F494709
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1550 | 461 | 3100 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300000549|LJQas_1007275|LJQas_10072751 |
| Length | 128 |
| Sequence | MTAVESSAAESQDDRFAYHRESSNRCGVTLMNNQNGYVVAEVMRGHEGVEVREYPSMIRIDGNNKIEFDFDEISEALGSEFDVYDFEEIMSTHYGRMVHLDDRTVLFANPEDAAEYIDFDLKVVEPGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Metatranscriptome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 19 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 20 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 148 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 220 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 235 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 236 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 237 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 249 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 253 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 256 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 257 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 258 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 259 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 260 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 263 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 264 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 265 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 266 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 333 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 370 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 385 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 387 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 450 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 451 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 452 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 453 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 454 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 455 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 456 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 457 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 458 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 459 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 460 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 461 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.58 |
| Metatranscriptomes | 42.71 |
| Isolates | 0.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0.32 |
| Rhizoplane | 4.84 |
| Rhizosphere | 91.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1007275 | 3300000549 | Bacteria | 1362 |
| 2 | bgg_mtDRAFT_1037018 | 3300000305 | Bacteria | 1261 |
| 3 | JGI24739J22299_10100985 | 3300001989 | Bacteria | 871 |
| 4 | JGI24737J22298_10154805 | 3300001990 | Bacteria | 676 |
| 5 | JGI24743J22301_10006549 | 3300001991 | Bacteria | 1990 |
| 6 | JGI24743J22301_10010932 | 3300001991 | Bacteria | 1626 |
| 7 | JGI24744J21845_10032804 | 3300002077 | Bacteria | 989 |
| 8 | Ga0006765J45826_106115 | 3300003161 | Bacteria | 683 |
| 9 | Ga0006770J48903_1024152 | 3300003305 | Bacteria | 509 |
| 10 | Ga0006770J48903_1036028 | 3300003305 | Bacteria | 633 |
| 11 | Ga0006770J48903_1044414 | 3300003305 | Bacteria | 825 |
| 12 | rootH2_10037862 | 3300003320 | Bacteria | 2584 |
| 13 | JGI25407J50210_10010461 | 3300003373 | Bacteria | 2361 |
| 14 | JGI25407J50210_10022104 | 3300003373 | Bacteria | 1654 |
| 15 | JGI25407J50210_10058016 | 3300003373 | Bacteria | 975 |
| 16 | JGI25407J50210_10068958 | 3300003373 | Bacteria | 884 |
| 17 | Ga0007417J51691_1011844 | 3300003544 | Bacteria | 899 |
| 18 | Ga0007417J51691_1020894 | 3300003544 | Bacteria | 2184 |
| 19 | Ga0007417J51691_1023789 | 3300003544 | Bacteria | 1071 |
| 20 | Ga0007417J51691_1029232 | 3300003544 | Bacteria | 1309 |
| 21 | Ga0007417J51691_1031395 | 3300003544 | Bacteria | 1260 |
| 22 | Ga0007417J51691_1032285 | 3300003544 | Bacteria | 775 |
| 23 | Ga0007417J51691_1033691 | 3300003544 | Bacteria | 982 |
| 24 | Ga0006781J51513_1006097 | 3300003568 | Bacteria | 1615 |
| 25 | Ga0006781J51513_1013153 | 3300003568 | Bacteria | 616 |
| 26 | Ga0006781J51513_1016077 | 3300003568 | Bacteria | 564 |
| 27 | Ga0007410J51695_1008856 | 3300003574 | Bacteria | 1923 |
| 28 | Ga0007410J51695_1018389 | 3300003574 | Bacteria | 963 |
| 29 | Ga0007410J51695_1042192 | 3300003574 | Bacteria | 906 |
| 30 | Ga0007409J51694_1007741 | 3300003575 | Bacteria | 876 |
| 31 | Ga0007409J51694_1007742 | 3300003575 | Bacteria | 1040 |
| 32 | Ga0007409J51694_1011577 | 3300003575 | Bacteria | 922 |
| 33 | Ga0007409J51694_1019397 | 3300003575 | Bacteria | 1047 |
| 34 | Ga0007409J51694_1022556 | 3300003575 | Bacteria | 1638 |
| 35 | Ga0007409J51694_1041078 | 3300003575 | Bacteria | 1359 |
| 36 | Ga0007416J51690_1009019 | 3300003577 | Bacteria | 1173 |
| 37 | Ga0007416J51690_1011696 | 3300003577 | Bacteria | 773 |
| 38 | Ga0007416J51690_1018488 | 3300003577 | Bacteria | 540 |
| 39 | Ga0007416J51690_1021822 | 3300003577 | Bacteria | 607 |
| 40 | Ga0007416J51690_1050276 | 3300003577 | Bacteria | 826 |
| 41 | Ga0007429J51699_1013820 | 3300003579 | Bacteria | 1145 |
| 42 | Ga0007429J51699_1020887 | 3300003579 | Bacteria | 818 |
| 43 | Ga0007429J51699_1021803 | 3300003579 | Bacteria | 1436 |
| 44 | Ga0007429J51699_1034151 | 3300003579 | Bacteria | 1503 |
| 45 | Ga0007429J51699_1039154 | 3300003579 | Bacteria | 1210 |
| 46 | Ga0007429J51699_1080258 | 3300003579 | Bacteria | 838 |
| 47 | Ga0032354_1003417 | 3300003693 | Bacteria | 857 |
| 48 | Ga0032354_1023209 | 3300003693 | Bacteria | 992 |
| 49 | Ga0032354_1033193 | 3300003693 | Bacteria | 709 |
| 50 | Ga0032354_1037363 | 3300003693 | Bacteria | 658 |
| 51 | Ga0032354_1043219 | 3300003693 | Bacteria | 1251 |
| 52 | Ga0032354_1048438 | 3300003693 | Bacteria | 1586 |
| 53 | Ga0058858_1001640 | 3300004785 | Bacteria | 2505 |
| 54 | Ga0058858_1035079 | 3300004785 | Bacteria | 1353 |
| 55 | Ga0058858_1428512 | 3300004785 | Bacteria | 868 |
| 56 | Ga0058858_1438279 | 3300004785 | Bacteria | 630 |
| 57 | Ga0058859_10007395 | 3300004798 | Bacteria | 779 |
| 58 | Ga0058859_10039925 | 3300004798 | Bacteria | 1522 |
| 59 | Ga0058859_10052612 | 3300004798 | Bacteria | 1792 |
| 60 | Ga0058859_10056563 | 3300004798 | Bacteria | 1243 |
| 61 | Ga0058859_10095538 | 3300004798 | Bacteria | 3204 |
| 62 | Ga0058859_11773704 | 3300004798 | Bacteria | 947 |
| 63 | Ga0058863_10003259 | 3300004799 | Bacteria | 1911 |
| 64 | Ga0058863_10055411 | 3300004799 | Bacteria | 1158 |
| 65 | Ga0058863_10088008 | 3300004799 | Bacteria | 1082 |
| 66 | Ga0058863_11727525 | 3300004799 | Bacteria | 661 |
| 67 | Ga0058863_11902200 | 3300004799 | Bacteria | 745 |
| 68 | Ga0058863_11942052 | 3300004799 | Bacteria | 762 |
| 69 | Ga0058863_11943932 | 3300004799 | Bacteria | 1422 |
| 70 | Ga0058861_10024395 | 3300004800 | Bacteria | 1614 |
| 71 | Ga0058861_10024951 | 3300004800 | Bacteria | 957 |
| 72 | Ga0058861_10043603 | 3300004800 | Bacteria | 1698 |
| 73 | Ga0058861_10071225 | 3300004800 | Bacteria | 1693 |
| 74 | Ga0058861_10075982 | 3300004800 | Bacteria | 609 |
| 75 | Ga0058861_10083556 | 3300004800 | Bacteria | 2423 |
| 76 | Ga0058861_10150641 | 3300004800 | Bacteria | 1558 |
| 77 | Ga0058861_11798679 | 3300004800 | Bacteria | 669 |
| 78 | Ga0058861_11977214 | 3300004800 | Bacteria | 544 |
| 79 | Ga0058861_12056731 | 3300004800 | Bacteria | 839 |
| 80 | Ga0058860_10041629 | 3300004801 | Bacteria | 1366 |
| 81 | Ga0058860_10053668 | 3300004801 | Bacteria | 2080 |
| 82 | Ga0058860_10134167 | 3300004801 | Bacteria | 2324 |
| 83 | Ga0058860_10154251 | 3300004801 | Bacteria | 1297 |
| 84 | Ga0058860_12159347 | 3300004801 | Bacteria | 652 |
| 85 | Ga0058860_12212618 | 3300004801 | Bacteria | 898 |
| 86 | Ga0058862_10048961 | 3300004803 | Bacteria | 1594 |
| 87 | Ga0058862_10053678 | 3300004803 | Bacteria | 904 |
| 88 | Ga0058862_10057100 | 3300004803 | Bacteria | 1442 |
| 89 | Ga0058862_10060482 | 3300004803 | Bacteria | 1205 |
| 90 | Ga0058862_10060744 | 3300004803 | Bacteria | 2841 |
| 91 | Ga0058862_10105153 | 3300004803 | Bacteria | 1764 |
| 92 | Ga0058862_10253325 | 3300004803 | Bacteria | 2129 |
| 93 | Ga0058862_10270879 | 3300004803 | Bacteria | 2731 |
| 94 | Ga0058862_12828490 | 3300004803 | Bacteria | 790 |
| 95 | Ga0058862_12840016 | 3300004803 | Bacteria | 619 |
| 96 | Ga0058862_12863248 | 3300004803 | Bacteria | 1158 |
| 97 | Ga0070658_10599438 | 3300005327 | Bacteria | 955 |
| 98 | Ga0070676_10435713 | 3300005328 | Bacteria | 919 |
| 99 | Ga0070683_100072328 | 3300005329 | Bacteria | 3218 |
| 100 | Ga0070683_100202443 | 3300005329 | Bacteria | 1885 |
| 101 | Ga0070683_100609912 | 3300005329 | Bacteria | 1045 |
| 102 | Ga0070683_100627640 | 3300005329 | Bacteria | 1029 |
| 103 | Ga0070683_100839796 | 3300005329 | Bacteria | 881 |
| 104 | Ga0070683_100959124 | 3300005329 | Bacteria | 821 |
| 105 | Ga0070690_100855116 | 3300005330 | Bacteria | 709 |
| 106 | Ga0070690_101576115 | 3300005330 | Bacteria | 532 |
| 107 | Ga0070670_100368653 | 3300005331 | Bacteria | 1264 |
| 108 | Ga0070677_10109300 | 3300005333 | Bacteria | 1232 |
| 109 | Ga0068869_100495114 | 3300005334 | Bacteria | 1019 |
| 110 | Ga0068869_102018736 | 3300005334 | Bacteria | 518 |
| 111 | Ga0070666_10633179 | 3300005335 | Bacteria | 782 |
| 112 | Ga0070680_101448709 | 3300005336 | Bacteria | 595 |
| 113 | Ga0070680_101506020 | 3300005336 | Bacteria | 583 |
| 114 | Ga0070682_100685631 | 3300005337 | Bacteria | 820 |
| 115 | Ga0070682_100924541 | 3300005337 | Bacteria | 718 |
| 116 | Ga0070682_101001488 | 3300005337 | Bacteria | 693 |
| 117 | Ga0070682_101190278 | 3300005337 | Bacteria | 643 |
| 118 | Ga0070682_101774655 | 3300005337 | Bacteria | 538 |
| 119 | Ga0068868_100035170 | 3300005338 | Bacteria | 3871 |
| 120 | Ga0068868_100055544 | 3300005338 | Bacteria | 3125 |
| 121 | Ga0068868_100666726 | 3300005338 | Bacteria | 928 |
| 122 | Ga0068868_100754730 | 3300005338 | Bacteria | 874 |
| 123 | Ga0068868_100875139 | 3300005338 | Bacteria | 815 |
| 124 | Ga0068868_101154274 | 3300005338 | Bacteria | 715 |
| 125 | Ga0068868_101376143 | 3300005338 | Bacteria | 658 |
| 126 | Ga0068868_102153452 | 3300005338 | Bacteria | 531 |
| 127 | Ga0070660_100456127 | 3300005339 | Bacteria | 1061 |
| 128 | Ga0070660_100599909 | 3300005339 | Bacteria | 921 |
| 129 | Ga0070660_101375065 | 3300005339 | Bacteria | 600 |
| 130 | Ga0070660_101539022 | 3300005339 | Bacteria | 566 |
| 131 | Ga0070689_100604638 | 3300005340 | Bacteria | 950 |
| 132 | Ga0070691_10145866 | 3300005341 | Bacteria | 1210 |
| 133 | Ga0070691_10244589 | 3300005341 | Bacteria | 960 |
| 134 | Ga0070687_100142621 | 3300005343 | Bacteria | 1397 |
| 135 | Ga0070661_100624402 | 3300005344 | Bacteria | 873 |
| 136 | Ga0070661_100837144 | 3300005344 | Bacteria | 757 |
| 137 | Ga0070661_100862549 | 3300005344 | Bacteria | 746 |
| 138 | Ga0070661_101215586 | 3300005344 | Bacteria | 631 |
| 139 | Ga0070692_10150862 | 3300005345 | Bacteria | 1324 |
| 140 | Ga0070668_100228838 | 3300005347 | Bacteria | 1536 |
| 141 | Ga0070668_101426143 | 3300005347 | Bacteria | 632 |
| 142 | Ga0070668_101532898 | 3300005347 | Bacteria | 610 |
| 143 | Ga0070669_100125620 | 3300005353 | Bacteria | 1963 |
| 144 | Ga0070669_100148199 | 3300005353 | Bacteria | 1814 |
| 145 | Ga0070669_101363192 | 3300005353 | Bacteria | 615 |
| 146 | Ga0070671_100147713 | 3300005355 | Bacteria | 1985 |
| 147 | Ga0070671_100940707 | 3300005355 | Bacteria | 756 |
| 148 | Ga0070671_101122269 | 3300005355 | Bacteria | 691 |
| 149 | Ga0070674_100459216 | 3300005356 | Bacteria | 1053 |
| 150 | Ga0070674_101090667 | 3300005356 | Bacteria | 704 |
