161257 3300046538 Bacteria 950
1299 Ga0495645_0010551 3300046543 Bacteria 6482
1300 Ga0495645_0014220 3300046543 Bacteria 5644
1301 Ga0495645_0025932 3300046543 Bacteria 4255
1302 Ga0495633_0077826 3300046558 Bacteria 1544
1303 Ga0495667_0438907 3300046559 Bacteria 821
1304 Ga0495656_0037449 3300046615 Bacteria 2004
1305 Ga0495668_0100685 3300046616 Bacteria 1581
1306 Ga0495611_0205392 3300046648 Bacteria 918
1307 Ga0495635_0028522 3300046663 Bacteria 3881
1308 Ga0495659_0022579 3300046664 Bacteria 2131
1309 Ga0495657_0129330 3300046675 Bacteria 1583
1310 Ga0495599_0064848 3300046678 Bacteria 2282
1311 Ga0495623_0019185 3300046679 Bacteria 4420
1312 Ga0495623_0062165 3300046679 Bacteria 2341
1313 Ga0495646_0095033 3300046680 Bacteria 1716
1314 Ga0495658_0063521 3300046683 Bacteria 2125
1315 Ga0495658_0205574 3300046683 Bacteria 1228
1316 Ga0495613_0016729 3300046689 Bacteria 5461
1317 Ga0495613_0049686 3300046689 Bacteria 3094
1318 Ga0495624_0076111 3300046690 Bacteria 2083
1319 Ga0495670_0015726 3300046691 Bacteria 3720
1320 Ga0495600_0186430 3300046809 Bacteria 1336
1321 Ga0495581_0042871 3300047315 Bacteria 2618
1322 Ga0495581_0068020 3300047315 Bacteria 2060
1323 Ga0495604_0000257 3300047317 Bacteria 47142
1324 Ga0495604_0124506 3300047317 Bacteria 1861
1325 Ga0495604_0137029 3300047317 Bacteria 1753
1326 Ga0495636_0099553 3300047318 Bacteria 1270
1327 Ga0495636_0108831 3300047318 Bacteria 1218
1328 Ga0495674_0105779 3300047319 Bacteria 2390
1329 Ga0495674_0146391 3300047319 Bacteria 1983
1330 Ga0495684_0001093 3300047471 Bacteria 21862
1331 Ga0495602_0019910 3300048088 Bacteria 6645
1332 Ga0495602_0083896 3300048088 Bacteria 2667
1333 Ga0496100_0022352 3300048903 Bacteria 3828
1334 Ga0496100_0054881 3300048903 Bacteria 2601
1335 Ga0496100_0089322 3300048903 Bacteria 2099
1336 Ga0496100_0112731 3300048903 Bacteria 1892
1337 Ga0496100_0200005 3300048903 Bacteria 1456
1338 Ga0496100_0319413 3300048903 Bacteria 1166
1339 Ga0496101_0593230 3300048904 Bacteria 876
1340 Ga0496102_0002465 3300048905 Bacteria 15784
1341 Ga0496102_0013029 3300048905 Bacteria 7198
1342 Ga0496102_0016939 3300048905 Bacteria 6378
1343 Ga0496102_0020275 3300048905 Bacteria 5875
1344 Ga0496102_0197370 3300048905 Bacteria 1897
1345 Ga0496102_0201655 3300048905 Bacteria 1875
1346 Ga0496102_0816766 3300048905 Bacteria 854
1347 Ga0496103_0001456 3300048906 Bacteria 15851
1348 Ga0496103_0104563 3300048906 Bacteria 1795
1349 Ga0496103_0142652 3300048906 Bacteria 1533
1350 Ga0496103_0174966 3300048906 Bacteria 1379
1351 Ga0496104_0083096 3300048907 Bacteria 3054
1352 Ga0496104_0141975 3300048907 Bacteria 2307
1353 Ga0496104_0161069 3300048907 Bacteria 2152
1354 Ga0496104_0399945 3300048907 Bacteria 1286
1355 Ga0496104_0691798 3300048907 Bacteria 927
1356 Ga0496105_0085000 3300048908 Bacteria 2614
1357 Ga0496105_0160811 3300048908 Bacteria 1844
1358 Ga0496105_0639053 3300048908 Bacteria 822
1359 Ga0496106_0010481 3300048909 Bacteria 6845
1360 Ga0496106_0032911 3300048909 Bacteria 3866
1361 Ga0496106_0049064 3300048909 Bacteria 3179
1362 Ga0496106_0076785 3300048909 Bacteria 2561
1363 Ga0496106_0080108 3300048909 Bacteria 2508
1364 Ga0496106_0177853 3300048909 Bacteria 1688
1365 Ga0496106_0285691 3300048909 Bacteria 1322
1366 Ga0496106_0402096 3300048909 Bacteria 1101
1367 Ga0496107_0017792 3300048910 Bacteria 5001
1368 Ga0496107_0088258 3300048910 Bacteria 2264
1369 Ga0496107_0186794 3300048910 Bacteria 1539
1370 Ga0496108_0006733 3300048911 Bacteria 9306
1371 Ga0496108_0125394 3300048911 Bacteria 2204
1372 Ga0496108_0460389 3300048911 Bacteria 1111
1373 Ga0496109_0000059 3300048912 Bacteria 118169
1374 Ga0496109_0105213 3300048912 Bacteria 2621
1375 Ga0496109_0185492 3300048912 Bacteria 1955
1376 Ga0496109_0427598 3300048912 Bacteria 1251
1377 Ga0496109_0480578 3300048912 Bacteria 1173
1378 Ga0496109_0728138 3300048912 Bacteria 930
1379 Ga0496110_0036756 3300048913 Bacteria 4254
1380 Ga0496110_0073486 3300048913 Bacteria 3034
1381 Ga0496110_0202319 3300048913 Bacteria 1805
1382 Ga0496110_0616299 3300048913 Bacteria 984
1383 Ga0496111_0022510 3300048914 Bacteria 4413
1384 Ga0496111_0039880 3300048914 Bacteria 3369
1385 Ga0496112_0000504 3300048915 Bacteria 26451
1386 Ga0496112_0005614 3300048915 Bacteria 10883
1387 Ga0496112_0012267 3300048915 Bacteria 7870
1388 Ga0496112_0013951 3300048915 Bacteria 7435
1389 Ga0496112_0015086 3300048915 Bacteria 7196
1390 Ga0496112_0017208 3300048915 Bacteria 6788
1391 Ga0496112_0034367 3300048915 Bacteria 4934
1392 Ga0496112_0103018 3300048915 Bacteria 2824
1393 Ga0496112_0463458 3300048915 Bacteria 1205
1394 Ga0496113_0001118 3300048916 Bacteria 14549
1395 Ga0496113_0054448 3300048916 Bacteria 2995
1396 Ga0496113_0188540 3300048916 Bacteria 1636
1397 Ga0496113_0239517 3300048916 Bacteria 1447
1398 Ga0496113_0295005 3300048916 Bacteria 1298
1399 Ga0496114_0005623 3300048917 Bacteria 9835
1400 Ga0496114_0190975 3300048917 Bacteria 1792
1401 Ga0496114_0651229 3300048917 Bacteria 926
1402 Ga0496115_0003064 3300048918 Bacteria 12002
1403 Ga0496115_0042212 3300048918 Bacteria 3633
1404 Ga0496115_0046392 3300048918 Bacteria 3472
1405 Ga0496115_0088019 3300048918 Bacteria 2535
1406 Ga0496115_0101318 3300048918 Bacteria 2361
1407 Ga0496119_0108139 3300048922 Bacteria 1549
1408 Ga0496126_0000004 3300048929 Bacteria 925026
1409 Ga0496126_0008266 3300048929 Bacteria 11238
1410 Ga0496126_0324927 3300048929 Bacteria 1264
1411 Ga0501290_015709 3300049513 Bacteria 1004
1412 Ga0501291_001069 3300049514 Bacteria 3159
1413 Ga0501292_008782 3300049515 Bacteria 1486
1414 Ga0501292_010478 3300049515 Bacteria 1388
1415 Ga0501295_073770 3300049518 Bacteria 766
1416 Ga0501296_000316 3300049519 Bacteria 4954
1417 Ga0501296_002073 3300049519 Bacteria 2061
1418 Ga0501297_004371 3300049520 Bacteria 1443
1419 Ga0501298_000322 3300049521 Bacteria 6368
1420 Ga0501298_053081 3300049521 Bacteria 844
1421 Ga0501299_004588 3300049522 Bacteria 2075
1422 Ga0501300_012384 3300049523 Bacteria 1243
1423 Ga0501036_0019851 3300049572 Bacteria 5643
1424 Ga0501038_0046743 3300049574 Bacteria 3752
1425 Ga0501039_0079635 3300049575 Bacteria 2549
1426 Ga0501039_0237490 3300049575 Bacteria 1433
1427 Ga0501041_0051805 3300049577 Bacteria 2502
1428 Ga0501041_0125877 3300049577 Bacteria 1595
1429 Ga0501041_0236781 3300049577 Bacteria 1147
1430 Ga0501042_0377511 3300049578 Bacteria 1026
1431 Ga0501042_0412775 3300049578 Bacteria 978
1432 Ga0501048_0250428 3300049582 Bacteria 1257
1433 Ga0501071_0034574 3300049587 Bacteria 3598
1434 Ga0501071_0105571 3300049587 Bacteria 2080
1435 Ga0501071_0782415 3300049587 Bacteria 735
1436 Ga0501072_0015815 3300049588 Bacteria 5785
1437 Ga0501072_0297284 3300049588 Bacteria 1283
1438 Ga0501072_0317224 3300049588 Bacteria 1239
1439 Ga0501074_0153511 3300049590 Bacteria 1646
1440 Ga0501074_0188870 3300049590 Bacteria 1469
