F494709

General Info

Members Datasets Scaffolds Average Seq Length
1550 461 3100 116

Family's Representative Sequence

Representative Sequence 3300000549|LJQas_1007275|LJQas_10072751
Length 128
Sequence MTAVESSAAESQDDRFAYHRESSNRCGVTLMNNQNGYVVAEVMRGHEGVEVREYPSMIRIDGNNKIEFDFDEISEALGSEFDVYDFEEIMSTHYGRMVHLDDRTVLFANPEDAAEYIDFDLKVVEPGS

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
220 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
248 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
249 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
252 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
253 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
256 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
257 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
258 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
263 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
264 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
265 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
266 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
333 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
383 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
384 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
385 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
386 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
387 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
389 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
449 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
450 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
451 2527291627 Frankia casuarinae Thr Isolate Nodule
452 2527291629 Frankia sp. BMG5.23 Isolate Nodule
453 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
454 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
455 2576861822 Frankia sp. CeD Isolate Nodule
456 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
457 2773857924 Frankia sp. CgIS1 Isolate Nodule
458 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
459 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
460 637000116 Frankia casuarinae CcI3 Isolate Nodule
461 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 56.58
Metatranscriptomes 42.71
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0.32
Rhizoplane 4.84
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1007275 3300000549 Bacteria 1362
2 bgg_mtDRAFT_1037018 3300000305 Bacteria 1261
3 JGI24739J22299_10100985 3300001989 Bacteria 871
4 JGI24737J22298_10154805 3300001990 Bacteria 676
5 JGI24743J22301_10006549 3300001991 Bacteria 1990
6 JGI24743J22301_10010932 3300001991 Bacteria 1626
7 JGI24744J21845_10032804 3300002077 Bacteria 989
8 Ga0006765J45826_106115 3300003161 Bacteria 683
9 Ga0006770J48903_1024152 3300003305 Bacteria 509
10 Ga0006770J48903_1036028 3300003305 Bacteria 633
11 Ga0006770J48903_1044414 3300003305 Bacteria 825
12 rootH2_10037862 3300003320 Bacteria 2584
13 JGI25407J50210_10010461 3300003373 Bacteria 2361
14 JGI25407J50210_10022104 3300003373 Bacteria 1654
15 JGI25407J50210_10058016 3300003373 Bacteria 975
16 JGI25407J50210_10068958 3300003373 Bacteria 884
17 Ga0007417J51691_1011844 3300003544 Bacteria 899
18 Ga0007417J51691_1020894 3300003544 Bacteria 2184
19 Ga0007417J51691_1023789 3300003544 Bacteria 1071
20 Ga0007417J51691_1029232 3300003544 Bacteria 1309
21 Ga0007417J51691_1031395 3300003544 Bacteria 1260
22 Ga0007417J51691_1032285 3300003544 Bacteria 775
23 Ga0007417J51691_1033691 3300003544 Bacteria 982
24 Ga0006781J51513_1006097 3300003568 Bacteria 1615
25 Ga0006781J51513_1013153 3300003568 Bacteria 616
26 Ga0006781J51513_1016077 3300003568 Bacteria 564
27 Ga0007410J51695_1008856 3300003574 Bacteria 1923
28 Ga0007410J51695_1018389 3300003574 Bacteria 963
29 Ga0007410J51695_1042192 3300003574 Bacteria 906
30 Ga0007409J51694_1007741 3300003575 Bacteria 876
31 Ga0007409J51694_1007742 3300003575 Bacteria 1040
32 Ga0007409J51694_1011577 3300003575 Bacteria 922
33 Ga0007409J51694_1019397 3300003575 Bacteria 1047
34 Ga0007409J51694_1022556 3300003575 Bacteria 1638
35 Ga0007409J51694_1041078 3300003575 Bacteria 1359
36 Ga0007416J51690_1009019 3300003577 Bacteria 1173
37 Ga0007416J51690_1011696 3300003577 Bacteria 773
38 Ga0007416J51690_1018488 3300003577 Bacteria 540
39 Ga0007416J51690_1021822 3300003577 Bacteria 607
40 Ga0007416J51690_1050276 3300003577 Bacteria 826
41 Ga0007429J51699_1013820 3300003579 Bacteria 1145
42 Ga0007429J51699_1020887 3300003579 Bacteria 818
43 Ga0007429J51699_1021803 3300003579 Bacteria 1436
44 Ga0007429J51699_1034151 3300003579 Bacteria 1503
45 Ga0007429J51699_1039154 3300003579 Bacteria 1210
46 Ga0007429J51699_1080258 3300003579 Bacteria 838
47 Ga0032354_1003417 3300003693 Bacteria 857
48 Ga0032354_1023209 3300003693 Bacteria 992
49 Ga0032354_1033193 3300003693 Bacteria 709
50 Ga0032354_1037363 3300003693 Bacteria 658
51 Ga0032354_1043219 3300003693 Bacteria 1251
52 Ga0032354_1048438 3300003693 Bacteria 1586
53 Ga0058858_1001640 3300004785 Bacteria 2505
54 Ga0058858_1035079 3300004785 Bacteria 1353
55 Ga0058858_1428512 3300004785 Bacteria 868
56 Ga0058858_1438279 3300004785 Bacteria 630
57 Ga0058859_10007395 3300004798 Bacteria 779
58 Ga0058859_10039925 3300004798 Bacteria 1522
59 Ga0058859_10052612 3300004798 Bacteria 1792
60 Ga0058859_10056563 3300004798 Bacteria 1243
61 Ga0058859_10095538 3300004798 Bacteria 3204
62 Ga0058859_11773704 3300004798 Bacteria 947
63 Ga0058863_10003259 3300004799 Bacteria 1911
64 Ga0058863_10055411 3300004799 Bacteria 1158
65 Ga0058863_10088008 3300004799 Bacteria 1082
66 Ga0058863_11727525 3300004799 Bacteria 661
67 Ga0058863_11902200 3300004799 Bacteria 745
68 Ga0058863_11942052 3300004799 Bacteria 762
69 Ga0058863_11943932 3300004799 Bacteria 1422
70 Ga0058861_10024395 3300004800 Bacteria 1614
71 Ga0058861_10024951 3300004800 Bacteria 957
72 Ga0058861_10043603 3300004800 Bacteria 1698
73 Ga0058861_10071225 3300004800 Bacteria 1693
74 Ga0058861_10075982 3300004800 Bacteria 609
75 Ga0058861_10083556 3300004800 Bacteria 2423
76 Ga0058861_10150641 3300004800 Bacteria 1558
77 Ga0058861_11798679 3300004800 Bacteria 669
78 Ga0058861_11977214 3300004800 Bacteria 544
79 Ga0058861_12056731 3300004800 Bacteria 839
80 Ga0058860_10041629 3300004801 Bacteria 1366
81 Ga0058860_10053668 3300004801 Bacteria 2080
82 Ga0058860_10134167 3300004801 Bacteria 2324
83 Ga0058860_10154251 3300004801 Bacteria 1297
84 Ga0058860_12159347 3300004801 Bacteria 652
85 Ga0058860_12212618 3300004801 Bacteria 898
86 Ga0058862_10048961 3300004803 Bacteria 1594
87 Ga0058862_10053678 3300004803 Bacteria 904
88 Ga0058862_10057100 3300004803 Bacteria 1442
89 Ga0058862_10060482 3300004803 Bacteria 1205
90 Ga0058862_10060744 3300004803 Bacteria 2841
91 Ga0058862_10105153 3300004803 Bacteria 1764
92 Ga0058862_10253325 3300004803 Bacteria 2129
93 Ga0058862_10270879 3300004803 Bacteria 2731
94 Ga0058862_12828490 3300004803 Bacteria 790
95 Ga0058862_12840016 3300004803 Bacteria 619
96 Ga0058862_12863248 3300004803 Bacteria 1158
97 Ga0070658_10599438 3300005327 Bacteria 955
98 Ga0070676_10435713 3300005328 Bacteria 919
99 Ga0070683_100072328 3300005329 Bacteria 3218
100 Ga0070683_100202443 3300005329 Bacteria 1885
101 Ga0070683_100609912 3300005329 Bacteria 1045
102 Ga0070683_100627640 3300005329 Bacteria 1029
103 Ga0070683_100839796 3300005329 Bacteria 881
104 Ga0070683_100959124 3300005329 Bacteria 821
105 Ga0070690_100855116 3300005330 Bacteria 709
106 Ga0070690_101576115 3300005330 Bacteria 532
107 Ga0070670_100368653 3300005331 Bacteria 1264
108 Ga0070677_10109300 3300005333 Bacteria 1232
109 Ga0068869_100495114 3300005334 Bacteria 1019
110 Ga0068869_102018736 3300005334 Bacteria 518
111 Ga0070666_10633179 3300005335 Bacteria 782
112 Ga0070680_101448709 3300005336 Bacteria 595
113 Ga0070680_101506020 3300005336 Bacteria 583
114 Ga0070682_100685631 3300005337 Bacteria 820
115 Ga0070682_100924541 3300005337 Bacteria 718
116 Ga0070682_101001488 3300005337 Bacteria 693
117 Ga0070682_101190278 3300005337 Bacteria 643
118 Ga0070682_101774655 3300005337 Bacteria 538
119 Ga0068868_100035170 3300005338 Bacteria 3871
120 Ga0068868_100055544 3300005338 Bacteria 3125
121 Ga0068868_100666726 3300005338 Bacteria 928
122 Ga0068868_100754730 3300005338 Bacteria 874
123 Ga0068868_100875139 3300005338 Bacteria 815
124 Ga0068868_101154274 3300005338 Bacteria 715
125 Ga0068868_101376143 3300005338 Bacteria 658
126 Ga0068868_102153452 3300005338 Bacteria 531
127 Ga0070660_100456127 3300005339 Bacteria 1061
128 Ga0070660_100599909 3300005339 Bacteria 921
129 Ga0070660_101375065 3300005339 Bacteria 600
130 Ga0070660_101539022 3300005339 Bacteria 566
131 Ga0070689_100604638 3300005340 Bacteria 950
132 Ga0070691_10145866 3300005341 Bacteria 1210
133 Ga0070691_10244589 3300005341 Bacteria 960
134 Ga0070687_100142621 3300005343 Bacteria 1397
135 Ga0070661_100624402 3300005344 Bacteria 873
136 Ga0070661_100837144 3300005344 Bacteria 757
137 Ga0070661_100862549 3300005344 Bacteria 746
138 Ga0070661_101215586 3300005344 Bacteria 631
139 Ga0070692_10150862 3300005345 Bacteria 1324
140 Ga0070668_100228838 3300005347 Bacteria 1536
141 Ga0070668_101426143 3300005347 Bacteria 632
142 Ga0070668_101532898 3300005347 Bacteria 610
143 Ga0070669_100125620 3300005353 Bacteria 1963
144 Ga0070669_100148199 3300005353 Bacteria 1814
145 Ga0070669_101363192 3300005353 Bacteria 615
146 Ga0070671_100147713 3300005355 Bacteria 1985
147 Ga0070671_100940707 3300005355 Bacteria 756
148 Ga0070671_101122269 3300005355 Bacteria 691
149 Ga0070674_100459216 3300005356 Bacteria 1053
150 Ga0070674_101090667 3300005356 Bacteria 704
151 Ga0070674_101599540 3300005356 Bacteria 588
152 Ga0070673_100065020 3300005364 Bacteria 2908
153 Ga0070673_100326373 3300005364 Bacteria 1357
154 Ga0070688_100157089 3300005365 Bacteria 1559
155 Ga0070659_100097958 3300005366 Bacteria 2357
156 Ga0070659_100112896 3300005366 Bacteria 2194
157 Ga0070659_100513301 3300005366 Bacteria 1023
158 Ga0070659_101540267 3300005366 Bacteria 593
159 Ga0070667_100068700 3300005367 Bacteria 3015
160 Ga0070667_100328191 3300005367 Bacteria 1382
161 Ga0070667_100517309 3300005367 Bacteria 1095
162 Ga0070667_100964915 3300005367 Bacteria 795
163 Ga0070709_10883544 3300005434 Bacteria 706
164 Ga0070709_11117971 3300005434 Bacteria 631
165 Ga0070714_100199986 3300005435 Bacteria 1827
166 Ga0070714_100233213 3300005435 Bacteria 1696
167 Ga0070713_100554814 3300005436 Bacteria 1088
168 Ga0070713_100878073 3300005436 Bacteria 862
169 Ga0070710_10910099 3300005437 Bacteria 635
170 Ga0070701_10015984 3300005438 Bacteria 3479
171 Ga0070701_10630101 3300005438 Bacteria 713
172 Ga0070705_100055200 3300005440 Bacteria 2334
173 Ga0070700_100140647 3300005441 Bacteria 1640
174 Ga0070700_100156908 3300005441 Bacteria 1562
175 Ga0070700_100302245 3300005441 Bacteria 1168
176 Ga0070700_100329018 3300005441 Bacteria 1125
177 Ga0070700_100466207 3300005441 Bacteria 964
178 Ga0070700_100555027 3300005441 Bacteria 893
179 Ga0070700_100568357 3300005441 Bacteria 884
180 Ga0070700_100703542 3300005441 Bacteria 804
181 Ga0070694_100095580 3300005444 Bacteria 2093
182 Ga0070694_100470840 3300005444 Bacteria 995
183 Ga0070663_100262783 3300005455 Bacteria 1370
184 Ga0070663_100511201 3300005455 Bacteria 999
185 Ga0070663_101170247 3300005455 Bacteria 675
186 Ga0070678_100518942 3300005456 Bacteria 1054
187 Ga0070678_100755865 3300005456 Bacteria 880
188 Ga0070662_100162562 3300005457 Bacteria 1747
189 Ga0070662_100191026 3300005457 Bacteria 1619
190 Ga0068867_100342253 3300005459 Bacteria 1245
191 Ga0070685_10379059 3300005466 Bacteria 974
192 Ga0070685_10406983 3300005466 Bacteria 943
193 Ga0070706_101703484 3300005467 Bacteria 574
194 Ga0070679_101300920 3300005530 Bacteria 673
195 Ga0070679_101577828 3300005530 Bacteria 604
196 Ga0070679_101669664 3300005530 Bacteria 585
197 Ga0070684_100047435 3300005535 Bacteria 3723
198 Ga0070684_100314713 3300005535 Bacteria 1437
199 Ga0070684_100398936 3300005535 Bacteria 1268
200 Ga0070684_100538851 3300005535 Bacteria 1083
201 Ga0070684_100570603 3300005535 Bacteria 1051
202 Ga0070684_101270674 3300005535 Bacteria 693
203 Ga0070697_100907460 3300005536 Bacteria 782
204 Ga0068853_100112495 3300005539 Bacteria 2420
205 Ga0068853_100753506 3300005539 Bacteria 931
206 Ga0068853_101215439 3300005539 Bacteria 728
207 Ga0070672_100405697 3300005543 Bacteria 1169
208 Ga0070672_102041055 3300005543 Bacteria 517
209 Ga0070686_100385048 3300005544 Bacteria 1062
210 Ga0070695_101035449 3300005545 Bacteria 669
211 Ga0070696_100195216 3300005546 Bacteria 1508
212 Ga0070696_101386851 3300005546 Bacteria 599
213 Ga0070693_100732703 3300005547 Bacteria 727
214 Ga0070665_101663393 3300005548 Bacteria 646
215 Ga0068855_100467800 3300005563 Bacteria 1374
216 Ga0070664_100038021 3300005564 Bacteria 4049
217 Ga0070664_100326428 3300005564 Bacteria 1391
218 Ga0070664_100356458 3300005564 Bacteria 1332
219 Ga0070664_100542883 3300005564 Bacteria 1074
220 Ga0070664_100547388 3300005564 Bacteria 1070
221 Ga0070664_100588177 3300005564 Bacteria 1031
222 Ga0068857_101170658 3300005577 Bacteria 744
223 Ga0068857_101435059 3300005577 Bacteria 672
224 Ga0068857_101501003 3300005577 Bacteria 657
225 Ga0068854_100133284 3300005578 Bacteria 1899
226 Ga0068854_100192331 3300005578 Bacteria 1599
227 Ga0068854_100208031 3300005578 Bacteria 1542
228 Ga0068856_100156611 3300005614 Bacteria 2288
229 Ga0070702_100005968 3300005615 Bacteria 5729
230 Ga0070702_100094856 3300005615 Bacteria 1817
231 Ga0070702_100100036 3300005615 Bacteria 1777
232 Ga0070702_100148753 3300005615 Bacteria 1501
233 Ga0070702_100215487 3300005615 Bacteria 1281
234 Ga0070702_100753777 3300005615 Bacteria 748
235 Ga0070702_100829735 3300005615 Bacteria 717
236 Ga0070702_100873534 3300005615 Bacteria 702
237 Ga0068852_100148741 3300005616 Bacteria 2175
238 Ga0068852_100169066 3300005616 Bacteria 2048
239 Ga0068852_100486021 3300005616 Bacteria 1228
240 Ga0068859_100238473 3300005617 Bacteria 1907
241 Ga0068859_100443167 3300005617 Bacteria 1395
242 Ga0068859_101302505 3300005617 Bacteria 801
243 Ga0068864_100178065 3300005618 Bacteria 1942
244 Ga0068864_100215043 3300005618 Bacteria 1771