| 151 | Ga0070674_101599540 | 3300005356 | Bacteria | 588 |
| 152 | Ga0070673_100065020 | 3300005364 | Bacteria | 2908 |
| 153 | Ga0070673_100326373 | 3300005364 | Bacteria | 1357 |
| 154 | Ga0070688_100157089 | 3300005365 | Bacteria | 1559 |
| 155 | Ga0070659_100097958 | 3300005366 | Bacteria | 2357 |
| 156 | Ga0070659_100112896 | 3300005366 | Bacteria | 2194 |
| 157 | Ga0070659_100513301 | 3300005366 | Bacteria | 1023 |
| 158 | Ga0070659_101540267 | 3300005366 | Bacteria | 593 |
| 159 | Ga0070667_100068700 | 3300005367 | Bacteria | 3015 |
| 160 | Ga0070667_100328191 | 3300005367 | Bacteria | 1382 |
| 161 | Ga0070667_100517309 | 3300005367 | Bacteria | 1095 |
| 162 | Ga0070667_100964915 | 3300005367 | Bacteria | 795 |
| 163 | Ga0070709_10883544 | 3300005434 | Bacteria | 706 |
| 164 | Ga0070709_11117971 | 3300005434 | Bacteria | 631 |
| 165 | Ga0070714_100199986 | 3300005435 | Bacteria | 1827 |
| 166 | Ga0070714_100233213 | 3300005435 | Bacteria | 1696 |
| 167 | Ga0070713_100554814 | 3300005436 | Bacteria | 1088 |
| 168 | Ga0070713_100878073 | 3300005436 | Bacteria | 862 |
| 169 | Ga0070710_10910099 | 3300005437 | Bacteria | 635 |
| 170 | Ga0070701_10015984 | 3300005438 | Bacteria | 3479 |
| 171 | Ga0070701_10630101 | 3300005438 | Bacteria | 713 |
| 172 | Ga0070705_100055200 | 3300005440 | Bacteria | 2334 |
| 173 | Ga0070700_100140647 | 3300005441 | Bacteria | 1640 |
| 174 | Ga0070700_100156908 | 3300005441 | Bacteria | 1562 |
| 175 | Ga0070700_100302245 | 3300005441 | Bacteria | 1168 |
| 176 | Ga0070700_100329018 | 3300005441 | Bacteria | 1125 |
| 177 | Ga0070700_100466207 | 3300005441 | Bacteria | 964 |
| 178 | Ga0070700_100555027 | 3300005441 | Bacteria | 893 |
| 179 | Ga0070700_100568357 | 3300005441 | Bacteria | 884 |
| 180 | Ga0070700_100703542 | 3300005441 | Bacteria | 804 |
| 181 | Ga0070694_100095580 | 3300005444 | Bacteria | 2093 |
| 182 | Ga0070694_100470840 | 3300005444 | Bacteria | 995 |
| 183 | Ga0070663_100262783 | 3300005455 | Bacteria | 1370 |
| 184 | Ga0070663_100511201 | 3300005455 | Bacteria | 999 |
| 185 | Ga0070663_101170247 | 3300005455 | Bacteria | 675 |
| 186 | Ga0070678_100518942 | 3300005456 | Bacteria | 1054 |
| 187 | Ga0070678_100755865 | 3300005456 | Bacteria | 880 |
| 188 | Ga0070662_100162562 | 3300005457 | Bacteria | 1747 |
| 189 | Ga0070662_100191026 | 3300005457 | Bacteria | 1619 |
| 190 | Ga0068867_100342253 | 3300005459 | Bacteria | 1245 |
| 191 | Ga0070685_10379059 | 3300005466 | Bacteria | 974 |
| 192 | Ga0070685_10406983 | 3300005466 | Bacteria | 943 |
| 193 | Ga0070706_101703484 | 3300005467 | Bacteria | 574 |
| 194 | Ga0070679_101300920 | 3300005530 | Bacteria | 673 |
| 195 | Ga0070679_101577828 | 3300005530 | Bacteria | 604 |
| 196 | Ga0070679_101669664 | 3300005530 | Bacteria | 585 |
| 197 | Ga0070684_100047435 | 3300005535 | Bacteria | 3723 |
| 198 | Ga0070684_100314713 | 3300005535 | Bacteria | 1437 |
| 199 | Ga0070684_100398936 | 3300005535 | Bacteria | 1268 |
| 200 | Ga0070684_100538851 | 3300005535 | Bacteria | 1083 |
| 201 | Ga0070684_100570603 | 3300005535 | Bacteria | 1051 |
| 202 | Ga0070684_101270674 | 3300005535 | Bacteria | 693 |
| 203 | Ga0070697_100907460 | 3300005536 | Bacteria | 782 |
| 204 | Ga0068853_100112495 | 3300005539 | Bacteria | 2420 |
| 205 | Ga0068853_100753506 | 3300005539 | Bacteria | 931 |
| 206 | Ga0068853_101215439 | 3300005539 | Bacteria | 728 |
| 207 | Ga0070672_100405697 | 3300005543 | Bacteria | 1169 |
| 208 | Ga0070672_102041055 | 3300005543 | Bacteria | 517 |
| 209 | Ga0070686_100385048 | 3300005544 | Bacteria | 1062 |
| 210 | Ga0070695_101035449 | 3300005545 | Bacteria | 669 |
| 211 | Ga0070696_100195216 | 3300005546 | Bacteria | 1508 |
| 212 | Ga0070696_101386851 | 3300005546 | Bacteria | 599 |
| 213 | Ga0070693_100732703 | 3300005547 | Bacteria | 727 |
| 214 | Ga0070665_101663393 | 3300005548 | Bacteria | 646 |
| 215 | Ga0068855_100467800 | 3300005563 | Bacteria | 1374 |
| 216 | Ga0070664_100038021 | 3300005564 | Bacteria | 4049 |
| 217 | Ga0070664_100326428 | 3300005564 | Bacteria | 1391 |
| 218 | Ga0070664_100356458 | 3300005564 | Bacteria | 1332 |
| 219 | Ga0070664_100542883 | 3300005564 | Bacteria | 1074 |
| 220 | Ga0070664_100547388 | 3300005564 | Bacteria | 1070 |
| 221 | Ga0070664_100588177 | 3300005564 | Bacteria | 1031 |
| 222 | Ga0068857_101170658 | 3300005577 | Bacteria | 744 |
| 223 | Ga0068857_101435059 | 3300005577 | Bacteria | 672 |
| 224 | Ga0068857_101501003 | 3300005577 | Bacteria | 657 |
| 225 | Ga0068854_100133284 | 3300005578 | Bacteria | 1899 |
| 226 | Ga0068854_100192331 | 3300005578 | Bacteria | 1599 |
| 227 | Ga0068854_100208031 | 3300005578 | Bacteria | 1542 |
| 228 | Ga0068856_100156611 | 3300005614 | Bacteria | 2288 |
| 229 | Ga0070702_100005968 | 3300005615 | Bacteria | 5729 |
| 230 | Ga0070702_100094856 | 3300005615 | Bacteria | 1817 |
| 231 | Ga0070702_100100036 | 3300005615 | Bacteria | 1777 |
| 232 | Ga0070702_100148753 | 3300005615 | Bacteria | 1501 |
| 233 | Ga0070702_100215487 | 3300005615 | Bacteria | 1281 |
| 234 | Ga0070702_100753777 | 3300005615 | Bacteria | 748 |
| 235 | Ga0070702_100829735 | 3300005615 | Bacteria | 717 |
| 236 | Ga0070702_100873534 | 3300005615 | Bacteria | 702 |
| 237 | Ga0068852_100148741 | 3300005616 | Bacteria | 2175 |
| 238 | Ga0068852_100169066 | 3300005616 | Bacteria | 2048 |
| 239 | Ga0068852_100486021 | 3300005616 | Bacteria | 1228 |
| 240 | Ga0068859_100238473 | 3300005617 | Bacteria | 1907 |
| 241 | Ga0068859_100443167 | 3300005617 | Bacteria | 1395 |
| 242 | Ga0068859_101302505 | 3300005617 | Bacteria | 801 |
| 243 | Ga0068864_100178065 | 3300005618 | Bacteria | 1942 |
| 244 | Ga0068864_100215043 | 3300005618 | Bacteria | 1771 |
| 245 | Ga0068864_100632467 | 3300005618 | Bacteria | 1041 |
| 246 | Ga0068864_101953739 | 3300005618 | Bacteria | 593 |
| 247 | Ga0068864_102048266 | 3300005618 | Bacteria | 579 |
| 248 | Ga0068866_10019649 | 3300005718 | Bacteria | 3081 |
| 249 | Ga0068866_10290617 | 3300005718 | Bacteria | 1016 |
| 250 | Ga0068866_10774535 | 3300005718 | Bacteria | 665 |
| 251 | Ga0068861_100028854 | 3300005719 | Bacteria | 4052 |
| 252 | Ga0068861_100267341 | 3300005719 | Bacteria | 1467 |
| 253 | Ga0068861_102141785 | 3300005719 | Bacteria | 560 |
| 254 | Ga0068861_102240874 | 3300005719 | Bacteria | 548 |
| 255 | Ga0068861_102376794 | 3300005719 | Bacteria | 533 |
| 256 | Ga0068851_10159693 | 3300005834 | Bacteria | 1237 |
| 257 | Ga0068851_10481159 | 3300005834 | Bacteria | 742 |
| 258 | Ga0068870_10169519 | 3300005840 | Bacteria | 1302 |
| 259 | Ga0068870_10572242 | 3300005840 | Bacteria | 764 |
| 260 | Ga0068870_10848555 | 3300005840 | Bacteria | 642 |
| 261 | Ga0068870_11076824 | 3300005840 | Bacteria | 577 |
| 262 | Ga0068863_100748762 | 3300005841 | Bacteria | 973 |
| 263 | Ga0068863_100827451 | 3300005841 | Bacteria | 924 |
| 264 | Ga0068863_101904246 | 3300005841 | Bacteria | 605 |
| 265 | Ga0068858_100047141 | 3300005842 | Bacteria | 3996 |
| 266 | Ga0068858_100437264 | 3300005842 | Bacteria | 1260 |
| 267 | Ga0068858_101085829 | 3300005842 | Bacteria | 785 |
| 268 | Ga0068858_101928464 | 3300005842 | Bacteria | 584 |
| 269 | Ga0068860_100380868 | 3300005843 | Bacteria | 1393 |
| 270 | Ga0068860_101387967 | 3300005843 | Bacteria | 724 |
| 271 | Ga0068862_100174048 | 3300005844 | Bacteria | 1928 |
| 272 | Ga0068862_100485760 | 3300005844 | Bacteria | 1170 |
| 273 | Ga0081455_10066477 | 3300005937 | Bacteria | 3011 |
| 274 | Ga0081455_10125348 | 3300005937 | Bacteria | 2017 |
| 275 | Ga0081455_10128478 | 3300005937 | Bacteria | 1985 |
| 276 | Ga0081455_10268510 | 3300005937 | Bacteria | 1239 |
| 277 | Ga0081455_10269260 | 3300005937 | Bacteria | 1237 |
| 278 | Ga0081455_10407928 | 3300005937 | Bacteria | 941 |
| 279 | Ga0081538_10000664 | 3300005981 | Bacteria | 37865 |
| 280 | Ga0081538_10008845 | 3300005981 | Bacteria | 8475 |
| 281 | Ga0081538_10009398 | 3300005981 | Bacteria | 8169 |
| 282 | Ga0081538_10030120 | 3300005981 | Bacteria | 3692 |
| 283 | Ga0081538_10052198 | 3300005981 | Bacteria | 2446 |
| 284 | Ga0081538_10170267 | 3300005981 | Bacteria | 951 |
| 285 | Ga0081540_1022450 | 3300005983 | Bacteria | 3727 |
| 286 | Ga0081540_1331141 | 3300005983 | Bacteria | 522 |
| 287 | Ga0081539_10121012 | 3300005985 | Bacteria | 1300 |
| 288 | Ga0081539_10245063 | 3300005985 | Bacteria | 800 |
| 289 | Ga0070717_10062040 | 3300006028 | Bacteria | 3099 |
| 290 | Ga0070717_10110108 | 3300006028 | Bacteria | 2348 |
| 291 | Ga0070717_11117588 | 3300006028 | Bacteria | 718 |
| 292 | Ga0075365_10202400 | 3300006038 | Bacteria | 1391 |
| 293 | Ga0075365_10224296 | 3300006038 | Bacteria | 1319 |
| 294 | Ga0075365_10285206 | 3300006038 | Bacteria | 1162 |
| 295 | Ga0075363_100741067 | 3300006048 | Bacteria | 595 |
| 296 | Ga0075432_10441052 | 3300006058 | Bacteria | 570 |
| 297 | Ga0070712_100383841 | 3300006175 | Bacteria | 1157 |
| 298 | Ga0097621_100244419 | 3300006237 | Bacteria | 1570 |
| 299 | Ga0097621_101929724 | 3300006237 | Bacteria | 564 |
| 300 | Ga0068871_100528844 | 3300006358 | Bacteria | 1066 |
| 301 | Ga0068871_100833751 | 3300006358 | Bacteria | 852 |
| 302 | Ga0075431_100347623 | 3300006847 | Bacteria | 1491 |
| 303 | Ga0075433_10491591 | 3300006852 | Bacteria | 1080 |
| 304 | Ga0068865_100113770 | 3300006881 | Bacteria | 2000 |
| 305 | Ga0068865_100338298 | 3300006881 | Bacteria | 1216 |
| 306 | Ga0068865_100951209 | 3300006881 | Bacteria | 750 |
| 307 | Ga0068865_102140123 | 3300006881 | Bacteria | 509 |
| 308 | Ga0097620_100238483 | 3300006931 | Bacteria | 1907 |
| 309 | Ga0097620_100443170 | 3300006931 | Bacteria | 1395 |
| 310 | Ga0097620_101302375 | 3300006931 | Bacteria | 801 |
| 311 | Ga0099795_10000516 | 3300007788 | Bacteria | 7255 |
| 312 | Ga0105244_10045580 | 3300009036 | Bacteria | 2255 |
| 313 | Ga0105240_12152258 | 3300009093 | Bacteria | 579 |
| 314 | Ga0111539_10007452 | 3300009094 | Bacteria | 14019 |
| 315 | Ga0111539_10084596 | 3300009094 | Bacteria | 3729 |
| 316 | Ga0111539_10437064 | 3300009094 | Bacteria | 1524 |
| 317 | Ga0111539_10560598 | 3300009094 | Bacteria | 1330 |
| 318 | Ga0111539_11025554 | 3300009094 | Bacteria | 959 |
| 319 | Ga0111539_11770868 | 3300009094 | Bacteria | 716 |
| 320 | Ga0105245_10022555 | 3300009098 | Bacteria | 5526 |
| 321 | Ga0105245_10630595 | 3300009098 | Bacteria | 1101 |
| 322 | Ga0105245_11361976 | 3300009098 | Bacteria | 759 |
| 323 | Ga0105245_11912945 | 3300009098 | Bacteria | 646 |
| 324 | Ga0105245_12286903 | 3300009098 | Bacteria | 594 |
| 325 | Ga0105245_12339952 | 3300009098 | Bacteria | 588 |
| 326 | Ga0105245_12950837 | 3300009098 | Bacteria | 527 |
| 327 | Ga0105247_10368293 | 3300009101 | Bacteria | 1015 |
| 328 | Ga0105247_10403907 | 3300009101 | Bacteria | 974 |
| 329 | Ga0105247_10734927 | 3300009101 | Bacteria | 746 |
| 330 | Ga0114129_12214805 | 3300009147 | Bacteria | 661 |
| 331 | Ga0114129_13055305 | 3300009147 | Bacteria | 548 |
| 332 | Ga0105243_10048410 | 3300009148 | Bacteria | 3351 |
| 333 | Ga0105243_10071897 | 3300009148 | Bacteria | 2798 |
| 334 | Ga0105243_10179357 | 3300009148 | Bacteria | 1841 |
| 335 | Ga0105243_10213753 | 3300009148 | Bacteria | 1700 |
| 336 | Ga0105243_10304961 | 3300009148 | Bacteria | 1445 |
| 337 | Ga0105243_11315281 | 3300009148 | Bacteria | 740 |
| 338 | Ga0105243_11734047 | 3300009148 | Bacteria | 654 |
| 339 | Ga0105241_10173608 | 3300009174 | Bacteria | 1782 |
| 340 | Ga0105241_10638040 | 3300009174 | Bacteria | 966 |
| 341 | Ga0105241_10641548 | 3300009174 | Bacteria | 964 |
| 342 | Ga0105241_11691031 | 3300009174 | Bacteria | 615 |
| 343 | Ga0105242_10042742 | 3300009176 | Bacteria | 3662 |
| 344 | Ga0105242_10379605 | 3300009176 | Bacteria | 1313 |
| 345 | Ga0105242_10509902 | 3300009176 | Bacteria | 1146 |