1441 Ga0501074_0309705 3300049590 Bacteria 1122
1442 Ga0501075_0010529 3300049591 Bacteria 6501
1443 Ga0501075_0013547 3300049591 Bacteria 5822
1444 Ga0501075_0184098 3300049591 Bacteria 1593
1445 Ga0501075_0513851 3300049591 Bacteria 914
1446 Ga0501076_0019578 3300049592 Bacteria 5175
1447 Ga0501076_0063903 3300049592 Bacteria 2933
1448 Ga0501202_001611 3300049652 Bacteria 3648
1449 Ga0501202_001857 3300049652 Bacteria 3468
1450 Ga0501202_004746 3300049652 Bacteria 2386
1451 Ga0501207_004661 3300049654 Bacteria 1874
1452 Ga0501207_036712 3300049654 Bacteria 841
1453 Ga0501208_008965 3300049655 Bacteria 1367
1454 Ga0501216_001320 3300049660 Bacteria 3321
1455 Ga0501216_002632 3300049660 Bacteria 2564
1456 Ga0501216_004153 3300049660 Bacteria 2141
1457 Ga0501217_000959 3300049661 Bacteria 5182
1458 Ga0501217_013085 3300049661 Bacteria 1857
1459 Ga0501223_007267 3300049663 Bacteria 2271
1460 Ga0501224_017737 3300049664 Bacteria 1058
1461 Ga0501224_019262 3300049664 Bacteria 1016
1462 Ga0501227_050285 3300049665 Bacteria 1050
1463 Ga0501230_065998 3300049667 Bacteria 739
1464 Ga0501233_012213 3300049668 Bacteria 1719
1465 Ga0501233_028876 3300049668 Bacteria 1241
1466 Ga0501235_000791 3300049669 Bacteria 6449
1467 Ga0501235_014968 3300049669 Bacteria 1709
1468 Ga0501236_002221 3300049670 Bacteria 2223
1469 Ga0501238_010637 3300049671 Bacteria 1230
1470 Ga0501240_031937 3300049673 Bacteria 845
1471 Ga0501243_006858 3300049675 Bacteria 1733
1472 Ga0501248_011107 3300049678 Bacteria 809
1473 Ga0501249_012515 3300049679 Bacteria 1794
1474 Ga0501255_035757 3300049684 Bacteria 710
1475 Ga0501256_009016 3300049685 Bacteria 937
1476 Ga0501257_002272 3300049686 Bacteria 4033
1477 Ga0501259_014178 3300049688 Bacteria 1348
1478 Ga0501260_002503 3300049689 Bacteria 1592
1479 Ga0501221_002209 3300049704 Bacteria 3234
1480 Ga0501221_017076 3300049704 Bacteria 1381
1481 Ga0501225_0002723 3300049705 Bacteria 5425
1482 Ga0501225_0007510 3300049705 Bacteria 3158
1483 Ga0501229_002679 3300049706 Bacteria 2104
1484 Ga0501234_001188 3300049707 Bacteria 4103
1485 Ga0501234_010971 3300049707 Bacteria 1414
1486 Ga0501245_004341 3300049708 Bacteria 1943
1487 Ga0501245_008321 3300049708 Bacteria 1477
1488 Ga0501245_009125 3300049708 Bacteria 1420
1489 Ga0501245_010677 3300049708 Bacteria 1329
1490 Ga0501079_0145334 3300049741 Bacteria 1848
1491 Ga0501081_0005880 3300049743 Bacteria 7941
1492 Ga0501081_0240449 3300049743 Bacteria 1320
1493 Ga0501083_0107286 3300049744 Bacteria 1838
1494 Ga0501263_010518 3300049760 Bacteria 1136
1495 Ga0501271_007129 3300049768 Bacteria 1121
1496 Ga0501272_010296 3300049769 Bacteria 1044
1497 Ga0501283_000216 3300049779 Bacteria 7657
1498 Ga0501035_0391676 3300049822 Bacteria 1157
1499 Ga0501035_0458549 3300049822 Bacteria 1054
1500 Ga0501045_0014761 3300049824 Bacteria 5539
1501 Ga0501045_0018088 3300049824 Bacteria 5008
1502 Ga0501045_0073045 3300049824 Bacteria 2526
1503 Ga0501045_0227091 3300049824 Bacteria 1390
1504 Ga0501045_0501377 3300049824 Bacteria 901
1505 Ga0501212_004175 3300049851 Bacteria 1850
1506 Ga0501212_009697 3300049851 Bacteria 1361
1507 Ga0501226_000317 3300049853 Bacteria 7113
1508 nmdc:mga05p37_105952_c1 3300050507 Bacteria 3458
1509 nmdc:mga05p37_174642_c1 3300050507 Bacteria 2618
1510 nmdc:mga05p37_195573_c1 3300050507 Bacteria 2452
1511 nmdc:mga05p37_214225_c1 3300050507 Unclassified 2327
1512 nmdc:mga05p37_2300_c1 3300050507 Bacteria 22281
1513 nmdc:mga05p37_242687_c1 3300050507 Bacteria 2165
1514 nmdc:mga05p37_288707_c1 3300050507 Bacteria 1953
1515 nmdc:mga05p37_30451_c1 3300050507 Bacteria 6585
1516 nmdc:mga05p37_348380_c1 3300050507 Bacteria 1744
1517 nmdc:mga05p37_410807_c1 3300050507 Bacteria 1578
1518 nmdc:mga05p37_464835_c1 3300050507 Bacteria 1461
1519 nmdc:mga05p37_578888_c1 3300050507 Bacteria 1272
1520 nmdc:mga05p37_635507_c1 3300050507 Bacteria 1198
1521 nmdc:mga05p37_676_c3 3300050507 Bacteria 29757
1522 nmdc:mga05p37_68918_c1 3300050507 Bacteria 4350
1523 nmdc:mga05p37_74269_c1 3300050507 Bacteria 4185
1524 nmdc:mga05p37_76064_c1 3300050507 Bacteria 4133
1525 nmdc:mga09592_119386_c1 3300050508 Bacteria 2264
1526 nmdc:mga09592_213718_c1 3300050508 Bacteria 1671
1527 nmdc:mga09592_322174_c1 3300050508 Bacteria 1339
1528 nmdc:mga09592_402562_c1 3300050508 Bacteria 1183
1529 nmdc:mga09592_44941_c1 3300050508 Bacteria 3719
1530 nmdc:mga0qj67_136307_c1 3300050509 Bacteria 1989
1531 nmdc:mga0qj67_176117_c1 3300050509 Bacteria 1737
1532 nmdc:mga0qj67_183486_c1 3300050509 Bacteria 1700
1533 nmdc:mga06r32_182220_c1 3300050510 Bacteria 2086
1534 nmdc:mga06r32_213024_c1 3300050510 Bacteria 1920
1535 nmdc:mga06r32_3408_c1 3300050510 Bacteria 14219
1536 nmdc:mga06r32_50481_c1 3300050510 Bacteria 3979
1537 nmdc:mga06r32_535525_c1 3300050510 Bacteria 1146
1538 nmdc:mga08y16_120867_c1 3300050511 Bacteria 2726
1539 nmdc:mga08y16_123202_c1 3300050511 Unclassified 2698
1540 nmdc:mga08y16_137917_c1 3300050511 Bacteria 2536
1541 nmdc:mga08y16_186145_c1 3300050511 Bacteria 2155
1542 nmdc:mga08y16_256169_c1 3300050511 Bacteria 1807
1543 nmdc:mga08y16_44547_c1 3300050511 Bacteria 4648
1544 nmdc:mga08y16_445716_c1 3300050511 Bacteria 1321
1545 nmdc:mga0n895_103584_c1 3300050512 Bacteria 2858
1546 nmdc:mga0n895_126564_c1 3300050512 Bacteria 2579
1547 nmdc:mga0n895_128885_c1 3300050512 Bacteria 2554
1548 nmdc:mga0n895_13733_c1 3300050512 Bacteria 7322
1549 nmdc:mga0n895_13865_c1 3300050512 Bacteria 7296
1550 nmdc:mga0n895_145356_c1 3300050512 Bacteria 2401
1551 nmdc:mga0n895_311002_c1 3300050512 Bacteria 1597
1552 nmdc:mga0n895_395313_c1 3300050512 Bacteria 1398
1553 nmdc:mga0n895_481191_c1 3300050512 Bacteria 1252
1554 nmdc:mga0n895_4814_c1 3300050512 Bacteria 11175
1555 nmdc:mga0n895_548617_c1 3300050512 Bacteria 1162
1556 nmdc:mga0n895_582112_c1 3300050512 Bacteria 1123
1557 nmdc:mga0n895_65860_c1 3300050512 Bacteria 3587
1558 nmdc:mga0n895_8850_c1 3300050512 Bacteria 8762
1559 nmdc:mga0rr50_108025_c1 3300050513 Bacteria 2198
1560 nmdc:mga0rr50_1523_c1 3300050513 Bacteria 12783
1561 nmdc:mga0rr50_1955_c1 3300050513 Bacteria 11439
1562 nmdc:mga0rr50_3936_c1 3300050513 Bacteria 8638
1563 nmdc:mga0rr50_45642_c1 3300050513 Bacteria 3222
1564 nmdc:mga0rr50_48159_c1 3300050513 Bacteria 3149
1565 nmdc:mga0rr50_496771_c1 3300050513 Bacteria 1037
1566 nmdc:mga08x19_12154_c1 3300050514 Bacteria 5183
1567 nmdc:mga08x19_174551_c1 3300050514 Bacteria 1465
1568 nmdc:mga08x19_19860_c1 3300050514 Bacteria 4129
1569 nmdc:mga08x19_342052_c1 3300050514 Bacteria 1044
1570 nmdc:mga08x19_57660_c1 3300050514 Bacteria 2510
1571 nmdc:mga08x19_79070_c1 3300050514 Bacteria 2156
1572 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
1573 nmdc:mga0a205_172074_c1 3300050515 Bacteria 2061
1574 nmdc:mga0a205_17249_c1 3300050515 Bacteria 6764
1575 nmdc:mga0a205_198572_c1 3300050515 Bacteria 1897
1576 nmdc:mga0a205_262105_c1 3300050515 Bacteria 1606