245 Ga0068864_100632467 3300005618 Bacteria 1041
246 Ga0068864_101953739 3300005618 Bacteria 593
247 Ga0068864_102048266 3300005618 Bacteria 579
248 Ga0068866_10019649 3300005718 Bacteria 3081
249 Ga0068866_10290617 3300005718 Bacteria 1016
250 Ga0068866_10774535 3300005718 Bacteria 665
251 Ga0068861_100028854 3300005719 Bacteria 4052
252 Ga0068861_100267341 3300005719 Bacteria 1467
253 Ga0068861_102141785 3300005719 Bacteria 560
254 Ga0068861_102240874 3300005719 Bacteria 548
255 Ga0068861_102376794 3300005719 Bacteria 533
256 Ga0068851_10159693 3300005834 Bacteria 1237
257 Ga0068851_10481159 3300005834 Bacteria 742
258 Ga0068870_10169519 3300005840 Bacteria 1302
259 Ga0068870_10572242 3300005840 Bacteria 764
260 Ga0068870_10848555 3300005840 Bacteria 642
261 Ga0068870_11076824 3300005840 Bacteria 577
262 Ga0068863_100748762 3300005841 Bacteria 973
263 Ga0068863_100827451 3300005841 Bacteria 924
264 Ga0068863_101904246 3300005841 Bacteria 605
265 Ga0068858_100047141 3300005842 Bacteria 3996
266 Ga0068858_100437264 3300005842 Bacteria 1260
267 Ga0068858_101085829 3300005842 Bacteria 785
268 Ga0068858_101928464 3300005842 Bacteria 584
269 Ga0068860_100380868 3300005843 Bacteria 1393
270 Ga0068860_101387967 3300005843 Bacteria 724
271 Ga0068862_100174048 3300005844 Bacteria 1928
272 Ga0068862_100485760 3300005844 Bacteria 1170
273 Ga0081455_10066477 3300005937 Bacteria 3011
274 Ga0081455_10125348 3300005937 Bacteria 2017
275 Ga0081455_10128478 3300005937 Bacteria 1985
276 Ga0081455_10268510 3300005937 Bacteria 1239
277 Ga0081455_10269260 3300005937 Bacteria 1237
278 Ga0081455_10407928 3300005937 Bacteria 941
279 Ga0081538_10000664 3300005981 Bacteria 37865
280 Ga0081538_10008845 3300005981 Bacteria 8475
281 Ga0081538_10009398 3300005981 Bacteria 8169
282 Ga0081538_10030120 3300005981 Bacteria 3692
283 Ga0081538_10052198 3300005981 Bacteria 2446
284 Ga0081538_10170267 3300005981 Bacteria 951
285 Ga0081540_1022450 3300005983 Bacteria 3727
286 Ga0081540_1331141 3300005983 Bacteria 522
287 Ga0081539_10121012 3300005985 Bacteria 1300
288 Ga0081539_10245063 3300005985 Bacteria 800
289 Ga0070717_10062040 3300006028 Bacteria 3099
290 Ga0070717_10110108 3300006028 Bacteria 2348
291 Ga0070717_11117588 3300006028 Bacteria 718
292 Ga0075365_10202400 3300006038 Bacteria 1391
293 Ga0075365_10224296 3300006038 Bacteria 1319
294 Ga0075365_10285206 3300006038 Bacteria 1162
295 Ga0075363_100741067 3300006048 Bacteria 595
296 Ga0075432_10441052 3300006058 Bacteria 570
297 Ga0070712_100383841 3300006175 Bacteria 1157
298 Ga0097621_100244419 3300006237 Bacteria 1570
299 Ga0097621_101929724 3300006237 Bacteria 564
300 Ga0068871_100528844 3300006358 Bacteria 1066
301 Ga0068871_100833751 3300006358 Bacteria 852
302 Ga0075431_100347623 3300006847 Bacteria 1491
303 Ga0075433_10491591 3300006852 Bacteria 1080
304 Ga0068865_100113770 3300006881 Bacteria 2000
305 Ga0068865_100338298 3300006881 Bacteria 1216
306 Ga0068865_100951209 3300006881 Bacteria 750
307 Ga0068865_102140123 3300006881 Bacteria 509
308 Ga0097620_100238483 3300006931 Bacteria 1907
309 Ga0097620_100443170 3300006931 Bacteria 1395
310 Ga0097620_101302375 3300006931 Bacteria 801
311 Ga0099795_10000516 3300007788 Bacteria 7255
312 Ga0105244_10045580 3300009036 Bacteria 2255
313 Ga0105240_12152258 3300009093 Bacteria 579
314 Ga0111539_10007452 3300009094 Bacteria 14019
315 Ga0111539_10084596 3300009094 Bacteria 3729
316 Ga0111539_10437064 3300009094 Bacteria 1524
317 Ga0111539_10560598 3300009094 Bacteria 1330
318 Ga0111539_11025554 3300009094 Bacteria 959
319 Ga0111539_11770868 3300009094 Bacteria 716
320 Ga0105245_10022555 3300009098 Bacteria 5526
321 Ga0105245_10630595 3300009098 Bacteria 1101
322 Ga0105245_11361976 3300009098 Bacteria 759
323 Ga0105245_11912945 3300009098 Bacteria 646
324 Ga0105245_12286903 3300009098 Bacteria 594
325 Ga0105245_12339952 3300009098 Bacteria 588
326 Ga0105245_12950837 3300009098 Bacteria 527
327 Ga0105247_10368293 3300009101 Bacteria 1015
328 Ga0105247_10403907 3300009101 Bacteria 974
329 Ga0105247_10734927 3300009101 Bacteria 746
330 Ga0114129_12214805 3300009147 Bacteria 661
331 Ga0114129_13055305 3300009147 Bacteria 548
332 Ga0105243_10048410 3300009148 Bacteria 3351
333 Ga0105243_10071897 3300009148 Bacteria 2798
334 Ga0105243_10179357 3300009148 Bacteria 1841
335 Ga0105243_10213753 3300009148 Bacteria 1700
336 Ga0105243_10304961 3300009148 Bacteria 1445
337 Ga0105243_11315281 3300009148 Bacteria 740
338 Ga0105243_11734047 3300009148 Bacteria 654
339 Ga0105241_10173608 3300009174 Bacteria 1782
340 Ga0105241_10638040 3300009174 Bacteria 966
341 Ga0105241_10641548 3300009174 Bacteria 964
342 Ga0105241_11691031 3300009174 Bacteria 615
343 Ga0105242_10042742 3300009176 Bacteria 3662
344 Ga0105242_10379605 3300009176 Bacteria 1313
345 Ga0105242_10509902 3300009176 Bacteria 1146
346 Ga0105242_11128143 3300009176 Bacteria 800
347 Ga0105248_11377886 3300009177 Bacteria 798
348 Ga0105248_13301844 3300009177 Bacteria 513
349 Ga0105237_11732556 3300009545 Bacteria 632
350 Ga0105237_11850821 3300009545 Bacteria 611
351 Ga0105238_10056515 3300009551 Bacteria 3937
352 Ga0105238_11351259 3300009551 Bacteria 739
353 Ga0105238_11446994 3300009551 Bacteria 715
354 Ga0105249_10080410 3300009553 Bacteria 3027
355 Ga0105249_10263012 3300009553 Bacteria 1715
356 Ga0105249_10341069 3300009553 Bacteria 1515
357 Ga0105249_10459598 3300009553 Bacteria 1313
358 Ga0105249_11165937 3300009553 Bacteria 841
359 Ga0105035_100266 3300009988 Bacteria 3348
360 Ga0099796_10014450 3300010159 Bacteria 2282
361 Ga0105239_10225017 3300010375 Bacteria 2104
362 Ga0105239_10335464 3300010375 Bacteria 1706
363 Ga0105239_10366509 3300010375 Bacteria 1628
364 Ga0105239_10601639 3300010375 Bacteria 1254
365 Ga0105239_11030401 3300010375 Bacteria 947
366 Ga0105239_11478105 3300010375 Bacteria 785
367 Ga0105246_10160157 3300011119 Bacteria 1714
368 Ga0105246_10165043 3300011119 Bacteria 1691
369 Ga0105246_10557737 3300011119 Bacteria 983
370 Ga0105246_10603067 3300011119 Bacteria 949
371 Ga0105246_12111238 3300011119 Bacteria 546
372 Ga0157341_1020259 3300012494 Bacteria 650
373 Ga0157373_10257737 3300013100 Bacteria 1234
374 Ga0157371_10109900 3300013102 Bacteria 1957
375 Ga0157371_10710014 3300013102 Bacteria 753
376 Ga0157371_10838035 3300013102 Bacteria 695
377 Ga0157371_11192176 3300013102 Bacteria 586
378 Ga0157369_10394030 3300013105 Bacteria 1437
379 Ga0157369_10883201 3300013105 Bacteria 917
380 Ga0157374_10113464 3300013296 Bacteria 2608
381 Ga0157374_11407785 3300013296 Bacteria 720
382 Ga0157374_11680570 3300013296 Bacteria 659
383 Ga0157374_11940134 3300013296 Bacteria 615
384 Ga0157374_11954601 3300013296 Bacteria 613
385 Ga0157374_12446891 3300013296 Bacteria 550
386 Ga0157378_10618109 3300013297 Bacteria 1096
387 Ga0157378_10748200 3300013297 Bacteria 1000
388 Ga0157378_10887486 3300013297 Bacteria 922
389 Ga0157378_10894874 3300013297 Bacteria 918
390 Ga0163162_10412857 3300013306 Bacteria 1482
391 Ga0163162_11490716 3300013306 Bacteria 770
392 Ga0163162_12088732 3300013306 Bacteria 650
393 Ga0163162_12089425 3300013306 Bacteria 650
394 Ga0163162_12236230 3300013306 Bacteria 628
395 Ga0163162_12291519 3300013306 Bacteria 620
396 Ga0157372_10104427 3300013307 Bacteria 3239
397 Ga0157372_10504305 3300013307 Bacteria 1411
398 Ga0157372_10578628 3300013307 Bacteria 1309
399 Ga0157372_10716473 3300013307 Bacteria 1164
400 Ga0157372_12126498 3300013307 Bacteria 645
401 Ga0157375_10174399 3300013308 Bacteria 2299
402 Ga0157375_10429033 3300013308 Bacteria 1488
403 Ga0157375_10494744 3300013308 Bacteria 1387
404 Ga0157375_13175425 3300013308 Bacteria 548
405 Ga0163163_13295134 3300014325 Bacteria 503
406 Ga0157380_10109278 3300014326 Bacteria 2320
407 Ga0157380_10403373 3300014326 Bacteria 1298
408 Ga0157380_12030140 3300014326 Bacteria 637
409 Ga0182008_10436448 3300014497 Bacteria 709
410 Ga0182008_10568077 3300014497 Bacteria 632
411 Ga0157377_10150374 3300014745 Bacteria 1439
412 Ga0157377_10458470 3300014745 Bacteria 882
413 Ga0157377_10520742 3300014745 Bacteria 835
414 Ga0157377_11189267 3300014745 Bacteria 590
415 Ga0157379_10291540 3300014968 Bacteria 1486
416 Ga0157379_11165340 3300014968 Bacteria 740
417 Ga0157379_11686778 3300014968 Bacteria 620
418 Ga0157376_10720216 3300014969 Bacteria 1004
419 Ga0157376_10809898 3300014969 Bacteria 950
420 Ga0163161_10228459 3300017792 Bacteria 1443
421 Ga0163161_10609151 3300017792 Bacteria 901
422 Ga0163161_11021927 3300017792 Bacteria 707
423 Ga0163161_11062866 3300017792 Bacteria 694
424 Ga0163161_11726911 3300017792 Bacteria 555
425 Ga0163161_11953049 3300017792 Bacteria 522
426 Ga0197907_10559423 3300020069 Bacteria 700
427 Ga0197907_10685680 3300020069 Bacteria 1082
428 Ga0197907_11395746 3300020069 Bacteria 1695
429 Ga0206356_10170539 3300020070 Bacteria 1057
430 Ga0206356_10275481 3300020070 Bacteria 516
431 Ga0206356_10811388 3300020070 Bacteria 1479
432 Ga0206356_11208272 3300020070 Bacteria 1058
433 Ga0206356_11567341 3300020070 Bacteria 1010
434 Ga0206349_1383806 3300020075 Bacteria 760
435 Ga0206355_1021710 3300020076 Bacteria 528
436 Ga0206352_10107249 3300020078 Bacteria 845
437 Ga0206352_10590329 3300020078 Bacteria 842
438 Ga0206352_10818017 3300020078 Bacteria 683
439 Ga0206350_10917422 3300020080 Bacteria 1006
440 Ga0206350_11505953 3300020080 Bacteria 1429
441 Ga0206350_11570365 3300020080 Bacteria 579
442 Ga0206354_10732226 3300020081 Bacteria 670
443 Ga0206354_10751741 3300020081 Bacteria 518
444 Ga0206354_11379949 3300020081 Bacteria 967
445 Ga0206353_10241100 3300020082 Bacteria 535
446 Ga0206353_10477591 3300020082 Bacteria 602
447 Ga0206353_11170794 3300020082 Bacteria 558
448 Ga0206353_11391376 3300020082 Bacteria 841
449 Ga0206353_11649880 3300020082 Bacteria 1026
450 Ga0213875_10000186 3300021388 Bacteria 63592
451 Ga0224712_10371560 3300022467 Bacteria 678
452 Ga0207426_1018112 3300025302 Bacteria 2488
453 Ga0207426_1124550 3300025302 Bacteria 632
454 Ga0207697_10284075 3300025315 Bacteria 733
455 Ga0207656_10087858 3300025321 Bacteria 1407
456 Ga0207656_10373081 3300025321 Bacteria 714
457 Ga0207653_10345804 3300025885 Bacteria 580
458 Ga0207682_10075049 3300025893 Bacteria 1439
459 Ga0207692_10086812 3300025898 Bacteria 1687
460 Ga0207692_10429837 3300025898 Bacteria 828
461 Ga0207692_10766509 3300025898 Bacteria 629
462 Ga0207642_10115606 3300025899 Bacteria 1374
463 Ga0207642_10226435 3300025899 Bacteria 1048
464 Ga0207642_10343382 3300025899 Bacteria 878
465 Ga0207710_10066252 3300025900 Bacteria 1648
466 Ga0207688_10006305 3300025901 Bacteria 6458
467 Ga0207688_10149196 3300025901 Bacteria 1380
468 Ga0207647_10130772 3300025904 Bacteria 1475
469 Ga0207647_10419278 3300025904 Bacteria 753
470 Ga0207685_10060235 3300025905 Bacteria 1500
471 Ga0207645_10081146 3300025907 Bacteria 2079
472 Ga0207645_10226161 3300025907 Bacteria 1234
473 Ga0207643_10061448 3300025908 Bacteria 2146
474 Ga0207643_10104243 3300025908 Bacteria 1665
475 Ga0207643_10117336 3300025908 Bacteria 1573
476 Ga0207643_10138730 3300025908 Bacteria 1451
477 Ga0207705_10054463 3300025909 Bacteria 2883
478 Ga0207654_10240415 3300025911 Bacteria 1210
479 Ga0207654_10328311 3300025911 Bacteria 1048
480 Ga0207707_11454280 3300025912 Bacteria 545
481 Ga0207695_10406402 3300025913 Bacteria 1246
482 Ga0207671_10611250 3300025914 Bacteria 869
483 Ga0207663_10599426 3300025916 Bacteria 865
484 Ga0207660_11157018 3300025917 Bacteria 630
485 Ga0207660_11483633 3300025917 Bacteria 548
486 Ga0207662_10030208 3300025918 Bacteria 3144
487 Ga0207662_10097614 3300025918 Bacteria 1816
488 Ga0207662_10182117 3300025918 Bacteria 1352
489 Ga0207662_10408059 3300025918 Bacteria 922
490 Ga0207657_10060828 3300025919 Bacteria 3240
491 Ga0207657_10273336 3300025919 Bacteria 1343
492 Ga0207657_10437776 3300025919 Bacteria 1026
493 Ga0207649_10207360 3300025920 Bacteria 1388
494 Ga0207649_10318788 3300025920 Bacteria 1141
495 Ga0207652_11405623 3300025921 Bacteria 601
496 Ga0207646_10342955 3300025922 Bacteria 1350
497 Ga0207681_10296625 3300025923 Bacteria 1278
498 Ga0207681_10438408 3300025923 Bacteria 1061
499 Ga0207681_11130789 3300025923 Bacteria 658
500 Ga0207694_10082177 3300025924 Bacteria 2532
501 Ga0207694_10161392 3300025924 Bacteria 1810
502 Ga0207694_10301109 3300025924 Bacteria 1320
503 Ga0207694_10905386 3300025924 Bacteria 746
504 Ga0207659_10218490 3300025926 Bacteria 1531
505 Ga0207659_10607951 3300025926 Bacteria 932
506 Ga0207687_10065756 3300025927 Bacteria 2575
507 Ga0207687_10096654 3300025927 Bacteria 2165
508 Ga0207687_10255396 3300025927 Bacteria 1395
509 Ga0207687_10274063 3300025927 Bacteria 1350
510 Ga0207687_10387045 3300025927 Bacteria 1147
511 Ga0207687_11285005 3300025927 Bacteria 629
512 Ga0207700_10081286 3300025928 Bacteria 2530
513 Ga0207700_11151663 3300025928 Bacteria 693
514 Ga0207664_10239794 3300025929 Bacteria 1579
515 Ga0207664_10249508 3300025929 Bacteria 1549
516 Ga0207644_10814765 3300025931 Bacteria 781
517 Ga0207644_11475183 3300025931 Bacteria 571
518 Ga0207644_11504483 3300025931 Bacteria 565
519 Ga0207690_10117990 3300025932 Bacteria 1922
520 Ga0207690_10193012 3300025932 Bacteria 1541
521 Ga0207690_10350225 3300025932 Bacteria 1168
522 Ga0207690_11018432 3300025932 Bacteria 689
523 Ga0207690_11507783 3300025932 Bacteria 562
524 Ga0207706_10342067 3300025933 Bacteria 1301
525 Ga0207706_10416919 3300025933 Bacteria 1163
526 Ga0207706_10567251 3300025933 Bacteria 976
527 Ga0207706_10683154 3300025933 Bacteria 878
528 Ga0207706_11015186 3300025933 Bacteria 696
529 Ga0207686_10219923 3300025934 Bacteria 1371
530 Ga0207686_10319424 3300025934 Bacteria 1159
531 Ga0207709_10016973 3300025935 Bacteria 4057
532 Ga0207709_10150636 3300025935 Bacteria 1611
533 Ga0207709_10252942 3300025935 Bacteria 1288
534 Ga0207709_10261617 3300025935 Bacteria 1269
535 Ga0207709_10267706 3300025935 Bacteria 1256
536 Ga0207709_10506832 3300025935 Bacteria 943
537 Ga0207670_10015950 3300025936 Bacteria 4501
538 Ga0207670_10558913 3300025936 Bacteria 936
539 Ga0207670_11655283 3300025936 Bacteria 544
540 Ga0207669_10465844 3300025937 Bacteria 1004
541 Ga0207704_10046576 3300025938 Bacteria 2586
542 Ga0207704_10568324 3300025938 Bacteria 924