| 346 | Ga0105242_11128143 | 3300009176 | Bacteria | 800 |
| 347 | Ga0105248_11377886 | 3300009177 | Bacteria | 798 |
| 348 | Ga0105248_13301844 | 3300009177 | Bacteria | 513 |
| 349 | Ga0105237_11732556 | 3300009545 | Bacteria | 632 |
| 350 | Ga0105237_11850821 | 3300009545 | Bacteria | 611 |
| 351 | Ga0105238_10056515 | 3300009551 | Bacteria | 3937 |
| 352 | Ga0105238_11351259 | 3300009551 | Bacteria | 739 |
| 353 | Ga0105238_11446994 | 3300009551 | Bacteria | 715 |
| 354 | Ga0105249_10080410 | 3300009553 | Bacteria | 3027 |
| 355 | Ga0105249_10263012 | 3300009553 | Bacteria | 1715 |
| 356 | Ga0105249_10341069 | 3300009553 | Bacteria | 1515 |
| 357 | Ga0105249_10459598 | 3300009553 | Bacteria | 1313 |
| 358 | Ga0105249_11165937 | 3300009553 | Bacteria | 841 |
| 359 | Ga0105035_100266 | 3300009988 | Bacteria | 3348 |
| 360 | Ga0099796_10014450 | 3300010159 | Bacteria | 2282 |
| 361 | Ga0105239_10225017 | 3300010375 | Bacteria | 2104 |
| 362 | Ga0105239_10335464 | 3300010375 | Bacteria | 1706 |
| 363 | Ga0105239_10366509 | 3300010375 | Bacteria | 1628 |
| 364 | Ga0105239_10601639 | 3300010375 | Bacteria | 1254 |
| 365 | Ga0105239_11030401 | 3300010375 | Bacteria | 947 |
| 366 | Ga0105239_11478105 | 3300010375 | Bacteria | 785 |
| 367 | Ga0105246_10160157 | 3300011119 | Bacteria | 1714 |
| 368 | Ga0105246_10165043 | 3300011119 | Bacteria | 1691 |
| 369 | Ga0105246_10557737 | 3300011119 | Bacteria | 983 |
| 370 | Ga0105246_10603067 | 3300011119 | Bacteria | 949 |
| 371 | Ga0105246_12111238 | 3300011119 | Bacteria | 546 |
| 372 | Ga0157341_1020259 | 3300012494 | Bacteria | 650 |
| 373 | Ga0157373_10257737 | 3300013100 | Bacteria | 1234 |
| 374 | Ga0157371_10109900 | 3300013102 | Bacteria | 1957 |
| 375 | Ga0157371_10710014 | 3300013102 | Bacteria | 753 |
| 376 | Ga0157371_10838035 | 3300013102 | Bacteria | 695 |
| 377 | Ga0157371_11192176 | 3300013102 | Bacteria | 586 |
| 378 | Ga0157369_10394030 | 3300013105 | Bacteria | 1437 |
| 379 | Ga0157369_10883201 | 3300013105 | Bacteria | 917 |
| 380 | Ga0157374_10113464 | 3300013296 | Bacteria | 2608 |
| 381 | Ga0157374_11407785 | 3300013296 | Bacteria | 720 |
| 382 | Ga0157374_11680570 | 3300013296 | Bacteria | 659 |
| 383 | Ga0157374_11940134 | 3300013296 | Bacteria | 615 |
| 384 | Ga0157374_11954601 | 3300013296 | Bacteria | 613 |
| 385 | Ga0157374_12446891 | 3300013296 | Bacteria | 550 |
| 386 | Ga0157378_10618109 | 3300013297 | Bacteria | 1096 |
| 387 | Ga0157378_10748200 | 3300013297 | Bacteria | 1000 |
| 388 | Ga0157378_10887486 | 3300013297 | Bacteria | 922 |
| 389 | Ga0157378_10894874 | 3300013297 | Bacteria | 918 |
| 390 | Ga0163162_10412857 | 3300013306 | Bacteria | 1482 |
| 391 | Ga0163162_11490716 | 3300013306 | Bacteria | 770 |
| 392 | Ga0163162_12088732 | 3300013306 | Bacteria | 650 |
| 393 | Ga0163162_12089425 | 3300013306 | Bacteria | 650 |
| 394 | Ga0163162_12236230 | 3300013306 | Bacteria | 628 |
| 395 | Ga0163162_12291519 | 3300013306 | Bacteria | 620 |
| 396 | Ga0157372_10104427 | 3300013307 | Bacteria | 3239 |
| 397 | Ga0157372_10504305 | 3300013307 | Bacteria | 1411 |
| 398 | Ga0157372_10578628 | 3300013307 | Bacteria | 1309 |
| 399 | Ga0157372_10716473 | 3300013307 | Bacteria | 1164 |
| 400 | Ga0157372_12126498 | 3300013307 | Bacteria | 645 |
| 401 | Ga0157375_10174399 | 3300013308 | Bacteria | 2299 |
| 402 | Ga0157375_10429033 | 3300013308 | Bacteria | 1488 |
| 403 | Ga0157375_10494744 | 3300013308 | Bacteria | 1387 |
| 404 | Ga0157375_13175425 | 3300013308 | Bacteria | 548 |
| 405 | Ga0163163_13295134 | 3300014325 | Bacteria | 503 |
| 406 | Ga0157380_10109278 | 3300014326 | Bacteria | 2320 |
| 407 | Ga0157380_10403373 | 3300014326 | Bacteria | 1298 |
| 408 | Ga0157380_12030140 | 3300014326 | Bacteria | 637 |
| 409 | Ga0182008_10436448 | 3300014497 | Bacteria | 709 |
| 410 | Ga0182008_10568077 | 3300014497 | Bacteria | 632 |
| 411 | Ga0157377_10150374 | 3300014745 | Bacteria | 1439 |
| 412 | Ga0157377_10458470 | 3300014745 | Bacteria | 882 |
| 413 | Ga0157377_10520742 | 3300014745 | Bacteria | 835 |
| 414 | Ga0157377_11189267 | 3300014745 | Bacteria | 590 |
| 415 | Ga0157379_10291540 | 3300014968 | Bacteria | 1486 |
| 416 | Ga0157379_11165340 | 3300014968 | Bacteria | 740 |
| 417 | Ga0157379_11686778 | 3300014968 | Bacteria | 620 |
| 418 | Ga0157376_10720216 | 3300014969 | Bacteria | 1004 |
| 419 | Ga0157376_10809898 | 3300014969 | Bacteria | 950 |
| 420 | Ga0163161_10228459 | 3300017792 | Bacteria | 1443 |
| 421 | Ga0163161_10609151 | 3300017792 | Bacteria | 901 |
| 422 | Ga0163161_11021927 | 3300017792 | Bacteria | 707 |
| 423 | Ga0163161_11062866 | 3300017792 | Bacteria | 694 |
| 424 | Ga0163161_11726911 | 3300017792 | Bacteria | 555 |
| 425 | Ga0163161_11953049 | 3300017792 | Bacteria | 522 |
| 426 | Ga0197907_10559423 | 3300020069 | Bacteria | 700 |
| 427 | Ga0197907_10685680 | 3300020069 | Bacteria | 1082 |
| 428 | Ga0197907_11395746 | 3300020069 | Bacteria | 1695 |
| 429 | Ga0206356_10170539 | 3300020070 | Bacteria | 1057 |
| 430 | Ga0206356_10275481 | 3300020070 | Bacteria | 516 |
| 431 | Ga0206356_10811388 | 3300020070 | Bacteria | 1479 |
| 432 | Ga0206356_11208272 | 3300020070 | Bacteria | 1058 |
| 433 | Ga0206356_11567341 | 3300020070 | Bacteria | 1010 |
| 434 | Ga0206349_1383806 | 3300020075 | Bacteria | 760 |
| 435 | Ga0206355_1021710 | 3300020076 | Bacteria | 528 |
| 436 | Ga0206352_10107249 | 3300020078 | Bacteria | 845 |
| 437 | Ga0206352_10590329 | 3300020078 | Bacteria | 842 |
| 438 | Ga0206352_10818017 | 3300020078 | Bacteria | 683 |
| 439 | Ga0206350_10917422 | 3300020080 | Bacteria | 1006 |
| 440 | Ga0206350_11505953 | 3300020080 | Bacteria | 1429 |
| 441 | Ga0206350_11570365 | 3300020080 | Bacteria | 579 |
| 442 | Ga0206354_10732226 | 3300020081 | Bacteria | 670 |
| 443 | Ga0206354_10751741 | 3300020081 | Bacteria | 518 |
| 444 | Ga0206354_11379949 | 3300020081 | Bacteria | 967 |
| 445 | Ga0206353_10241100 | 3300020082 | Bacteria | 535 |
| 446 | Ga0206353_10477591 | 3300020082 | Bacteria | 602 |
| 447 | Ga0206353_11170794 | 3300020082 | Bacteria | 558 |
| 448 | Ga0206353_11391376 | 3300020082 | Bacteria | 841 |
| 449 | Ga0206353_11649880 | 3300020082 | Bacteria | 1026 |
| 450 | Ga0213875_10000186 | 3300021388 | Bacteria | 63592 |
| 451 | Ga0224712_10371560 | 3300022467 | Bacteria | 678 |
| 452 | Ga0207426_1018112 | 3300025302 | Bacteria | 2488 |
| 453 | Ga0207426_1124550 | 3300025302 | Bacteria | 632 |
| 454 | Ga0207697_10284075 | 3300025315 | Bacteria | 733 |
| 455 | Ga0207656_10087858 | 3300025321 | Bacteria | 1407 |
| 456 | Ga0207656_10373081 | 3300025321 | Bacteria | 714 |
| 457 | Ga0207653_10345804 | 3300025885 | Bacteria | 580 |
| 458 | Ga0207682_10075049 | 3300025893 | Bacteria | 1439 |
| 459 | Ga0207692_10086812 | 3300025898 | Bacteria | 1687 |
| 460 | Ga0207692_10429837 | 3300025898 | Bacteria | 828 |
| 461 | Ga0207692_10766509 | 3300025898 | Bacteria | 629 |
| 462 | Ga0207642_10115606 | 3300025899 | Bacteria | 1374 |
| 463 | Ga0207642_10226435 | 3300025899 | Bacteria | 1048 |
| 464 | Ga0207642_10343382 | 3300025899 | Bacteria | 878 |
| 465 | Ga0207710_10066252 | 3300025900 | Bacteria | 1648 |
| 466 | Ga0207688_10006305 | 3300025901 | Bacteria | 6458 |
| 467 | Ga0207688_10149196 | 3300025901 | Bacteria | 1380 |
| 468 | Ga0207647_10130772 | 3300025904 | Bacteria | 1475 |
| 469 | Ga0207647_10419278 | 3300025904 | Bacteria | 753 |
| 470 | Ga0207685_10060235 | 3300025905 | Bacteria | 1500 |
| 471 | Ga0207645_10081146 | 3300025907 | Bacteria | 2079 |
| 472 | Ga0207645_10226161 | 3300025907 | Bacteria | 1234 |
| 473 | Ga0207643_10061448 | 3300025908 | Bacteria | 2146 |
| 474 | Ga0207643_10104243 | 3300025908 | Bacteria | 1665 |
| 475 | Ga0207643_10117336 | 3300025908 | Bacteria | 1573 |
| 476 | Ga0207643_10138730 | 3300025908 | Bacteria | 1451 |
| 477 | Ga0207705_10054463 | 3300025909 | Bacteria | 2883 |
| 478 | Ga0207654_10240415 | 3300025911 | Bacteria | 1210 |
| 479 | Ga0207654_10328311 | 3300025911 | Bacteria | 1048 |
| 480 | Ga0207707_11454280 | 3300025912 | Bacteria | 545 |
| 481 | Ga0207695_10406402 | 3300025913 | Bacteria | 1246 |
| 482 | Ga0207671_10611250 | 3300025914 | Bacteria | 869 |
| 483 | Ga0207663_10599426 | 3300025916 | Bacteria | 865 |
| 484 | Ga0207660_11157018 | 3300025917 | Bacteria | 630 |
| 485 | Ga0207660_11483633 | 3300025917 | Bacteria | 548 |
| 486 | Ga0207662_10030208 | 3300025918 | Bacteria | 3144 |
| 487 | Ga0207662_10097614 | 3300025918 | Bacteria | 1816 |
| 488 | Ga0207662_10182117 | 3300025918 | Bacteria | 1352 |
| 489 | Ga0207662_10408059 | 3300025918 | Bacteria | 922 |
| 490 | Ga0207657_10060828 | 3300025919 | Bacteria | 3240 |
| 491 | Ga0207657_10273336 | 3300025919 | Bacteria | 1343 |
| 492 | Ga0207657_10437776 | 3300025919 | Bacteria | 1026 |
| 493 | Ga0207649_10207360 | 3300025920 | Bacteria | 1388 |
| 494 | Ga0207649_10318788 | 3300025920 | Bacteria | 1141 |
| 495 | Ga0207652_11405623 | 3300025921 | Bacteria | 601 |
| 496 | Ga0207646_10342955 | 3300025922 | Bacteria | 1350 |
| 497 | Ga0207681_10296625 | 3300025923 | Bacteria | 1278 |
| 498 | Ga0207681_10438408 | 3300025923 | Bacteria | 1061 |
| 499 | Ga0207681_11130789 | 3300025923 | Bacteria | 658 |
| 500 | Ga0207694_10082177 | 3300025924 | Bacteria | 2532 |
| 501 | Ga0207694_10161392 | 3300025924 | Bacteria | 1810 |
| 502 | Ga0207694_10301109 | 3300025924 | Bacteria | 1320 |
| 503 | Ga0207694_10905386 | 3300025924 | Bacteria | 746 |
| 504 | Ga0207659_10218490 | 3300025926 | Bacteria | 1531 |
| 505 | Ga0207659_10607951 | 3300025926 | Bacteria | 932 |
| 506 | Ga0207687_10065756 | 3300025927 | Bacteria | 2575 |
| 507 | Ga0207687_10096654 | 3300025927 | Bacteria | 2165 |
| 508 | Ga0207687_10255396 | 3300025927 | Bacteria | 1395 |
| 509 | Ga0207687_10274063 | 3300025927 | Bacteria | 1350 |
| 510 | Ga0207687_10387045 | 3300025927 | Bacteria | 1147 |
| 511 | Ga0207687_11285005 | 3300025927 | Bacteria | 629 |
| 512 | Ga0207700_10081286 | 3300025928 | Bacteria | 2530 |
| 513 | Ga0207700_11151663 | 3300025928 | Bacteria | 693 |
| 514 | Ga0207664_10239794 | 3300025929 | Bacteria | 1579 |
| 515 | Ga0207664_10249508 | 3300025929 | Bacteria | 1549 |
| 516 | Ga0207644_10814765 | 3300025931 | Bacteria | 781 |
| 517 | Ga0207644_11475183 | 3300025931 | Bacteria | 571 |
| 518 | Ga0207644_11504483 | 3300025931 | Bacteria | 565 |
| 519 | Ga0207690_10117990 | 3300025932 | Bacteria | 1922 |
| 520 | Ga0207690_10193012 | 3300025932 | Bacteria | 1541 |
| 521 | Ga0207690_10350225 | 3300025932 | Bacteria | 1168 |
| 522 | Ga0207690_11018432 | 3300025932 | Bacteria | 689 |
| 523 | Ga0207690_11507783 | 3300025932 | Bacteria | 562 |
| 524 | Ga0207706_10342067 | 3300025933 | Bacteria | 1301 |
| 525 | Ga0207706_10416919 | 3300025933 | Bacteria | 1163 |
| 526 | Ga0207706_10567251 | 3300025933 | Bacteria | 976 |
| 527 | Ga0207706_10683154 | 3300025933 | Bacteria | 878 |
| 528 | Ga0207706_11015186 | 3300025933 | Bacteria | 696 |
| 529 | Ga0207686_10219923 | 3300025934 | Bacteria | 1371 |
| 530 | Ga0207686_10319424 | 3300025934 | Bacteria | 1159 |
| 531 | Ga0207709_10016973 | 3300025935 | Bacteria | 4057 |
| 532 | Ga0207709_10150636 | 3300025935 | Bacteria | 1611 |
| 533 | Ga0207709_10252942 | 3300025935 | Bacteria | 1288 |
| 534 | Ga0207709_10261617 | 3300025935 | Bacteria | 1269 |
| 535 | Ga0207709_10267706 | 3300025935 | Bacteria | 1256 |
| 536 | Ga0207709_10506832 | 3300025935 | Bacteria | 943 |
| 537 | Ga0207670_10015950 | 3300025936 | Bacteria | 4501 |
| 538 | Ga0207670_10558913 | 3300025936 | Bacteria | 936 |
| 539 | Ga0207670_11655283 | 3300025936 | Bacteria | 544 |
| 540 | Ga0207669_10465844 | 3300025937 | Bacteria | 1004 |
| 541 | Ga0207704_10046576 | 3300025938 | Bacteria | 2586 |