1577 nmdc:mga0a205_272478_c1 3300050515 Bacteria 1569
1578 nmdc:mga0a205_28144_c1 3300050515 Bacteria 5372
1579 nmdc:mga0a205_3032_c1 3300050515 Bacteria 14885
1580 nmdc:mga0a205_442681_c1 3300050515 Bacteria 1160
1581 nmdc:mga0a205_53065_c1 3300050515 Bacteria 3124
1582 nmdc:mga0a205_56867_c1 3300050515 Bacteria 3777
1583 nmdc:mga0a205_58042_c1 3300050515 Bacteria 3738
1584 nmdc:mga0a205_648634_c1 3300050515 Bacteria 907
1585 Ga0495601_0016587 3300053077 Bacteria 4465
1586 Ga0495601_0182567 3300053077 Bacteria 1371
1587 Ga0495619_0018819 3300053085 Bacteria 4385
1588 Ga0501084_0338524 3300054114 Bacteria 1271
1589 Ga0587066_044316 3300059490 Bacteria 851
1590 Ga0587077_017594 3300059493 Bacteria 1220
1591 Ga0587079_021322 3300059647 Bacteria 1165
1592 Ga0501082_0173787 3300060353 Bacteria 1873
1593 Ga0530510_0154138 3300061734 Bacteria 1697
1594 Ga0495600_0374444
1595 CNAas_1001291
1596 LJNas_1000830
1597 JGI24743J22301_10001093
1598 JGI24748J21848_1000019
1599 JGI24748J21848_1001990
1600 JGI24034J26672_10000003
1601 JGI24751J29686_10001293
1602 rootH2_10123433
1603 Ga0065704_10083421
1604 Ga0065712_10005182
1605 Ga0065712_10022915
1606 Ga0065712_10033054
1607 Ga0065712_10070904
1608 Ga0065712_10161590
1609 Ga0065715_10013764
1610 Ga0065715_10111941
1611 Ga0065715_10321232
1612 Ga0065715_10324098
1613 Ga0065715_10350384
1614 Ga0065715_10500547
1615 Ga0065707_10003411
1616 Ga0065707_10017326
1617 Ga0065707_10022069
1618 Ga0065707_10027156
1619 Ga0065707_10102526
1620 Ga0065707_10126446
1621 Ga0065707_10177129
1622 Ga0065707_10488284
1623 Ga0065707_10512683
1624 Ga0070658_10818289
1625 Ga0070683_100019378
1626 Ga0070683_100052975
1627 Ga0070683_100141516
1628 Ga0070683_100187232
1629 Ga0070690_100003539
1630 Ga0070690_100022593
1631 Ga0070690_100025472
1632 Ga0070690_100047447
1633 Ga0070670_100023345
1634 Ga0070670_100060302
1635 Ga0070670_100259457
1636 Ga0068869_100001750
1637 Ga0068869_100007562
1638 Ga0068869_100015071
1639 Ga0068869_100037588
1640 Ga0068869_100094473
1641 Ga0068869_100146538
1642 Ga0068869_100222316
1643 Ga0070666_10009297
1644 Ga0070680_100027092
1645 Ga0070682_100003672
1646 Ga0070682_100032918
1647 Ga0070682_100135945
1648 Ga0068868_100001505
1649 Ga0068868_100018523
1650 Ga0068868_100023843
1651 Ga0068868_100025112
1652 Ga0068868_100030623
1653 Ga0068868_100057945
1654 Ga0068868_100068950
1655 Ga0068868_100158129
1656 Ga0070660_100002927
1657 Ga0070689_100008202
1658 Ga0070689_100278355
1659 Ga0070687_100059840
1660 Ga0070661_100004876
1661 Ga0070661_100016232
1662 Ga0070661_100038658
1663 Ga0070692_10084232
1664 Ga0070692_10221863
1665 Ga0070692_10285605
1666 Ga0070692_10306795
1667 Ga0070692_10325146
1668 Ga0070668_100008545
1669 Ga0070668_100009793
1670 Ga0070668_100059917
1671 Ga0070668_100276317
1672 Ga0070669_100004924
1673 Ga0070669_100006566
1674 Ga0070669_100008631
1675 Ga0070669_100135956
1676 Ga0070669_100314157
1677 Ga0070669_100494673
1678 Ga0070675_100002720
1679 Ga0070675_100257995
1680 Ga0070675_100336998
1681 Ga0070671_100027588
1682 Ga0070671_100124043
1683 Ga0070671_100210666
1684 Ga0070671_100715019
1685 Ga0070673_100037931
1686 Ga0070673_100109694
1687 Ga0070673_100193292
1688 Ga0070673_100281592
1689 Ga0070673_100633224
1690 Ga0070688_100219098
1691 Ga0070659_100006734
1692 Ga0070659_100010812
1693 Ga0070659_100018254
1694 Ga0070659_100029013
1695 Ga0070659_100281988
1696 Ga0070667_100092243
1697 Ga0070667_100239971
1698 Ga0070703_10000128
1699 Ga0070703_10005045
1700 Ga0070703_10030848
1701 Ga0070709_10018148
1702 Ga0070709_10087551
1703 Ga0070709_10158090
1704 Ga0070709_10188917
1705 Ga0070709_10206873
1706 Ga0070714_100154683
1707 Ga0070713_100001624
1708 Ga0070713_100011353
1709 Ga0070713_100095967
1710 Ga0070713_100164403
1711 Ga0070713_100328159
1712 Ga0070713_100518391
1713 Ga0070713_100665763
1714 Ga0070713_100860445
1715 Ga0070713_101109972
1716 Ga0070710_10095356
1717 Ga0070710_10565889
1718 Ga0070701_10134409
1719 Ga0070701_10159014
1720 Ga0070701_10348263
1721 Ga0070711_100000802
1722 Ga0070711_100067389
1723 Ga0070711_100112976
1724 Ga0070711_100115002
1725 Ga0070711_100207960
1726 Ga0070705_100137736
1727 Ga0070705_100154851
1728 Ga0070705_100236996
1729 Ga0070705_100328786
1730 Ga0070700_100000264
1731 Ga0070700_100006788
1732 Ga0070700_100018438
1733 Ga0070700_100022274
1734 Ga0070700_100062685
1735 Ga0070700_100071749
1736 Ga0070700_100330386
1737 Ga0070694_100008254
1738 Ga0070694_100008946
1739 Ga0070694_100011642
1740 Ga0070694_100055163
1741 Ga0070694_100089741
1742 Ga0070694_100156932
1743 Ga0070694_100239131
1744 Ga0070708_100000715
1745 Ga0070708_100003240
1746 Ga0070708_100006607
1747 Ga0070708_100011368
1748 Ga0070708_100013504
1749 Ga0070708_100015142
1750 Ga0070708_100021328
1751 Ga0070708_100035750
1752 Ga0070708_100055179
1753 Ga0070708_100077917
1754 Ga0070708_100080789
1755 Ga0070708_100101352
1756 Ga0070708_100115869
1757 Ga0070708_100154442
1758 Ga0070708_100234420
1759 Ga0070663_100008038
1760 Ga0070663_100150266
1761 Ga0070663_100153744
1762 Ga0070663_100742383
1763 Ga0070678_100037536
1764 Ga0070678_100052688
1765 Ga0070678_100215697
1766 Ga0070678_100286349
1767 Ga0070662_100045970
1768 Ga0070662_100083318
1769 Ga0070662_100156777
1770 Ga0070662_100559838
1771 Ga0070681_10000182
1772 Ga0070681_10000285
1773 Ga0070681_10020377
1774 Ga0070681_10028784
1775 Ga0070681_10033936
1776 Ga0070681_10088295
1777 Ga0070681_10102689
1778 Ga0070681_10216331
1779 Ga0070681_10595864
1780 Ga0068867_100003661
1781 Ga0068867_100037163
1782 Ga0068867_100137229
1783 Ga0068867_100189432
1784 Ga0068867_100332795
1785 Ga0068867_100353313
1786 Ga0070685_10017487
1787 Ga0070685_10037392
1788 Ga0070685_10044111
1789 Ga0070706_100000023
1790 Ga0070706_100014288
1791 Ga0070706_100016887
1792 Ga0070706_100018309
1793 Ga0070706_100045829
1794 Ga0070706_100066604
1795 Ga0070706_100104851
1796 Ga0070706_100115383
1797 Ga0070706_100116795
1798 Ga0070706_100121374
1799 Ga0070706_100144304
1800 Ga0070706_100156999
1801 Ga0070706_100571222
1802 Ga0070707_100000359
1803 Ga0070707_100002913
1804 Ga0070707_100014789
1805 Ga0070707_100015729
1806 Ga0070707_100016578
1807 Ga0070707_100016924
1808 Ga0070707_100024529
1809 Ga0070707_100057727
1810 Ga0070707_100093578
1811 Ga0070707_100108531
1812 Ga0070707_100109180
1813 Ga0070707_100448775
1814 Ga0070707_100544759
1815 Ga0070707_100566301
1816 Ga0070707_100796299
1817 Ga0070698_100000010
1818 Ga0070698_100001116
1819 Ga0070698_100001899
1820 Ga0070698_100018496
1821 Ga0070698_100019201
1822 Ga0070698_100025809
1823 Ga0070698_100027693
1824 Ga0070698_100034303
1825 Ga0070698_100065150
1826 Ga0070698_100076560
1827 Ga0070698_100115248
1828 Ga0070698_100272191
1829 Ga0070698_100438097
1830 Ga0070698_100583919
1831 Ga0070698_100780751
1832 Ga0070699_100007919
1833 Ga0070699_100047752
1834 Ga0070699_100063493