543 Ga0207704_11473372 3300025938 Bacteria 584
544 Ga0207704_11703365 3300025938 Bacteria 542
545 Ga0207665_11215471 3300025939 Bacteria 601
546 Ga0207691_10128791 3300025940 Bacteria 2237
547 Ga0207691_10222398 3300025940 Bacteria 1637
548 Ga0207691_10231547 3300025940 Bacteria 1600
549 Ga0207711_10598136 3300025941 Bacteria 1029
550 Ga0207689_10385010 3300025942 Bacteria 1168
551 Ga0207689_10523120 3300025942 Bacteria 995
552 Ga0207689_10623572 3300025942 Bacteria 908
553 Ga0207661_10073549 3300025944 Bacteria 2799
554 Ga0207661_10367696 3300025944 Bacteria 1300
555 Ga0207661_10562315 3300025944 Bacteria 1045
556 Ga0207661_10626967 3300025944 Bacteria 988
557 Ga0207661_11013008 3300025944 Bacteria 765
558 Ga0207661_11068171 3300025944 Bacteria 743
559 Ga0207661_11448385 3300025944 Bacteria 630
560 Ga0207679_10098467 3300025945 Bacteria 2280
561 Ga0207679_10139564 3300025945 Bacteria 1957
562 Ga0207679_10293666 3300025945 Bacteria 1398
563 Ga0207679_10310375 3300025945 Bacteria 1362
564 Ga0207679_10379276 3300025945 Bacteria 1239
565 Ga0207679_10565132 3300025945 Bacteria 1022
566 Ga0207679_10706117 3300025945 Bacteria 915
567 Ga0207667_10209220 3300025949 Bacteria 2000
568 Ga0207667_10632047 3300025949 Bacteria 1077
569 Ga0207651_10749441 3300025960 Bacteria 863
570 Ga0207651_10899179 3300025960 Bacteria 788
571 Ga0207651_12092025 3300025960 Bacteria 508
572 Ga0207712_10345794 3300025961 Bacteria 1235
573 Ga0207712_10583914 3300025961 Bacteria 965
574 Ga0207712_10971442 3300025961 Bacteria 753
575 Ga0207712_11164936 3300025961 Bacteria 687
576 Ga0207668_10165750 3300025972 Bacteria 1727
577 Ga0207668_10241147 3300025972 Bacteria 1463
578 Ga0207668_11422266 3300025972 Bacteria 625
579 Ga0207640_10090771 3300025981 Bacteria 2115
580 Ga0207640_10119204 3300025981 Bacteria 1887
581 Ga0207640_10749486 3300025981 Bacteria 842
582 Ga0207640_10871815 3300025981 Bacteria 785
583 Ga0207640_11093040 3300025981 Bacteria 705
584 Ga0207658_10077177 3300025986 Bacteria 2541
585 Ga0207658_10415697 3300025986 Bacteria 1185
586 Ga0207677_10119823 3300026023 Bacteria 1977
587 Ga0207677_10265266 3300026023 Bacteria 1402
588 Ga0207677_10282281 3300026023 Bacteria 1364
589 Ga0207677_10394617 3300026023 Bacteria 1172
590 Ga0207677_10462761 3300026023 Bacteria 1089
591 Ga0207677_11539043 3300026023 Bacteria 615
592 Ga0207703_10457821 3300026035 Bacteria 1193
593 Ga0207703_11702061 3300026035 Bacteria 606
594 Ga0207703_11726728 3300026035 Bacteria 602
595 Ga0207639_10327841 3300026041 Bacteria 1361
596 Ga0207678_10091030 3300026067 Bacteria 2607
597 Ga0207678_10135952 3300026067 Bacteria 2097
598 Ga0207678_10337880 3300026067 Bacteria 1297
599 Ga0207678_10471933 3300026067 Bacteria 1092
600 Ga0207678_10780579 3300026067 Bacteria 843
601 Ga0207708_10006747 3300026075 Bacteria 8493
602 Ga0207708_10021676 3300026075 Bacteria 4846
603 Ga0207708_10117707 3300026075 Bacteria 2068
604 Ga0207708_10212189 3300026075 Bacteria 1548
605 Ga0207708_10435132 3300026075 Bacteria 1090
606 Ga0207708_10491497 3300026075 Bacteria 1027
607 Ga0207702_10385135 3300026078 Bacteria 1349
608 Ga0207702_11030810 3300026078 Bacteria 816
609 Ga0207641_10410437 3300026088 Bacteria 1302
610 Ga0207641_10602444 3300026088 Bacteria 1076
611 Ga0207648_10036106 3300026089 Bacteria 4354
612 Ga0207648_10069143 3300026089 Bacteria 3077
613 Ga0207648_11031103 3300026089 Bacteria 771
614 Ga0207648_11370253 3300026089 Bacteria 665
615 Ga0207676_10160438 3300026095 Bacteria 1947
616 Ga0207676_10330611 3300026095 Bacteria 1402
617 Ga0207676_10364529 3300026095 Bacteria 1340
618 Ga0207676_10558008 3300026095 Bacteria 1095
619 Ga0207676_11799746 3300026095 Bacteria 611
620 Ga0207674_10189996 3300026116 Bacteria 2004
621 Ga0207674_10268034 3300026116 Bacteria 1655
622 Ga0207674_10309208 3300026116 Bacteria 1530
623 Ga0207674_10772180 3300026116 Bacteria 927
624 Ga0207674_11517907 3300026116 Bacteria 639
625 Ga0207675_100015029 3300026118 Bacteria 7223
626 Ga0207675_100027033 3300026118 Bacteria 5342
627 Ga0207675_100386488 3300026118 Bacteria 1377
628 Ga0207675_100626540 3300026118 Bacteria 1080
629 Ga0207675_101905379 3300026118 Bacteria 613
630 Ga0207683_10146311 3300026121 Bacteria 2131
631 Ga0207683_10427290 3300026121 Bacteria 1220
632 Ga0207698_10025487 3300026142 Bacteria 4168
633 Ga0207698_10332046 3300026142 Bacteria 1429
634 Ga0207698_10451066 3300026142 Bacteria 1242
635 Ga0207698_10600255 3300026142 Bacteria 1085
636 Ga0207698_10863129 3300026142 Bacteria 911
637 Ga0210002_1026614 3300027617 Bacteria 950
638 Ga0207428_10035062 3300027907 Bacteria 4105
639 Ga0207428_10064577 3300027907 Bacteria 2890
640 Ga0207428_10230917 3300027907 Bacteria 1385
641 Ga0207428_11253473 3300027907 Bacteria 515
642 Ga0268266_12191820 3300028379 Bacteria 525
643 Ga0268265_10220765 3300028380 Bacteria 1658
644 Ga0268265_10243786 3300028380 Bacteria 1588
645 Ga0268265_11122965 3300028380 Bacteria 781
646 Ga0268264_10236003 3300028381 Bacteria 1691
647 Ga0268264_10372871 3300028381 Bacteria 1365
648 Ga0268264_10567988 3300028381 Bacteria 1114
649 Ga0307515_10282807 3300028794 Bacteria 1364
650 Ga0311001_1068448 3300029277 Bacteria 776
651 Ga0265766_1000621 3300030863 Bacteria 1578
652 Ga0307513_10001463 3300031456 Bacteria 33963
653 Ga0307509_10324242 3300031507 Bacteria 1275
654 Ga0307408_100099408 3300031548 Bacteria 2214
655 Ga0307408_100673465 3300031548 Bacteria 927
656 Ga0307405_10035279 3300031731 Bacteria 2986
657 Ga0307405_11429335 3300031731 Bacteria 606
658 Ga0307405_11947356 3300031731 Bacteria 525
659 Ga0307413_11549141 3300031824 Bacteria 587
660 Ga0307410_10235915 3300031852 Bacteria 1415
661 Ga0307410_10373024 3300031852 Bacteria 1146
662 Ga0307410_10874195 3300031852 Bacteria 769
663 Ga0307410_11037735 3300031852 Bacteria 708
664 Ga0307410_11313617 3300031852 Bacteria 633
665 Ga0307406_10324856 3300031901 Bacteria 1192
666 Ga0307406_10455891 3300031901 Bacteria 1027
667 Ga0307406_11128299 3300031901 Bacteria 678
668 Ga0307406_11797948 3300031901 Bacteria 545
669 Ga0307406_11820032 3300031901 Bacteria 542
670 Ga0307407_10028596 3300031903 Bacteria 2982
671 Ga0307407_10401120 3300031903 Bacteria 984
672 Ga0307407_10840084 3300031903 Bacteria 701
673 Ga0307407_10859732 3300031903 Bacteria 694
674 Ga0307412_11248457 3300031911 Bacteria 667
675 Ga0307412_11556021 3300031911 Bacteria 603
676 Ga0307409_100065027 3300031995 Bacteria 2868
677 Ga0307409_100088553 3300031995 Bacteria 2528
678 Ga0307416_100096931 3300032002 Bacteria 2552
679 Ga0307416_100596372 3300032002 Bacteria 1184
680 Ga0307416_100745749 3300032002 Bacteria 1071
681 Ga0307416_101215646 3300032002 Bacteria 859
682 Ga0307416_101728795 3300032002 Bacteria 730
683 Ga0307416_102232325 3300032002 Bacteria 648
684 Ga0307414_10159495 3300032004 Bacteria 1790
685 Ga0307414_10302843 3300032004 Bacteria 1353
686 Ga0307411_10212720 3300032005 Bacteria 1494
687 Ga0307411_10399537 3300032005 Bacteria 1136
688 Ga0307411_10765883 3300032005 Bacteria 847
689 Ga0307411_11520559 3300032005 Bacteria 616
690 Ga0307415_100046422 3300032126 Bacteria 2918
691 Ga0307415_100080155 3300032126 Bacteria 2328
692 Ga0307415_100217910 3300032126 Bacteria 1528
693 Ga0307415_100360563 3300032126 Bacteria 1227
694 Ga0307415_100676615 3300032126 Bacteria 928
695 Ga0307415_100781586 3300032126 Bacteria 870
696 Ga0307415_100867099 3300032126 Bacteria 830
697 Ga0307415_101126391 3300032126 Bacteria 736
698 Ga0307507_10016447 3300033179 Bacteria 8602
699 Ga0307507_10421610 3300033179 Bacteria 749
700 Ga0307510_10128745 3300033180 Bacteria 2212
701 Ga0373948_0052903 3300034817 Bacteria 876
702 Ga0373952_0035304 3300035092 Bacteria 1131
703 Ga0373960_0224769 3300035121 Bacteria 673
704 Ga0373962_0069926 3300035242 Bacteria 1047
705 Ga0373931_0762600 3300035691 Bacteria 643
706 Ga0395900_0262505 3300037418 Bacteria 1724
707 Ga0395900_0480304 3300037418 Bacteria 1195
708 Ga0395900_1437529 3300037418 Bacteria 602
709 Ga0395898_0082059 3300037466 Bacteria 3108
710 Ga0395898_0203609 3300037466 Bacteria 1889
711 Ga0395898_0607035 3300037466 Bacteria 1037
712 Ga0395898_1059989 3300037466 Bacteria 745
713 Ga0395898_1703167 3300037466 Bacteria 553
714 Ga0436364_1040466 3300037853 Bacteria 95595
715 Ga0395901_0016549 3300038443 Bacteria 7514
716 Ga0395901_0378307 3300038443 Bacteria 1458
717 Ga0395901_1517126 3300038443 Bacteria 626
718 Ga0451789_0128125 3300041443 Bacteria 820
719 Ga0451791_0134196 3300041451 Bacteria 1401
720 Ga0451801_20889 3300041455 Bacteria 622
721 Ga0451798_0205759 3300041458 Bacteria 851
722 Ga0451800_0529711 3300041459 Bacteria 753
723 Ga0451800_0798604 3300041459 Bacteria 600
724 Ga0451802_0283187 3300041460 Bacteria 726
725 Ga0451802_1367216 3300041460 Bacteria 504
726 Ga0451805_092273 3300041461 Bacteria 1110
727 Ga0451804_0654268 3300041463 Bacteria 920
728 Ga0451807_1200229 3300041486 Bacteria 1044
729 Ga0451839_0954223 3300041496 Bacteria 534
730 Ga0451841_0722847 3300041498 Bacteria 992
731 Ga0451845_0883599 3300041501 Bacteria 643
732 Ga0451847_0240470 3300041503 Bacteria 583
733 Ga0451851_0564806 3300041507 Bacteria 550
734 Ga0451843_0427164 3300041509 Bacteria 780
735 Ga0451843_0898051 3300041509 Bacteria 846
736 Ga0451853_3042107 3300041512 Bacteria 561
737 Ga0439455_0013690 3300042012 Bacteria 1842
738 Ga0439456_032747 3300042013 Bacteria 1117
739 Ga0439463_015388 3300042016 Bacteria 1893
740 Ga0450913_012317 3300042117 Bacteria 706
741 Ga0439440_0008620 3300042993 Bacteria 2098
742 Ga0466969_0334174 3300044656 Bacteria 686
743 Ga0466972_0010066 3300044658 Bacteria 4750
744 Ga0466965_0001592 3300044683 Bacteria 9258
745 Ga0466965_0166270 3300044683 Bacteria 1158
746 Ga0466965_0169076 3300044683 Bacteria 1149
747 Ga0466966_0010823 3300044684 Bacteria 6061
748 Ga0466963_0023118 3300044694 Bacteria 3942
749 Ga0466963_0080919 3300044694 Bacteria 2200
750 Ga0466963_0137997 3300044694 Bacteria 1688
751 Ga0466963_0652069 3300044694 Bacteria 743
752 Ga0466964_0148680 3300044706 Bacteria 1084
753 Ga0466971_0036627 3300044719 Bacteria 2200
754 Ga0466971_0106427 3300044719 Bacteria 1292
755 Ga0466970_0011374 3300044765 Bacteria 4536
756 Ga0466970_0622520 3300044765 Bacteria 627
757 Ga0466957_0097592 3300044842 Bacteria 1848
758 Ga0466957_0606913 3300044842 Bacteria 766
759 Ga0466957_0611034 3300044842 Bacteria 764
760 Ga0466957_0810454 3300044842 Bacteria 665
761 Ga0466960_0002139 3300044901 Bacteria 7362
762 Ga0466960_0024310 3300044901 Bacteria 2732
763 Ga0466960_0223944 3300044901 Bacteria 1036
764 Ga0466959_0039373 3300045049 Bacteria 3493
765 Ga0466959_0755709 3300045049 Bacteria 651
766 Ga0466958_0007347 3300045836 Bacteria 6053
767 Ga0466958_0571255 3300045836 Bacteria 735
768 Ga0466967_0040750 3300045976 Bacteria 4000
769 Ga0466967_0057831 3300045976 Bacteria 3425
770 Ga0466967_0110602 3300045976 Bacteria 2524
771 Ga0466967_0119187 3300045976 Bacteria 2435
772 Ga0466967_0125309 3300045976 Bacteria 2378
773 Ga0466967_0198901 3300045976 Bacteria 1897
774 Ga0466967_0207520 3300045976 Bacteria 1857
775 Ga0466967_0623831 3300045976 Bacteria 1065
776 Ga0466967_0694611 3300045976 Bacteria 1007
777 Ga0466967_0929966 3300045976 Bacteria 865
778 Ga0466967_1002136 3300045976 Bacteria 832
779 Ga0495592_0246836 3300046454 Bacteria 1182
780 Ga0495650_0000121 3300046471 Bacteria 183055
781 Ga0495582_0648186 3300046473 Bacteria 611
782 Ga0495605_0206732 3300046474 Bacteria 854
783 Ga0495664_0199755 3300046477 Bacteria 1212
784 Ga0495584_0105725 3300046491 Bacteria 1423
785 Ga0495584_0424660 3300046491 Bacteria 676
786 Ga0495596_0391688 3300046500 Bacteria 541
787 Ga0495620_0152288 3300046515 Bacteria 901
788 Ga0495620_0248283 3300046515 Bacteria 679
789 Ga0495628_0782046 3300046516 Unclassified 669
790 Ga0495631_0073623 3300046518 Bacteria 1475
791 Ga0495643_0189256 3300046522 Bacteria 995
792 Ga0495643_0292210 3300046522 Bacteria 746
793 Ga0495643_0483711 3300046522 Bacteria 535
794 Ga0495663_0190944 3300046525 Bacteria 712
795 Ga0495652_0197519 3300046529 Bacteria 1529
796 Ga0495640_0284809 3300046533 Bacteria 1029
797 Ga0495609_0183579 3300046538 Bacteria 880
798 Ga0495597_0234214 3300046542 Bacteria 726
799 Ga0495656_0200638 3300046615 Bacteria 990
800 Ga0495656_0531202 3300046615 Bacteria 626
801 Ga0495668_0298181 3300046616 Bacteria 884
802 Ga0495661_0214353 3300046665 Bacteria 1001
803 Ga0495657_0316103 3300046675 Bacteria 929
804 Ga0495670_0193902 3300046691 Bacteria 1075
805 Ga0495660_0430780 3300046810 Bacteria 573
806 Ga0495604_0868413 3300047317 Bacteria 565
807 Ga0495680_0440993 3300047322 Bacteria 893
808 Ga0495685_204320 3300047447 Bacteria 633
809 Ga0495686_0129578 3300047472 Bacteria 1497
810 Ga0495602_0288454 3300048088 Bacteria 1206
811 Ga0495615_0121571 3300048090 Bacteria 756
812 Ga0496100_0002773 3300048903 Bacteria 8960
813 Ga0496100_0536201 3300048903 Bacteria 904
814 Ga0496100_0956149 3300048903 Bacteria 673
815 Ga0496100_1431507 3300048903 Bacteria 546
816 Ga0496100_1572317 3300048903 Bacteria 520
817 Ga0496101_0191749 3300048904 Bacteria 1577
818 Ga0496101_0420541 3300048904 Bacteria 1053
819 Ga0496102_0028096 3300048905 Bacteria 5026
820 Ga0496102_0069677 3300048905 Bacteria 3228
821 Ga0496102_0207279 3300048905 Bacteria 1848
822 Ga0496102_0374613 3300048905 Bacteria 1340
823 Ga0496102_1124164 3300048905 Bacteria 705
824 Ga0496103_0179030 3300048906 Bacteria 1362
825 Ga0496103_0228643 3300048906 Bacteria 1196
826 Ga0496104_0001942 3300048907 Bacteria 17924
827 Ga0496105_0038675 3300048908 Bacteria 3930
828 Ga0496105_0137245 3300048908 Bacteria 2014
829 Ga0496105_0411382 3300048908 Bacteria 1072
830 Ga0496105_0542447 3300048908 Bacteria 909
831 Ga0496106_0003395 3300048909 Bacteria 11865
832 Ga0496106_0034087 3300048909 Bacteria 3802
833 Ga0496106_0089222 3300048909 Bacteria 2377
834 Ga0496106_0196797 3300048909 Bacteria 1603
835 Ga0496106_0203841 3300048909 Bacteria 1575
836 Ga0496106_0347174 3300048909 Bacteria 1192
837 Ga0496106_0648786 3300048909 Bacteria 843
838 Ga0496106_0916898 3300048909 Bacteria 691
839 Ga0496107_0007662 3300048910 Bacteria 7454
840 Ga0496107_0096234 3300048910 Bacteria 2166
841 Ga0496107_0462601 3300048910 Bacteria 942
842 Ga0496107_0987831 3300048910 Bacteria 611