| 542 | Ga0207704_10568324 | 3300025938 | Bacteria | 924 |
| 543 | Ga0207704_11473372 | 3300025938 | Bacteria | 584 |
| 544 | Ga0207704_11703365 | 3300025938 | Bacteria | 542 |
| 545 | Ga0207665_11215471 | 3300025939 | Bacteria | 601 |
| 546 | Ga0207691_10128791 | 3300025940 | Bacteria | 2237 |
| 547 | Ga0207691_10222398 | 3300025940 | Bacteria | 1637 |
| 548 | Ga0207691_10231547 | 3300025940 | Bacteria | 1600 |
| 549 | Ga0207711_10598136 | 3300025941 | Bacteria | 1029 |
| 550 | Ga0207689_10385010 | 3300025942 | Bacteria | 1168 |
| 551 | Ga0207689_10523120 | 3300025942 | Bacteria | 995 |
| 552 | Ga0207689_10623572 | 3300025942 | Bacteria | 908 |
| 553 | Ga0207661_10073549 | 3300025944 | Bacteria | 2799 |
| 554 | Ga0207661_10367696 | 3300025944 | Bacteria | 1300 |
| 555 | Ga0207661_10562315 | 3300025944 | Bacteria | 1045 |
| 556 | Ga0207661_10626967 | 3300025944 | Bacteria | 988 |
| 557 | Ga0207661_11013008 | 3300025944 | Bacteria | 765 |
| 558 | Ga0207661_11068171 | 3300025944 | Bacteria | 743 |
| 559 | Ga0207661_11448385 | 3300025944 | Bacteria | 630 |
| 560 | Ga0207679_10098467 | 3300025945 | Bacteria | 2280 |
| 561 | Ga0207679_10139564 | 3300025945 | Bacteria | 1957 |
| 562 | Ga0207679_10293666 | 3300025945 | Bacteria | 1398 |
| 563 | Ga0207679_10310375 | 3300025945 | Bacteria | 1362 |
| 564 | Ga0207679_10379276 | 3300025945 | Bacteria | 1239 |
| 565 | Ga0207679_10565132 | 3300025945 | Bacteria | 1022 |
| 566 | Ga0207679_10706117 | 3300025945 | Bacteria | 915 |
| 567 | Ga0207667_10209220 | 3300025949 | Bacteria | 2000 |
| 568 | Ga0207667_10632047 | 3300025949 | Bacteria | 1077 |
| 569 | Ga0207651_10749441 | 3300025960 | Bacteria | 863 |
| 570 | Ga0207651_10899179 | 3300025960 | Bacteria | 788 |
| 571 | Ga0207651_12092025 | 3300025960 | Bacteria | 508 |
| 572 | Ga0207712_10345794 | 3300025961 | Bacteria | 1235 |
| 573 | Ga0207712_10583914 | 3300025961 | Bacteria | 965 |
| 574 | Ga0207712_10971442 | 3300025961 | Bacteria | 753 |
| 575 | Ga0207712_11164936 | 3300025961 | Bacteria | 687 |
| 576 | Ga0207668_10165750 | 3300025972 | Bacteria | 1727 |
| 577 | Ga0207668_10241147 | 3300025972 | Bacteria | 1463 |
| 578 | Ga0207668_11422266 | 3300025972 | Bacteria | 625 |
| 579 | Ga0207640_10090771 | 3300025981 | Bacteria | 2115 |
| 580 | Ga0207640_10119204 | 3300025981 | Bacteria | 1887 |
| 581 | Ga0207640_10749486 | 3300025981 | Bacteria | 842 |
| 582 | Ga0207640_10871815 | 3300025981 | Bacteria | 785 |
| 583 | Ga0207640_11093040 | 3300025981 | Bacteria | 705 |
| 584 | Ga0207658_10077177 | 3300025986 | Bacteria | 2541 |
| 585 | Ga0207658_10415697 | 3300025986 | Bacteria | 1185 |
| 586 | Ga0207677_10119823 | 3300026023 | Bacteria | 1977 |
| 587 | Ga0207677_10265266 | 3300026023 | Bacteria | 1402 |
| 588 | Ga0207677_10282281 | 3300026023 | Bacteria | 1364 |
| 589 | Ga0207677_10394617 | 3300026023 | Bacteria | 1172 |
| 590 | Ga0207677_10462761 | 3300026023 | Bacteria | 1089 |
| 591 | Ga0207677_11539043 | 3300026023 | Bacteria | 615 |
| 592 | Ga0207703_10457821 | 3300026035 | Bacteria | 1193 |
| 593 | Ga0207703_11702061 | 3300026035 | Bacteria | 606 |
| 594 | Ga0207703_11726728 | 3300026035 | Bacteria | 602 |
| 595 | Ga0207639_10327841 | 3300026041 | Bacteria | 1361 |
| 596 | Ga0207678_10091030 | 3300026067 | Bacteria | 2607 |
| 597 | Ga0207678_10135952 | 3300026067 | Bacteria | 2097 |
| 598 | Ga0207678_10337880 | 3300026067 | Bacteria | 1297 |
| 599 | Ga0207678_10471933 | 3300026067 | Bacteria | 1092 |
| 600 | Ga0207678_10780579 | 3300026067 | Bacteria | 843 |
| 601 | Ga0207708_10006747 | 3300026075 | Bacteria | 8493 |
| 602 | Ga0207708_10021676 | 3300026075 | Bacteria | 4846 |
| 603 | Ga0207708_10117707 | 3300026075 | Bacteria | 2068 |
| 604 | Ga0207708_10212189 | 3300026075 | Bacteria | 1548 |
| 605 | Ga0207708_10435132 | 3300026075 | Bacteria | 1090 |
| 606 | Ga0207708_10491497 | 3300026075 | Bacteria | 1027 |
| 607 | Ga0207702_10385135 | 3300026078 | Bacteria | 1349 |
| 608 | Ga0207702_11030810 | 3300026078 | Bacteria | 816 |
| 609 | Ga0207641_10410437 | 3300026088 | Bacteria | 1302 |
| 610 | Ga0207641_10602444 | 3300026088 | Bacteria | 1076 |
| 611 | Ga0207648_10036106 | 3300026089 | Bacteria | 4354 |
| 612 | Ga0207648_10069143 | 3300026089 | Bacteria | 3077 |
| 613 | Ga0207648_11031103 | 3300026089 | Bacteria | 771 |
| 614 | Ga0207648_11370253 | 3300026089 | Bacteria | 665 |
| 615 | Ga0207676_10160438 | 3300026095 | Bacteria | 1947 |
| 616 | Ga0207676_10330611 | 3300026095 | Bacteria | 1402 |
| 617 | Ga0207676_10364529 | 3300026095 | Bacteria | 1340 |
| 618 | Ga0207676_10558008 | 3300026095 | Bacteria | 1095 |
| 619 | Ga0207676_11799746 | 3300026095 | Bacteria | 611 |
| 620 | Ga0207674_10189996 | 3300026116 | Bacteria | 2004 |
| 621 | Ga0207674_10268034 | 3300026116 | Bacteria | 1655 |
| 622 | Ga0207674_10309208 | 3300026116 | Bacteria | 1530 |
| 623 | Ga0207674_10772180 | 3300026116 | Bacteria | 927 |
| 624 | Ga0207674_11517907 | 3300026116 | Bacteria | 639 |
| 625 | Ga0207675_100015029 | 3300026118 | Bacteria | 7223 |
| 626 | Ga0207675_100027033 | 3300026118 | Bacteria | 5342 |
| 627 | Ga0207675_100386488 | 3300026118 | Bacteria | 1377 |
| 628 | Ga0207675_100626540 | 3300026118 | Bacteria | 1080 |
| 629 | Ga0207675_101905379 | 3300026118 | Bacteria | 613 |
| 630 | Ga0207683_10146311 | 3300026121 | Bacteria | 2131 |
| 631 | Ga0207683_10427290 | 3300026121 | Bacteria | 1220 |
| 632 | Ga0207698_10025487 | 3300026142 | Bacteria | 4168 |
| 633 | Ga0207698_10332046 | 3300026142 | Bacteria | 1429 |
| 634 | Ga0207698_10451066 | 3300026142 | Bacteria | 1242 |
| 635 | Ga0207698_10600255 | 3300026142 | Bacteria | 1085 |
| 636 | Ga0207698_10863129 | 3300026142 | Bacteria | 911 |
| 637 | Ga0210002_1026614 | 3300027617 | Bacteria | 950 |
| 638 | Ga0207428_10035062 | 3300027907 | Bacteria | 4105 |
| 639 | Ga0207428_10064577 | 3300027907 | Bacteria | 2890 |
| 640 | Ga0207428_10230917 | 3300027907 | Bacteria | 1385 |
| 641 | Ga0207428_11253473 | 3300027907 | Bacteria | 515 |
| 642 | Ga0268266_12191820 | 3300028379 | Bacteria | 525 |
| 643 | Ga0268265_10220765 | 3300028380 | Bacteria | 1658 |
| 644 | Ga0268265_10243786 | 3300028380 | Bacteria | 1588 |
| 645 | Ga0268265_11122965 | 3300028380 | Bacteria | 781 |
| 646 | Ga0268264_10236003 | 3300028381 | Bacteria | 1691 |
| 647 | Ga0268264_10372871 | 3300028381 | Bacteria | 1365 |
| 648 | Ga0268264_10567988 | 3300028381 | Bacteria | 1114 |
| 649 | Ga0307515_10282807 | 3300028794 | Bacteria | 1364 |
| 650 | Ga0311001_1068448 | 3300029277 | Bacteria | 776 |
| 651 | Ga0265766_1000621 | 3300030863 | Bacteria | 1578 |
| 652 | Ga0307513_10001463 | 3300031456 | Bacteria | 33963 |
| 653 | Ga0307509_10324242 | 3300031507 | Bacteria | 1275 |
| 654 | Ga0307408_100099408 | 3300031548 | Bacteria | 2214 |
| 655 | Ga0307408_100673465 | 3300031548 | Bacteria | 927 |
| 656 | Ga0307405_10035279 | 3300031731 | Bacteria | 2986 |
| 657 | Ga0307405_11429335 | 3300031731 | Bacteria | 606 |
| 658 | Ga0307405_11947356 | 3300031731 | Bacteria | 525 |
| 659 | Ga0307413_11549141 | 3300031824 | Bacteria | 587 |
| 660 | Ga0307410_10235915 | 3300031852 | Bacteria | 1415 |
| 661 | Ga0307410_10373024 | 3300031852 | Bacteria | 1146 |
| 662 | Ga0307410_10874195 | 3300031852 | Bacteria | 769 |
| 663 | Ga0307410_11037735 | 3300031852 | Bacteria | 708 |
| 664 | Ga0307410_11313617 | 3300031852 | Bacteria | 633 |
| 665 | Ga0307406_10324856 | 3300031901 | Bacteria | 1192 |
| 666 | Ga0307406_10455891 | 3300031901 | Bacteria | 1027 |
| 667 | Ga0307406_11128299 | 3300031901 | Bacteria | 678 |
| 668 | Ga0307406_11797948 | 3300031901 | Bacteria | 545 |
| 669 | Ga0307406_11820032 | 3300031901 | Bacteria | 542 |
| 670 | Ga0307407_10028596 | 3300031903 | Bacteria | 2982 |
| 671 | Ga0307407_10401120 | 3300031903 | Bacteria | 984 |
| 672 | Ga0307407_10840084 | 3300031903 | Bacteria | 701 |
| 673 | Ga0307407_10859732 | 3300031903 | Bacteria | 694 |
| 674 | Ga0307412_11248457 | 3300031911 | Bacteria | 667 |
| 675 | Ga0307412_11556021 | 3300031911 | Bacteria | 603 |
| 676 | Ga0307409_100065027 | 3300031995 | Bacteria | 2868 |
| 677 | Ga0307409_100088553 | 3300031995 | Bacteria | 2528 |
| 678 | Ga0307416_100096931 | 3300032002 | Bacteria | 2552 |
| 679 | Ga0307416_100596372 | 3300032002 | Bacteria | 1184 |
| 680 | Ga0307416_100745749 | 3300032002 | Bacteria | 1071 |
| 681 | Ga0307416_101215646 | 3300032002 | Bacteria | 859 |
| 682 | Ga0307416_101728795 | 3300032002 | Bacteria | 730 |
| 683 | Ga0307416_102232325 | 3300032002 | Bacteria | 648 |
| 684 | Ga0307414_10159495 | 3300032004 | Bacteria | 1790 |
| 685 | Ga0307414_10302843 | 3300032004 | Bacteria | 1353 |
| 686 | Ga0307411_10212720 | 3300032005 | Bacteria | 1494 |
| 687 | Ga0307411_10399537 | 3300032005 | Bacteria | 1136 |
| 688 | Ga0307411_10765883 | 3300032005 | Bacteria | 847 |
| 689 | Ga0307411_11520559 | 3300032005 | Bacteria | 616 |
| 690 | Ga0307415_100046422 | 3300032126 | Bacteria | 2918 |
| 691 | Ga0307415_100080155 | 3300032126 | Bacteria | 2328 |
| 692 | Ga0307415_100217910 | 3300032126 | Bacteria | 1528 |
| 693 | Ga0307415_100360563 | 3300032126 | Bacteria | 1227 |
| 694 | Ga0307415_100676615 | 3300032126 | Bacteria | 928 |
| 695 | Ga0307415_100781586 | 3300032126 | Bacteria | 870 |
| 696 | Ga0307415_100867099 | 3300032126 | Bacteria | 830 |
| 697 | Ga0307415_101126391 | 3300032126 | Bacteria | 736 |
| 698 | Ga0307507_10016447 | 3300033179 | Bacteria | 8602 |
| 699 | Ga0307507_10421610 | 3300033179 | Bacteria | 749 |
| 700 | Ga0307510_10128745 | 3300033180 | Bacteria | 2212 |
| 701 | Ga0373948_0052903 | 3300034817 | Bacteria | 876 |
| 702 | Ga0373952_0035304 | 3300035092 | Bacteria | 1131 |
| 703 | Ga0373960_0224769 | 3300035121 | Bacteria | 673 |
| 704 | Ga0373962_0069926 | 3300035242 | Bacteria | 1047 |
| 705 | Ga0373931_0762600 | 3300035691 | Bacteria | 643 |
| 706 | Ga0395900_0262505 | 3300037418 | Bacteria | 1724 |
| 707 | Ga0395900_0480304 | 3300037418 | Bacteria | 1195 |
| 708 | Ga0395900_1437529 | 3300037418 | Bacteria | 602 |
| 709 | Ga0395898_0082059 | 3300037466 | Bacteria | 3108 |
| 710 | Ga0395898_0203609 | 3300037466 | Bacteria | 1889 |
| 711 | Ga0395898_0607035 | 3300037466 | Bacteria | 1037 |
| 712 | Ga0395898_1059989 | 3300037466 | Bacteria | 745 |
| 713 | Ga0395898_1703167 | 3300037466 | Bacteria | 553 |
| 714 | Ga0436364_1040466 | 3300037853 | Bacteria | 95595 |
| 715 | Ga0395901_0016549 | 3300038443 | Bacteria | 7514 |
| 716 | Ga0395901_0378307 | 3300038443 | Bacteria | 1458 |
| 717 | Ga0395901_1517126 | 3300038443 | Bacteria | 626 |
| 718 | Ga0451789_0128125 | 3300041443 | Bacteria | 820 |
| 719 | Ga0451791_0134196 | 3300041451 | Bacteria | 1401 |
| 720 | Ga0451801_20889 | 3300041455 | Bacteria | 622 |
| 721 | Ga0451798_0205759 | 3300041458 | Bacteria | 851 |
| 722 | Ga0451800_0529711 | 3300041459 | Bacteria | 753 |
| 723 | Ga0451800_0798604 | 3300041459 | Bacteria | 600 |
| 724 | Ga0451802_0283187 | 3300041460 | Bacteria | 726 |
| 725 | Ga0451802_1367216 | 3300041460 | Bacteria | 504 |
| 726 | Ga0451805_092273 | 3300041461 | Bacteria | 1110 |
| 727 | Ga0451804_0654268 | 3300041463 | Bacteria | 920 |
| 728 | Ga0451807_1200229 | 3300041486 | Bacteria | 1044 |
| 729 | Ga0451839_0954223 | 3300041496 | Bacteria | 534 |
| 730 | Ga0451841_0722847 | 3300041498 | Bacteria | 992 |
| 731 | Ga0451845_0883599 | 3300041501 | Bacteria | 643 |
| 732 | Ga0451847_0240470 | 3300041503 | Bacteria | 583 |
| 733 | Ga0451851_0564806 | 3300041507 | Bacteria | 550 |
| 734 | Ga0451843_0427164 | 3300041509 | Bacteria | 780 |
| 735 | Ga0451843_0898051 | 3300041509 | Bacteria | 846 |
| 736 | Ga0451853_3042107 | 3300041512 | Bacteria | 561 |
| 737 | Ga0439455_0013690 | 3300042012 | Bacteria | 1842 |
| 738 | Ga0439456_032747 | 3300042013 | Bacteria | 1117 |