1835 Ga0070699_100090074
1836 Ga0070699_100122186
1837 Ga0070699_100150737
1838 Ga0070699_100206176
1839 Ga0070699_100211838
1840 Ga0070699_100274141
1841 Ga0070699_100350452
1842 Ga0070699_100401039
1843 Ga0070699_100541605
1844 Ga0070699_100571112
1845 Ga0070679_100000348
1846 Ga0070679_100016835
1847 Ga0070679_100110471
1848 Ga0070679_100322349
1849 Ga0070684_100004868
1850 Ga0070684_100114332
1851 Ga0070697_100000231
1852 Ga0070697_100000493
1853 Ga0070697_100000512
1854 Ga0070697_100001316
1855 Ga0070697_100013677
1856 Ga0070697_100016453
1857 Ga0070697_100018179
1858 Ga0070697_100028079
1859 Ga0070697_100049782
1860 Ga0070697_100062711
1861 Ga0070697_100068883
1862 Ga0070697_100104112
1863 Ga0070697_100124987
1864 Ga0070697_100156207
1865 Ga0070697_100156570
1866 Ga0070697_100159582
1867 Ga0070697_100170342
1868 Ga0070697_100172216
1869 Ga0070697_100535994
1870 Ga0070697_100711130
1871 Ga0070697_100857001
1872 Ga0068853_100008464
1873 Ga0068853_100009149
1874 Ga0068853_100136200
1875 Ga0068853_100268733
1876 Ga0070672_100008678
1877 Ga0070672_100024316
1878 Ga0070672_100304344
1879 Ga0070686_100010598
1880 Ga0070686_100037599
1881 Ga0070686_100067677
1882 Ga0070686_100155742
1883 Ga0070686_100158817
1884 Ga0070686_100180050
1885 Ga0070686_100257160
1886 Ga0070695_100004975
1887 Ga0070695_100013827
1888 Ga0070695_100030421
1889 Ga0070695_100036040
1890 Ga0070695_100076476
1891 Ga0070695_100081897
1892 Ga0070695_100120926
1893 Ga0070695_100121834
1894 Ga0070695_100179258
1895 Ga0070695_100191144
1896 Ga0070695_100281609
1897 Ga0070695_100409554
1898 Ga0070695_100463055
1899 Ga0070696_100002714
1900 Ga0070696_100011204
1901 Ga0070696_100038410
1902 Ga0070696_100064212
1903 Ga0070696_100078897
1904 Ga0070696_100080082
1905 Ga0070696_100142444
1906 Ga0070696_100201820
1907 Ga0070696_100245932
1908 Ga0070696_100328264
1909 Ga0070696_100330924
1910 Ga0070696_100384256
1911 Ga0070696_100493797
1912 Ga0070693_100000854
1913 Ga0070693_100011704
1914 Ga0070693_100017081
1915 Ga0070693_100023234
1916 Ga0070693_100054692
1917 Ga0070693_100165125
1918 Ga0070693_100209086
1919 Ga0070693_100213963
1920 Ga0070665_100001090
1921 Ga0070665_100147039
1922 Ga0070665_100445123
1923 Ga0070704_100028948
1924 Ga0070704_100064891
1925 Ga0070704_100067426
1926 Ga0070704_100264624
1927 Ga0070704_100269754
1928 Ga0070704_100307390
1929 Ga0068855_100000603
1930 Ga0068855_100002829
1931 Ga0068855_100048495
1932 Ga0068855_100223333
1933 Ga0068855_100261262
1934 Ga0068855_100734304
1935 Ga0070664_100009593
1936 Ga0070664_100009943
1937 Ga0070664_100019016
1938 Ga0070664_100023109
1939 Ga0070664_100322886
1940 Ga0070664_100343703
1941 Ga0070664_100593440
1942 Ga0070664_100772320
1943 Ga0068857_100002023
1944 Ga0068857_100004405
1945 Ga0068857_100013633
1946 Ga0068857_100060506
1947 Ga0068857_100091540
1948 Ga0068857_100133644
1949 Ga0068854_100007128
1950 Ga0068854_100019968
1951 Ga0068854_100025889
1952 Ga0068854_100083895
1953 Ga0068854_100093516
1954 Ga0068854_100107166
1955 Ga0068854_100129211
1956 Ga0068856_100000859
1957 Ga0068856_100006882
1958 Ga0068856_100054561
1959 Ga0068856_100070719
1960 Ga0068856_100080505
1961 Ga0068856_100128052
1962 Ga0068856_100168099
1963 Ga0068856_100239972
1964 Ga0070702_100018517
1965 Ga0070702_100038764
1966 Ga0070702_100081516
1967 Ga0070702_100118005
1968 Ga0070702_100126506
1969 Ga0070702_100466403
1970 Ga0068852_100011750
1971 Ga0068852_100120902
1972 Ga0068852_100207790
1973 Ga0068852_100217594
1974 Ga0068852_100222172
1975 Ga0068859_100014366
1976 Ga0068859_100019485
1977 Ga0068859_100022936
1978 Ga0068859_100040391
1979 Ga0068859_100045082
1980 Ga0068859_100046922
1981 Ga0068859_100058628
1982 Ga0068859_100063756
1983 Ga0068859_100112693
1984 Ga0068859_100242515
1985 Ga0068859_100298946
1986 Ga0068859_100638749
1987 Ga0068864_100015016
1988 Ga0068864_100022965
1989 Ga0068864_100060980
1990 Ga0068864_100074844
1991 Ga0068864_100079700
1992 Ga0068864_100138218
1993 Ga0068864_100148116
1994 Ga0068864_100158855
1995 Ga0068864_100463657
1996 Ga0068864_100610021
1997 Ga0068866_10002818
1998 Ga0068866_10026477
1999 Ga0068861_100028832
2000 Ga0068861_100057782
2001 Ga0068861_100109346
2002 Ga0068861_100119738
2003 Ga0068861_100135753
2004 Ga0068861_100169352
2005 Ga0068861_100292680
2006 Ga0068861_100650785
2007 Ga0068851_10001253
2008 Ga0068851_10003656
2009 Ga0068851_10009328
2010 Ga0068851_10078723
2011 Ga0068870_10314209
2012 Ga0068863_100002776
2013 Ga0068863_100036461
2014 Ga0068863_100045027
2015 Ga0068863_100060166
2016 Ga0068863_100107739
2017 Ga0068863_100141911
2018 Ga0068863_100144576
2019 Ga0068863_100159832
2020 Ga0068863_100187421
2021 Ga0068863_100591086
2022 Ga0068863_100723651
2023 Ga0068863_100751678
2024 Ga0068858_100001045
2025 Ga0068858_100008341
2026 Ga0068858_100016629
2027 Ga0068858_100017625
2028 Ga0068858_100031742
2029 Ga0068858_100079803
2030 Ga0068858_100093732
2031 Ga0068858_100143568
2032 Ga0068858_100315152
2033 Ga0068858_100550207
2034 Ga0068858_100735601
2035 Ga0068860_100008952
2036 Ga0068860_100016241
2037 Ga0068860_100020140
2038 Ga0068860_100028605
2039 Ga0068860_100055048
2040 Ga0068860_100370768
2041 Ga0068860_100505412
2042 Ga0068862_100031830
2043 Ga0068862_100050216
2044 Ga0068862_100098708
2045 Ga0068862_100160883
2046 Ga0068862_100224261
2047 Ga0068862_100813519
2048 Ga0081455_10183442
2049 Ga0081539_10005776
2050 Ga0070717_10001889
2051 Ga0070717_10009585
2052 Ga0070717_10012714
2053 Ga0070717_10029726
2054 Ga0070717_10042987
2055 Ga0070717_10093948
2056 Ga0070717_10116195
2057 Ga0070717_10204177
2058 Ga0070717_10243138
2059 Ga0075432_10047823
2060 Ga0070715_10000030
2061 Ga0070715_10003144
2062 Ga0070715_10232145
2063 Ga0070715_10423952
2064 Ga0070716_100001574
2065 Ga0070716_100004264
2066 Ga0070716_100018680
2067 Ga0070716_100043757
2068 Ga0070716_100070266
2069 Ga0070716_100099030
2070 Ga0070716_100243573
2071 Ga0070716_100258290
2072 Ga0070712_100000044
2073 Ga0070712_100087332
2074 Ga0070712_100144372
2075 Ga0070712_100229839
2076 Ga0097621_100000110
2077 Ga0097621_100000799
2078 Ga0097621_100004133
2079 Ga0097621_100010677
2080 Ga0097621_100017819
2081 Ga0097621_100022380
2082 Ga0097621_100024499
2083 Ga0097621_100070105
2084 Ga0097621_100139802
2085 Ga0097621_100867377
2086 Ga0068871_100000095
2087 Ga0068871_100000179
2088 Ga0068871_100001333
2089 Ga0068871_100001824
2090 Ga0068871_100002061
2091 Ga0068871_100017557
2092 Ga0068871_100037795
2093 Ga0068871_100047817
2094 Ga0068871_100088349
2095 Ga0068871_100273503
2096 Ga0068871_100344205
2097 Ga0068871_100376240
2098 Ga0068871_100697905
2099 Ga0075428_100060878
2100 Ga0075428_100327563
2101 Ga0075428_100363559
2102 Ga0075428_100555070
2103 Ga0075428_100786582
2104 Ga0075430_100010936
2105 Ga0075430_100032237
2106 Ga0075430_100176237
2107 Ga0075430_100440027
2108 Ga0075431_100074275
2109 Ga0075431_100077941