843 Ga0496108_0004397 3300048911 Bacteria 11344
844 Ga0496108_0029625 3300048911 Bacteria 4535
845 Ga0496108_0066759 3300048911 Bacteria 3034
846 Ga0496108_0427467 3300048911 Bacteria 1157
847 Ga0496108_0715708 3300048911 Bacteria 867
848 Ga0496108_1007796 3300048911 Bacteria 711
849 Ga0496108_1325997 3300048911 Bacteria 604
850 Ga0496109_0003783 3300048912 Bacteria 12627
851 Ga0496109_0049151 3300048912 Bacteria 3838
852 Ga0496109_0084275 3300048912 Bacteria 2932
853 Ga0496109_0160470 3300048912 Bacteria 2106
854 Ga0496109_1894731 3300048912 Bacteria 529
855 Ga0496110_0008810 3300048913 Bacteria 8125
856 Ga0496110_0047545 3300048913 Bacteria 3758
857 Ga0496110_0211714 3300048913 Bacteria 1762
858 Ga0496110_0256135 3300048913 Bacteria 1593
859 Ga0496110_0486024 3300048913 Bacteria 1125
860 Ga0496110_1326046 3300048913 Bacteria 629
861 Ga0496111_0009446 3300048914 Bacteria 6510
862 Ga0496111_0013162 3300048914 Bacteria 5623
863 Ga0496111_0042251 3300048914 Bacteria 3273
864 Ga0496111_0072961 3300048914 Bacteria 2499
865 Ga0496111_1047855 3300048914 Bacteria 583
866 Ga0496112_0070989 3300048915 Bacteria 3442
867 Ga0496112_0076375 3300048915 Bacteria 3313
868 Ga0496112_0098271 3300048915 Bacteria 2897
869 Ga0496112_0336580 3300048915 Bacteria 1453
870 Ga0496113_0046394 3300048916 Bacteria 3225
871 Ga0496113_0168713 3300048916 Bacteria 1733
872 Ga0496114_0293864 3300048917 Bacteria 1434
873 Ga0496114_0744443 3300048917 Bacteria 857
874 Ga0496115_0019085 3300048918 Bacteria 5272
875 Ga0496121_0895015 3300048924 Bacteria 511
876 Ga0496122_0245040 3300048925 Bacteria 1007
877 Ga0496126_0841011 3300048929 Bacteria 701
878 Ga0501306_101553 3300049127 Bacteria 515
879 Ga0501308_014011 3300049128 Bacteria 933
880 Ga0501308_021415 3300049128 Bacteria 812
881 Ga0501308_051846 3300049128 Bacteria 602
882 Ga0501308_086363 3300049128 Bacteria 505
883 Ga0501305_092585 3300049161 Bacteria 555
884 Ga0501307_012450 3300049162 Bacteria 1013
885 Ga0495682_0362415 3300049460 Bacteria 511
886 Ga0501291_166445 3300049514 Bacteria 507
887 Ga0501311_004211 3300049527 Bacteria 1518
888 Ga0501311_011671 3300049527 Bacteria 1087
889 Ga0501311_054662 3300049527 Bacteria 633
890 Ga0501311_074607 3300049527 Bacteria 568
891 Ga0501312_038468 3300049528 Bacteria 775
892 Ga0501315_023215 3300049531 Bacteria 850
893 Ga0501315_040578 3300049531 Bacteria 703
894 Ga0501317_082713 3300049533 Bacteria 558
895 Ga0501318_001018 3300049534 Bacteria 2060
896 Ga0501318_003795 3300049534 Bacteria 1410
897 Ga0501321_007936 3300049537 Bacteria 1115
898 Ga0501321_018462 3300049537 Bacteria 847
899 Ga0501321_069983 3300049537 Bacteria 544
900 Ga0501325_001897 3300049541 Bacteria 1361
901 Ga0501325_001985 3300049541 Bacteria 1345
902 Ga0501325_017902 3300049541 Bacteria 721
903 Ga0501329_16827 3300049545 Bacteria 504
904 Ga0501031_0023483 3300049568 Bacteria 4020
905 Ga0501031_0901149 3300049568 Bacteria 566
906 Ga0501032_0052260 3300049569 Bacteria 2753
907 Ga0501032_0307944 3300049569 Bacteria 1023
908 Ga0501033_0007388 3300049570 Bacteria 8557
909 Ga0501033_0147150 3300049570 Bacteria 1701
910 Ga0501034_0042646 3300049571 Bacteria 4593
911 Ga0501034_0071807 3300049571 Bacteria 3470
912 Ga0501036_0047556 3300049572 Bacteria 3633
913 Ga0501036_0049091 3300049572 Bacteria 3573
914 Ga0501036_0171983 3300049572 Bacteria 1825
915 Ga0501036_0255412 3300049572 Bacteria 1468
916 Ga0501037_0077521 3300049573 Bacteria 2412
917 Ga0501037_0725049 3300049573 Bacteria 660
918 Ga0501037_1126678 3300049573 Bacteria 507
919 Ga0501038_0001079 3300049574 Bacteria 24647
920 Ga0501038_0034050 3300049574 Bacteria 4481
921 Ga0501038_0545548 3300049574 Bacteria 882
922 Ga0501039_0120994 3300049575 Bacteria 2051
923 Ga0501039_0203613 3300049575 Bacteria 1556
924 Ga0501039_0920492 3300049575 Bacteria 680
925 Ga0501042_0059447 3300049578 Bacteria 2729
926 Ga0501042_0109869 3300049578 Bacteria 1985
927 Ga0501042_0828630 3300049578 Bacteria 673
928 Ga0501043_0024370 3300049579 Bacteria 4748
929 Ga0501043_0185597 3300049579 Bacteria 1619
930 Ga0501043_0223253 3300049579 Bacteria 1457
931 Ga0501046_0041339 3300049580 Bacteria 3680
932 Ga0501047_0052072 3300049581 Bacteria 3956
933 Ga0501048_0051421 3300049582 Bacteria 2933
934 Ga0501048_0091402 3300049582 Bacteria 2147
935 Ga0501048_0798079 3300049582 Bacteria 678
936 Ga0501067_0051694 3300049583 Bacteria 2277
937 Ga0501067_0260731 3300049583 Bacteria 965
938 Ga0501068_0348196 3300049584 Bacteria 952
939 Ga0501068_0754843 3300049584 Bacteria 637
940 Ga0501068_0827420 3300049584 Bacteria 608
941 Ga0501069_0150182 3300049585 Bacteria 1339
942 Ga0501069_0622417 3300049585 Bacteria 649
943 Ga0501070_0319174 3300049586 Bacteria 1264
944 Ga0501070_0381825 3300049586 Bacteria 1141
945 Ga0501070_0547027 3300049586 Bacteria 927
946 Ga0501070_1493524 3300049586 Bacteria 511
947 Ga0501071_0058388 3300049587 Bacteria 2790
948 Ga0501071_0216372 3300049587 Bacteria 1441
949 Ga0501071_1373206 3300049587 Bacteria 546
950 Ga0501072_0097294 3300049588 Bacteria 2339
951 Ga0501072_0168191 3300049588 Bacteria 1749
952 Ga0501072_0476709 3300049588 Bacteria 987
953 Ga0501073_1194656 3300049589 Bacteria 522
954 Ga0501074_0323500 3300049590 Bacteria 1095
955 Ga0501075_0037970 3300049591 Bacteria 3600
956 Ga0501076_0016442 3300049592 Bacteria 5609
957 Ga0501076_0141130 3300049592 Bacteria 1957
958 Ga0501076_0237550 3300049592 Bacteria 1490
959 Ga0501076_0273975 3300049592 Bacteria 1382
960 Ga0501077_0078396 3300049593 Bacteria 2094
961 Ga0501077_0702772 3300049593 Bacteria 650
962 Ga0501221_216078 3300049704 Bacteria 539
963 Ga0501079_0082392 3300049741 Bacteria 2488
964 Ga0501079_0226162 3300049741 Bacteria 1462
965 Ga0501081_0082339 3300049743 Bacteria 2254
966 Ga0501081_0306217 3300049743 Bacteria 1166
967 Ga0501083_0400704 3300049744 Bacteria 893
968 Ga0501280_088980 3300049776 Bacteria 579
969 Ga0501035_0036974 3300049822 Bacteria 4423
970 Ga0501035_0039260 3300049822 Bacteria 4284
971 Ga0501035_0327522 3300049822 Bacteria 1286
972 Ga0501035_1030741 3300049822 Bacteria 646
973 Ga0501044_0016796 3300049823 Bacteria 7855
974 Ga0501044_0576948 3300049823 Bacteria 1019
975 Ga0501045_0103926 3300049824 Bacteria 2104
976 Ga0501045_0162626 3300049824 Bacteria 1662
977 Ga0501045_0256265 3300049824 Bacteria 1302
978 nmdc:mga0yw44_426241_c1 3300050492 Bacteria 898
979 nmdc:mga05p37_1163961_c1 3300050507 Bacteria 801
980 nmdc:mga05p37_715917_c1 3300050507 Bacteria 1109
981 nmdc:mga0qj67_428572_c2 3300050509 Bacteria 603
982 nmdc:mga06r32_339037_c1 3300050510 Bacteria 1488
983 nmdc:mga08y16_1242772_c1 3300050511 Bacteria 714
984 nmdc:mga08y16_1849565_c1 3300050511 Bacteria 556
985 nmdc:mga08y16_196471_c1 3300050511 Bacteria 2091
986 nmdc:mga08y16_285749_c1 3300050511 Bacteria 1701
987 nmdc:mga08y16_67959_c1 3300050511 Bacteria 3717
988 nmdc:mga0n895_293134_c1 3300050512 Bacteria 1649
989 nmdc:mga0rr50_807485_c1 3300050513 Bacteria 800
990 nmdc:mga0a205_1215050_c1 3300050515 Bacteria 601
991 nmdc:mga0a205_291709_c1 3300050515 Bacteria 1505
992 Ga0495601_0151786 3300053077 Bacteria 1512
993 Ga0495655_0002245 3300053083 Bacteria 3053
994 Ga0495655_0043056 3300053083 Bacteria 1162
995 Ga0495655_0366240 3300053083 Bacteria 507
996 Ga0500556_0000795 3300053104 Bacteria 18495
997 Ga0500652_259146 3300053131 Bacteria 686
998 Ga0500588_0413632 3300053146 Bacteria 514
999 Ga0500589_277848 3300053147 Bacteria 602
1000 Ga0500604_0058002 3300053151 Bacteria 1210
1001 Ga0500616_0006750 3300053153 Bacteria 7441
1002 Ga0500616_0019028 3300053153 Bacteria 3877
1003 Ga0500616_0070509 3300053153 Bacteria 1783
1004 Ga0500599_000599 3300053736 Bacteria 3818
1005 Ga0501084_0125615 3300054114 Bacteria 2158
1006 Ga0501084_0160909 3300054114 Bacteria 1894
1007 Ga0501084_0228000 3300054114 Bacteria 1572
1008 Ga0501084_0236930 3300054114 Bacteria 1540
1009 Ga0587084_002055 3300059477 Bacteria 2029
1010 Ga0587084_003660 3300059477 Bacteria 1705
1011 Ga0587084_009573 3300059477 Bacteria 1255
1012 Ga0587084_013874 3300059477 Bacteria 1115
1013 Ga0587084_014910 3300059477 Bacteria 1090
1014 Ga0587084_019828 3300059477 Bacteria 994
1015 Ga0587084_039621 3300059477 Bacteria 795
1016 Ga0587084_047051 3300059477 Bacteria 752
1017 Ga0587084_097922 3300059477 Bacteria 591
1018 Ga0587084_109442 3300059477 Bacteria 569
1019 Ga0587084_111349 3300059477 Bacteria 566
1020 Ga0587084_118767 3300059477 Bacteria 554
1021 Ga0587084_119440 3300059477 Bacteria 553
1022 Ga0587093_003172 3300059478 Bacteria 1593
1023 Ga0587093_012761 3300059478 Bacteria 1024
1024 Ga0587093_013733 3300059478 Bacteria 1000
1025 Ga0587093_017042 3300059478 Bacteria 933
1026 Ga0587093_022758 3300059478 Bacteria 852
1027 Ga0587093_023948 3300059478 Bacteria 837
1028 Ga0587093_034077 3300059478 Bacteria 746
1029 Ga0587093_047461 3300059478 Bacteria 669
1030 Ga0587093_055045 3300059478 Bacteria 637
1031 Ga0587093_056664 3300059478 Bacteria 631
1032 Ga0587093_060095 3300059478 Bacteria 619
1033 Ga0587093_063100 3300059478 Bacteria 609
1034 Ga0587066_000991 3300059490 Bacteria 2684
1035 Ga0587066_006908 3300059490 Bacteria 1517
1036 Ga0587066_007921 3300059490 Bacteria 1459
1037 Ga0587066_017346 3300059490 Bacteria 1146
1038 Ga0587066_102556 3300059490 Bacteria 652
1039 Ga0587066_113046 3300059490 Bacteria 632
1040 Ga0587066_145128 3300059490 Bacteria 583
1041 Ga0587066_149429 3300059490 Bacteria 578
1042 Ga0587066_152284 3300059490 Bacteria 574
1043 Ga0587066_172249 3300059490 Bacteria 552
1044 Ga0587066_189410 3300059490 Bacteria 535
1045 Ga0587066_190848 3300059490 Bacteria 533
1046 Ga0587066_226182 3300059490 Bacteria 504
1047 Ga0587070_000518 3300059491 Bacteria 3262
1048 Ga0587070_015780 3300059491 Bacteria 1201
1049 Ga0587070_027402 3300059491 Bacteria 1009
1050 Ga0587070_041652 3300059491 Bacteria 881
1051 Ga0587070_045163 3300059491 Bacteria 859
1052 Ga0587070_074895 3300059491 Bacteria 730
1053 Ga0587070_075993 3300059491 Bacteria 727
1054 Ga0587070_076079 3300059491 Bacteria 727
1055 Ga0587070_089163 3300059491 Bacteria 691
1056 Ga0587070_141789 3300059491 Bacteria 594
1057 Ga0587070_165846 3300059491 Bacteria 565
1058 Ga0587070_170806 3300059491 Bacteria 559
1059 Ga0587073_0002621 3300059492 Bacteria 2338
1060 Ga0587073_0010685 3300059492 Bacteria 1549
1061 Ga0587073_0014258 3300059492 Bacteria 1412
1062 Ga0587073_0028145 3300059492 Bacteria 1140
1063 Ga0587073_0065717 3300059492 Bacteria 863
1064 Ga0587073_0070705 3300059492 Bacteria 842
1065 Ga0587073_0088168 3300059492 Bacteria 784
1066 Ga0587073_0169030 3300059492 Bacteria 633
1067 Ga0587073_0184224 3300059492 Bacteria 615
1068 Ga0587073_0240939 3300059492 Bacteria 562
1069 Ga0587073_0247866 3300059492 Bacteria 557
1070 Ga0587073_0252309 3300059492 Bacteria 554
1071 Ga0587073_0294384 3300059492 Bacteria 526
1072 Ga0587073_0306433 3300059492 Bacteria 519
1073 Ga0587077_006352 3300059493 Bacteria 1669
1074 Ga0587077_017451 3300059493 Bacteria 1223
1075 Ga0587077_027933 3300059493 Bacteria 1053
1076 Ga0587077_037489 3300059493 Bacteria 957
1077 Ga0587077_067252 3300059493 Bacteria 792
1078 Ga0587077_068909 3300059493 Bacteria 786
1079 Ga0587077_069421 3300059493 Bacteria 784
1080 Ga0587077_089792 3300059493 Bacteria 720
1081 Ga0587077_112682 3300059493 Bacteria 668
1082 Ga0587077_119469 3300059493 Bacteria 656
1083 Ga0587077_134889 3300059493 Bacteria 630
1084 Ga0587077_170803 3300059493 Bacteria 582
1085 Ga0587077_186729 3300059493 Bacteria 565
1086 Ga0587077_195201 3300059493 Bacteria 557
1087 Ga0587077_268703 3300059493 Bacteria 500
1088 Ga0587080_001432 3300059503 Bacteria 2585
1089 Ga0587080_006193 3300059503 Bacteria 1640
1090 Ga0587080_017952 3300059503 Bacteria 1132
1091 Ga0587080_018687 3300059503 Bacteria 1116
1092 Ga0587080_038060 3300059503 Bacteria 866
1093 Ga0587080_040393 3300059503 Bacteria 848
1094 Ga0587080_048491 3300059503 Bacteria 796
1095 Ga0587080_056586 3300059503 Bacteria 754
1096 Ga0587080_060521 3300059503 Bacteria 736
1097 Ga0587080_076416 3300059503 Bacteria 679
1098 Ga0587080_077941 3300059503 Bacteria 675
1099 Ga0587080_081553 3300059503 Bacteria 664
1100 Ga0587080_088942 3300059503 Bacteria 645
1101 Ga0587080_117060 3300059503 Bacteria 587
1102 Ga0587082_001111 3300059504 Bacteria 2646
1103 Ga0587082_004844 3300059504 Bacteria 1716
1104 Ga0587082_009673 3300059504 Bacteria 1372
1105 Ga0587082_010472 3300059504 Bacteria 1340
1106 Ga0587082_013344 3300059504 Bacteria 1237
1107 Ga0587082_015319 3300059504 Bacteria 1182
1108 Ga0587082_018137 3300059504 Bacteria 1117
1109 Ga0587082_021999 3300059504 Bacteria 1046
1110 Ga0587082_030084 3300059504 Bacteria 942
1111 Ga0587082_041570 3300059504 Bacteria 845
1112 Ga0587082_045566 3300059504 Bacteria 819
1113 Ga0587082_049528 3300059504 Bacteria 797
1114 Ga0587082_105971 3300059504 Bacteria 619
1115 Ga0587082_118390 3300059504 Bacteria 596
1116 Ga0587082_135994 3300059504 Bacteria 569
1117 Ga0587082_143228 3300059504 Bacteria 559
1118 Ga0587082_154109 3300059504 Bacteria 546
1119 Ga0587082_188488 3300059504 Bacteria 509
1120 Ga0587083_0001379 3300059505 Bacteria 2707
1121 Ga0587083_0006855 3300059505 Bacteria 1717
1122 Ga0587083_0011164 3300059505 Bacteria 1476
1123 Ga0587083_0042637 3300059505 Bacteria 957
1124 Ga0587083_0070280 3300059505 Bacteria 811
1125 Ga0587083_0073650 3300059505 Bacteria 798
1126 Ga0587083_0078531 3300059505 Bacteria 781
1127 Ga0587083_0095407 3300059505 Bacteria 732
1128 Ga0587083_0095757 3300059505 Bacteria 731
1129 Ga0587083_0152895 3300059505 Bacteria 625
1130 Ga0587083_0153467 3300059505 Bacteria 624
1131 Ga0587083_0154286 3300059505 Bacteria 623
1132 Ga0587083_0189731 3300059505 Bacteria 580
1133 Ga0587083_0199813 3300059505 Bacteria 570
1134 Ga0587083_0236452 3300059505 Bacteria 538
1135 Ga0587085_001378 3300059506 Bacteria 2224
1136 Ga0587085_003216 3300059506 Bacteria 1753
1137 Ga0587085_005971 3300059506 Bacteria 1461
1138 Ga0587085_006596 3300059506 Bacteria 1418
1139 Ga0587085_016647 3300059506 Bacteria 1067
1140 Ga0587085_017025 3300059506 Bacteria 1060
1141 Ga0587085_027271 3300059506 Bacteria 915
1142 Ga0587085_047544 3300059506 Bacteria 771
1143 Ga0587085_048064 3300059506 Bacteria 768
1144 Ga0587085_049374 3300059506 Bacteria 761
1145 Ga0587085_086528 3300059506 Bacteria 640