| 739 | Ga0439463_015388 | 3300042016 | Bacteria | 1893 |
| 740 | Ga0450913_012317 | 3300042117 | Bacteria | 706 |
| 741 | Ga0439440_0008620 | 3300042993 | Bacteria | 2098 |
| 742 | Ga0466969_0334174 | 3300044656 | Bacteria | 686 |
| 743 | Ga0466972_0010066 | 3300044658 | Bacteria | 4750 |
| 744 | Ga0466965_0001592 | 3300044683 | Bacteria | 9258 |
| 745 | Ga0466965_0166270 | 3300044683 | Bacteria | 1158 |
| 746 | Ga0466965_0169076 | 3300044683 | Bacteria | 1149 |
| 747 | Ga0466966_0010823 | 3300044684 | Bacteria | 6061 |
| 748 | Ga0466963_0023118 | 3300044694 | Bacteria | 3942 |
| 749 | Ga0466963_0080919 | 3300044694 | Bacteria | 2200 |
| 750 | Ga0466963_0137997 | 3300044694 | Bacteria | 1688 |
| 751 | Ga0466963_0652069 | 3300044694 | Bacteria | 743 |
| 752 | Ga0466964_0148680 | 3300044706 | Bacteria | 1084 |
| 753 | Ga0466971_0036627 | 3300044719 | Bacteria | 2200 |
| 754 | Ga0466971_0106427 | 3300044719 | Bacteria | 1292 |
| 755 | Ga0466970_0011374 | 3300044765 | Bacteria | 4536 |
| 756 | Ga0466970_0622520 | 3300044765 | Bacteria | 627 |
| 757 | Ga0466957_0097592 | 3300044842 | Bacteria | 1848 |
| 758 | Ga0466957_0606913 | 3300044842 | Bacteria | 766 |
| 759 | Ga0466957_0611034 | 3300044842 | Bacteria | 764 |
| 760 | Ga0466957_0810454 | 3300044842 | Bacteria | 665 |
| 761 | Ga0466960_0002139 | 3300044901 | Bacteria | 7362 |
| 762 | Ga0466960_0024310 | 3300044901 | Bacteria | 2732 |
| 763 | Ga0466960_0223944 | 3300044901 | Bacteria | 1036 |
| 764 | Ga0466959_0039373 | 3300045049 | Bacteria | 3493 |
| 765 | Ga0466959_0755709 | 3300045049 | Bacteria | 651 |
| 766 | Ga0466958_0007347 | 3300045836 | Bacteria | 6053 |
| 767 | Ga0466958_0571255 | 3300045836 | Bacteria | 735 |
| 768 | Ga0466967_0040750 | 3300045976 | Bacteria | 4000 |
| 769 | Ga0466967_0057831 | 3300045976 | Bacteria | 3425 |
| 770 | Ga0466967_0110602 | 3300045976 | Bacteria | 2524 |
| 771 | Ga0466967_0119187 | 3300045976 | Bacteria | 2435 |
| 772 | Ga0466967_0125309 | 3300045976 | Bacteria | 2378 |
| 773 | Ga0466967_0198901 | 3300045976 | Bacteria | 1897 |
| 774 | Ga0466967_0207520 | 3300045976 | Bacteria | 1857 |
| 775 | Ga0466967_0623831 | 3300045976 | Bacteria | 1065 |
| 776 | Ga0466967_0694611 | 3300045976 | Bacteria | 1007 |
| 777 | Ga0466967_0929966 | 3300045976 | Bacteria | 865 |
| 778 | Ga0466967_1002136 | 3300045976 | Bacteria | 832 |
| 779 | Ga0495592_0246836 | 3300046454 | Bacteria | 1182 |
| 780 | Ga0495650_0000121 | 3300046471 | Bacteria | 183055 |
| 781 | Ga0495582_0648186 | 3300046473 | Bacteria | 611 |
| 782 | Ga0495605_0206732 | 3300046474 | Bacteria | 854 |
| 783 | Ga0495664_0199755 | 3300046477 | Bacteria | 1212 |
| 784 | Ga0495584_0105725 | 3300046491 | Bacteria | 1423 |
| 785 | Ga0495584_0424660 | 3300046491 | Bacteria | 676 |
| 786 | Ga0495596_0391688 | 3300046500 | Bacteria | 541 |
| 787 | Ga0495620_0152288 | 3300046515 | Bacteria | 901 |
| 788 | Ga0495620_0248283 | 3300046515 | Bacteria | 679 |
| 789 | Ga0495628_0782046 | 3300046516 | Unclassified | 669 |
| 790 | Ga0495631_0073623 | 3300046518 | Bacteria | 1475 |
| 791 | Ga0495643_0189256 | 3300046522 | Bacteria | 995 |
| 792 | Ga0495643_0292210 | 3300046522 | Bacteria | 746 |
| 793 | Ga0495643_0483711 | 3300046522 | Bacteria | 535 |
| 794 | Ga0495663_0190944 | 3300046525 | Bacteria | 712 |
| 795 | Ga0495652_0197519 | 3300046529 | Bacteria | 1529 |
| 796 | Ga0495640_0284809 | 3300046533 | Bacteria | 1029 |
| 797 | Ga0495609_0183579 | 3300046538 | Bacteria | 880 |
| 798 | Ga0495597_0234214 | 3300046542 | Bacteria | 726 |
| 799 | Ga0495656_0200638 | 3300046615 | Bacteria | 990 |
| 800 | Ga0495656_0531202 | 3300046615 | Bacteria | 626 |
| 801 | Ga0495668_0298181 | 3300046616 | Bacteria | 884 |
| 802 | Ga0495661_0214353 | 3300046665 | Bacteria | 1001 |
| 803 | Ga0495657_0316103 | 3300046675 | Bacteria | 929 |
| 804 | Ga0495670_0193902 | 3300046691 | Bacteria | 1075 |
| 805 | Ga0495660_0430780 | 3300046810 | Bacteria | 573 |
| 806 | Ga0495604_0868413 | 3300047317 | Bacteria | 565 |
| 807 | Ga0495680_0440993 | 3300047322 | Bacteria | 893 |
| 808 | Ga0495685_204320 | 3300047447 | Bacteria | 633 |
| 809 | Ga0495686_0129578 | 3300047472 | Bacteria | 1497 |
| 810 | Ga0495602_0288454 | 3300048088 | Bacteria | 1206 |
| 811 | Ga0495615_0121571 | 3300048090 | Bacteria | 756 |
| 812 | Ga0496100_0002773 | 3300048903 | Bacteria | 8960 |
| 813 | Ga0496100_0536201 | 3300048903 | Bacteria | 904 |
| 814 | Ga0496100_0956149 | 3300048903 | Bacteria | 673 |
| 815 | Ga0496100_1431507 | 3300048903 | Bacteria | 546 |
| 816 | Ga0496100_1572317 | 3300048903 | Bacteria | 520 |
| 817 | Ga0496101_0191749 | 3300048904 | Bacteria | 1577 |
| 818 | Ga0496101_0420541 | 3300048904 | Bacteria | 1053 |
| 819 | Ga0496102_0028096 | 3300048905 | Bacteria | 5026 |
| 820 | Ga0496102_0069677 | 3300048905 | Bacteria | 3228 |
| 821 | Ga0496102_0207279 | 3300048905 | Bacteria | 1848 |
| 822 | Ga0496102_0374613 | 3300048905 | Bacteria | 1340 |
| 823 | Ga0496102_1124164 | 3300048905 | Bacteria | 705 |
| 824 | Ga0496103_0179030 | 3300048906 | Bacteria | 1362 |
| 825 | Ga0496103_0228643 | 3300048906 | Bacteria | 1196 |
| 826 | Ga0496104_0001942 | 3300048907 | Bacteria | 17924 |
| 827 | Ga0496105_0038675 | 3300048908 | Bacteria | 3930 |
| 828 | Ga0496105_0137245 | 3300048908 | Bacteria | 2014 |
| 829 | Ga0496105_0411382 | 3300048908 | Bacteria | 1072 |
| 830 | Ga0496105_0542447 | 3300048908 | Bacteria | 909 |
| 831 | Ga0496106_0003395 | 3300048909 | Bacteria | 11865 |
| 832 | Ga0496106_0034087 | 3300048909 | Bacteria | 3802 |
| 833 | Ga0496106_0089222 | 3300048909 | Bacteria | 2377 |
| 834 | Ga0496106_0196797 | 3300048909 | Bacteria | 1603 |
| 835 | Ga0496106_0203841 | 3300048909 | Bacteria | 1575 |
| 836 | Ga0496106_0347174 | 3300048909 | Bacteria | 1192 |
| 837 | Ga0496106_0648786 | 3300048909 | Bacteria | 843 |
| 838 | Ga0496106_0916898 | 3300048909 | Bacteria | 691 |
| 839 | Ga0496107_0007662 | 3300048910 | Bacteria | 7454 |
| 840 | Ga0496107_0096234 | 3300048910 | Bacteria | 2166 |
| 841 | Ga0496107_0462601 | 3300048910 | Bacteria | 942 |
| 842 | Ga0496107_0987831 | 3300048910 | Bacteria | 611 |
| 843 | Ga0496108_0004397 | 3300048911 | Bacteria | 11344 |
| 844 | Ga0496108_0029625 | 3300048911 | Bacteria | 4535 |
| 845 | Ga0496108_0066759 | 3300048911 | Bacteria | 3034 |
| 846 | Ga0496108_0427467 | 3300048911 | Bacteria | 1157 |
| 847 | Ga0496108_0715708 | 3300048911 | Bacteria | 867 |
| 848 | Ga0496108_1007796 | 3300048911 | Bacteria | 711 |
| 849 | Ga0496108_1325997 | 3300048911 | Bacteria | 604 |
| 850 | Ga0496109_0003783 | 3300048912 | Bacteria | 12627 |
| 851 | Ga0496109_0049151 | 3300048912 | Bacteria | 3838 |
| 852 | Ga0496109_0084275 | 3300048912 | Bacteria | 2932 |
| 853 | Ga0496109_0160470 | 3300048912 | Bacteria | 2106 |
| 854 | Ga0496109_1894731 | 3300048912 | Bacteria | 529 |
| 855 | Ga0496110_0008810 | 3300048913 | Bacteria | 8125 |
| 856 | Ga0496110_0047545 | 3300048913 | Bacteria | 3758 |
| 857 | Ga0496110_0211714 | 3300048913 | Bacteria | 1762 |
| 858 | Ga0496110_0256135 | 3300048913 | Bacteria | 1593 |
| 859 | Ga0496110_0486024 | 3300048913 | Bacteria | 1125 |
| 860 | Ga0496110_1326046 | 3300048913 | Bacteria | 629 |
| 861 | Ga0496111_0009446 | 3300048914 | Bacteria | 6510 |
| 862 | Ga0496111_0013162 | 3300048914 | Bacteria | 5623 |
| 863 | Ga0496111_0042251 | 3300048914 | Bacteria | 3273 |
| 864 | Ga0496111_0072961 | 3300048914 | Bacteria | 2499 |
| 865 | Ga0496111_1047855 | 3300048914 | Bacteria | 583 |
| 866 | Ga0496112_0070989 | 3300048915 | Bacteria | 3442 |
| 867 | Ga0496112_0076375 | 3300048915 | Bacteria | 3313 |
| 868 | Ga0496112_0098271 | 3300048915 | Bacteria | 2897 |
| 869 | Ga0496112_0336580 | 3300048915 | Bacteria | 1453 |
| 870 | Ga0496113_0046394 | 3300048916 | Bacteria | 3225 |
| 871 | Ga0496113_0168713 | 3300048916 | Bacteria | 1733 |
| 872 | Ga0496114_0293864 | 3300048917 | Bacteria | 1434 |
| 873 | Ga0496114_0744443 | 3300048917 | Bacteria | 857 |
| 874 | Ga0496115_0019085 | 3300048918 | Bacteria | 5272 |
| 875 | Ga0496121_0895015 | 3300048924 | Bacteria | 511 |
| 876 | Ga0496122_0245040 | 3300048925 | Bacteria | 1007 |
| 877 | Ga0496126_0841011 | 3300048929 | Bacteria | 701 |
| 878 | Ga0501306_101553 | 3300049127 | Bacteria | 515 |
| 879 | Ga0501308_014011 | 3300049128 | Bacteria | 933 |
| 880 | Ga0501308_021415 | 3300049128 | Bacteria | 812 |
| 881 | Ga0501308_051846 | 3300049128 | Bacteria | 602 |
| 882 | Ga0501308_086363 | 3300049128 | Bacteria | 505 |
| 883 | Ga0501305_092585 | 3300049161 | Bacteria | 555 |
| 884 | Ga0501307_012450 | 3300049162 | Bacteria | 1013 |
| 885 | Ga0495682_0362415 | 3300049460 | Bacteria | 511 |
| 886 | Ga0501291_166445 | 3300049514 | Bacteria | 507 |
| 887 | Ga0501311_004211 | 3300049527 | Bacteria | 1518 |
| 888 | Ga0501311_011671 | 3300049527 | Bacteria | 1087 |
| 889 | Ga0501311_054662 | 3300049527 | Bacteria | 633 |
| 890 | Ga0501311_074607 | 3300049527 | Bacteria | 568 |
| 891 | Ga0501312_038468 | 3300049528 | Bacteria | 775 |
| 892 | Ga0501315_023215 | 3300049531 | Bacteria | 850 |
| 893 | Ga0501315_040578 | 3300049531 | Bacteria | 703 |
| 894 | Ga0501317_082713 | 3300049533 | Bacteria | 558 |
| 895 | Ga0501318_001018 | 3300049534 | Bacteria | 2060 |
| 896 | Ga0501318_003795 | 3300049534 | Bacteria | 1410 |
| 897 | Ga0501321_007936 | 3300049537 | Bacteria | 1115 |
| 898 | Ga0501321_018462 | 3300049537 | Bacteria | 847 |
| 899 | Ga0501321_069983 | 3300049537 | Bacteria | 544 |
| 900 | Ga0501325_001897 | 3300049541 | Bacteria | 1361 |
| 901 | Ga0501325_001985 | 3300049541 | Bacteria | 1345 |
| 902 | Ga0501325_017902 | 3300049541 | Bacteria | 721 |
| 903 | Ga0501329_16827 | 3300049545 | Bacteria | 504 |
| 904 | Ga0501031_0023483 | 3300049568 | Bacteria | 4020 |
| 905 | Ga0501031_0901149 | 3300049568 | Bacteria | 566 |
| 906 | Ga0501032_0052260 | 3300049569 | Bacteria | 2753 |
| 907 | Ga0501032_0307944 | 3300049569 | Bacteria | 1023 |
| 908 | Ga0501033_0007388 | 3300049570 | Bacteria | 8557 |
| 909 | Ga0501033_0147150 | 3300049570 | Bacteria | 1701 |
| 910 | Ga0501034_0042646 | 3300049571 | Bacteria | 4593 |
| 911 | Ga0501034_0071807 | 3300049571 | Bacteria | 3470 |
| 912 | Ga0501036_0047556 | 3300049572 | Bacteria | 3633 |
| 913 | Ga0501036_0049091 | 3300049572 | Bacteria | 3573 |
| 914 | Ga0501036_0171983 | 3300049572 | Bacteria | 1825 |
| 915 | Ga0501036_0255412 | 3300049572 | Bacteria | 1468 |
| 916 | Ga0501037_0077521 | 3300049573 | Bacteria | 2412 |
| 917 | Ga0501037_0725049 | 3300049573 | Bacteria | 660 |
| 918 | Ga0501037_1126678 | 3300049573 | Bacteria | 507 |
| 919 | Ga0501038_0001079 | 3300049574 | Bacteria | 24647 |
| 920 | Ga0501038_0034050 | 3300049574 | Bacteria | 4481 |
| 921 | Ga0501038_0545548 | 3300049574 | Bacteria | 882 |
| 922 | Ga0501039_0120994 | 3300049575 | Bacteria | 2051 |
| 923 | Ga0501039_0203613 | 3300049575 | Bacteria | 1556 |
| 924 | Ga0501039_0920492 | 3300049575 | Bacteria | 680 |
| 925 | Ga0501042_0059447 | 3300049578 | Bacteria | 2729 |
| 926 | Ga0501042_0109869 | 3300049578 | Bacteria | 1985 |
| 927 | Ga0501042_0828630 | 3300049578 | Bacteria | 673 |
| 928 | Ga0501043_0024370 | 3300049579 | Bacteria | 4748 |
| 929 | Ga0501043_0185597 | 3300049579 | Bacteria | 1619 |
| 930 | Ga0501043_0223253 | 3300049579 | Bacteria | 1457 |
| 931 | Ga0501046_0041339 | 3300049580 | Bacteria | 3680 |
| 932 | Ga0501047_0052072 | 3300049581 | Bacteria | 3956 |
| 933 | Ga0501048_0051421 | 3300049582 | Bacteria | 2933 |
| 934 | Ga0501048_0091402 | 3300049582 | Bacteria | 2147 |
| 935 | Ga0501048_0798079 | 3300049582 | Bacteria | 678 |
| 936 | Ga0501067_0051694 | 3300049583 | Bacteria | 2277 |
| 937 | Ga0501067_0260731 | 3300049583 | Bacteria | 965 |
| 938 | Ga0501068_0348196 | 3300049584 | Bacteria | 952 |