2110 Ga0075431_100287831
2111 Ga0075431_100298125
2112 Ga0075431_100773885
2113 Ga0075433_10007401
2114 Ga0075433_10011084
2115 Ga0075433_10035385
2116 Ga0075433_10039871
2117 Ga0075433_10043705
2118 Ga0075433_10048421
2119 Ga0075433_10154244
2120 Ga0075433_10196945
2121 Ga0075433_10363896
2122 Ga0075434_100012224
2123 Ga0075434_100012301
2124 Ga0075434_100013214
2125 Ga0075434_100015196
2126 Ga0075434_100018130
2127 Ga0075434_100031511
2128 Ga0075434_100034364
2129 Ga0075434_100053388
2130 Ga0075434_100109139
2131 Ga0075434_100144938
2132 Ga0075434_100395584
2133 Ga0075434_100396800
2134 Ga0075434_100433542
2135 Ga0075434_101212653
2136 Ga0075429_100035408
2137 Ga0075429_100267597
2138 Ga0075429_100357350
2139 Ga0068865_100004716
2140 Ga0068865_100013417
2141 Ga0068865_100046614
2142 Ga0068865_100105127
2143 Ga0068865_100123542
2144 Ga0068865_100180956
2145 Ga0068865_100492886
2146 Ga0068865_100694409
2147 Ga0068865_100802532
2148 Ga0075436_100000016
2149 Ga0075436_100015841
2150 Ga0075436_100024761
2151 Ga0075436_100039293
2152 Ga0075436_100148928
2153 Ga0075436_100238466
2154 Ga0075436_100337613
2155 Ga0075436_100486821
2156 Ga0075436_100570491
2157 Ga0097620_100014367
2158 Ga0097620_100019485
2159 Ga0097620_100022940
2160 Ga0097620_100040393
2161 Ga0097620_100045083
2162 Ga0097620_100046921
2163 Ga0097620_100058629
2164 Ga0097620_100063756
2165 Ga0097620_100112701
2166 Ga0097620_100242532
2167 Ga0097620_100298926
2168 Ga0097620_100638690
2169 Ga0075435_100000338
2170 Ga0075435_100001387
2171 Ga0075435_100007411
2172 Ga0075435_100014098
2173 Ga0075435_100076051
2174 Ga0075435_100076057
2175 Ga0075435_100315033
2176 Ga0075435_100387962
2177 Ga0099794_10039545
2178 Ga0099794_10053300
2179 Ga0099794_10249620
2180 Ga0099795_10036803
2181 Ga0105251_10111849
2182 Ga0105240_10054913
2183 Ga0105240_10070056
2184 Ga0105240_10317413
2185 Ga0111539_10005605
2186 Ga0111539_10008723
2187 Ga0111539_10039526
2188 Ga0111539_10058001
2189 Ga0111539_10065032
2190 Ga0111539_10137517
2191 Ga0111539_10642736
2192 Ga0111539_10815430
2193 Ga0105245_10005699
2194 Ga0105245_10005818
2195 Ga0105245_10033917
2196 Ga0105245_10143890
2197 Ga0105245_10158450
2198 Ga0105245_10447279
2199 Ga0105247_10000003
2200 Ga0105247_10003978
2201 Ga0105247_10119597
2202 Ga0105247_10151626
2203 Ga0105247_10221040
2204 Ga0114129_10003333
2205 Ga0114129_10026237
2206 Ga0114129_10035650
2207 Ga0114129_10042482
2208 Ga0114129_10125128
2209 Ga0114129_10148398
2210 Ga0114129_10215384
2211 Ga0114129_10240153
2212 Ga0114129_10327037
2213 Ga0114129_10335986
2214 Ga0114129_10370086
2215 Ga0114129_10479064
2216 Ga0114129_10656864
2217 Ga0114129_10665340
2218 Ga0114129_11255491
2219 Ga0105243_10001017
2220 Ga0105243_10001623
2221 Ga0105243_10031851
2222 Ga0105243_10095386
2223 Ga0105243_10171063
2224 Ga0105243_10522532
2225 Ga0105243_11062656
2226 Ga0105241_10011232
2227 Ga0105241_10020081
2228 Ga0105241_10045071
2229 Ga0105241_10287741
2230 Ga0105241_10295445
2231 Ga0105241_10368730
2232 Ga0105242_10004591
2233 Ga0105242_10004959
2234 Ga0105242_10042621
2235 Ga0105242_10084217
2236 Ga0105242_10092458
2237 Ga0105242_10116265
2238 Ga0105242_10233855
2239 Ga0105242_10245701
2240 Ga0105242_10247731
2241 Ga0105248_10004304
2242 Ga0105248_10013845
2243 Ga0105248_10015241
2244 Ga0105248_10017846
2245 Ga0105248_10028453
2246 Ga0105248_10049267
2247 Ga0105248_10072083
2248 Ga0105248_10090746
2249 Ga0105248_10096225
2250 Ga0105248_10239696
2251 Ga0105248_10294011
2252 Ga0105248_11093526
2253 Ga0105237_10007450
2254 Ga0105237_10030647
2255 Ga0105237_10039275
2256 Ga0105237_10069980
2257 Ga0105237_10075970
2258 Ga0105237_10293887
2259 Ga0105238_10000057
2260 Ga0105238_10014415
2261 Ga0105238_10085055
2262 Ga0105238_10096972
2263 Ga0105238_10226771
2264 Ga0105238_10305596
2265 Ga0105249_10014285
2266 Ga0105249_10055733
2267 Ga0105249_10108318
2268 Ga0105249_10131992
2269 Ga0105249_10566848
2270 Ga0105249_10688881
2271 Ga0105249_11001868
2272 Ga0099796_10012563
2273 Ga0099796_10020260
2274 Ga0105239_10011785
2275 Ga0105239_10013320
2276 Ga0105239_10013519
2277 Ga0105239_10015435
2278 Ga0105239_10026134
2279 Ga0105239_10105008
2280 Ga0105239_10122436
2281 Ga0105239_10130113
2282 Ga0105239_10227650
2283 Ga0105239_10600608
2284 Ga0105239_10710756
2285 Ga0105246_10004521
2286 Ga0105246_10535204
2287 Ga0157373_10009538
2288 Ga0157373_10045613
2289 Ga0157373_10112120
2290 Ga0157373_10206925
2291 Ga0157373_10227812
2292 Ga0157373_10232273
2293 Ga0157371_10003920
2294 Ga0157371_10004155
2295 Ga0157371_10006746
2296 Ga0157371_10206415
2297 Ga0157369_10001318
2298 Ga0157369_10047308
2299 Ga0157369_10061052
2300 Ga0157369_10205928
2301 Ga0157369_10756103
2302 Ga0157374_10000094
2303 Ga0157374_10000218
2304 Ga0157374_10008962
2305 Ga0157374_10009681
2306 Ga0157374_10036210
2307 Ga0157374_10117634
2308 Ga0157374_10137800
2309 Ga0157374_10187830
2310 Ga0157374_10194877
2311 Ga0157374_10278421
2312 Ga0157374_10485121
2313 Ga0157374_10525068
2314 Ga0157378_10000028
2315 Ga0157378_10000059
2316 Ga0157378_10000660
2317 Ga0157378_10001487
2318 Ga0157378_10012197
2319 Ga0157378_10019547
2320 Ga0157378_10030173
2321 Ga0157378_10039356
2322 Ga0157378_10041448
2323 Ga0157378_10093119
2324 Ga0157378_10138876
2325 Ga0157378_10143230
2326 Ga0157378_10191100
2327 Ga0157378_10210121
2328 Ga0157378_10218513
2329 Ga0157378_10251674
2330 Ga0157378_10327960
2331 Ga0157378_10329929
2332 Ga0157378_10820515
2333 Ga0163162_10000147
2334 Ga0163162_10001573
2335 Ga0163162_10004857
2336 Ga0163162_10009091
2337 Ga0163162_10027759
2338 Ga0163162_10058457
2339 Ga0163162_10106827
2340 Ga0163162_10206909
2341 Ga0163162_10728490
2342 Ga0163162_11301330
2343 Ga0157372_10000679
2344 Ga0157372_10000736
2345 Ga0157372_10003980
2346 Ga0157372_10013069
2347 Ga0157372_10071799
2348 Ga0157372_10159954
2349 Ga0157372_10283541
2350 Ga0157372_10724869
2351 Ga0157372_10904862
2352 Ga0157375_10002987
2353 Ga0157375_10033040
2354 Ga0157375_10035155
2355 Ga0157375_10069493
2356 Ga0157375_10224387
2357 Ga0157375_10279606
2358 Ga0157375_10463006
2359 Ga0157375_11062900
2360 Ga0163163_10018820
2361 Ga0163163_10023437
2362 Ga0163163_10146336
2363 Ga0163163_10172022
2364 Ga0163163_10230998
2365 Ga0163163_10567764
2366 Ga0163163_10648524
2367 Ga0163163_11100970
2368 Ga0157380_10013428
2369 Ga0157380_10044190
2370 Ga0157380_10095518
2371 Ga0157380_10354419
2372 Ga0182008_10042067
2373 Ga0157377_10001949
2374 Ga0157377_10009963
2375 Ga0157379_10003382
2376 Ga0157379_10007448
2377 Ga0157379_10017596
2378 Ga0157379_10044069
2379 Ga0157379_10095001
2380 Ga0157379_10119789
2381 Ga0157376_10000010
2382 Ga0157376_10002726
2383 Ga0157376_10009165
2384 Ga0157376_10010018
2385 Ga0157376_10010882
2386 Ga0157376_10015244
2387 Ga0157376_10021027
2388 Ga0157376_10032306
2389 Ga0157376_10054330
2390 Ga0182005_1005871
2391 Ga0163161_10004485
2392 Ga0163161_10058354