1146 Ga0587085_088692 3300059506 Bacteria 635
1147 Ga0587085_093283 3300059506 Bacteria 625
1148 Ga0587085_098081 3300059506 Bacteria 615
1149 Ga0587085_099099 3300059506 Bacteria 613
1150 Ga0587085_105327 3300059506 Bacteria 601
1151 Ga0587085_105371 3300059506 Bacteria 601
1152 Ga0587086_000408 3300059507 Bacteria 3026
1153 Ga0587086_005146 3300059507 Bacteria 1401
1154 Ga0587086_005932 3300059507 Bacteria 1342
1155 Ga0587086_008361 3300059507 Bacteria 1208
1156 Ga0587086_012257 3300059507 Bacteria 1062
1157 Ga0587086_012570 3300059507 Bacteria 1054
1158 Ga0587086_012832 3300059507 Bacteria 1047
1159 Ga0587086_014606 3300059507 Bacteria 1004
1160 Ga0587086_020108 3300059507 Bacteria 904
1161 Ga0587086_032746 3300059507 Bacteria 772
1162 Ga0587086_037365 3300059507 Bacteria 738
1163 Ga0587086_043191 3300059507 Bacteria 704
1164 Ga0587086_056206 3300059507 Bacteria 646
1165 Ga0587086_057662 3300059507 Bacteria 640
1166 Ga0587086_060283 3300059507 Bacteria 631
1167 Ga0587086_061017 3300059507 Bacteria 629
1168 Ga0587086_063111 3300059507 Bacteria 622
1169 Ga0587086_079563 3300059507 Bacteria 576
1170 Ga0587086_087548 3300059507 Bacteria 558
1171 Ga0587086_115562 3300059507 Bacteria 508
1172 Ga0587088_001042 3300059508 Bacteria 2710
1173 Ga0587088_006273 3300059508 Bacteria 1598
1174 Ga0587088_013179 3300059508 Bacteria 1264
1175 Ga0587088_017968 3300059508 Bacteria 1146
1176 Ga0587088_022812 3300059508 Bacteria 1059
1177 Ga0587088_048841 3300059508 Bacteria 822
1178 Ga0587088_052035 3300059508 Bacteria 805
1179 Ga0587088_054429 3300059508 Bacteria 793
1180 Ga0587088_057035 3300059508 Bacteria 781
1181 Ga0587088_061253 3300059508 Bacteria 763
1182 Ga0587088_075191 3300059508 Bacteria 712
1183 Ga0587088_083279 3300059508 Bacteria 688
1184 Ga0587088_090946 3300059508 Bacteria 668
1185 Ga0587088_117280 3300059508 Bacteria 612
1186 Ga0587088_144040 3300059508 Bacteria 571
1187 Ga0587088_145770 3300059508 Bacteria 569
1188 Ga0587088_166442 3300059508 Bacteria 544
1189 Ga0587088_193201 3300059508 Bacteria 516
1190 Ga0587088_205416 3300059508 Bacteria 505
1191 Ga0587089_004290 3300059509 Bacteria 1566
1192 Ga0587089_015444 3300059509 Bacteria 1008
1193 Ga0587089_019399 3300059509 Bacteria 930
1194 Ga0587089_025444 3300059509 Bacteria 845
1195 Ga0587089_045265 3300059509 Bacteria 692
1196 Ga0587089_055838 3300059509 Bacteria 643
1197 Ga0587089_071133 3300059509 Bacteria 591
1198 Ga0587089_071646 3300059509 Bacteria 590
1199 Ga0587089_075152 3300059509 Bacteria 580
1200 Ga0587090_005126 3300059510 Bacteria 1626
1201 Ga0587090_005193 3300059510 Bacteria 1621
1202 Ga0587090_005325 3300059510 Bacteria 1607
1203 Ga0587090_049008 3300059510 Bacteria 769
1204 Ga0587090_074004 3300059510 Bacteria 671
1205 Ga0587090_075476 3300059510 Bacteria 666
1206 Ga0587090_094876 3300059510 Bacteria 616
1207 Ga0587090_127665 3300059510 Bacteria 557
1208 Ga0587091_002505 3300059511 Bacteria 2187
1209 Ga0587091_008700 3300059511 Bacteria 1507
1210 Ga0587091_018026 3300059511 Bacteria 1196
1211 Ga0587091_021312 3300059511 Bacteria 1134
1212 Ga0587091_034332 3300059511 Bacteria 969
1213 Ga0587091_048831 3300059511 Bacteria 862
1214 Ga0587091_050337 3300059511 Bacteria 853
1215 Ga0587091_074737 3300059511 Bacteria 749
1216 Ga0587091_075465 3300059511 Bacteria 746
1217 Ga0587091_089238 3300059511 Bacteria 705
1218 Ga0587091_091133 3300059511 Bacteria 700
1219 Ga0587091_103726 3300059511 Bacteria 670
1220 Ga0587091_116421 3300059511 Bacteria 644
1221 Ga0587091_132112 3300059511 Bacteria 617
1222 Ga0587091_206281 3300059511 Bacteria 530
1223 Ga0587092_002129 3300059512 Bacteria 2078
1224 Ga0587092_029016 3300059512 Bacteria 904
1225 Ga0587092_030847 3300059512 Bacteria 886
1226 Ga0587092_032419 3300059512 Bacteria 872
1227 Ga0587092_042202 3300059512 Bacteria 798
1228 Ga0587092_101496 3300059512 Bacteria 593
1229 Ga0587092_103414 3300059512 Bacteria 590
1230 Ga0587092_159350 3300059512 Bacteria 509
1231 Ga0587094_004792 3300059513 Bacteria 1554
1232 Ga0587094_018680 3300059513 Bacteria 988
1233 Ga0587094_023287 3300059513 Bacteria 915
1234 Ga0587094_029836 3300059513 Bacteria 840
1235 Ga0587094_052605 3300059513 Bacteria 694
1236 Ga0587094_066133 3300059513 Bacteria 642
1237 Ga0587094_077640 3300059513 Bacteria 609
1238 Ga0587094_109586 3300059513 Bacteria 542
1239 Ga0587094_124374 3300059513 Bacteria 519
1240 Ga0587094_127555 3300059513 Bacteria 515
1241 Ga0587095_000831 3300059514 Bacteria 1742
1242 Ga0587095_002808 3300059514 Bacteria 1195
1243 Ga0587095_005790 3300059514 Bacteria 945
1244 Ga0587095_019725 3300059514 Bacteria 640
1245 Ga0587095_021141 3300059514 Bacteria 626
1246 Ga0587095_022555 3300059514 Bacteria 613
1247 Ga0587097_04508 3300059603 Bacteria 630
1248 Ga0587097_05058 3300059603 Bacteria 610
1249 Ga0587098_002988 3300059604 Bacteria 1483
1250 Ga0587098_005150 3300059604 Bacteria 1269
1251 Ga0587098_033869 3300059604 Bacteria 715
1252 Ga0587098_050618 3300059604 Bacteria 630
1253 Ga0587106_002015 3300059605 Bacteria 1928
1254 Ga0587106_003903 3300059605 Bacteria 1604
1255 Ga0587106_016693 3300059605 Bacteria 1041
1256 Ga0587106_027646 3300059605 Bacteria 889
1257 Ga0587106_041694 3300059605 Bacteria 781
1258 Ga0587106_062531 3300059605 Bacteria 687
1259 Ga0587106_110024 3300059605 Bacteria 573
1260 Ga0587106_139145 3300059605 Bacteria 531
1261 Ga0587121_09004 3300059606 Bacteria 613
1262 Ga0587125_001367 3300059607 Bacteria 1756
1263 Ga0587125_007431 3300059607 Bacteria 1062
1264 Ga0587125_008670 3300059607 Bacteria 1015
1265 Ga0587125_008709 3300059607 Bacteria 1013
1266 Ga0587125_010054 3300059607 Bacteria 969
1267 Ga0587125_057886 3300059607 Bacteria 560
1268 Ga0587125_079621 3300059607 Bacteria 507
1269 Ga0587129_005518 3300059608 Bacteria 865
1270 Ga0587129_007589 3300059608 Bacteria 789
1271 Ga0587129_009139 3300059608 Bacteria 745
1272 Ga0587129_010014 3300059608 Bacteria 726
1273 Ga0587129_022676 3300059608 Bacteria 566
1274 Ga0587131_001126 3300059609 Bacteria 1258
1275 Ga0587131_013108 3300059609 Bacteria 619
1276 Ga0587099_000608 3300059622 Bacteria 2163
1277 Ga0587099_011787 3300059622 Bacteria 891
1278 Ga0587099_013191 3300059622 Bacteria 859
1279 Ga0587099_018936 3300059622 Bacteria 763
1280 Ga0587099_025886 3300059622 Bacteria 690
1281 Ga0587099_046410 3300059622 Bacteria 570
1282 Ga0587099_050321 3300059622 Bacteria 555
1283 Ga0587099_054770 3300059622 Bacteria 539
1284 Ga0587099_059533 3300059622 Bacteria 524
1285 Ga0587099_059763 3300059622 Bacteria 524
1286 Ga0587099_062389 3300059622 Bacteria 517
1287 Ga0587101_005266 3300059623 Bacteria 1427
1288 Ga0587101_012858 3300059623 Bacteria 1094
1289 Ga0587101_017226 3300059623 Bacteria 998
1290 Ga0587101_022110 3300059623 Bacteria 925
1291 Ga0587101_022480 3300059623 Bacteria 920
1292 Ga0587101_027769 3300059623 Bacteria 863
1293 Ga0587101_033011 3300059623 Bacteria 817
1294 Ga0587101_117599 3300059623 Bacteria 546
1295 Ga0587101_123985 3300059623 Bacteria 537
1296 Ga0587109_007537 3300059624 Bacteria 1648
1297 Ga0587109_017415 3300059624 Bacteria 1243
1298 Ga0587109_048179 3300059624 Bacteria 866
1299 Ga0587109_066185 3300059624 Bacteria 772
1300 Ga0587109_072152 3300059624 Bacteria 748
1301 Ga0587109_092590 3300059624 Bacteria 684
1302 Ga0587109_133232 3300059624 Bacteria 601
1303 Ga0587109_165335 3300059624 Bacteria 556
1304 Ga0587109_202801 3300059624 Bacteria 517
1305 Ga0587113_005567 3300059625 Bacteria 1043
1306 Ga0587113_007174 3300059625 Bacteria 965
1307 Ga0587113_015837 3300059625 Bacteria 750
1308 Ga0587113_032049 3300059625 Bacteria 600
1309 Ga0587113_037226 3300059625 Bacteria 572
1310 Ga0587115_002485 3300059626 Bacteria 1838
1311 Ga0587115_003264 3300059626 Bacteria 1694
1312 Ga0587115_010849 3300059626 Bacteria 1141
1313 Ga0587115_022387 3300059626 Bacteria 890
1314 Ga0587115_025173 3300059626 Bacteria 854
1315 Ga0587115_062328 3300059626 Bacteria 628
1316 Ga0587115_068568 3300059626 Bacteria 608
1317 Ga0587115_080511 3300059626 Bacteria 576
1318 Ga0587115_096174 3300059626 Bacteria 544
1319 Ga0587117_004775 3300059627 Bacteria 1429
1320 Ga0587117_004960 3300059627 Bacteria 1415
1321 Ga0587117_034019 3300059627 Bacteria 782
1322 Ga0587117_038117 3300059627 Bacteria 755
1323 Ga0587117_055042 3300059627 Bacteria 670
1324 Ga0587117_084311 3300059627 Bacteria 584
1325 Ga0587117_084439 3300059627 Bacteria 583
1326 Ga0587117_096261 3300059627 Bacteria 559
1327 Ga0587117_128286 3300059627 Bacteria 508
1328 Ga0587122_006423 3300059628 Bacteria 1015
1329 Ga0587122_024214 3300059628 Bacteria 679
1330 Ga0587122_027635 3300059628 Bacteria 652
1331 Ga0587127_012912 3300059629 Bacteria 674
1332 Ga0587127_013803 3300059629 Bacteria 660
1333 Ga0587127_020843 3300059629 Bacteria 580
1334 Ga0587127_020846 3300059629 Bacteria 580
1335 Ga0587128_000231 3300059630 Bacteria 3535
1336 Ga0587128_002976 3300059630 Bacteria 1829
1337 Ga0587128_019167 3300059630 Bacteria 1033
1338 Ga0587128_023505 3300059630 Bacteria 967
1339 Ga0587128_025419 3300059630 Bacteria 943
1340 Ga0587128_037450 3300059630 Bacteria 834
1341 Ga0587128_044396 3300059630 Bacteria 789
1342 Ga0587128_094006 3300059630 Bacteria 619
1343 Ga0587130_009508 3300059631 Bacteria 937
1344 Ga0587130_015055 3300059631 Bacteria 794
1345 Ga0587062_003510 3300059639 Bacteria 1592
1346 Ga0587062_014697 3300059639 Bacteria 1037
1347 Ga0587062_032954 3300059639 Bacteria 803
1348 Ga0587062_036146 3300059639 Bacteria 781
1349 Ga0587062_040297 3300059639 Bacteria 755
1350 Ga0587062_078730 3300059639 Bacteria 609
1351 Ga0587062_108832 3300059639 Bacteria 548
1352 Ga0587062_125905 3300059639 Bacteria 522
1353 Ga0587067_008983 3300059640 Bacteria 1477
1354 Ga0587067_042822 3300059640 Bacteria 886
1355 Ga0587067_045468 3300059640 Bacteria 869
1356 Ga0587067_053094 3300059640 Bacteria 826
1357 Ga0587067_055569 3300059640 Bacteria 814
1358 Ga0587067_067753 3300059640 Bacteria 763
1359 Ga0587067_097622 3300059640 Bacteria 675
1360 Ga0587067_104445 3300059640 Bacteria 660
1361 Ga0587067_160563 3300059640 Bacteria 571
1362 Ga0587067_191387 3300059640 Bacteria 539
1363 Ga0587068_006412 3300059641 Bacteria 1647
1364 Ga0587068_007578 3300059641 Bacteria 1552
1365 Ga0587068_011196 3300059641 Bacteria 1349
1366 Ga0587068_016956 3300059641 Bacteria 1159
1367 Ga0587068_024329 3300059641 Bacteria 1014
1368 Ga0587068_027484 3300059641 Bacteria 968
1369 Ga0587068_031544 3300059641 Bacteria 921
1370 Ga0587068_054018 3300059641 Bacteria 758
1371 Ga0587068_084048 3300059641 Bacteria 647
1372 Ga0587068_105858 3300059641 Bacteria 596
1373 Ga0587068_115752 3300059641 Bacteria 577
1374 Ga0587068_172780 3300059641 Bacteria 501
1375 Ga0587069_000423 3300059642 Bacteria 3153
1376 Ga0587069_022579 3300059642 Bacteria 956
1377 Ga0587069_025016 3300059642 Bacteria 925
1378 Ga0587069_038770 3300059642 Bacteria 804
1379 Ga0587069_063709 3300059642 Bacteria 685
1380 Ga0587069_065948 3300059642 Bacteria 678
1381 Ga0587069_078342 3300059642 Bacteria 640
1382 Ga0587069_094022 3300059642 Bacteria 603
1383 Ga0587069_098278 3300059642 Bacteria 595
1384 Ga0587069_101177 3300059642 Bacteria 589
1385 Ga0587069_119762 3300059642 Bacteria 557
1386 Ga0587069_155105 3300059642 Bacteria 511
1387 Ga0587072_007163 3300059643 Bacteria 1725
1388 Ga0587072_010385 3300059643 Bacteria 1503
1389 Ga0587072_032506 3300059643 Bacteria 980
1390 Ga0587072_040730 3300059643 Bacteria 902
1391 Ga0587072_052886 3300059643 Bacteria 818
1392 Ga0587072_082533 3300059643 Bacteria 697
1393 Ga0587072_103157 3300059643 Bacteria 642
1394 Ga0587072_132483 3300059643 Bacteria 588
1395 Ga0587072_151346 3300059643 Bacteria 560
1396 Ga0587075_000942 3300059644 Bacteria 2627
1397 Ga0587075_001141 3300059644 Bacteria 2484
1398 Ga0587075_015215 3300059644 Bacteria 1079
1399 Ga0587075_020016 3300059644 Bacteria 985
1400 Ga0587075_026001 3300059644 Bacteria 903
1401 Ga0587075_048705 3300059644 Bacteria 733
1402 Ga0587075_065329 3300059644 Bacteria 665
1403 Ga0587075_083329 3300059644 Bacteria 614
1404 Ga0587075_107925 3300059644 Bacteria 563
1405 Ga0587075_119878 3300059644 Bacteria 544
1406 Ga0587076_001738 3300059645 Bacteria 2297
1407 Ga0587076_002239 3300059645 Bacteria 2138
1408 Ga0587076_003512 3300059645 Bacteria 1875
1409 Ga0587076_018915 3300059645 Bacteria 1115
1410 Ga0587076_018999 3300059645 Bacteria 1113
1411 Ga0587076_032650 3300059645 Bacteria 932
1412 Ga0587076_034114 3300059645 Bacteria 918
1413 Ga0587076_048973 3300059645 Bacteria 817
1414 Ga0587076_056070 3300059645 Bacteria 782
1415 Ga0587076_088978 3300059645 Bacteria 672
1416 Ga0587076_097806 3300059645 Bacteria 651
1417 Ga0587076_107574 3300059645 Bacteria 631
1418 Ga0587078_002836 3300059646 Bacteria 1707
1419 Ga0587078_026198 3300059646 Bacteria 765
1420 Ga0587078_035613 3300059646 Bacteria 686
1421 Ga0587078_053953 3300059646 Bacteria 595
1422 Ga0587078_060681 3300059646 Bacteria 573
1423 Ga0587078_083937 3300059646 Bacteria 514
1424 Ga0587078_086781 3300059646 Bacteria 509
1425 Ga0587079_001277 3300059647 Bacteria 2762
1426 Ga0587079_007543 3300059647 Bacteria 1632
1427 Ga0587079_008150 3300059647 Bacteria 1592
1428 Ga0587079_008584 3300059647 Bacteria 1567
1429 Ga0587079_013901 3300059647 Bacteria 1341
1430 Ga0587079_019197 3300059647 Bacteria 1207
1431 Ga0587079_020407 3300059647 Bacteria 1182
1432 Ga0587079_024036 3300059647 Bacteria 1120
1433 Ga0587079_041959 3300059647 Bacteria 928
1434 Ga0587079_049661 3300059647 Bacteria 876
1435 Ga0587079_080950 3300059647 Bacteria 743
1436 Ga0587079_083553 3300059647 Bacteria 734
1437 Ga0587079_083715 3300059647 Bacteria 734
1438 Ga0587079_091965 3300059647 Bacteria 711
1439 Ga0587079_104607 3300059647 Bacteria 680
1440 Ga0587079_106599 3300059647 Bacteria 676
1441 Ga0587079_116810 3300059647 Bacteria 655
1442 Ga0587079_130581 3300059647 Bacteria 631
1443 Ga0587079_160316 3300059647 Bacteria 588
1444 Ga0587079_213699 3300059647 Bacteria 532
1445 Ga0587079_234985 3300059647 Bacteria 515
1446 Ga0587100_001025 3300059648 Bacteria 1528
1447 Ga0587100_001642 3300059648 Bacteria 1341
1448 Ga0587100_002716 3300059648 Bacteria 1165
1449 Ga0587100_003045 3300059648 Bacteria 1126
1450 Ga0587100_039625 3300059648 Bacteria 527
1451 Ga0587100_046374 3300059648 Bacteria 502