| 939 | Ga0501068_0754843 | 3300049584 | Bacteria | 637 |
| 940 | Ga0501068_0827420 | 3300049584 | Bacteria | 608 |
| 941 | Ga0501069_0150182 | 3300049585 | Bacteria | 1339 |
| 942 | Ga0501069_0622417 | 3300049585 | Bacteria | 649 |
| 943 | Ga0501070_0319174 | 3300049586 | Bacteria | 1264 |
| 944 | Ga0501070_0381825 | 3300049586 | Bacteria | 1141 |
| 945 | Ga0501070_0547027 | 3300049586 | Bacteria | 927 |
| 946 | Ga0501070_1493524 | 3300049586 | Bacteria | 511 |
| 947 | Ga0501071_0058388 | 3300049587 | Bacteria | 2790 |
| 948 | Ga0501071_0216372 | 3300049587 | Bacteria | 1441 |
| 949 | Ga0501071_1373206 | 3300049587 | Bacteria | 546 |
| 950 | Ga0501072_0097294 | 3300049588 | Bacteria | 2339 |
| 951 | Ga0501072_0168191 | 3300049588 | Bacteria | 1749 |
| 952 | Ga0501072_0476709 | 3300049588 | Bacteria | 987 |
| 953 | Ga0501073_1194656 | 3300049589 | Bacteria | 522 |
| 954 | Ga0501074_0323500 | 3300049590 | Bacteria | 1095 |
| 955 | Ga0501075_0037970 | 3300049591 | Bacteria | 3600 |
| 956 | Ga0501076_0016442 | 3300049592 | Bacteria | 5609 |
| 957 | Ga0501076_0141130 | 3300049592 | Bacteria | 1957 |
| 958 | Ga0501076_0237550 | 3300049592 | Bacteria | 1490 |
| 959 | Ga0501076_0273975 | 3300049592 | Bacteria | 1382 |
| 960 | Ga0501077_0078396 | 3300049593 | Bacteria | 2094 |
| 961 | Ga0501077_0702772 | 3300049593 | Bacteria | 650 |
| 962 | Ga0501221_216078 | 3300049704 | Bacteria | 539 |
| 963 | Ga0501079_0082392 | 3300049741 | Bacteria | 2488 |
| 964 | Ga0501079_0226162 | 3300049741 | Bacteria | 1462 |
| 965 | Ga0501081_0082339 | 3300049743 | Bacteria | 2254 |
| 966 | Ga0501081_0306217 | 3300049743 | Bacteria | 1166 |
| 967 | Ga0501083_0400704 | 3300049744 | Bacteria | 893 |
| 968 | Ga0501280_088980 | 3300049776 | Bacteria | 579 |
| 969 | Ga0501035_0036974 | 3300049822 | Bacteria | 4423 |
| 970 | Ga0501035_0039260 | 3300049822 | Bacteria | 4284 |
| 971 | Ga0501035_0327522 | 3300049822 | Bacteria | 1286 |
| 972 | Ga0501035_1030741 | 3300049822 | Bacteria | 646 |
| 973 | Ga0501044_0016796 | 3300049823 | Bacteria | 7855 |
| 974 | Ga0501044_0576948 | 3300049823 | Bacteria | 1019 |
| 975 | Ga0501045_0103926 | 3300049824 | Bacteria | 2104 |
| 976 | Ga0501045_0162626 | 3300049824 | Bacteria | 1662 |
| 977 | Ga0501045_0256265 | 3300049824 | Bacteria | 1302 |
| 978 | nmdc:mga0yw44_426241_c1 | 3300050492 | Bacteria | 898 |
| 979 | nmdc:mga05p37_1163961_c1 | 3300050507 | Bacteria | 801 |
| 980 | nmdc:mga05p37_715917_c1 | 3300050507 | Bacteria | 1109 |
| 981 | nmdc:mga0qj67_428572_c2 | 3300050509 | Bacteria | 603 |
| 982 | nmdc:mga06r32_339037_c1 | 3300050510 | Bacteria | 1488 |
| 983 | nmdc:mga08y16_1242772_c1 | 3300050511 | Bacteria | 714 |
| 984 | nmdc:mga08y16_1849565_c1 | 3300050511 | Bacteria | 556 |
| 985 | nmdc:mga08y16_196471_c1 | 3300050511 | Bacteria | 2091 |
| 986 | nmdc:mga08y16_285749_c1 | 3300050511 | Bacteria | 1701 |
| 987 | nmdc:mga08y16_67959_c1 | 3300050511 | Bacteria | 3717 |
| 988 | nmdc:mga0n895_293134_c1 | 3300050512 | Bacteria | 1649 |
| 989 | nmdc:mga0rr50_807485_c1 | 3300050513 | Bacteria | 800 |
| 990 | nmdc:mga0a205_1215050_c1 | 3300050515 | Bacteria | 601 |
| 991 | nmdc:mga0a205_291709_c1 | 3300050515 | Bacteria | 1505 |
| 992 | Ga0495601_0151786 | 3300053077 | Bacteria | 1512 |
| 993 | Ga0495655_0002245 | 3300053083 | Bacteria | 3053 |
| 994 | Ga0495655_0043056 | 3300053083 | Bacteria | 1162 |
| 995 | Ga0495655_0366240 | 3300053083 | Bacteria | 507 |
| 996 | Ga0500556_0000795 | 3300053104 | Bacteria | 18495 |
| 997 | Ga0500652_259146 | 3300053131 | Bacteria | 686 |
| 998 | Ga0500588_0413632 | 3300053146 | Bacteria | 514 |
| 999 | Ga0500589_277848 | 3300053147 | Bacteria | 602 |
| 1000 | Ga0500604_0058002 | 3300053151 | Bacteria | 1210 |
| 1001 | Ga0500616_0006750 | 3300053153 | Bacteria | 7441 |
| 1002 | Ga0500616_0019028 | 3300053153 | Bacteria | 3877 |
| 1003 | Ga0500616_0070509 | 3300053153 | Bacteria | 1783 |
| 1004 | Ga0500599_000599 | 3300053736 | Bacteria | 3818 |
| 1005 | Ga0501084_0125615 | 3300054114 | Bacteria | 2158 |
| 1006 | Ga0501084_0160909 | 3300054114 | Bacteria | 1894 |
| 1007 | Ga0501084_0228000 | 3300054114 | Bacteria | 1572 |
| 1008 | Ga0501084_0236930 | 3300054114 | Bacteria | 1540 |
| 1009 | Ga0587084_002055 | 3300059477 | Bacteria | 2029 |
| 1010 | Ga0587084_003660 | 3300059477 | Bacteria | 1705 |
| 1011 | Ga0587084_009573 | 3300059477 | Bacteria | 1255 |
| 1012 | Ga0587084_013874 | 3300059477 | Bacteria | 1115 |
| 1013 | Ga0587084_014910 | 3300059477 | Bacteria | 1090 |
| 1014 | Ga0587084_019828 | 3300059477 | Bacteria | 994 |
| 1015 | Ga0587084_039621 | 3300059477 | Bacteria | 795 |
| 1016 | Ga0587084_047051 | 3300059477 | Bacteria | 752 |
| 1017 | Ga0587084_097922 | 3300059477 | Bacteria | 591 |
| 1018 | Ga0587084_109442 | 3300059477 | Bacteria | 569 |
| 1019 | Ga0587084_111349 | 3300059477 | Bacteria | 566 |
| 1020 | Ga0587084_118767 | 3300059477 | Bacteria | 554 |
| 1021 | Ga0587084_119440 | 3300059477 | Bacteria | 553 |
| 1022 | Ga0587093_003172 | 3300059478 | Bacteria | 1593 |
| 1023 | Ga0587093_012761 | 3300059478 | Bacteria | 1024 |
| 1024 | Ga0587093_013733 | 3300059478 | Bacteria | 1000 |
| 1025 | Ga0587093_017042 | 3300059478 | Bacteria | 933 |
| 1026 | Ga0587093_022758 | 3300059478 | Bacteria | 852 |
| 1027 | Ga0587093_023948 | 3300059478 | Bacteria | 837 |
| 1028 | Ga0587093_034077 | 3300059478 | Bacteria | 746 |
| 1029 | Ga0587093_047461 | 3300059478 | Bacteria | 669 |
| 1030 | Ga0587093_055045 | 3300059478 | Bacteria | 637 |
| 1031 | Ga0587093_056664 | 3300059478 | Bacteria | 631 |
| 1032 | Ga0587093_060095 | 3300059478 | Bacteria | 619 |
| 1033 | Ga0587093_063100 | 3300059478 | Bacteria | 609 |
| 1034 | Ga0587066_000991 | 3300059490 | Bacteria | 2684 |
| 1035 | Ga0587066_006908 | 3300059490 | Bacteria | 1517 |
| 1036 | Ga0587066_007921 | 3300059490 | Bacteria | 1459 |
| 1037 | Ga0587066_017346 | 3300059490 | Bacteria | 1146 |
| 1038 | Ga0587066_102556 | 3300059490 | Bacteria | 652 |
| 1039 | Ga0587066_113046 | 3300059490 | Bacteria | 632 |
| 1040 | Ga0587066_145128 | 3300059490 | Bacteria | 583 |
| 1041 | Ga0587066_149429 | 3300059490 | Bacteria | 578 |
| 1042 | Ga0587066_152284 | 3300059490 | Bacteria | 574 |
| 1043 | Ga0587066_172249 | 3300059490 | Bacteria | 552 |
| 1044 | Ga0587066_189410 | 3300059490 | Bacteria | 535 |
| 1045 | Ga0587066_190848 | 3300059490 | Bacteria | 533 |
| 1046 | Ga0587066_226182 | 3300059490 | Bacteria | 504 |
| 1047 | Ga0587070_000518 | 3300059491 | Bacteria | 3262 |
| 1048 | Ga0587070_015780 | 3300059491 | Bacteria | 1201 |
| 1049 | Ga0587070_027402 | 3300059491 | Bacteria | 1009 |
| 1050 | Ga0587070_041652 | 3300059491 | Bacteria | 881 |
| 1051 | Ga0587070_045163 | 3300059491 | Bacteria | 859 |
| 1052 | Ga0587070_074895 | 3300059491 | Bacteria | 730 |
| 1053 | Ga0587070_075993 | 3300059491 | Bacteria | 727 |
| 1054 | Ga0587070_076079 | 3300059491 | Bacteria | 727 |
| 1055 | Ga0587070_089163 | 3300059491 | Bacteria | 691 |
| 1056 | Ga0587070_141789 | 3300059491 | Bacteria | 594 |
| 1057 | Ga0587070_165846 | 3300059491 | Bacteria | 565 |
| 1058 | Ga0587070_170806 | 3300059491 | Bacteria | 559 |
| 1059 | Ga0587073_0002621 | 3300059492 | Bacteria | 2338 |
| 1060 | Ga0587073_0010685 | 3300059492 | Bacteria | 1549 |
| 1061 | Ga0587073_0014258 | 3300059492 | Bacteria | 1412 |
| 1062 | Ga0587073_0028145 | 3300059492 | Bacteria | 1140 |
| 1063 | Ga0587073_0065717 | 3300059492 | Bacteria | 863 |
| 1064 | Ga0587073_0070705 | 3300059492 | Bacteria | 842 |
| 1065 | Ga0587073_0088168 | 3300059492 | Bacteria | 784 |
| 1066 | Ga0587073_0169030 | 3300059492 | Bacteria | 633 |
| 1067 | Ga0587073_0184224 | 3300059492 | Bacteria | 615 |
| 1068 | Ga0587073_0240939 | 3300059492 | Bacteria | 562 |
| 1069 | Ga0587073_0247866 | 3300059492 | Bacteria | 557 |
| 1070 | Ga0587073_0252309 | 3300059492 | Bacteria | 554 |
| 1071 | Ga0587073_0294384 | 3300059492 | Bacteria | 526 |
| 1072 | Ga0587073_0306433 | 3300059492 | Bacteria | 519 |
| 1073 | Ga0587077_006352 | 3300059493 | Bacteria | 1669 |
| 1074 | Ga0587077_017451 | 3300059493 | Bacteria | 1223 |
| 1075 | Ga0587077_027933 | 3300059493 | Bacteria | 1053 |
| 1076 | Ga0587077_037489 | 3300059493 | Bacteria | 957 |
| 1077 | Ga0587077_067252 | 3300059493 | Bacteria | 792 |
| 1078 | Ga0587077_068909 | 3300059493 | Bacteria | 786 |
| 1079 | Ga0587077_069421 | 3300059493 | Bacteria | 784 |
| 1080 | Ga0587077_089792 | 3300059493 | Bacteria | 720 |
| 1081 | Ga0587077_112682 | 3300059493 | Bacteria | 668 |
| 1082 | Ga0587077_119469 | 3300059493 | Bacteria | 656 |
| 1083 | Ga0587077_134889 | 3300059493 | Bacteria | 630 |
| 1084 | Ga0587077_170803 | 3300059493 | Bacteria | 582 |
| 1085 | Ga0587077_186729 | 3300059493 | Bacteria | 565 |
| 1086 | Ga0587077_195201 | 3300059493 | Bacteria | 557 |
| 1087 | Ga0587077_268703 | 3300059493 | Bacteria | 500 |
| 1088 | Ga0587080_001432 | 3300059503 | Bacteria | 2585 |
| 1089 | Ga0587080_006193 | 3300059503 | Bacteria | 1640 |
| 1090 | Ga0587080_017952 | 3300059503 | Bacteria | 1132 |
| 1091 | Ga0587080_018687 | 3300059503 | Bacteria | 1116 |
| 1092 | Ga0587080_038060 | 3300059503 | Bacteria | 866 |
| 1093 | Ga0587080_040393 | 3300059503 | Bacteria | 848 |
| 1094 | Ga0587080_048491 | 3300059503 | Bacteria | 796 |
| 1095 | Ga0587080_056586 | 3300059503 | Bacteria | 754 |
| 1096 | Ga0587080_060521 | 3300059503 | Bacteria | 736 |
| 1097 | Ga0587080_076416 | 3300059503 | Bacteria | 679 |
| 1098 | Ga0587080_077941 | 3300059503 | Bacteria | 675 |
| 1099 | Ga0587080_081553 | 3300059503 | Bacteria | 664 |
| 1100 | Ga0587080_088942 | 3300059503 | Bacteria | 645 |
| 1101 | Ga0587080_117060 | 3300059503 | Bacteria | 587 |
| 1102 | Ga0587082_001111 | 3300059504 | Bacteria | 2646 |
| 1103 | Ga0587082_004844 | 3300059504 | Bacteria | 1716 |
| 1104 | Ga0587082_009673 | 3300059504 | Bacteria | 1372 |
| 1105 | Ga0587082_010472 | 3300059504 | Bacteria | 1340 |
| 1106 | Ga0587082_013344 | 3300059504 | Bacteria | 1237 |
| 1107 | Ga0587082_015319 | 3300059504 | Bacteria | 1182 |
| 1108 | Ga0587082_018137 | 3300059504 | Bacteria | 1117 |
| 1109 | Ga0587082_021999 | 3300059504 | Bacteria | 1046 |
| 1110 | Ga0587082_030084 | 3300059504 | Bacteria | 942 |
| 1111 | Ga0587082_041570 | 3300059504 | Bacteria | 845 |
| 1112 | Ga0587082_045566 | 3300059504 | Bacteria | 819 |
| 1113 | Ga0587082_049528 | 3300059504 | Bacteria | 797 |
| 1114 | Ga0587082_105971 | 3300059504 | Bacteria | 619 |
| 1115 | Ga0587082_118390 | 3300059504 | Bacteria | 596 |
| 1116 | Ga0587082_135994 | 3300059504 | Bacteria | 569 |
| 1117 | Ga0587082_143228 | 3300059504 | Bacteria | 559 |
| 1118 | Ga0587082_154109 | 3300059504 | Bacteria | 546 |
| 1119 | Ga0587082_188488 | 3300059504 | Bacteria | 509 |
| 1120 | Ga0587083_0001379 | 3300059505 | Bacteria | 2707 |
| 1121 | Ga0587083_0006855 | 3300059505 | Bacteria | 1717 |
| 1122 | Ga0587083_0011164 | 3300059505 | Bacteria | 1476 |
| 1123 | Ga0587083_0042637 | 3300059505 | Bacteria | 957 |
| 1124 | Ga0587083_0070280 | 3300059505 | Bacteria | 811 |
| 1125 | Ga0587083_0073650 | 3300059505 | Bacteria | 798 |
| 1126 | Ga0587083_0078531 | 3300059505 | Bacteria | 781 |
| 1127 | Ga0587083_0095407 | 3300059505 | Bacteria | 732 |
| 1128 | Ga0587083_0095757 | 3300059505 | Bacteria | 731 |
| 1129 | Ga0587083_0152895 | 3300059505 | Bacteria | 625 |
| 1130 | Ga0587083_0153467 | 3300059505 | Bacteria | 624 |
| 1131 | Ga0587083_0154286 | 3300059505 | Bacteria | 623 |
| 1132 | Ga0587083_0189731 | 3300059505 | Bacteria | 580 |
| 1133 | Ga0587083_0199813 | 3300059505 | Bacteria | 570 |
| 1134 | Ga0587083_0236452 | 3300059505 | Bacteria | 538 |
| 1135 | Ga0587085_001378 | 3300059506 | Bacteria | 2224 |
| 1136 | Ga0587085_003216 | 3300059506 | Bacteria | 1753 |