2393 Ga0213872_10002569
2394 Ga0213872_10018718
2395 Ga0213872_10043965
2396 Ga0213872_10067608
2397 Ga0213875_10067715
2398 Ga0213871_10001017
2399 Ga0213871_10012862
2400 Ga0228598_1000016
2401 Ga0228598_1005001
2402 Ga0207672_1000052
2403 Ga0207697_10003483
2404 Ga0207697_10068354
2405 Ga0207656_10002208
2406 Ga0207656_10026433
2407 Ga0207656_10059851
2408 Ga0207653_10000019
2409 Ga0207653_10001726
2410 Ga0207653_10010775
2411 Ga0207692_10082654
2412 Ga0207642_10001161
2413 Ga0207642_10122002
2414 Ga0207710_10000001
2415 Ga0207710_10014739
2416 Ga0207710_10115431
2417 Ga0207688_10087321
2418 Ga0207688_10222072
2419 Ga0207680_10005969
2420 Ga0207680_10017559
2421 Ga0207680_10111773
2422 Ga0207647_10000659
2423 Ga0207647_10003313
2424 Ga0207647_10010726
2425 Ga0207647_10133936
2426 Ga0207647_10176315
2427 Ga0207647_10260097
2428 Ga0207685_10000009
2429 Ga0207685_10155226
2430 Ga0207699_10017682
2431 Ga0207699_10089677
2432 Ga0207699_10194263
2433 Ga0207645_10004308
2434 Ga0207643_10004919
2435 Ga0207643_10192061
2436 Ga0207643_10368009
2437 Ga0207705_10236393
2438 Ga0207684_10000146
2439 Ga0207684_10000445
2440 Ga0207684_10002533
2441 Ga0207684_10003671
2442 Ga0207684_10020822
2443 Ga0207684_10022812
2444 Ga0207684_10041725
2445 Ga0207684_10047581
2446 Ga0207684_10070972
2447 Ga0207684_10111961
2448 Ga0207684_10113379
2449 Ga0207684_10114478
2450 Ga0207684_10130246
2451 Ga0207684_10166231
2452 Ga0207684_10216389
2453 Ga0207684_10476446
2454 Ga0207684_10496702
2455 Ga0207654_10009567
2456 Ga0207654_10022867
2457 Ga0207654_10052146
2458 Ga0207654_10055559
2459 Ga0207654_10064481
2460 Ga0207707_10000004
2461 Ga0207707_10000673
2462 Ga0207707_10007101
2463 Ga0207707_10023892
2464 Ga0207707_10040622
2465 Ga0207707_10106503
2466 Ga0207707_10360711
2467 Ga0207707_10381044
2468 Ga0207695_10053584
2469 Ga0207695_10222483
2470 Ga0207695_10304724
2471 Ga0207671_10002213
2472 Ga0207671_10083713
2473 Ga0207671_10088118
2474 Ga0207671_10190526
2475 Ga0207671_10208486
2476 Ga0207693_10000230
2477 Ga0207693_10019599
2478 Ga0207693_10052392
2479 Ga0207693_10109077
2480 Ga0207693_10150577
2481 Ga0207693_10493484
2482 Ga0207663_10002820
2483 Ga0207663_10035994
2484 Ga0207663_10082817
2485 Ga0207663_10100820
2486 Ga0207663_10127329
2487 Ga0207663_10206167
2488 Ga0207663_10275053
2489 Ga0207663_10298439
2490 Ga0207663_10558548
2491 Ga0207660_10004602
2492 Ga0207660_10023082
2493 Ga0207660_10079013
2494 Ga0207660_10172848
2495 Ga0207660_10182091
2496 Ga0207660_10578087
2497 Ga0207662_10011852
2498 Ga0207662_10021705
2499 Ga0207662_10101195
2500 Ga0207662_10110776
2501 Ga0207662_10220449
2502 Ga0207657_10003001
2503 Ga0207657_10005454
2504 Ga0207657_10016288
2505 Ga0207657_10362120
2506 Ga0207649_10000368
2507 Ga0207649_10023259
2508 Ga0207652_10000330
2509 Ga0207652_10060491
2510 Ga0207652_10107490
2511 Ga0207646_10000651
2512 Ga0207646_10002173
2513 Ga0207646_10002290
2514 Ga0207646_10005487
2515 Ga0207646_10006026
2516 Ga0207646_10012131
2517 Ga0207646_10096340
2518 Ga0207646_10099182
2519 Ga0207646_10112669
2520 Ga0207646_10149503
2521 Ga0207646_10219665
2522 Ga0207646_10234654
2523 Ga0207646_10281779
2524 Ga0207646_10316607
2525 Ga0207646_10596537
2526 Ga0207646_10722827
2527 Ga0207646_10742489
2528 Ga0207646_10793631
2529 Ga0207681_10020258
2530 Ga0207681_10034865
2531 Ga0207681_10424449
2532 Ga0207694_10001387
2533 Ga0207694_10208501
2534 Ga0207694_10472418
2535 Ga0207650_10000042
2536 Ga0207659_10008333
2537 Ga0207659_10066762
2538 Ga0207659_10146942
2539 Ga0207659_10172618
2540 Ga0207687_10001106
2541 Ga0207687_10005532
2542 Ga0207687_10007448
2543 Ga0207687_10091278
2544 Ga0207687_10268248
2545 Ga0207700_10010190
2546 Ga0207700_10059185
2547 Ga0207700_10073583
2548 Ga0207700_10085585
2549 Ga0207700_10104965
2550 Ga0207700_10339251
2551 Ga0207700_10653318
2552 Ga0207664_10161356
2553 Ga0207644_10024922
2554 Ga0207644_10094313
2555 Ga0207690_10015996
2556 Ga0207690_10199607
2557 Ga0207690_10244600
2558 Ga0207706_10000938
2559 Ga0207706_10001110
2560 Ga0207706_10016398
2561 Ga0207706_10032553
2562 Ga0207706_10054474
2563 Ga0207706_10298681
2564 Ga0207706_10424762
2565 Ga0207686_10001639
2566 Ga0207686_10023949
2567 Ga0207686_10100027
2568 Ga0207686_10154540
2569 Ga0207686_10177920
2570 Ga0207686_10286310
2571 Ga0207686_10537125
2572 Ga0207709_10000738
2573 Ga0207709_10154206
2574 Ga0207709_10353634
2575 Ga0207709_10853942
2576 Ga0207670_10022310
2577 Ga0207670_10031135
2578 Ga0207670_10111404
2579 Ga0207670_10212268
2580 Ga0207669_10210078
2581 Ga0207704_10008002
2582 Ga0207704_10009498
2583 Ga0207704_10010698
2584 Ga0207704_10052096
2585 Ga0207704_10058603
2586 Ga0207704_10245218
2587 Ga0207704_10669002
2588 Ga0207665_10003009
2589 Ga0207665_10005483
2590 Ga0207665_10026402
2591 Ga0207665_10035816
2592 Ga0207665_10060811
2593 Ga0207665_10087669
2594 Ga0207665_10117436
2595 Ga0207665_10162831
2596 Ga0207665_10352973
2597 Ga0207691_10025764
2598 Ga0207691_10026770
2599 Ga0207691_10311787
2600 Ga0207711_10007119
2601 Ga0207711_10010907
2602 Ga0207711_10024755
2603 Ga0207711_10059589
2604 Ga0207711_10160288
2605 Ga0207711_10340521
2606 Ga0207711_10445987
2607 Ga0207689_10004136
2608 Ga0207689_10007507
2609 Ga0207689_10009397
2610 Ga0207689_10015780
2611 Ga0207689_10069609
2612 Ga0207689_10095765
2613 Ga0207689_10127145
2614 Ga0207689_10212185
2615 Ga0207689_10282738
2616 Ga0207661_10000672
2617 Ga0207661_10039690
2618 Ga0207661_10842649
2619 Ga0207679_10000989
2620 Ga0207679_10055021
2621 Ga0207679_10067818
2622 Ga0207667_10002030
2623 Ga0207667_10004332
2624 Ga0207667_10022254
2625 Ga0207667_10039376
2626 Ga0207651_10170473
2627 Ga0207651_10205259
2628 Ga0207651_10366171
2629 Ga0207651_10518324
2630 Ga0207712_10012463
2631 Ga0207712_10235348
2632 Ga0207712_10437979
2633 Ga0207712_10574730
2634 Ga0207668_10017078
2635 Ga0207668_10033899
2636 Ga0207668_10355097
2637 Ga0207640_10003825
2638 Ga0207640_10055113
2639 Ga0207640_10077493
2640 Ga0207640_10087344
2641 Ga0207640_10170622
2642 Ga0207640_10194017
2643 Ga0207658_10026521
2644 Ga0207658_10280737
2645 Ga0207677_10002750
2646 Ga0207677_10003546
2647 Ga0207677_10037087
2648 Ga0207677_10081946
2649 Ga0207677_10270723
2650 Ga0207677_10280250
2651 Ga0207677_10462252
2652 Ga0207703_10001746
2653 Ga0207703_10008166
2654 Ga0207703_10013006
2655 Ga0207703_10015319
2656 Ga0207703_10071399
2657 Ga0207703_10186728
2658 Ga0207703_10256575
2659 Ga0207703_10286664
2660 Ga0207703_10572935
2661 Ga0207703_10906583
2662 Ga0207639_10056720
2663 Ga0207639_10059613
2664 Ga0207639_10228386
2665 Ga0207639_11019921
2666 Ga0207678_10001163
2667 Ga0207678_10021484
2668 Ga0207678_10169934
2669 Ga0207708_10000591
2670 Ga0207708_10007596
2671 Ga0207708_10009934
2672 Ga0207708_10013694
2673 Ga0207708_10022168
2674 Ga0207708_10114899
2675 Ga0207708_10153749
2676 Ga0207708_10257676
2677 Ga0207708_10630547