1452 Ga0587102_002171 3300059649 Bacteria 1486
1453 Ga0587102_004939 3300059649 Bacteria 1159
1454 Ga0587102_016609 3300059649 Bacteria 793
1455 Ga0587102_018048 3300059649 Bacteria 774
1456 Ga0587102_019065 3300059649 Bacteria 760
1457 Ga0587102_023351 3300059649 Bacteria 713
1458 Ga0587102_030170 3300059649 Bacteria 659
1459 Ga0587102_044030 3300059649 Bacteria 584
1460 Ga0587102_046947 3300059649 Bacteria 572
1461 Ga0587104_006205 3300059650 Bacteria 805
1462 Ga0587104_010995 3300059650 Bacteria 669
1463 Ga0587105_011039 3300059651 Bacteria 692
1464 Ga0587105_021148 3300059651 Bacteria 572
1465 Ga0587105_031492 3300059651 Bacteria 508
1466 Ga0587107_001773 3300059652 Bacteria 1823
1467 Ga0587107_005621 3300059652 Bacteria 1334
1468 Ga0587107_009040 3300059652 Bacteria 1166
1469 Ga0587107_026966 3300059652 Bacteria 847
1470 Ga0587107_056122 3300059652 Bacteria 682
1471 Ga0587107_056366 3300059652 Bacteria 681
1472 Ga0587107_058032 3300059652 Bacteria 675
1473 Ga0587107_074147 3300059652 Bacteria 627
1474 Ga0587108_020281 3300059653 Bacteria 628
1475 Ga0587108_027844 3300059653 Bacteria 566
1476 Ga0587108_039353 3300059653 Bacteria 504
1477 Ga0587110_003344 3300059654 Bacteria 1336
1478 Ga0587110_019685 3300059654 Bacteria 755
1479 Ga0587110_028756 3300059654 Bacteria 668
1480 Ga0587114_001018 3300059655 Bacteria 2192
1481 Ga0587114_006659 3300059655 Bacteria 1299
1482 Ga0587114_021119 3300059655 Bacteria 919
1483 Ga0587114_059950 3300059655 Bacteria 665
1484 Ga0587114_084231 3300059655 Bacteria 596
1485 Ga0587116_01217 3300059656 Bacteria 1214
1486 Ga0587116_17275 3300059656 Bacteria 532
1487 Ga0587119_001808 3300059658 Bacteria 1832
1488 Ga0587119_005015 3300059658 Bacteria 1340
1489 Ga0587119_008110 3300059658 Bacteria 1148
1490 Ga0587119_015334 3300059658 Bacteria 927
1491 Ga0587119_045009 3300059658 Bacteria 644
1492 Ga0587119_068161 3300059658 Bacteria 560
1493 Ga0587119_079085 3300059658 Bacteria 533
1494 Ga0587120_003320 3300059659 Bacteria 1151
1495 Ga0587120_016986 3300059659 Bacteria 668
1496 Ga0587120_022896 3300059659 Bacteria 604
1497 Ga0587071_003723 3300060344 Bacteria 2215
1498 Ga0587071_009573 3300060344 Bacteria 1598
1499 Ga0587071_011816 3300060344 Bacteria 1480
1500 Ga0587071_012420 3300060344 Bacteria 1453
1501 Ga0587071_042401 3300060344 Bacteria 916
1502 Ga0587071_073640 3300060344 Bacteria 748
1503 Ga0587071_086010 3300060344 Bacteria 707
1504 Ga0587071_103454 3300060344 Bacteria 662
1505 Ga0587071_105515 3300060344 Bacteria 657
1506 Ga0587071_106314 3300060344 Bacteria 655
1507 Ga0587071_109830 3300060344 Bacteria 647
1508 Ga0587071_110550 3300060344 Bacteria 646
1509 Ga0587071_224144 3300060344 Bacteria 501
1510 Ga0587111_0002392 3300060346 Bacteria 2492
1511 Ga0587111_0004349 3300060346 Bacteria 2101
1512 Ga0587111_0006892 3300060346 Bacteria 1822
1513 Ga0587111_0010132 3300060346 Bacteria 1611
1514 Ga0587111_0010639 3300060346 Bacteria 1584
1515 Ga0587111_0010952 3300060346 Bacteria 1570
1516 Ga0587111_0012560 3300060346 Bacteria 1498
1517 Ga0587111_0016715 3300060346 Bacteria 1358
1518 Ga0587111_0025685 3300060346 Bacteria 1168
1519 Ga0587111_0029964 3300060346 Bacteria 1105
1520 Ga0587111_0032277 3300060346 Bacteria 1076
1521 Ga0587111_0070436 3300060346 Bacteria 815
1522 Ga0587111_0073385 3300060346 Bacteria 803
1523 Ga0587111_0082601 3300060346 Bacteria 770
1524 Ga0587111_0083066 3300060346 Bacteria 769
1525 Ga0587111_0149340 3300060346 Bacteria 626
1526 Ga0587111_0164445 3300060346 Bacteria 606
1527 Ga0587111_0167768 3300060346 Bacteria 601
1528 Ga0587111_0186118 3300060346 Bacteria 580
1529 Ga0587111_0192093 3300060346 Bacteria 574
1530 Ga0587111_0196665 3300060346 Bacteria 569
1531 Ga0587111_0205514 3300060346 Bacteria 561
1532 Ga0587111_0254075 3300060346 Bacteria 521
1533 Ga0501082_0116201 3300060353 Bacteria 2317
1534 Ga0501082_0469068 3300060353 Bacteria 1100
1535 Ga0466962_0016446 3300061719 Bacteria 3568
1536 Ga0466962_0066031 3300061719 Bacteria 1727
1537 Ga0466962_0089480 3300061719 Bacteria 1474
1538 Ga0466962_0601038 3300061719 Bacteria 561
1539 Ga0530510_0051747 3300061734 Bacteria 2968
1540 2528205978 2527291627 Bacteria 5309833
1541 2528215642 2527291629 Bacteria 5267418
1542 2546951158 2546825537 Bacteria 5389291
1543 2558906592 2558860112 Bacteria 9931328
1544 2579750830 2576861822 Bacteria 5004595
1545 2734968320 2734482000 Bacteria 5525167
1546 2774866829 2773857924 Bacteria 5256821
1547 2795785159 2795385470 Bacteria 8317180
1548 3003003853 3002998708 Bacteria 11715108
1549 637879847 637000116 Bacteria 5433628
1550 8054474609 8054472261 Bacteria 7464355
1551 LJQas_1007275
1552 bgg_mtDRAFT_1037018
1553 JGI24739J22299_10100985
1554 JGI24737J22298_10154805
1555 JGI24743J22301_10006549
1556 JGI24743J22301_10010932
1557 JGI24744J21845_10032804
1558 Ga0006765J45826_106115
1559 Ga0006770J48903_1024152
1560 Ga0006770J48903_1036028
1561 Ga0006770J48903_1044414
1562 rootH2_10037862
1563 JGI25407J50210_10010461
1564 JGI25407J50210_10022104
1565 JGI25407J50210_10058016
1566 JGI25407J50210_10068958
1567 Ga0007417J51691_1011844
1568 Ga0007417J51691_1020894
1569 Ga0007417J51691_1023789
1570 Ga0007417J51691_1029232
1571 Ga0007417J51691_1031395
1572 Ga0007417J51691_1032285
1573 Ga0007417J51691_1033691
1574 Ga0006781J51513_1006097
1575 Ga0006781J51513_1013153
1576 Ga0006781J51513_1016077
1577 Ga0007410J51695_1008856
1578 Ga0007410J51695_1018389
1579 Ga0007410J51695_1042192
1580 Ga0007409J51694_1007741
1581 Ga0007409J51694_1007742
1582 Ga0007409J51694_1011577
1583 Ga0007409J51694_1019397
1584 Ga0007409J51694_1022556
1585 Ga0007409J51694_1041078
1586 Ga0007416J51690_1009019
1587 Ga0007416J51690_1011696
1588 Ga0007416J51690_1018488
1589 Ga0007416J51690_1021822
1590 Ga0007416J51690_1050276
1591 Ga0007429J51699_1013820
1592 Ga0007429J51699_1020887
1593 Ga0007429J51699_1021803
1594 Ga0007429J51699_1034151
1595 Ga0007429J51699_1039154
1596 Ga0007429J51699_1080258
1597 Ga0032354_1003417
1598 Ga0032354_1023209
1599 Ga0032354_1033193
1600 Ga0032354_1037363
1601 Ga0032354_1043219
1602 Ga0032354_1048438
1603 Ga0058858_1001640
1604 Ga0058858_1035079
1605 Ga0058858_1428512
1606 Ga0058858_1438279
1607 Ga0058859_10007395
1608 Ga0058859_10039925
1609 Ga0058859_10052612
1610 Ga0058859_10056563
1611 Ga0058859_10095538
1612 Ga0058859_11773704
1613 Ga0058863_10003259
1614 Ga0058863_10055411
1615 Ga0058863_10088008
1616 Ga0058863_11727525
1617 Ga0058863_11902200
1618 Ga0058863_11942052
1619 Ga0058863_11943932
1620 Ga0058861_10024395
1621 Ga0058861_10024951
1622 Ga0058861_10043603
1623 Ga0058861_10071225
1624 Ga0058861_10075982
1625 Ga0058861_10083556
1626 Ga0058861_10150641
1627 Ga0058861_11798679
1628 Ga0058861_11977214
1629 Ga0058861_12056731
1630 Ga0058860_10041629
1631 Ga0058860_10053668
1632 Ga0058860_10134167
1633 Ga0058860_10154251
1634 Ga0058860_12159347
1635 Ga0058860_12212618
1636 Ga0058862_10048961
1637 Ga0058862_10053678
1638 Ga0058862_10057100
1639 Ga0058862_10060482
1640 Ga0058862_10060744
1641 Ga0058862_10105153
1642 Ga0058862_10253325
1643 Ga0058862_10270879
1644 Ga0058862_12828490
1645 Ga0058862_12840016
1646 Ga0058862_12863248
1647 Ga0070658_10599438
1648 Ga0070676_10435713
1649 Ga0070683_100072328
1650 Ga0070683_100202443
1651 Ga0070683_100609912
1652 Ga0070683_100627640
1653 Ga0070683_100839796
1654 Ga0070683_100959124
1655 Ga0070690_100855116
1656 Ga0070690_101576115
1657 Ga0070670_100368653
1658 Ga0070677_10109300
1659 Ga0068869_100495114
1660 Ga0068869_102018736
1661 Ga0070666_10633179
1662 Ga0070680_101448709
1663 Ga0070680_101506020
1664 Ga0070682_100685631
1665 Ga0070682_100924541
1666 Ga0070682_101001488
1667 Ga0070682_101190278
1668 Ga0070682_101774655
1669 Ga0068868_100035170
1670 Ga0068868_100055544
1671 Ga0068868_100666726
1672 Ga0068868_100754730
1673 Ga0068868_100875139
1674 Ga0068868_101154274
1675 Ga0068868_101376143
1676 Ga0068868_102153452
1677 Ga0070660_100456127
1678 Ga0070660_100599909
1679 Ga0070660_101375065
1680 Ga0070660_101539022
1681 Ga0070689_100604638
1682 Ga0070691_10145866
1683 Ga0070691_10244589
1684 Ga0070687_100142621
1685 Ga0070661_100624402
1686 Ga0070661_100837144
1687 Ga0070661_100862549
1688 Ga0070661_101215586
1689 Ga0070692_10150862
1690 Ga0070668_100228838
1691 Ga0070668_101426143
1692 Ga0070668_101532898
1693 Ga0070669_100125620
1694 Ga0070669_100148199
1695 Ga0070669_101363192
1696 Ga0070671_100147713
1697 Ga0070671_100940707
1698 Ga0070671_101122269
1699 Ga0070674_100459216
1700 Ga0070674_101090667
1701 Ga0070674_101599540
1702 Ga0070673_100065020
1703 Ga0070673_100326373
1704 Ga0070688_100157089
1705 Ga0070659_100097958
1706 Ga0070659_100112896
1707 Ga0070659_100513301
1708 Ga0070659_101540267
1709 Ga0070667_100068700
1710 Ga0070667_100328191
1711 Ga0070667_100517309
1712 Ga0070667_100964915
1713 Ga0070709_10883544
1714 Ga0070709_11117971
1715 Ga0070714_100199986
1716 Ga0070714_100233213
1717 Ga0070713_100554814
1718 Ga0070713_100878073
1719 Ga0070710_10910099
1720 Ga0070701_10015984
1721 Ga0070701_10630101
1722 Ga0070705_100055200
1723 Ga0070700_100140647
1724 Ga0070700_100156908
1725 Ga0070700_100302245
1726 Ga0070700_100329018
1727 Ga0070700_100466207
1728 Ga0070700_100555027
1729 Ga0070700_100568357
1730 Ga0070700_100703542
1731 Ga0070694_100095580
1732 Ga0070694_100470840
1733 Ga0070663_100262783
1734 Ga0070663_100511201
1735 Ga0070663_101170247
1736 Ga0070678_100518942
1737 Ga0070678_100755865
1738 Ga0070662_100162562
1739 Ga0070662_100191026
1740 Ga0068867_100342253
1741 Ga0070685_10379059
1742 Ga0070685_10406983
1743 Ga0070706_101703484
1744 Ga0070679_101300920
1745 Ga0070679_101577828
1746 Ga0070679_101669664
1747 Ga0070684_100047435
1748 Ga0070684_100314713
1749 Ga0070684_100398936
1750 Ga0070684_100538851
1751 Ga0070684_100570603
1752 Ga0070684_101270674
1753 Ga0070697_100907460
1754 Ga0068853_100112495
1755 Ga0068853_100753506
1756 Ga0068853_101215439
1757 Ga0070672_100405697
1758 Ga0070672_102041055
1759 Ga0070686_100385048
1760 Ga0070695_101035449
1761 Ga0070696_100195216
1762 Ga0070696_101386851
1763 Ga0070693_100732703
1764 Ga0070665_101663393
1765 Ga0068855_100467800
1766 Ga0070664_100038021
1767 Ga0070664_100326428
1768 Ga0070664_100356458
1769 Ga0070664_100542883
1770 Ga0070664_100547388
1771 Ga0070664_100588177
1772 Ga0068857_101170658
1773 Ga0068857_101435059
1774 Ga0068857_101501003
1775 Ga0068854_100133284
1776 Ga0068854_100192331
1777 Ga0068854_100208031
1778 Ga0068856_100156611
1779 Ga0070702_100005968
1780 Ga0070702_100094856
1781 Ga0070702_100100036
1782 Ga0070702_100148753
1783 Ga0070702_100215487
1784 Ga0070702_100753777
1785 Ga0070702_100829735
1786 Ga0070702_100873534
1787 Ga0068852_100148741
1788 Ga0068852_100169066
1789 Ga0068852_100486021
1790 Ga0068859_100238473
1791 Ga0068859_100443167
1792 Ga0068859_101302505
1793 Ga0068864_100178065
1794 Ga0068864_100215043
1795 Ga0068864_100632467
1796 Ga0068864_101953739
1797 Ga0068864_102048266
1798 Ga0068866_10019649
1799 Ga0068866_10290617
1800 Ga0068866_10774535
1801 Ga0068861_100028854
1802 Ga0068861_100267341
1803 Ga0068861_102141785
1804 Ga0068861_102240874
1805 Ga0068861_102376794
1806 Ga0068851_10159693
1807 Ga0068851_10481159
1808 Ga0068870_10169519
1809 Ga0068870_10572242
1810 Ga0068870_10848555
1811 Ga0068870_11076824
1812 Ga0068863_100748762
1813 Ga0068863_100827451
1814 Ga0068863_101904246
1815 Ga0068858_100047141
1816 Ga0068858_100437264
1817 Ga0068858_101085829
1818 Ga0068858_101928464
1819 Ga0068860_100380868
1820 Ga0068860_101387967
1821 Ga0068862_100174048
1822 Ga0068862_100485760
1823 Ga0081455_10066477
1824 Ga0081455_10125348
1825 Ga0081455_10128478
1826 Ga0081455_10268510
1827 Ga0081455_10269260
1828 Ga0081455_10407928
1829 Ga0081538_10000664
1830 Ga0081538_10008845
1831 Ga0081538_10009398
1832 Ga0081538_10030120
1833 Ga0081538_10052198
1834 Ga0081538_10170267
1835 Ga0081540_1022450
1836 Ga0081540_1331141
1837 Ga0081539_10121012
1838 Ga0081539_10245063
1839 Ga0070717_10062040
1840 Ga0070717_10110108
1841 Ga0070717_11117588
1842 Ga0075365_10202400
1843 Ga0075365_10224296
1844 Ga0075365_10285206
1845 Ga0075363_100741067
1846 Ga0075432_10441052
1847 Ga0070712_100383841
1848 Ga0097621_100244419
1849 Ga0097621_101929724
1850 Ga0068871_100528844
1851 Ga0068871_100833751
1852 Ga0075431_100347623
1853 Ga0075433_10491591
1854 Ga0068865_100113770
1855 Ga0068865_100338298
1856 Ga0068865_100951209
1857 Ga0068865_102140123
1858 Ga0097620_100238483
1859 Ga0097620_100443170
1860 Ga0097620_101302375
1861 Ga0099795_10000516
1862 Ga0105244_10045580
1863 Ga0105240_12152258
1864 Ga0111539_10007452
1865 Ga0111539_10084596
1866 Ga0111539_10437064
1867 Ga0111539_10560598
1868 Ga0111539_11025554
1869 Ga0111539_11770868
1870 Ga0105245_10022555
1871 Ga0105245_10630595
1872 Ga0105245_11361976
1873 Ga0105245_11912945
1874 Ga0105245_12286903
1875 Ga0105245_12339952
1876 Ga0105245_12950837
1877 Ga0105247_10368293
1878 Ga0105247_10403907
1879 Ga0105247_10734927
1880 Ga0114129_12214805
1881 Ga0114129_13055305
1882 Ga0105243_10048410
1883 Ga0105243_10071897
1884 Ga0105243_10179357
1885 Ga0105243_10213753
1886 Ga0105243_10304961
1887 Ga0105243_11315281
1888 Ga0105243_11734047
1889 Ga0105241_10173608
1890 Ga0105241_10638040
1891 Ga0105241_10641548
1892 Ga0105241_11691031
1893 Ga0105242_10042742
1894 Ga0105242_10379605
1895 Ga0105242_10509902
1896 Ga0105242_11128143
1897 Ga0105248_11377886
1898 Ga0105248_13301844
1899 Ga0105237_11732556
1900 Ga0105237_11850821
1901 Ga0105238_10056515
1902 Ga0105238_11351259
1903 Ga0105238_11446994
1904 Ga0105249_10080410
1905 Ga0105249_10263012
1906 Ga0105249_10341069
1907 Ga0105249_10459598
1908 Ga0105249_11165937
1909 Ga0105035_100266
1910 Ga0099796_10014450
1911 Ga0105239_10225017
1912 Ga0105239_10335464
1913 Ga0105239_10366509
1914 Ga0105239_10601639
1915 Ga0105239_11030401
1916 Ga0105239_11478105
1917 Ga0105246_10160157
1918 Ga0105246_10165043
1919 Ga0105246_10557737
1920 Ga0105246_10603067
1921 Ga0105246_12111238
1922 Ga0157341_1020259
1923 Ga0157373_10257737
1924 Ga0157371_10109900
1925 Ga0157371_10710014
1926 Ga0157371_10838035
1927 Ga0157371_11192176
1928 Ga0157369_10394030
1929 Ga0157369_10883201
1930 Ga0157374_10113464
1931 Ga0157374_11407785
1932 Ga0157374_11680570
1933 Ga0157374_11940134
1934 Ga0157374_11954601
1935 Ga0157374_12446891