| 1137 | Ga0587085_005971 | 3300059506 | Bacteria | 1461 |
| 1138 | Ga0587085_006596 | 3300059506 | Bacteria | 1418 |
| 1139 | Ga0587085_016647 | 3300059506 | Bacteria | 1067 |
| 1140 | Ga0587085_017025 | 3300059506 | Bacteria | 1060 |
| 1141 | Ga0587085_027271 | 3300059506 | Bacteria | 915 |
| 1142 | Ga0587085_047544 | 3300059506 | Bacteria | 771 |
| 1143 | Ga0587085_048064 | 3300059506 | Bacteria | 768 |
| 1144 | Ga0587085_049374 | 3300059506 | Bacteria | 761 |
| 1145 | Ga0587085_086528 | 3300059506 | Bacteria | 640 |
| 1146 | Ga0587085_088692 | 3300059506 | Bacteria | 635 |
| 1147 | Ga0587085_093283 | 3300059506 | Bacteria | 625 |
| 1148 | Ga0587085_098081 | 3300059506 | Bacteria | 615 |
| 1149 | Ga0587085_099099 | 3300059506 | Bacteria | 613 |
| 1150 | Ga0587085_105327 | 3300059506 | Bacteria | 601 |
| 1151 | Ga0587085_105371 | 3300059506 | Bacteria | 601 |
| 1152 | Ga0587086_000408 | 3300059507 | Bacteria | 3026 |
| 1153 | Ga0587086_005146 | 3300059507 | Bacteria | 1401 |
| 1154 | Ga0587086_005932 | 3300059507 | Bacteria | 1342 |
| 1155 | Ga0587086_008361 | 3300059507 | Bacteria | 1208 |
| 1156 | Ga0587086_012257 | 3300059507 | Bacteria | 1062 |
| 1157 | Ga0587086_012570 | 3300059507 | Bacteria | 1054 |
| 1158 | Ga0587086_012832 | 3300059507 | Bacteria | 1047 |
| 1159 | Ga0587086_014606 | 3300059507 | Bacteria | 1004 |
| 1160 | Ga0587086_020108 | 3300059507 | Bacteria | 904 |
| 1161 | Ga0587086_032746 | 3300059507 | Bacteria | 772 |
| 1162 | Ga0587086_037365 | 3300059507 | Bacteria | 738 |
| 1163 | Ga0587086_043191 | 3300059507 | Bacteria | 704 |
| 1164 | Ga0587086_056206 | 3300059507 | Bacteria | 646 |
| 1165 | Ga0587086_057662 | 3300059507 | Bacteria | 640 |
| 1166 | Ga0587086_060283 | 3300059507 | Bacteria | 631 |
| 1167 | Ga0587086_061017 | 3300059507 | Bacteria | 629 |
| 1168 | Ga0587086_063111 | 3300059507 | Bacteria | 622 |
| 1169 | Ga0587086_079563 | 3300059507 | Bacteria | 576 |
| 1170 | Ga0587086_087548 | 3300059507 | Bacteria | 558 |
| 1171 | Ga0587086_115562 | 3300059507 | Bacteria | 508 |
| 1172 | Ga0587088_001042 | 3300059508 | Bacteria | 2710 |
| 1173 | Ga0587088_006273 | 3300059508 | Bacteria | 1598 |
| 1174 | Ga0587088_013179 | 3300059508 | Bacteria | 1264 |
| 1175 | Ga0587088_017968 | 3300059508 | Bacteria | 1146 |
| 1176 | Ga0587088_022812 | 3300059508 | Bacteria | 1059 |
| 1177 | Ga0587088_048841 | 3300059508 | Bacteria | 822 |
| 1178 | Ga0587088_052035 | 3300059508 | Bacteria | 805 |
| 1179 | Ga0587088_054429 | 3300059508 | Bacteria | 793 |
| 1180 | Ga0587088_057035 | 3300059508 | Bacteria | 781 |
| 1181 | Ga0587088_061253 | 3300059508 | Bacteria | 763 |
| 1182 | Ga0587088_075191 | 3300059508 | Bacteria | 712 |
| 1183 | Ga0587088_083279 | 3300059508 | Bacteria | 688 |
| 1184 | Ga0587088_090946 | 3300059508 | Bacteria | 668 |
| 1185 | Ga0587088_117280 | 3300059508 | Bacteria | 612 |
| 1186 | Ga0587088_144040 | 3300059508 | Bacteria | 571 |
| 1187 | Ga0587088_145770 | 3300059508 | Bacteria | 569 |
| 1188 | Ga0587088_166442 | 3300059508 | Bacteria | 544 |
| 1189 | Ga0587088_193201 | 3300059508 | Bacteria | 516 |
| 1190 | Ga0587088_205416 | 3300059508 | Bacteria | 505 |
| 1191 | Ga0587089_004290 | 3300059509 | Bacteria | 1566 |
| 1192 | Ga0587089_015444 | 3300059509 | Bacteria | 1008 |
| 1193 | Ga0587089_019399 | 3300059509 | Bacteria | 930 |
| 1194 | Ga0587089_025444 | 3300059509 | Bacteria | 845 |
| 1195 | Ga0587089_045265 | 3300059509 | Bacteria | 692 |
| 1196 | Ga0587089_055838 | 3300059509 | Bacteria | 643 |
| 1197 | Ga0587089_071133 | 3300059509 | Bacteria | 591 |
| 1198 | Ga0587089_071646 | 3300059509 | Bacteria | 590 |
| 1199 | Ga0587089_075152 | 3300059509 | Bacteria | 580 |
| 1200 | Ga0587090_005126 | 3300059510 | Bacteria | 1626 |
| 1201 | Ga0587090_005193 | 3300059510 | Bacteria | 1621 |
| 1202 | Ga0587090_005325 | 3300059510 | Bacteria | 1607 |
| 1203 | Ga0587090_049008 | 3300059510 | Bacteria | 769 |
| 1204 | Ga0587090_074004 | 3300059510 | Bacteria | 671 |
| 1205 | Ga0587090_075476 | 3300059510 | Bacteria | 666 |
| 1206 | Ga0587090_094876 | 3300059510 | Bacteria | 616 |
| 1207 | Ga0587090_127665 | 3300059510 | Bacteria | 557 |
| 1208 | Ga0587091_002505 | 3300059511 | Bacteria | 2187 |
| 1209 | Ga0587091_008700 | 3300059511 | Bacteria | 1507 |
| 1210 | Ga0587091_018026 | 3300059511 | Bacteria | 1196 |
| 1211 | Ga0587091_021312 | 3300059511 | Bacteria | 1134 |
| 1212 | Ga0587091_034332 | 3300059511 | Bacteria | 969 |
| 1213 | Ga0587091_048831 | 3300059511 | Bacteria | 862 |
| 1214 | Ga0587091_050337 | 3300059511 | Bacteria | 853 |
| 1215 | Ga0587091_074737 | 3300059511 | Bacteria | 749 |
| 1216 | Ga0587091_075465 | 3300059511 | Bacteria | 746 |
| 1217 | Ga0587091_089238 | 3300059511 | Bacteria | 705 |
| 1218 | Ga0587091_091133 | 3300059511 | Bacteria | 700 |
| 1219 | Ga0587091_103726 | 3300059511 | Bacteria | 670 |
| 1220 | Ga0587091_116421 | 3300059511 | Bacteria | 644 |
| 1221 | Ga0587091_132112 | 3300059511 | Bacteria | 617 |
| 1222 | Ga0587091_206281 | 3300059511 | Bacteria | 530 |
| 1223 | Ga0587092_002129 | 3300059512 | Bacteria | 2078 |
| 1224 | Ga0587092_029016 | 3300059512 | Bacteria | 904 |
| 1225 | Ga0587092_030847 | 3300059512 | Bacteria | 886 |
| 1226 | Ga0587092_032419 | 3300059512 | Bacteria | 872 |
| 1227 | Ga0587092_042202 | 3300059512 | Bacteria | 798 |
| 1228 | Ga0587092_101496 | 3300059512 | Bacteria | 593 |
| 1229 | Ga0587092_103414 | 3300059512 | Bacteria | 590 |
| 1230 | Ga0587092_159350 | 3300059512 | Bacteria | 509 |
| 1231 | Ga0587094_004792 | 3300059513 | Bacteria | 1554 |
| 1232 | Ga0587094_018680 | 3300059513 | Bacteria | 988 |
| 1233 | Ga0587094_023287 | 3300059513 | Bacteria | 915 |
| 1234 | Ga0587094_029836 | 3300059513 | Bacteria | 840 |
| 1235 | Ga0587094_052605 | 3300059513 | Bacteria | 694 |
| 1236 | Ga0587094_066133 | 3300059513 | Bacteria | 642 |
| 1237 | Ga0587094_077640 | 3300059513 | Bacteria | 609 |
| 1238 | Ga0587094_109586 | 3300059513 | Bacteria | 542 |
| 1239 | Ga0587094_124374 | 3300059513 | Bacteria | 519 |
| 1240 | Ga0587094_127555 | 3300059513 | Bacteria | 515 |
| 1241 | Ga0587095_000831 | 3300059514 | Bacteria | 1742 |
| 1242 | Ga0587095_002808 | 3300059514 | Bacteria | 1195 |
| 1243 | Ga0587095_005790 | 3300059514 | Bacteria | 945 |
| 1244 | Ga0587095_019725 | 3300059514 | Bacteria | 640 |
| 1245 | Ga0587095_021141 | 3300059514 | Bacteria | 626 |
| 1246 | Ga0587095_022555 | 3300059514 | Bacteria | 613 |
| 1247 | Ga0587097_04508 | 3300059603 | Bacteria | 630 |
| 1248 | Ga0587097_05058 | 3300059603 | Bacteria | 610 |
| 1249 | Ga0587098_002988 | 3300059604 | Bacteria | 1483 |
| 1250 | Ga0587098_005150 | 3300059604 | Bacteria | 1269 |
| 1251 | Ga0587098_033869 | 3300059604 | Bacteria | 715 |
| 1252 | Ga0587098_050618 | 3300059604 | Bacteria | 630 |
| 1253 | Ga0587106_002015 | 3300059605 | Bacteria | 1928 |
| 1254 | Ga0587106_003903 | 3300059605 | Bacteria | 1604 |
| 1255 | Ga0587106_016693 | 3300059605 | Bacteria | 1041 |
| 1256 | Ga0587106_027646 | 3300059605 | Bacteria | 889 |
| 1257 | Ga0587106_041694 | 3300059605 | Bacteria | 781 |
| 1258 | Ga0587106_062531 | 3300059605 | Bacteria | 687 |
| 1259 | Ga0587106_110024 | 3300059605 | Bacteria | 573 |
| 1260 | Ga0587106_139145 | 3300059605 | Bacteria | 531 |
| 1261 | Ga0587121_09004 | 3300059606 | Bacteria | 613 |
| 1262 | Ga0587125_001367 | 3300059607 | Bacteria | 1756 |
| 1263 | Ga0587125_007431 | 3300059607 | Bacteria | 1062 |
| 1264 | Ga0587125_008670 | 3300059607 | Bacteria | 1015 |
| 1265 | Ga0587125_008709 | 3300059607 | Bacteria | 1013 |
| 1266 | Ga0587125_010054 | 3300059607 | Bacteria | 969 |
| 1267 | Ga0587125_057886 | 3300059607 | Bacteria | 560 |
| 1268 | Ga0587125_079621 | 3300059607 | Bacteria | 507 |
| 1269 | Ga0587129_005518 | 3300059608 | Bacteria | 865 |
| 1270 | Ga0587129_007589 | 3300059608 | Bacteria | 789 |
| 1271 | Ga0587129_009139 | 3300059608 | Bacteria | 745 |
| 1272 | Ga0587129_010014 | 3300059608 | Bacteria | 726 |
| 1273 | Ga0587129_022676 | 3300059608 | Bacteria | 566 |
| 1274 | Ga0587131_001126 | 3300059609 | Bacteria | 1258 |
| 1275 | Ga0587131_013108 | 3300059609 | Bacteria | 619 |
| 1276 | Ga0587099_000608 | 3300059622 | Bacteria | 2163 |
| 1277 | Ga0587099_011787 | 3300059622 | Bacteria | 891 |
| 1278 | Ga0587099_013191 | 3300059622 | Bacteria | 859 |
| 1279 | Ga0587099_018936 | 3300059622 | Bacteria | 763 |
| 1280 | Ga0587099_025886 | 3300059622 | Bacteria | 690 |
| 1281 | Ga0587099_046410 | 3300059622 | Bacteria | 570 |
| 1282 | Ga0587099_050321 | 3300059622 | Bacteria | 555 |
| 1283 | Ga0587099_054770 | 3300059622 | Bacteria | 539 |
| 1284 | Ga0587099_059533 | 3300059622 | Bacteria | 524 |
| 1285 | Ga0587099_059763 | 3300059622 | Bacteria | 524 |
| 1286 | Ga0587099_062389 | 3300059622 | Bacteria | 517 |
| 1287 | Ga0587101_005266 | 3300059623 | Bacteria | 1427 |
| 1288 | Ga0587101_012858 | 3300059623 | Bacteria | 1094 |
| 1289 | Ga0587101_017226 | 3300059623 | Bacteria | 998 |
| 1290 | Ga0587101_022110 | 3300059623 | Bacteria | 925 |
| 1291 | Ga0587101_022480 | 3300059623 | Bacteria | 920 |
| 1292 | Ga0587101_027769 | 3300059623 | Bacteria | 863 |
| 1293 | Ga0587101_033011 | 3300059623 | Bacteria | 817 |
| 1294 | Ga0587101_117599 | 3300059623 | Bacteria | 546 |
| 1295 | Ga0587101_123985 | 3300059623 | Bacteria | 537 |
| 1296 | Ga0587109_007537 | 3300059624 | Bacteria | 1648 |
| 1297 | Ga0587109_017415 | 3300059624 | Bacteria | 1243 |
| 1298 | Ga0587109_048179 | 3300059624 | Bacteria | 866 |
| 1299 | Ga0587109_066185 | 3300059624 | Bacteria | 772 |
| 1300 | Ga0587109_072152 | 3300059624 | Bacteria | 748 |
| 1301 | Ga0587109_092590 | 3300059624 | Bacteria | 684 |
| 1302 | Ga0587109_133232 | 3300059624 | Bacteria | 601 |
| 1303 | Ga0587109_165335 | 3300059624 | Bacteria | 556 |
| 1304 | Ga0587109_202801 | 3300059624 | Bacteria | 517 |
| 1305 | Ga0587113_005567 | 3300059625 | Bacteria | 1043 |
| 1306 | Ga0587113_007174 | 3300059625 | Bacteria | 965 |
| 1307 | Ga0587113_015837 | 3300059625 | Bacteria | 750 |
| 1308 | Ga0587113_032049 | 3300059625 | Bacteria | 600 |
| 1309 | Ga0587113_037226 | 3300059625 | Bacteria | 572 |
| 1310 | Ga0587115_002485 | 3300059626 | Bacteria | 1838 |
| 1311 | Ga0587115_003264 | 3300059626 | Bacteria | 1694 |
| 1312 | Ga0587115_010849 | 3300059626 | Bacteria | 1141 |
| 1313 | Ga0587115_022387 | 3300059626 | Bacteria | 890 |
| 1314 | Ga0587115_025173 | 3300059626 | Bacteria | 854 |
| 1315 | Ga0587115_062328 | 3300059626 | Bacteria | 628 |
| 1316 | Ga0587115_068568 | 3300059626 | Bacteria | 608 |
| 1317 | Ga0587115_080511 | 3300059626 | Bacteria | 576 |
| 1318 | Ga0587115_096174 | 3300059626 | Bacteria | 544 |
| 1319 | Ga0587117_004775 | 3300059627 | Bacteria | 1429 |
| 1320 | Ga0587117_004960 | 3300059627 | Bacteria | 1415 |
| 1321 | Ga0587117_034019 | 3300059627 | Bacteria | 782 |
| 1322 | Ga0587117_038117 | 3300059627 | Bacteria | 755 |
| 1323 | Ga0587117_055042 | 3300059627 | Bacteria | 670 |
| 1324 | Ga0587117_084311 | 3300059627 | Bacteria | 584 |
| 1325 | Ga0587117_084439 | 3300059627 | Bacteria | 583 |
| 1326 | Ga0587117_096261 | 3300059627 | Bacteria | 559 |
| 1327 | Ga0587117_128286 | 3300059627 | Bacteria | 508 |
| 1328 | Ga0587122_006423 | 3300059628 | Bacteria | 1015 |
| 1329 | Ga0587122_024214 | 3300059628 | Bacteria | 679 |
| 1330 | Ga0587122_027635 | 3300059628 | Bacteria | 652 |
| 1331 | Ga0587127_012912 | 3300059629 | Bacteria | 674 |
| 1332 | Ga0587127_013803 | 3300059629 | Bacteria | 660 |
| 1333 | Ga0587127_020843 | 3300059629 | Bacteria | 580 |
| 1334 | Ga0587127_020846 | 3300059629 | Bacteria | 580 |
| 1335 | Ga0587128_000231 | 3300059630 | Bacteria | 3535 |
| 1336 | Ga0587128_002976 | 3300059630 | Bacteria | 1829 |
| 1337 | Ga0587128_019167 | 3300059630 | Bacteria | 1033 |