2678 Ga0207702_10001368
2679 Ga0207702_10006408
2680 Ga0207702_10179796
2681 Ga0207702_10204553
2682 Ga0207702_10211725
2683 Ga0207702_10242295
2684 Ga0207702_10411917
2685 Ga0207641_10001156
2686 Ga0207641_10008612
2687 Ga0207641_10027191
2688 Ga0207641_10033569
2689 Ga0207641_10057371
2690 Ga0207641_10066019
2691 Ga0207641_10130728
2692 Ga0207641_10222739
2693 Ga0207641_10256459
2694 Ga0207641_10259527
2695 Ga0207641_10321789
2696 Ga0207641_10372116
2697 Ga0207641_10423733
2698 Ga0207648_10005527
2699 Ga0207648_10005955
2700 Ga0207648_10023043
2701 Ga0207648_10130027
2702 Ga0207648_10331587
2703 Ga0207648_10897288
2704 Ga0207676_10015142
2705 Ga0207676_10016616
2706 Ga0207676_10024369
2707 Ga0207676_10042967
2708 Ga0207676_10059251
2709 Ga0207676_10079091
2710 Ga0207676_10294130
2711 Ga0207676_10700490
2712 Ga0207674_10002642
2713 Ga0207674_10011157
2714 Ga0207674_10014083
2715 Ga0207674_10032433
2716 Ga0207674_10037486
2717 Ga0207674_10319491
2718 Ga0207674_10527124
2719 Ga0207674_10850883
2720 Ga0207674_11183014
2721 Ga0207675_100003366
2722 Ga0207675_100021393
2723 Ga0207675_100031575
2724 Ga0207675_100037312
2725 Ga0207675_100053045
2726 Ga0207675_100060968
2727 Ga0207675_100241806
2728 Ga0207675_100466995
2729 Ga0207675_100777768
2730 Ga0207683_10008274
2731 Ga0207683_10031496
2732 Ga0207683_10059195
2733 Ga0207698_10018984
2734 Ga0207698_10035965
2735 Ga0207698_10128165
2736 Ga0207698_10435295
2737 Ga0207698_10799628
2738 Ga0209971_1028654
2739 Ga0207428_10003633
2740 Ga0207428_10023613
2741 Ga0207428_10092643
2742 Ga0207428_10145855
2743 Ga0207428_10275193
2744 Ga0268266_10000141
2745 Ga0268266_10016476
2746 Ga0268266_10034705
2747 Ga0268266_10184399
2748 Ga0268266_10422991
2749 Ga0268265_10023265
2750 Ga0268265_10034878
2751 Ga0268265_10047085
2752 Ga0268265_10139514
2753 Ga0268265_10536521
2754 Ga0268264_10013891
2755 Ga0268264_10020404
2756 Ga0268264_10038327
2757 Ga0268264_10043325
2758 Ga0268264_10082187
2759 Ga0268264_10184968
2760 Ga0268264_10194962
2761 Ga0268264_10577660
2762 Ga0265762_1002197
2763 Ga0265760_10010444
2764 Ga0265760_10019644
2765 Ga0307408_100339298
2766 Ga0307408_100435313
2767 Ga0307408_100493482
2768 Ga0307405_10049234
2769 Ga0307405_10183576
2770 Ga0307413_10301257
2771 Ga0307410_10036291
2772 Ga0307410_10113502
2773 Ga0307406_10032478
2774 Ga0307406_10068314
2775 Ga0307406_10332234
2776 Ga0307407_10076472
2777 Ga0307407_10281750
2778 Ga0307409_100668235
2779 Ga0307409_100754112
2780 Ga0307416_100027725
2781 Ga0307416_100261954
2782 Ga0307416_100387636
2783 Ga0307416_100434633
2784 Ga0307414_10055378
2785 Ga0307414_10427643
2786 Ga0307411_10185985
2787 Ga0307415_100038555
2788 Ga0307415_100457167
2789 Ga0316593_10032707
2790 Ga0373958_0066373
2791 Ga0373934_0000303
2792 Ga0373951_0063079
2793 Ga0373936_0007666
2794 Ga0373939_0039554
2795 Ga0373953_0007065
2796 Ga0373954_0000123
2797 Ga0373956_0002972
2798 Ga0373957_0003740
2799 Ga0373955_0000328
2800 Ga0373962_0038019
2801 Ga0373931_0020003
2802 Ga0373931_0029346
2803 Ga0373931_0208824
2804 Ga0373931_0234454
2805 Ga0373927_0296861
2806 Ga0373927_0380583
2807 Ga0373933_0001026
2808 Ga0373937_0002671
2809 Ga0373925_0107372
2810 Ga0373925_0120765
2811 Ga0395900_0048108
2812 Ga0395900_0123313
2813 Ga0395900_0550226
2814 Ga0395898_0058704
2815 Ga0395898_0186007
2816 Ga0395898_0535313
2817 Ga0395898_0759149
2818 Ga0395905_0001854
2819 Ga0395905_0005241
2820 Ga0395905_0020578
2821 Ga0395905_0027989
2822 Ga0395905_0098421
2823 Ga0395905_0129986
2824 Ga0395905_0241266
2825 Ga0395905_0833437
2826 Ga0436364_1092140
2827 Ga0436364_1445510
2828 Ga0395901_0079113
2829 Ga0395901_0518235
2830 Ga0242420_013587
2831 Ga0436360_1106412
2832 Ga0436360_1213990
2833 Ga0436361_0012325
2834 Ga0436361_0174660
2835 Ga0436361_0199066
2836 Ga0436361_1052230
2837 Ga0436363_0068179
2838 Ga0436363_0487536
2839 Ga0436363_1712977
2840 Ga0436362_0328001
2841 Ga0436362_0356003
2842 Ga0439458_0004179
2843 Ga0439435_0032724
2844 Ga0439464_0094932
2845 Ga0439460_0014373
2846 Ga0439460_0066188
2847 Ga0451577_0045301
2848 Ga0453683_0058841
2849 Ga0453683_0078796
2850 Ga0453683_0078962
2851 Ga0453683_0424731
2852 Ga0453684_0081894
2853 Ga0451576_0320146
2854 Ga0451576_0986948
2855 Ga0451576_1056516
2856 Ga0466967_0001003
2857 Ga0466967_0496716
2858 Ga0495592_0042054
2859 Ga0495592_0233931
2860 Ga0495603_0064247
2861 Ga0495629_0006399
2862 Ga0495629_0151201
2863 Ga0495641_0168454
2864 Ga0495653_0156099
2865 Ga0495580_0004639
2866 Ga0495580_0012852
2867 Ga0495580_0031791
2868 Ga0495580_0033089
2869 Ga0495580_0067424
2870 Ga0495580_0090882
2871 Ga0495580_0122419
2872 Ga0495580_0130935
2873 Ga0495582_0000263
2874 Ga0495639_0009972
2875 Ga0495662_0046855
2876 Ga0495664_0313585
2877 Ga0495594_0002748
2878 Ga0495594_0048667
2879 Ga0495608_0045052
2880 Ga0495618_0100309
2881 Ga0495628_0122177
2882 Ga0495628_0149103
2883 Ga0495628_0244329
2884 Ga0495630_0040876
2885 Ga0495644_0000107
2886 Ga0495586_0125362
2887 Ga0495587_0013626
2888 Ga0495587_0018550
2889 Ga0495598_0093882
2890 Ga0495609_0037073
2891 Ga0495609_0161257
2892 Ga0495645_0010551
2893 Ga0495645_0014220
2894 Ga0495645_0025932
2895 Ga0495633_0077826
2896 Ga0495667_0438907
2897 Ga0495656_0037449
2898 Ga0495668_0100685
2899 Ga0495611_0205392
2900 Ga0495635_0028522
2901 Ga0495659_0022579
2902 Ga0495657_0129330
2903 Ga0495599_0064848
2904 Ga0495623_0019185
2905 Ga0495623_0062165
2906 Ga0495646_0095033
2907 Ga0495658_0063521
2908 Ga0495658_0205574
2909 Ga0495613_0016729
2910 Ga0495613_0049686
2911 Ga0495624_0076111
2912 Ga0495670_0015726
2913 Ga0495600_0186430
2914 Ga0495581_0042871
2915 Ga0495581_0068020
2916 Ga0495604_0000257
2917 Ga0495604_0124506
2918 Ga0495604_0137029
2919 Ga0495636_0099553
2920 Ga0495636_0108831
2921 Ga0495674_0105779
2922 Ga0495674_0146391
2923 Ga0495684_0001093
2924 Ga0495602_0019910
2925 Ga0495602_0083896
2926 Ga0496100_0022352
2927 Ga0496100_0054881
2928 Ga0496100_0089322
2929 Ga0496100_0112731
2930 Ga0496100_0200005
2931 Ga0496100_0319413
2932 Ga0496101_0593230
2933 Ga0496102_0002465
2934 Ga0496102_0013029
2935 Ga0496102_0016939
2936 Ga0496102_0020275
2937 Ga0496102_0197370
2938 Ga0496102_0201655
2939 Ga0496102_0816766
2940 Ga0496103_0001456
2941 Ga0496103_0104563
2942 Ga0496103_0142652
2943 Ga0496103_0174966
2944 Ga0496104_0083096
2945 Ga0496104_0141975
2946 Ga0496104_0161069
2947 Ga0496104_0399945
2948 Ga0496104_0691798
2949 Ga0496105_0085000
2950 Ga0496105_0160811
2951 Ga0496105_0639053
2952 Ga0496106_0010481
2953 Ga0496106_0032911
2954 Ga0496106_0049064
2955 Ga0496106_0076785
2956 Ga0496106_0080108
2957 Ga0496106_0177853
2958 Ga0496106_0285691
2959 Ga0496106_0402096
2960 Ga0496107_0017792
2961 Ga0496107_0088258
2962 Ga0496107_0186794
2963 Ga0496108_0006733
2964 Ga0496108_0125394
2965 Ga0496108_0460389
2966 Ga0496109_0000059
2967 Ga0496109_0105213
2968 Ga0496109_0185492
2969 Ga0496109_0427598