1936 Ga0157378_10618109
1937 Ga0157378_10748200
1938 Ga0157378_10887486
1939 Ga0157378_10894874
1940 Ga0163162_10412857
1941 Ga0163162_11490716
1942 Ga0163162_12088732
1943 Ga0163162_12089425
1944 Ga0163162_12236230
1945 Ga0163162_12291519
1946 Ga0157372_10104427
1947 Ga0157372_10504305
1948 Ga0157372_10578628
1949 Ga0157372_10716473
1950 Ga0157372_12126498
1951 Ga0157375_10174399
1952 Ga0157375_10429033
1953 Ga0157375_10494744
1954 Ga0157375_13175425
1955 Ga0163163_13295134
1956 Ga0157380_10109278
1957 Ga0157380_10403373
1958 Ga0157380_12030140
1959 Ga0182008_10436448
1960 Ga0182008_10568077
1961 Ga0157377_10150374
1962 Ga0157377_10458470
1963 Ga0157377_10520742
1964 Ga0157377_11189267
1965 Ga0157379_10291540
1966 Ga0157379_11165340
1967 Ga0157379_11686778
1968 Ga0157376_10720216
1969 Ga0157376_10809898
1970 Ga0163161_10228459
1971 Ga0163161_10609151
1972 Ga0163161_11021927
1973 Ga0163161_11062866
1974 Ga0163161_11726911
1975 Ga0163161_11953049
1976 Ga0197907_10559423
1977 Ga0197907_10685680
1978 Ga0197907_11395746
1979 Ga0206356_10170539
1980 Ga0206356_10275481
1981 Ga0206356_10811388
1982 Ga0206356_11208272
1983 Ga0206356_11567341
1984 Ga0206349_1383806
1985 Ga0206355_1021710
1986 Ga0206352_10107249
1987 Ga0206352_10590329
1988 Ga0206352_10818017
1989 Ga0206350_10917422
1990 Ga0206350_11505953
1991 Ga0206350_11570365
1992 Ga0206354_10732226
1993 Ga0206354_10751741
1994 Ga0206354_11379949
1995 Ga0206353_10241100
1996 Ga0206353_10477591
1997 Ga0206353_11170794
1998 Ga0206353_11391376
1999 Ga0206353_11649880
2000 Ga0213875_10000186
2001 Ga0224712_10371560
2002 Ga0207426_1018112
2003 Ga0207426_1124550
2004 Ga0207697_10284075
2005 Ga0207656_10087858
2006 Ga0207656_10373081
2007 Ga0207653_10345804
2008 Ga0207682_10075049
2009 Ga0207692_10086812
2010 Ga0207692_10429837
2011 Ga0207692_10766509
2012 Ga0207642_10115606
2013 Ga0207642_10226435
2014 Ga0207642_10343382
2015 Ga0207710_10066252
2016 Ga0207688_10006305
2017 Ga0207688_10149196
2018 Ga0207647_10130772
2019 Ga0207647_10419278
2020 Ga0207685_10060235
2021 Ga0207645_10081146
2022 Ga0207645_10226161
2023 Ga0207643_10061448
2024 Ga0207643_10104243
2025 Ga0207643_10117336
2026 Ga0207643_10138730
2027 Ga0207705_10054463
2028 Ga0207654_10240415
2029 Ga0207654_10328311
2030 Ga0207707_11454280
2031 Ga0207695_10406402
2032 Ga0207671_10611250
2033 Ga0207663_10599426
2034 Ga0207660_11157018
2035 Ga0207660_11483633
2036 Ga0207662_10030208
2037 Ga0207662_10097614
2038 Ga0207662_10182117
2039 Ga0207662_10408059
2040 Ga0207657_10060828
2041 Ga0207657_10273336
2042 Ga0207657_10437776
2043 Ga0207649_10207360
2044 Ga0207649_10318788
2045 Ga0207652_11405623
2046 Ga0207646_10342955
2047 Ga0207681_10296625
2048 Ga0207681_10438408
2049 Ga0207681_11130789
2050 Ga0207694_10082177
2051 Ga0207694_10161392
2052 Ga0207694_10301109
2053 Ga0207694_10905386
2054 Ga0207659_10218490
2055 Ga0207659_10607951
2056 Ga0207687_10065756
2057 Ga0207687_10096654
2058 Ga0207687_10255396
2059 Ga0207687_10274063
2060 Ga0207687_10387045
2061 Ga0207687_11285005
2062 Ga0207700_10081286
2063 Ga0207700_11151663
2064 Ga0207664_10239794
2065 Ga0207664_10249508
2066 Ga0207644_10814765
2067 Ga0207644_11475183
2068 Ga0207644_11504483
2069 Ga0207690_10117990
2070 Ga0207690_10193012
2071 Ga0207690_10350225
2072 Ga0207690_11018432
2073 Ga0207690_11507783
2074 Ga0207706_10342067
2075 Ga0207706_10416919
2076 Ga0207706_10567251
2077 Ga0207706_10683154
2078 Ga0207706_11015186
2079 Ga0207686_10219923
2080 Ga0207686_10319424
2081 Ga0207709_10016973
2082 Ga0207709_10150636
2083 Ga0207709_10252942
2084 Ga0207709_10261617
2085 Ga0207709_10267706
2086 Ga0207709_10506832
2087 Ga0207670_10015950
2088 Ga0207670_10558913
2089 Ga0207670_11655283
2090 Ga0207669_10465844
2091 Ga0207704_10046576
2092 Ga0207704_10568324
2093 Ga0207704_11473372
2094 Ga0207704_11703365
2095 Ga0207665_11215471
2096 Ga0207691_10128791
2097 Ga0207691_10222398
2098 Ga0207691_10231547
2099 Ga0207711_10598136
2100 Ga0207689_10385010
2101 Ga0207689_10523120
2102 Ga0207689_10623572
2103 Ga0207661_10073549
2104 Ga0207661_10367696
2105 Ga0207661_10562315
2106 Ga0207661_10626967
2107 Ga0207661_11013008
2108 Ga0207661_11068171
2109 Ga0207661_11448385
2110 Ga0207679_10098467
2111 Ga0207679_10139564
2112 Ga0207679_10293666
2113 Ga0207679_10310375
2114 Ga0207679_10379276
2115 Ga0207679_10565132
2116 Ga0207679_10706117
2117 Ga0207667_10209220
2118 Ga0207667_10632047
2119 Ga0207651_10749441
2120 Ga0207651_10899179
2121 Ga0207651_12092025
2122 Ga0207712_10345794
2123 Ga0207712_10583914
2124 Ga0207712_10971442
2125 Ga0207712_11164936
2126 Ga0207668_10165750
2127 Ga0207668_10241147
2128 Ga0207668_11422266
2129 Ga0207640_10090771
2130 Ga0207640_10119204
2131 Ga0207640_10749486
2132 Ga0207640_10871815
2133 Ga0207640_11093040
2134 Ga0207658_10077177
2135 Ga0207658_10415697
2136 Ga0207677_10119823
2137 Ga0207677_10265266
2138 Ga0207677_10282281
2139 Ga0207677_10394617
2140 Ga0207677_10462761
2141 Ga0207677_11539043
2142 Ga0207703_10457821
2143 Ga0207703_11702061
2144 Ga0207703_11726728
2145 Ga0207639_10327841
2146 Ga0207678_10091030
2147 Ga0207678_10135952
2148 Ga0207678_10337880
2149 Ga0207678_10471933
2150 Ga0207678_10780579
2151 Ga0207708_10006747
2152 Ga0207708_10021676
2153 Ga0207708_10117707
2154 Ga0207708_10212189
2155 Ga0207708_10435132
2156 Ga0207708_10491497
2157 Ga0207702_10385135
2158 Ga0207702_11030810
2159 Ga0207641_10410437
2160 Ga0207641_10602444
2161 Ga0207648_10036106
2162 Ga0207648_10069143
2163 Ga0207648_11031103
2164 Ga0207648_11370253
2165 Ga0207676_10160438
2166 Ga0207676_10330611
2167 Ga0207676_10364529
2168 Ga0207676_10558008
2169 Ga0207676_11799746
2170 Ga0207674_10189996
2171 Ga0207674_10268034
2172 Ga0207674_10309208
2173 Ga0207674_10772180
2174 Ga0207674_11517907
2175 Ga0207675_100015029
2176 Ga0207675_100027033
2177 Ga0207675_100386488
2178 Ga0207675_100626540
2179 Ga0207675_101905379
2180 Ga0207683_10146311
2181 Ga0207683_10427290
2182 Ga0207698_10025487
2183 Ga0207698_10332046
2184 Ga0207698_10451066
2185 Ga0207698_10600255
2186 Ga0207698_10863129
2187 Ga0210002_1026614
2188 Ga0207428_10035062
2189 Ga0207428_10064577
2190 Ga0207428_10230917
2191 Ga0207428_11253473
2192 Ga0268266_12191820
2193 Ga0268265_10220765
2194 Ga0268265_10243786
2195 Ga0268265_11122965
2196 Ga0268264_10236003
2197 Ga0268264_10372871
2198 Ga0268264_10567988
2199 Ga0307515_10282807
2200 Ga0311001_1068448
2201 Ga0265766_1000621
2202 Ga0307513_10001463
2203 Ga0307509_10324242
2204 Ga0307408_100099408
2205 Ga0307408_100673465
2206 Ga0307405_10035279
2207 Ga0307405_11429335
2208 Ga0307405_11947356
2209 Ga0307413_11549141
2210 Ga0307410_10235915
2211 Ga0307410_10373024
2212 Ga0307410_10874195
2213 Ga0307410_11037735
2214 Ga0307410_11313617
2215 Ga0307406_10324856
2216 Ga0307406_10455891
2217 Ga0307406_11128299
2218 Ga0307406_11797948
2219 Ga0307406_11820032
2220 Ga0307407_10028596
2221 Ga0307407_10401120
2222 Ga0307407_10840084
2223 Ga0307407_10859732
2224 Ga0307412_11248457
2225 Ga0307412_11556021
2226 Ga0307409_100065027
2227 Ga0307409_100088553
2228 Ga0307416_100096931
2229 Ga0307416_100596372
2230 Ga0307416_100745749
2231 Ga0307416_101215646
2232 Ga0307416_101728795
2233 Ga0307416_102232325
2234 Ga0307414_10159495
2235 Ga0307414_10302843
2236 Ga0307411_10212720
2237 Ga0307411_10399537
2238 Ga0307411_10765883
2239 Ga0307411_11520559
2240 Ga0307415_100046422
2241 Ga0307415_100080155
2242 Ga0307415_100217910
2243 Ga0307415_100360563
2244 Ga0307415_100676615
2245 Ga0307415_100781586
2246 Ga0307415_100867099
2247 Ga0307415_101126391
2248 Ga0307507_10016447
2249 Ga0307507_10421610
2250 Ga0307510_10128745
2251 Ga0373948_0052903
2252 Ga0373952_0035304
2253 Ga0373960_0224769
2254 Ga0373962_0069926
2255 Ga0373931_0762600
2256 Ga0395900_0262505
2257 Ga0395900_0480304
2258 Ga0395900_1437529
2259 Ga0395898_0082059
2260 Ga0395898_0203609
2261 Ga0395898_0607035
2262 Ga0395898_1059989
2263 Ga0395898_1703167
2264 Ga0436364_1040466
2265 Ga0395901_0016549
2266 Ga0395901_0378307
2267 Ga0395901_1517126
2268 Ga0451789_0128125
2269 Ga0451791_0134196
2270 Ga0451801_20889
2271 Ga0451798_0205759
2272 Ga0451800_0529711
2273 Ga0451800_0798604
2274 Ga0451802_0283187
2275 Ga0451802_1367216
2276 Ga0451805_092273
2277 Ga0451804_0654268
2278 Ga0451807_1200229
2279 Ga0451839_0954223
2280 Ga0451841_0722847
2281 Ga0451845_0883599
2282 Ga0451847_0240470
2283 Ga0451851_0564806
2284 Ga0451843_0427164
2285 Ga0451843_0898051
2286 Ga0451853_3042107
2287 Ga0439455_0013690
2288 Ga0439456_032747
2289 Ga0439463_015388
2290 Ga0450913_012317
2291 Ga0439440_0008620
2292 Ga0466969_0334174
2293 Ga0466972_0010066
2294 Ga0466965_0001592
2295 Ga0466965_0166270
2296 Ga0466965_0169076
2297 Ga0466966_0010823
2298 Ga0466963_0023118
2299 Ga0466963_0080919
2300 Ga0466963_0137997
2301 Ga0466963_0652069
2302 Ga0466964_0148680
2303 Ga0466971_0036627
2304 Ga0466971_0106427
2305 Ga0466970_0011374
2306 Ga0466970_0622520
2307 Ga0466957_0097592
2308 Ga0466957_0606913
2309 Ga0466957_0611034
2310 Ga0466957_0810454
2311 Ga0466960_0002139
2312 Ga0466960_0024310
2313 Ga0466960_0223944
2314 Ga0466959_0039373
2315 Ga0466959_0755709
2316 Ga0466958_0007347
2317 Ga0466958_0571255
2318 Ga0466967_0040750
2319 Ga0466967_0057831
2320 Ga0466967_0110602
2321 Ga0466967_0119187
2322 Ga0466967_0125309
2323 Ga0466967_0198901
2324 Ga0466967_0207520
2325 Ga0466967_0623831
2326 Ga0466967_0694611
2327 Ga0466967_0929966
2328 Ga0466967_1002136
2329 Ga0495592_0246836
2330 Ga0495650_0000121
2331 Ga0495582_0648186
2332 Ga0495605_0206732
2333 Ga0495664_0199755
2334 Ga0495584_0105725
2335 Ga0495584_0424660
2336 Ga0495596_0391688
2337 Ga0495620_0152288
2338 Ga0495620_0248283
2339 Ga0495628_0782046
2340 Ga0495631_0073623
2341 Ga0495643_0189256
2342 Ga0495643_0292210
2343 Ga0495643_0483711
2344 Ga0495663_0190944
2345 Ga0495652_0197519
2346 Ga0495640_0284809
2347 Ga0495609_0183579
2348 Ga0495597_0234214
2349 Ga0495656_0200638
2350 Ga0495656_0531202
2351 Ga0495668_0298181
2352 Ga0495661_0214353
2353 Ga0495657_0316103
2354 Ga0495670_0193902
2355 Ga0495660_0430780
2356 Ga0495604_0868413
2357 Ga0495680_0440993
2358 Ga0495685_204320
2359 Ga0495686_0129578
2360 Ga0495602_0288454
2361 Ga0495615_0121571
2362 Ga0496100_0002773
2363 Ga0496100_0536201
2364 Ga0496100_0956149
2365 Ga0496100_1431507
2366 Ga0496100_1572317
2367 Ga0496101_0191749
2368 Ga0496101_0420541
2369 Ga0496102_0028096
2370 Ga0496102_0069677
2371 Ga0496102_0207279
2372 Ga0496102_0374613
2373 Ga0496102_1124164
2374 Ga0496103_0179030
2375 Ga0496103_0228643
2376 Ga0496104_0001942
2377 Ga0496105_0038675
2378 Ga0496105_0137245
2379 Ga0496105_0411382
2380 Ga0496105_0542447
2381 Ga0496106_0003395
2382 Ga0496106_0034087
2383 Ga0496106_0089222
2384 Ga0496106_0196797
2385 Ga0496106_0203841
2386 Ga0496106_0347174
2387 Ga0496106_0648786
2388 Ga0496106_0916898
2389 Ga0496107_0007662
2390 Ga0496107_0096234
2391 Ga0496107_0462601
2392 Ga0496107_0987831
2393 Ga0496108_0004397
2394 Ga0496108_0029625
2395 Ga0496108_0066759
2396 Ga0496108_0427467
2397 Ga0496108_0715708
2398 Ga0496108_1007796
2399 Ga0496108_1325997
2400 Ga0496109_0003783
2401 Ga0496109_0049151
2402 Ga0496109_0084275
2403 Ga0496109_0160470
2404 Ga0496109_1894731
2405 Ga0496110_0008810
2406 Ga0496110_0047545
2407 Ga0496110_0211714
2408 Ga0496110_0256135
2409 Ga0496110_0486024
2410 Ga0496110_1326046
2411 Ga0496111_0009446
2412 Ga0496111_0013162
2413 Ga0496111_0042251
2414 Ga0496111_0072961
2415 Ga0496111_1047855
2416 Ga0496112_0070989
2417 Ga0496112_0076375
2418 Ga0496112_0098271
2419 Ga0496112_0336580
2420 Ga0496113_0046394
2421 Ga0496113_0168713
2422 Ga0496114_0293864
2423 Ga0496114_0744443
2424 Ga0496115_0019085
2425 Ga0496121_0895015
2426 Ga0496122_0245040
2427 Ga0496126_0841011
2428 Ga0501306_101553
2429 Ga0501308_014011
2430 Ga0501308_021415
2431 Ga0501308_051846
2432 Ga0501308_086363
2433 Ga0501305_092585
2434 Ga0501307_012450
2435 Ga0495682_0362415
2436 Ga0501291_166445
2437 Ga0501311_004211
2438 Ga0501311_011671
2439 Ga0501311_054662
2440 Ga0501311_074607
2441 Ga0501312_038468
2442 Ga0501315_023215
2443 Ga0501315_040578
2444 Ga0501317_082713
2445 Ga0501318_001018
2446 Ga0501318_003795
2447 Ga0501321_007936
2448 Ga0501321_018462
2449 Ga0501321_069983
2450 Ga0501325_001897
2451 Ga0501325_001985
2452 Ga0501325_017902
2453 Ga0501329_16827
2454 Ga0501031_0023483
2455 Ga0501031_0901149
2456 Ga0501032_0052260
2457 Ga0501032_0307944
2458 Ga0501033_0007388
2459 Ga0501033_0147150
2460 Ga0501034_0042646
2461 Ga0501034_0071807
2462 Ga0501036_0047556
2463 Ga0501036_0049091
2464 Ga0501036_0171983
2465 Ga0501036_0255412
2466 Ga0501037_0077521
2467 Ga0501037_0725049
2468 Ga0501037_1126678
2469 Ga0501038_0001079
2470 Ga0501038_0034050
2471 Ga0501038_0545548
2472 Ga0501039_0120994
2473 Ga0501039_0203613
2474 Ga0501039_0920492
2475 Ga0501042_0059447
2476 Ga0501042_0109869
2477 Ga0501042_0828630
2478 Ga0501043_0024370
2479 Ga0501043_0185597
2480 Ga0501043_0223253
2481 Ga0501046_0041339
2482 Ga0501047_0052072
2483 Ga0501048_0051421
2484 Ga0501048_0091402
2485 Ga0501048_0798079
2486 Ga0501067_0051694
2487 Ga0501067_0260731
2488 Ga0501068_0348196
2489 Ga0501068_0754843
2490 Ga0501068_0827420
2491 Ga0501069_0150182
2492 Ga0501069_0622417
2493 Ga0501070_0319174
2494 Ga0501070_0381825
2495 Ga0501070_0547027
2496 Ga0501070_1493524
2497 Ga0501071_0058388
2498 Ga0501071_0216372
2499 Ga0501071_1373206
2500 Ga0501072_0097294
2501 Ga0501072_0168191
2502 Ga0501072_0476709
2503 Ga0501073_1194656
2504 Ga0501074_0323500
2505 Ga0501075_0037970
2506 Ga0501076_0016442
2507 Ga0501076_0141130
2508 Ga0501076_0237550
2509 Ga0501076_0273975
2510 Ga0501077_0078396
2511 Ga0501077_0702772
2512 Ga0501221_216078
2513 Ga0501079_0082392
2514 Ga0501079_0226162
2515 Ga0501081_0082339
2516 Ga0501081_0306217
2517 Ga0501083_0400704
2518 Ga0501280_088980
2519 Ga0501035_0036974
2520 Ga0501035_0039260
2521 Ga0501035_0327522
2522 Ga0501035_1030741
2523 Ga0501044_0016796
2524 Ga0501044_0576948
2525 Ga0501045_0103926
2526 Ga0501045_0162626
2527 Ga0501045_0256265
2528 nmdc:mga0yw44_426241_c1
2529 nmdc:mga05p37_1163961_c1
2530 nmdc:mga05p37_715917_c1
2531 nmdc:mga0qj67_428572_c2
2532 nmdc:mga06r32_339037_c1
2533 nmdc:mga08y16_1242772_c1
2534 nmdc:mga08y16_1849565_c1
2535 nmdc:mga08y16_196471_c1
2536 nmdc:mga08y16_285749_c1