2970 Ga0496109_0480578
2971 Ga0496109_0728138
2972 Ga0496110_0036756
2973 Ga0496110_0073486
2974 Ga0496110_0202319
2975 Ga0496110_0616299
2976 Ga0496111_0022510
2977 Ga0496111_0039880
2978 Ga0496112_0000504
2979 Ga0496112_0005614
2980 Ga0496112_0012267
2981 Ga0496112_0013951
2982 Ga0496112_0015086
2983 Ga0496112_0017208
2984 Ga0496112_0034367
2985 Ga0496112_0103018
2986 Ga0496112_0463458
2987 Ga0496113_0001118
2988 Ga0496113_0054448
2989 Ga0496113_0188540
2990 Ga0496113_0239517
2991 Ga0496113_0295005
2992 Ga0496114_0005623
2993 Ga0496114_0190975
2994 Ga0496114_0651229
2995 Ga0496115_0003064
2996 Ga0496115_0042212
2997 Ga0496115_0046392
2998 Ga0496115_0088019
2999 Ga0496115_0101318
3000 Ga0496119_0108139
3001 Ga0496126_0000004
3002 Ga0496126_0008266
3003 Ga0496126_0324927
3004 Ga0501290_015709
3005 Ga0501291_001069
3006 Ga0501292_008782
3007 Ga0501292_010478
3008 Ga0501295_073770
3009 Ga0501296_000316
3010 Ga0501296_002073
3011 Ga0501297_004371
3012 Ga0501298_000322
3013 Ga0501298_053081
3014 Ga0501299_004588
3015 Ga0501300_012384
3016 Ga0501036_0019851
3017 Ga0501038_0046743
3018 Ga0501039_0079635
3019 Ga0501039_0237490
3020 Ga0501041_0051805
3021 Ga0501041_0125877
3022 Ga0501041_0236781
3023 Ga0501042_0377511
3024 Ga0501042_0412775
3025 Ga0501048_0250428
3026 Ga0501071_0034574
3027 Ga0501071_0105571
3028 Ga0501071_0782415
3029 Ga0501072_0015815
3030 Ga0501072_0297284
3031 Ga0501072_0317224
3032 Ga0501074_0153511
3033 Ga0501074_0188870
3034 Ga0501074_0309705
3035 Ga0501075_0010529
3036 Ga0501075_0013547
3037 Ga0501075_0184098
3038 Ga0501075_0513851
3039 Ga0501076_0019578
3040 Ga0501076_0063903
3041 Ga0501202_001611
3042 Ga0501202_001857
3043 Ga0501202_004746
3044 Ga0501207_004661
3045 Ga0501207_036712
3046 Ga0501208_008965
3047 Ga0501216_001320
3048 Ga0501216_002632
3049 Ga0501216_004153
3050 Ga0501217_000959
3051 Ga0501217_013085
3052 Ga0501223_007267
3053 Ga0501224_017737
3054 Ga0501224_019262
3055 Ga0501227_050285
3056 Ga0501230_065998
3057 Ga0501233_012213
3058 Ga0501233_028876
3059 Ga0501235_000791
3060 Ga0501235_014968
3061 Ga0501236_002221
3062 Ga0501238_010637
3063 Ga0501240_031937
3064 Ga0501243_006858
3065 Ga0501248_011107
3066 Ga0501249_012515
3067 Ga0501255_035757
3068 Ga0501256_009016
3069 Ga0501257_002272
3070 Ga0501259_014178
3071 Ga0501260_002503
3072 Ga0501221_002209
3073 Ga0501221_017076
3074 Ga0501225_0002723
3075 Ga0501225_0007510
3076 Ga0501229_002679
3077 Ga0501234_001188
3078 Ga0501234_010971
3079 Ga0501245_004341
3080 Ga0501245_008321
3081 Ga0501245_009125
3082 Ga0501245_010677
3083 Ga0501079_0145334
3084 Ga0501081_0005880
3085 Ga0501081_0240449
3086 Ga0501083_0107286
3087 Ga0501263_010518
3088 Ga0501271_007129
3089 Ga0501272_010296
3090 Ga0501283_000216
3091 Ga0501035_0391676
3092 Ga0501035_0458549
3093 Ga0501045_0014761
3094 Ga0501045_0018088
3095 Ga0501045_0073045
3096 Ga0501045_0227091
3097 Ga0501045_0501377
3098 Ga0501212_004175
3099 Ga0501212_009697
3100 Ga0501226_000317
3101 nmdc:mga05p37_105952_c1
3102 nmdc:mga05p37_174642_c1
3103 nmdc:mga05p37_195573_c1
3104 nmdc:mga05p37_214225_c1
3105 nmdc:mga05p37_2300_c1
3106 nmdc:mga05p37_242687_c1
3107 nmdc:mga05p37_288707_c1
3108 nmdc:mga05p37_30451_c1
3109 nmdc:mga05p37_348380_c1
3110 nmdc:mga05p37_410807_c1
3111 nmdc:mga05p37_464835_c1
3112 nmdc:mga05p37_578888_c1
3113 nmdc:mga05p37_635507_c1
3114 nmdc:mga05p37_676_c3
3115 nmdc:mga05p37_68918_c1
3116 nmdc:mga05p37_74269_c1
3117 nmdc:mga05p37_76064_c1
3118 nmdc:mga09592_119386_c1
3119 nmdc:mga09592_213718_c1
3120 nmdc:mga09592_322174_c1
3121 nmdc:mga09592_402562_c1
3122 nmdc:mga09592_44941_c1
3123 nmdc:mga0qj67_136307_c1
3124 nmdc:mga0qj67_176117_c1
3125 nmdc:mga0qj67_183486_c1
3126 nmdc:mga06r32_182220_c1
3127 nmdc:mga06r32_213024_c1
3128 nmdc:mga06r32_3408_c1
3129 nmdc:mga06r32_50481_c1
3130 nmdc:mga06r32_535525_c1
3131 nmdc:mga08y16_120867_c1
3132 nmdc:mga08y16_123202_c1
3133 nmdc:mga08y16_137917_c1
3134 nmdc:mga08y16_186145_c1
3135 nmdc:mga08y16_256169_c1
3136 nmdc:mga08y16_44547_c1
3137 nmdc:mga08y16_445716_c1
3138 nmdc:mga0n895_103584_c1
3139 nmdc:mga0n895_126564_c1
3140 nmdc:mga0n895_128885_c1
3141 nmdc:mga0n895_13733_c1
3142 nmdc:mga0n895_13865_c1
3143 nmdc:mga0n895_145356_c1
3144 nmdc:mga0n895_311002_c1
3145 nmdc:mga0n895_395313_c1
3146 nmdc:mga0n895_481191_c1
3147 nmdc:mga0n895_4814_c1
3148 nmdc:mga0n895_548617_c1
3149 nmdc:mga0n895_582112_c1
3150 nmdc:mga0n895_65860_c1
3151 nmdc:mga0n895_8850_c1
3152 nmdc:mga0rr50_108025_c1
3153 nmdc:mga0rr50_1523_c1
3154 nmdc:mga0rr50_1955_c1
3155 nmdc:mga0rr50_3936_c1
3156 nmdc:mga0rr50_45642_c1
3157 nmdc:mga0rr50_48159_c1
3158 nmdc:mga0rr50_496771_c1
3159 nmdc:mga08x19_12154_c1
3160 nmdc:mga08x19_174551_c1
3161 nmdc:mga08x19_19860_c1
3162 nmdc:mga08x19_342052_c1
3163 nmdc:mga08x19_57660_c1
3164 nmdc:mga08x19_79070_c1
3165 nmdc:mga08x19_8_c1
3166 nmdc:mga0a205_172074_c1
3167 nmdc:mga0a205_17249_c1
3168 nmdc:mga0a205_198572_c1
3169 nmdc:mga0a205_262105_c1
3170 nmdc:mga0a205_272478_c1
3171 nmdc:mga0a205_28144_c1
3172 nmdc:mga0a205_3032_c1
3173 nmdc:mga0a205_442681_c1
3174 nmdc:mga0a205_53065_c1
3175 nmdc:mga0a205_56867_c1
3176 nmdc:mga0a205_58042_c1
3177 nmdc:mga0a205_648634_c1
3178 Ga0495601_0016587
3179 Ga0495601_0182567
3180 Ga0495619_0018819
3181 Ga0501084_0338524
3182 Ga0587066_044316
3183 Ga0587077_017594
3184 Ga0587079_021322
3185 Ga0501082_0173787
3186 Ga0530510_0154138

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

59

169

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

203

279

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lxl-assembly1.cif.gz_A crystal structure of c-terminal dna-binding domain of escherichia coli ompr 0.9741 130 226
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9738 3 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9733 3 120
2ftk-assembly2.cif.gz_H berylloflouride spo0f complex with spo0b 0.9707 2 117
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9667 3 122
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9865 3 85 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9809 4 81 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9773 1 81 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9759 3 81 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9753 1 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A651EM46-F1-model_v4 EAL domain-containing protein 0.982 2 123 GO:0000160
GO:0071111
AF-A0A4P5XGE1-F1-model_v4 deleted 0.9804 1 120
AF-A0A523EAV0-F1-model_v4 Diguanylate cyclase 0.9738 1 121 GO:0000160
GO:0005886
GO:0043709
GO:0052621
GO:1902201
AF-A0A2N2TQE8-F1-model_v4 Adenylate/guanylate cyclase domain-containing response regulator 0.9734 3 120 GO:0000156
GO:0000976
GO:0004016
GO:0005829
GO:0006355
GO:0009190
GO:0032993
AF-A0A2J0KYQ6-F1-model_v4 Response regulatory domain-containing protein 0.9731 1 117 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map