2537 nmdc:mga08y16_67959_c1
2538 nmdc:mga0n895_293134_c1
2539 nmdc:mga0rr50_807485_c1
2540 nmdc:mga0a205_1215050_c1
2541 nmdc:mga0a205_291709_c1
2542 Ga0495601_0151786
2543 Ga0495655_0002245
2544 Ga0495655_0043056
2545 Ga0495655_0366240
2546 Ga0500556_0000795
2547 Ga0500652_259146
2548 Ga0500588_0413632
2549 Ga0500589_277848
2550 Ga0500604_0058002
2551 Ga0500616_0006750
2552 Ga0500616_0019028
2553 Ga0500616_0070509
2554 Ga0500599_000599
2555 Ga0501084_0125615
2556 Ga0501084_0160909
2557 Ga0501084_0228000
2558 Ga0501084_0236930
2559 Ga0587084_002055
2560 Ga0587084_003660
2561 Ga0587084_009573
2562 Ga0587084_013874
2563 Ga0587084_014910
2564 Ga0587084_019828
2565 Ga0587084_039621
2566 Ga0587084_047051
2567 Ga0587084_097922
2568 Ga0587084_109442
2569 Ga0587084_111349
2570 Ga0587084_118767
2571 Ga0587084_119440
2572 Ga0587093_003172
2573 Ga0587093_012761
2574 Ga0587093_013733
2575 Ga0587093_017042
2576 Ga0587093_022758
2577 Ga0587093_023948
2578 Ga0587093_034077
2579 Ga0587093_047461
2580 Ga0587093_055045
2581 Ga0587093_056664
2582 Ga0587093_060095
2583 Ga0587093_063100
2584 Ga0587066_000991
2585 Ga0587066_006908
2586 Ga0587066_007921
2587 Ga0587066_017346
2588 Ga0587066_102556
2589 Ga0587066_113046
2590 Ga0587066_145128
2591 Ga0587066_149429
2592 Ga0587066_152284
2593 Ga0587066_172249
2594 Ga0587066_189410
2595 Ga0587066_190848
2596 Ga0587066_226182
2597 Ga0587070_000518
2598 Ga0587070_015780
2599 Ga0587070_027402
2600 Ga0587070_041652
2601 Ga0587070_045163
2602 Ga0587070_074895
2603 Ga0587070_075993
2604 Ga0587070_076079
2605 Ga0587070_089163
2606 Ga0587070_141789
2607 Ga0587070_165846
2608 Ga0587070_170806
2609 Ga0587073_0002621
2610 Ga0587073_0010685
2611 Ga0587073_0014258
2612 Ga0587073_0028145
2613 Ga0587073_0065717
2614 Ga0587073_0070705
2615 Ga0587073_0088168
2616 Ga0587073_0169030
2617 Ga0587073_0184224
2618 Ga0587073_0240939
2619 Ga0587073_0247866
2620 Ga0587073_0252309
2621 Ga0587073_0294384
2622 Ga0587073_0306433
2623 Ga0587077_006352
2624 Ga0587077_017451
2625 Ga0587077_027933
2626 Ga0587077_037489
2627 Ga0587077_067252
2628 Ga0587077_068909
2629 Ga0587077_069421
2630 Ga0587077_089792
2631 Ga0587077_112682
2632 Ga0587077_119469
2633 Ga0587077_134889
2634 Ga0587077_170803
2635 Ga0587077_186729
2636 Ga0587077_195201
2637 Ga0587077_268703
2638 Ga0587080_001432
2639 Ga0587080_006193
2640 Ga0587080_017952
2641 Ga0587080_018687
2642 Ga0587080_038060
2643 Ga0587080_040393
2644 Ga0587080_048491
2645 Ga0587080_056586
2646 Ga0587080_060521
2647 Ga0587080_076416
2648 Ga0587080_077941
2649 Ga0587080_081553
2650 Ga0587080_088942
2651 Ga0587080_117060
2652 Ga0587082_001111
2653 Ga0587082_004844
2654 Ga0587082_009673
2655 Ga0587082_010472
2656 Ga0587082_013344
2657 Ga0587082_015319
2658 Ga0587082_018137
2659 Ga0587082_021999
2660 Ga0587082_030084
2661 Ga0587082_041570
2662 Ga0587082_045566
2663 Ga0587082_049528
2664 Ga0587082_105971
2665 Ga0587082_118390
2666 Ga0587082_135994
2667 Ga0587082_143228
2668 Ga0587082_154109
2669 Ga0587082_188488
2670 Ga0587083_0001379
2671 Ga0587083_0006855
2672 Ga0587083_0011164
2673 Ga0587083_0042637
2674 Ga0587083_0070280
2675 Ga0587083_0073650
2676 Ga0587083_0078531
2677 Ga0587083_0095407
2678 Ga0587083_0095757
2679 Ga0587083_0152895
2680 Ga0587083_0153467
2681 Ga0587083_0154286
2682 Ga0587083_0189731
2683 Ga0587083_0199813
2684 Ga0587083_0236452
2685 Ga0587085_001378
2686 Ga0587085_003216
2687 Ga0587085_005971
2688 Ga0587085_006596
2689 Ga0587085_016647
2690 Ga0587085_017025
2691 Ga0587085_027271
2692 Ga0587085_047544
2693 Ga0587085_048064
2694 Ga0587085_049374
2695 Ga0587085_086528
2696 Ga0587085_088692
2697 Ga0587085_093283
2698 Ga0587085_098081
2699 Ga0587085_099099
2700 Ga0587085_105327
2701 Ga0587085_105371
2702 Ga0587086_000408
2703 Ga0587086_005146
2704 Ga0587086_005932
2705 Ga0587086_008361
2706 Ga0587086_012257
2707 Ga0587086_012570
2708 Ga0587086_012832
2709 Ga0587086_014606
2710 Ga0587086_020108
2711 Ga0587086_032746
2712 Ga0587086_037365
2713 Ga0587086_043191
2714 Ga0587086_056206
2715 Ga0587086_057662
2716 Ga0587086_060283
2717 Ga0587086_061017
2718 Ga0587086_063111
2719 Ga0587086_079563
2720 Ga0587086_087548
2721 Ga0587086_115562
2722 Ga0587088_001042
2723 Ga0587088_006273
2724 Ga0587088_013179
2725 Ga0587088_017968
2726 Ga0587088_022812
2727 Ga0587088_048841
2728 Ga0587088_052035
2729 Ga0587088_054429
2730 Ga0587088_057035
2731 Ga0587088_061253
2732 Ga0587088_075191
2733 Ga0587088_083279
2734 Ga0587088_090946
2735 Ga0587088_117280
2736 Ga0587088_144040
2737 Ga0587088_145770
2738 Ga0587088_166442
2739 Ga0587088_193201
2740 Ga0587088_205416
2741 Ga0587089_004290
2742 Ga0587089_015444
2743 Ga0587089_019399
2744 Ga0587089_025444
2745 Ga0587089_045265
2746 Ga0587089_055838
2747 Ga0587089_071133
2748 Ga0587089_071646
2749 Ga0587089_075152
2750 Ga0587090_005126
2751 Ga0587090_005193
2752 Ga0587090_005325
2753 Ga0587090_049008
2754 Ga0587090_074004
2755 Ga0587090_075476
2756 Ga0587090_094876
2757 Ga0587090_127665
2758 Ga0587091_002505
2759 Ga0587091_008700
2760 Ga0587091_018026
2761 Ga0587091_021312
2762 Ga0587091_034332
2763 Ga0587091_048831
2764 Ga0587091_050337
2765 Ga0587091_074737
2766 Ga0587091_075465
2767 Ga0587091_089238
2768 Ga0587091_091133
2769 Ga0587091_103726
2770 Ga0587091_116421
2771 Ga0587091_132112
2772 Ga0587091_206281
2773 Ga0587092_002129
2774 Ga0587092_029016
2775 Ga0587092_030847
2776 Ga0587092_032419
2777 Ga0587092_042202
2778 Ga0587092_101496
2779 Ga0587092_103414
2780 Ga0587092_159350
2781 Ga0587094_004792
2782 Ga0587094_018680
2783 Ga0587094_023287
2784 Ga0587094_029836
2785 Ga0587094_052605
2786 Ga0587094_066133
2787 Ga0587094_077640
2788 Ga0587094_109586
2789 Ga0587094_124374
2790 Ga0587094_127555
2791 Ga0587095_000831
2792 Ga0587095_002808
2793 Ga0587095_005790
2794 Ga0587095_019725
2795 Ga0587095_021141
2796 Ga0587095_022555
2797 Ga0587097_04508
2798 Ga0587097_05058
2799 Ga0587098_002988
2800 Ga0587098_005150
2801 Ga0587098_033869
2802 Ga0587098_050618
2803 Ga0587106_002015
2804 Ga0587106_003903
2805 Ga0587106_016693
2806 Ga0587106_027646
2807 Ga0587106_041694
2808 Ga0587106_062531
2809 Ga0587106_110024
2810 Ga0587106_139145
2811 Ga0587121_09004
2812 Ga0587125_001367
2813 Ga0587125_007431
2814 Ga0587125_008670
2815 Ga0587125_008709
2816 Ga0587125_010054
2817 Ga0587125_057886
2818 Ga0587125_079621
2819 Ga0587129_005518
2820 Ga0587129_007589
2821 Ga0587129_009139
2822 Ga0587129_010014
2823 Ga0587129_022676
2824 Ga0587131_001126
2825 Ga0587131_013108
2826 Ga0587099_000608
2827 Ga0587099_011787
2828 Ga0587099_013191
2829 Ga0587099_018936
2830 Ga0587099_025886
2831 Ga0587099_046410
2832 Ga0587099_050321
2833 Ga0587099_054770
2834 Ga0587099_059533
2835 Ga0587099_059763
2836 Ga0587099_062389
2837 Ga0587101_005266
2838 Ga0587101_012858
2839 Ga0587101_017226
2840 Ga0587101_022110
2841 Ga0587101_022480
2842 Ga0587101_027769
2843 Ga0587101_033011
2844 Ga0587101_117599
2845 Ga0587101_123985
2846 Ga0587109_007537
2847 Ga0587109_017415
2848 Ga0587109_048179
2849 Ga0587109_066185
2850 Ga0587109_072152
2851 Ga0587109_092590
2852 Ga0587109_133232
2853 Ga0587109_165335
2854 Ga0587109_202801
2855 Ga0587113_005567
2856 Ga0587113_007174
2857 Ga0587113_015837
2858 Ga0587113_032049
2859 Ga0587113_037226
2860 Ga0587115_002485
2861 Ga0587115_003264
2862 Ga0587115_010849
2863 Ga0587115_022387
2864 Ga0587115_025173
2865 Ga0587115_062328
2866 Ga0587115_068568
2867 Ga0587115_080511
2868 Ga0587115_096174
2869 Ga0587117_004775
2870 Ga0587117_004960
2871 Ga0587117_034019
2872 Ga0587117_038117
2873 Ga0587117_055042
2874 Ga0587117_084311
2875 Ga0587117_084439
2876 Ga0587117_096261
2877 Ga0587117_128286
2878 Ga0587122_006423
2879 Ga0587122_024214
2880 Ga0587122_027635
2881 Ga0587127_012912
2882 Ga0587127_013803
2883 Ga0587127_020843
2884 Ga0587127_020846
2885 Ga0587128_000231
2886 Ga0587128_002976
2887 Ga0587128_019167
2888 Ga0587128_023505
2889 Ga0587128_025419
2890 Ga0587128_037450
2891 Ga0587128_044396
2892 Ga0587128_094006
2893 Ga0587130_009508
2894 Ga0587130_015055
2895 Ga0587062_003510
2896 Ga0587062_014697
2897 Ga0587062_032954
2898 Ga0587062_036146
2899 Ga0587062_040297
2900 Ga0587062_078730
2901 Ga0587062_108832
2902 Ga0587062_125905
2903 Ga0587067_008983
2904 Ga0587067_042822
2905 Ga0587067_045468
2906 Ga0587067_053094
2907 Ga0587067_055569
2908 Ga0587067_067753
2909 Ga0587067_097622
2910 Ga0587067_104445
2911 Ga0587067_160563
2912 Ga0587067_191387
2913 Ga0587068_006412
2914 Ga0587068_007578
2915 Ga0587068_011196
2916 Ga0587068_016956
2917 Ga0587068_024329
2918 Ga0587068_027484
2919 Ga0587068_031544
2920 Ga0587068_054018
2921 Ga0587068_084048
2922 Ga0587068_105858
2923 Ga0587068_115752
2924 Ga0587068_172780
2925 Ga0587069_000423
2926 Ga0587069_022579
2927 Ga0587069_025016
2928 Ga0587069_038770
2929 Ga0587069_063709
2930 Ga0587069_065948
2931 Ga0587069_078342
2932 Ga0587069_094022
2933 Ga0587069_098278
2934 Ga0587069_101177
2935 Ga0587069_119762
2936 Ga0587069_155105
2937 Ga0587072_007163
2938 Ga0587072_010385
2939 Ga0587072_032506
2940 Ga0587072_040730
2941 Ga0587072_052886
2942 Ga0587072_082533
2943 Ga0587072_103157
2944 Ga0587072_132483
2945 Ga0587072_151346
2946 Ga0587075_000942
2947 Ga0587075_001141
2948 Ga0587075_015215
2949 Ga0587075_020016
2950 Ga0587075_026001
2951 Ga0587075_048705
2952 Ga0587075_065329
2953 Ga0587075_083329
2954 Ga0587075_107925
2955 Ga0587075_119878
2956 Ga0587076_001738
2957 Ga0587076_002239
2958 Ga0587076_003512
2959 Ga0587076_018915
2960 Ga0587076_018999
2961 Ga0587076_032650
2962 Ga0587076_034114
2963 Ga0587076_048973
2964 Ga0587076_056070
2965 Ga0587076_088978
2966 Ga0587076_097806
2967 Ga0587076_107574
2968 Ga0587078_002836
2969 Ga0587078_026198
2970 Ga0587078_035613
2971 Ga0587078_053953
2972 Ga0587078_060681
2973 Ga0587078_083937
2974 Ga0587078_086781
2975 Ga0587079_001277
2976 Ga0587079_007543
2977 Ga0587079_008150
2978 Ga0587079_008584
2979 Ga0587079_013901
2980 Ga0587079_019197
2981 Ga0587079_020407
2982 Ga0587079_024036
2983 Ga0587079_041959
2984 Ga0587079_049661
2985 Ga0587079_080950
2986 Ga0587079_083553
2987 Ga0587079_083715
2988 Ga0587079_091965
2989 Ga0587079_104607
2990 Ga0587079_106599
2991 Ga0587079_116810
2992 Ga0587079_130581
2993 Ga0587079_160316
2994 Ga0587079_213699
2995 Ga0587079_234985
2996 Ga0587100_001025
2997 Ga0587100_001642
2998 Ga0587100_002716
2999 Ga0587100_003045
3000 Ga0587100_039625
3001 Ga0587100_046374
3002 Ga0587102_002171
3003 Ga0587102_004939
3004 Ga0587102_016609
3005 Ga0587102_018048
3006 Ga0587102_019065
3007 Ga0587102_023351
3008 Ga0587102_030170
3009 Ga0587102_044030
3010 Ga0587102_046947
3011 Ga0587104_006205
3012 Ga0587104_010995
3013 Ga0587105_011039
3014 Ga0587105_021148
3015 Ga0587105_031492
3016 Ga0587107_001773
3017 Ga0587107_005621
3018 Ga0587107_009040
3019 Ga0587107_026966
3020 Ga0587107_056122
3021 Ga0587107_056366
3022 Ga0587107_058032
3023 Ga0587107_074147
3024 Ga0587108_020281
3025 Ga0587108_027844
3026 Ga0587108_039353
3027 Ga0587110_003344
3028 Ga0587110_019685
3029 Ga0587110_028756
3030 Ga0587114_001018
3031 Ga0587114_006659
3032 Ga0587114_021119
3033 Ga0587114_059950
3034 Ga0587114_084231
3035 Ga0587116_01217
3036 Ga0587116_17275
3037 Ga0587119_001808
3038 Ga0587119_005015
3039 Ga0587119_008110
3040 Ga0587119_015334
3041 Ga0587119_045009
3042 Ga0587119_068161
3043 Ga0587119_079085
3044 Ga0587120_003320
3045 Ga0587120_016986
3046 Ga0587120_022896
3047 Ga0587071_003723
3048 Ga0587071_009573
3049 Ga0587071_011816
3050 Ga0587071_012420
3051 Ga0587071_042401
3052 Ga0587071_073640
3053 Ga0587071_086010
3054 Ga0587071_103454
3055 Ga0587071_105515
3056 Ga0587071_106314
3057 Ga0587071_109830
3058 Ga0587071_110550
3059 Ga0587071_224144
3060 Ga0587111_0002392
3061 Ga0587111_0004349
3062 Ga0587111_0006892
3063 Ga0587111_0010132
3064 Ga0587111_0010639
3065 Ga0587111_0010952
3066 Ga0587111_0012560
3067 Ga0587111_0016715
3068 Ga0587111_0025685
3069 Ga0587111_0029964
3070 Ga0587111_0032277
3071 Ga0587111_0070436
3072 Ga0587111_0073385
3073 Ga0587111_0082601
3074 Ga0587111_0083066
3075 Ga0587111_0149340
3076 Ga0587111_0164445
3077 Ga0587111_0167768
3078 Ga0587111_0186118
3079 Ga0587111_0192093
3080 Ga0587111_0196665
3081 Ga0587111_0205514
3082 Ga0587111_0254075
3083 Ga0501082_0116201
3084 Ga0501082_0469068
3085 Ga0466962_0016446
3086 Ga0466962_0066031
3087 Ga0466962_0089480
3088 Ga0466962_0601038
3089 Ga0530510_0051747
3090 2528205978
3091 2528215642
3092 2546951158
3093 2558906592
3094 2579750830
3095 2734968320
3096 2774866829
3097 2795785159
3098 3003003853
3099 637879847
3100 8054474609

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02406

MmoB_DmpM

MmoB/DmpM family

24

108

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2inn-assembly1.cif.gz_L structure of the phenol hydroxyalse-regulatory protein complex 0.8904 13 98
2bf3-assembly1.cif.gz_A crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing ten n-terminal residues (delta-n10 t4mod) 0.8832 13 96
7s6s-assembly1.cif.gz_D complex structure of methane monooxygenase hydroxylase and regulatory subunit dbl1 0.8747 11 99
6yd0-assembly1.cif.gz_G xfel structure of the soluble methane monooxygenase hydroxylase and regulatory subunit complex, from methylosinus trichosporium ob3b, diferric state 0.8735 11 99
2inn-assembly1.cif.gz_L structure of the phenol hydroxyalse-regulatory protein complex 0.8718 13 98
ID Description Score Start End Superfamily
af_E7F8M0_152_249_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9205 37 50 2.60.40.10
2innL00 Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM 0.8803 13 98 3.90.56.10
2bf5B00 Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM 0.8767 13 99 3.90.56.10
4gamI00 Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM 0.8665 11 98 3.90.56.10
2inpL00 Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM 0.8643 13 96 3.90.56.10
ID Description Score Start End GO Terms
AF-A0A535ZU68-F1-model_v4 Monooxygenase 0.986 18 101 GO:0004497
AF-A0A6N7YSN1-F1-model_v4 Monooxygenase 0.9653 13 107 GO:0004497
AF-A0A349M0P0-F1-model_v4 Monooxygenase 0.9638 18 113 GO:0004497
AF-Q768T2-F1-model_v4 Propane 2-monooxygenase, effector component (Prm) (Propane 2-monooxygenase, coupling protein component) 0.9549 3 113 GO:0004497
AF-A0A523PBT7-F1-model_v4 Monooxygenase 0.9548 8 105 GO:0004497

Map