| 1338 | Ga0587128_023505 | 3300059630 | Bacteria | 967 |
| 1339 | Ga0587128_025419 | 3300059630 | Bacteria | 943 |
| 1340 | Ga0587128_037450 | 3300059630 | Bacteria | 834 |
| 1341 | Ga0587128_044396 | 3300059630 | Bacteria | 789 |
| 1342 | Ga0587128_094006 | 3300059630 | Bacteria | 619 |
| 1343 | Ga0587130_009508 | 3300059631 | Bacteria | 937 |
| 1344 | Ga0587130_015055 | 3300059631 | Bacteria | 794 |
| 1345 | Ga0587062_003510 | 3300059639 | Bacteria | 1592 |
| 1346 | Ga0587062_014697 | 3300059639 | Bacteria | 1037 |
| 1347 | Ga0587062_032954 | 3300059639 | Bacteria | 803 |
| 1348 | Ga0587062_036146 | 3300059639 | Bacteria | 781 |
| 1349 | Ga0587062_040297 | 3300059639 | Bacteria | 755 |
| 1350 | Ga0587062_078730 | 3300059639 | Bacteria | 609 |
| 1351 | Ga0587062_108832 | 3300059639 | Bacteria | 548 |
| 1352 | Ga0587062_125905 | 3300059639 | Bacteria | 522 |
| 1353 | Ga0587067_008983 | 3300059640 | Bacteria | 1477 |
| 1354 | Ga0587067_042822 | 3300059640 | Bacteria | 886 |
| 1355 | Ga0587067_045468 | 3300059640 | Bacteria | 869 |
| 1356 | Ga0587067_053094 | 3300059640 | Bacteria | 826 |
| 1357 | Ga0587067_055569 | 3300059640 | Bacteria | 814 |
| 1358 | Ga0587067_067753 | 3300059640 | Bacteria | 763 |
| 1359 | Ga0587067_097622 | 3300059640 | Bacteria | 675 |
| 1360 | Ga0587067_104445 | 3300059640 | Bacteria | 660 |
| 1361 | Ga0587067_160563 | 3300059640 | Bacteria | 571 |
| 1362 | Ga0587067_191387 | 3300059640 | Bacteria | 539 |
| 1363 | Ga0587068_006412 | 3300059641 | Bacteria | 1647 |
| 1364 | Ga0587068_007578 | 3300059641 | Bacteria | 1552 |
| 1365 | Ga0587068_011196 | 3300059641 | Bacteria | 1349 |
| 1366 | Ga0587068_016956 | 3300059641 | Bacteria | 1159 |
| 1367 | Ga0587068_024329 | 3300059641 | Bacteria | 1014 |
| 1368 | Ga0587068_027484 | 3300059641 | Bacteria | 968 |
| 1369 | Ga0587068_031544 | 3300059641 | Bacteria | 921 |
| 1370 | Ga0587068_054018 | 3300059641 | Bacteria | 758 |
| 1371 | Ga0587068_084048 | 3300059641 | Bacteria | 647 |
| 1372 | Ga0587068_105858 | 3300059641 | Bacteria | 596 |
| 1373 | Ga0587068_115752 | 3300059641 | Bacteria | 577 |
| 1374 | Ga0587068_172780 | 3300059641 | Bacteria | 501 |
| 1375 | Ga0587069_000423 | 3300059642 | Bacteria | 3153 |
| 1376 | Ga0587069_022579 | 3300059642 | Bacteria | 956 |
| 1377 | Ga0587069_025016 | 3300059642 | Bacteria | 925 |
| 1378 | Ga0587069_038770 | 3300059642 | Bacteria | 804 |
| 1379 | Ga0587069_063709 | 3300059642 | Bacteria | 685 |
| 1380 | Ga0587069_065948 | 3300059642 | Bacteria | 678 |
| 1381 | Ga0587069_078342 | 3300059642 | Bacteria | 640 |
| 1382 | Ga0587069_094022 | 3300059642 | Bacteria | 603 |
| 1383 | Ga0587069_098278 | 3300059642 | Bacteria | 595 |
| 1384 | Ga0587069_101177 | 3300059642 | Bacteria | 589 |
| 1385 | Ga0587069_119762 | 3300059642 | Bacteria | 557 |
| 1386 | Ga0587069_155105 | 3300059642 | Bacteria | 511 |
| 1387 | Ga0587072_007163 | 3300059643 | Bacteria | 1725 |
| 1388 | Ga0587072_010385 | 3300059643 | Bacteria | 1503 |
| 1389 | Ga0587072_032506 | 3300059643 | Bacteria | 980 |
| 1390 | Ga0587072_040730 | 3300059643 | Bacteria | 902 |
| 1391 | Ga0587072_052886 | 3300059643 | Bacteria | 818 |
| 1392 | Ga0587072_082533 | 3300059643 | Bacteria | 697 |
| 1393 | Ga0587072_103157 | 3300059643 | Bacteria | 642 |
| 1394 | Ga0587072_132483 | 3300059643 | Bacteria | 588 |
| 1395 | Ga0587072_151346 | 3300059643 | Bacteria | 560 |
| 1396 | Ga0587075_000942 | 3300059644 | Bacteria | 2627 |
| 1397 | Ga0587075_001141 | 3300059644 | Bacteria | 2484 |
| 1398 | Ga0587075_015215 | 3300059644 | Bacteria | 1079 |
| 1399 | Ga0587075_020016 | 3300059644 | Bacteria | 985 |
| 1400 | Ga0587075_026001 | 3300059644 | Bacteria | 903 |
| 1401 | Ga0587075_048705 | 3300059644 | Bacteria | 733 |
| 1402 | Ga0587075_065329 | 3300059644 | Bacteria | 665 |
| 1403 | Ga0587075_083329 | 3300059644 | Bacteria | 614 |
| 1404 | Ga0587075_107925 | 3300059644 | Bacteria | 563 |
| 1405 | Ga0587075_119878 | 3300059644 | Bacteria | 544 |
| 1406 | Ga0587076_001738 | 3300059645 | Bacteria | 2297 |
| 1407 | Ga0587076_002239 | 3300059645 | Bacteria | 2138 |
| 1408 | Ga0587076_003512 | 3300059645 | Bacteria | 1875 |
| 1409 | Ga0587076_018915 | 3300059645 | Bacteria | 1115 |
| 1410 | Ga0587076_018999 | 3300059645 | Bacteria | 1113 |
| 1411 | Ga0587076_032650 | 3300059645 | Bacteria | 932 |
| 1412 | Ga0587076_034114 | 3300059645 | Bacteria | 918 |
| 1413 | Ga0587076_048973 | 3300059645 | Bacteria | 817 |
| 1414 | Ga0587076_056070 | 3300059645 | Bacteria | 782 |
| 1415 | Ga0587076_088978 | 3300059645 | Bacteria | 672 |
| 1416 | Ga0587076_097806 | 3300059645 | Bacteria | 651 |
| 1417 | Ga0587076_107574 | 3300059645 | Bacteria | 631 |
| 1418 | Ga0587078_002836 | 3300059646 | Bacteria | 1707 |
| 1419 | Ga0587078_026198 | 3300059646 | Bacteria | 765 |
| 1420 | Ga0587078_035613 | 3300059646 | Bacteria | 686 |
| 1421 | Ga0587078_053953 | 3300059646 | Bacteria | 595 |
| 1422 | Ga0587078_060681 | 3300059646 | Bacteria | 573 |
| 1423 | Ga0587078_083937 | 3300059646 | Bacteria | 514 |
| 1424 | Ga0587078_086781 | 3300059646 | Bacteria | 509 |
| 1425 | Ga0587079_001277 | 3300059647 | Bacteria | 2762 |
| 1426 | Ga0587079_007543 | 3300059647 | Bacteria | 1632 |
| 1427 | Ga0587079_008150 | 3300059647 | Bacteria | 1592 |
| 1428 | Ga0587079_008584 | 3300059647 | Bacteria | 1567 |
| 1429 | Ga0587079_013901 | 3300059647 | Bacteria | 1341 |
| 1430 | Ga0587079_019197 | 3300059647 | Bacteria | 1207 |
| 1431 | Ga0587079_020407 | 3300059647 | Bacteria | 1182 |
| 1432 | Ga0587079_024036 | 3300059647 | Bacteria | 1120 |
| 1433 | Ga0587079_041959 | 3300059647 | Bacteria | 928 |
| 1434 | Ga0587079_049661 | 3300059647 | Bacteria | 876 |
| 1435 | Ga0587079_080950 | 3300059647 | Bacteria | 743 |
| 1436 | Ga0587079_083553 | 3300059647 | Bacteria | 734 |
| 1437 | Ga0587079_083715 | 3300059647 | Bacteria | 734 |
| 1438 | Ga0587079_091965 | 3300059647 | Bacteria | 711 |
| 1439 | Ga0587079_104607 | 3300059647 | Bacteria | 680 |
| 1440 | Ga0587079_106599 | 3300059647 | Bacteria | 676 |
| 1441 | Ga0587079_116810 | 3300059647 | Bacteria | 655 |
| 1442 | Ga0587079_130581 | 3300059647 | Bacteria | 631 |
| 1443 | Ga0587079_160316 | 3300059647 | Bacteria | 588 |
| 1444 | Ga0587079_213699 | 3300059647 | Bacteria | 532 |
| 1445 | Ga0587079_234985 | 3300059647 | Bacteria | 515 |
| 1446 | Ga0587100_001025 | 3300059648 | Bacteria | 1528 |
| 1447 | Ga0587100_001642 | 3300059648 | Bacteria | 1341 |
| 1448 | Ga0587100_002716 | 3300059648 | Bacteria | 1165 |
| 1449 | Ga0587100_003045 | 3300059648 | Bacteria | 1126 |
| 1450 | Ga0587100_039625 | 3300059648 | Bacteria | 527 |
| 1451 | Ga0587100_046374 | 3300059648 | Bacteria | 502 |
| 1452 | Ga0587102_002171 | 3300059649 | Bacteria | 1486 |
| 1453 | Ga0587102_004939 | 3300059649 | Bacteria | 1159 |
| 1454 | Ga0587102_016609 | 3300059649 | Bacteria | 793 |
| 1455 | Ga0587102_018048 | 3300059649 | Bacteria | 774 |
| 1456 | Ga0587102_019065 | 3300059649 | Bacteria | 760 |
| 1457 | Ga0587102_023351 | 3300059649 | Bacteria | 713 |
| 1458 | Ga0587102_030170 | 3300059649 | Bacteria | 659 |
| 1459 | Ga0587102_044030 | 3300059649 | Bacteria | 584 |
| 1460 | Ga0587102_046947 | 3300059649 | Bacteria | 572 |
| 1461 | Ga0587104_006205 | 3300059650 | Bacteria | 805 |
| 1462 | Ga0587104_010995 | 3300059650 | Bacteria | 669 |
| 1463 | Ga0587105_011039 | 3300059651 | Bacteria | 692 |
| 1464 | Ga0587105_021148 | 3300059651 | Bacteria | 572 |
| 1465 | Ga0587105_031492 | 3300059651 | Bacteria | 508 |
| 1466 | Ga0587107_001773 | 3300059652 | Bacteria | 1823 |
| 1467 | Ga0587107_005621 | 3300059652 | Bacteria | 1334 |
| 1468 | Ga0587107_009040 | 3300059652 | Bacteria | 1166 |
| 1469 | Ga0587107_026966 | 3300059652 | Bacteria | 847 |
| 1470 | Ga0587107_056122 | 3300059652 | Bacteria | 682 |
| 1471 | Ga0587107_056366 | 3300059652 | Bacteria | 681 |
| 1472 | Ga0587107_058032 | 3300059652 | Bacteria | 675 |
| 1473 | Ga0587107_074147 | 3300059652 | Bacteria | 627 |
| 1474 | Ga0587108_020281 | 3300059653 | Bacteria | 628 |
| 1475 | Ga0587108_027844 | 3300059653 | Bacteria | 566 |
| 1476 | Ga0587108_039353 | 3300059653 | Bacteria | 504 |
| 1477 | Ga0587110_003344 | 3300059654 | Bacteria | 1336 |
| 1478 | Ga0587110_019685 | 3300059654 | Bacteria | 755 |
| 1479 | Ga0587110_028756 | 3300059654 | Bacteria | 668 |
| 1480 | Ga0587114_001018 | 3300059655 | Bacteria | 2192 |
| 1481 | Ga0587114_006659 | 3300059655 | Bacteria | 1299 |
| 1482 | Ga0587114_021119 | 3300059655 | Bacteria | 919 |
| 1483 | Ga0587114_059950 | 3300059655 | Bacteria | 665 |
| 1484 | Ga0587114_084231 | 3300059655 | Bacteria | 596 |
| 1485 | Ga0587116_01217 | 3300059656 | Bacteria | 1214 |
| 1486 | Ga0587116_17275 | 3300059656 | Bacteria | 532 |
| 1487 | Ga0587119_001808 | 3300059658 | Bacteria | 1832 |
| 1488 | Ga0587119_005015 | 3300059658 | Bacteria | 1340 |
| 1489 | Ga0587119_008110 | 3300059658 | Bacteria | 1148 |
| 1490 | Ga0587119_015334 | 3300059658 | Bacteria | 927 |
| 1491 | Ga0587119_045009 | 3300059658 | Bacteria | 644 |
| 1492 | Ga0587119_068161 | 3300059658 | Bacteria | 560 |
| 1493 | Ga0587119_079085 | 3300059658 | Bacteria | 533 |
| 1494 | Ga0587120_003320 | 3300059659 | Bacteria | 1151 |
| 1495 | Ga0587120_016986 | 3300059659 | Bacteria | 668 |
| 1496 | Ga0587120_022896 | 3300059659 | Bacteria | 604 |
| 1497 | Ga0587071_003723 | 3300060344 | Bacteria | 2215 |
| 1498 | Ga0587071_009573 | 3300060344 | Bacteria | 1598 |
| 1499 | Ga0587071_011816 | 3300060344 | Bacteria | 1480 |
| 1500 | Ga0587071_012420 | 3300060344 | Bacteria | 1453 |
| 1501 | Ga0587071_042401 | 3300060344 | Bacteria | 916 |
| 1502 | Ga0587071_073640 | 3300060344 | Bacteria | 748 |
| 1503 | Ga0587071_086010 | 3300060344 | Bacteria | 707 |
| 1504 | Ga0587071_103454 | 3300060344 | Bacteria | 662 |
| 1505 | Ga0587071_105515 | 3300060344 | Bacteria | 657 |
| 1506 | Ga0587071_106314 | 3300060344 | Bacteria | 655 |
| 1507 | Ga0587071_109830 | 3300060344 | Bacteria | 647 |
| 1508 | Ga0587071_110550 | 3300060344 | Bacteria | 646 |
| 1509 | Ga0587071_224144 | 3300060344 | Bacteria | 501 |
| 1510 | Ga0587111_0002392 | 3300060346 | Bacteria | 2492 |
| 1511 | Ga0587111_0004349 | 3300060346 | Bacteria | 2101 |
| 1512 | Ga0587111_0006892 | 3300060346 | Bacteria | 1822 |
| 1513 | Ga0587111_0010132 | 3300060346 | Bacteria | 1611 |
| 1514 | Ga0587111_0010639 | 3300060346 | Bacteria | 1584 |
| 1515 | Ga0587111_0010952 | 3300060346 | Bacteria | 1570 |
| 1516 | Ga0587111_0012560 | 3300060346 | Bacteria | 1498 |
| 1517 | Ga0587111_0016715 | 3300060346 | Bacteria | 1358 |
| 1518 | Ga0587111_0025685 | 3300060346 | Bacteria | 1168 |
| 1519 | Ga0587111_0029964 | 3300060346 | Bacteria | 1105 |
| 1520 | Ga0587111_0032277 | 3300060346 | Bacteria | 1076 |
| 1521 | Ga0587111_0070436 | 3300060346 | Bacteria | 815 |
| 1522 | Ga0587111_0073385 | 3300060346 | Bacteria | 803 |
| 1523 | Ga0587111_0082601 | 3300060346 | Bacteria | 770 |
| 1524 | Ga0587111_0083066 | 3300060346 | Bacteria | 769 |
| 1525 | Ga0587111_0149340 | 3300060346 | Bacteria | 626 |
| 1526 | Ga0587111_0164445 | 3300060346 | Bacteria | 606 |
| 1527 | Ga0587111_0167768 | 3300060346 | Bacteria | 601 |
| 1528 | Ga0587111_0186118 | 3300060346 | Bacteria | 580 |
| 1529 | Ga0587111_0192093 | 3300060346 | Bacteria | 574 |
| 1530 | Ga0587111_0196665 | 3300060346 | Bacteria | 569 |
| 1531 | Ga0587111_0205514 | 3300060346 | Bacteria | 561 |
| 1532 | Ga0587111_0254075 | 3300060346 | Bacteria | 521 |
| 1533 | Ga0501082_0116201 | 3300060353 | Bacteria | 2317 |
| 1534 | Ga0501082_0469068 | 3300060353 | Bacteria | 1100 |
| 1535 | Ga0466962_0016446 | 3300061719 | Bacteria | 3568 |
| 1536 | Ga0466962_0066031 | 3300061719 | Bacteria | 1727 |
| 1537 | Ga0466962_0089480 | 3300061719 | Bacteria | 1474 |
| 1538 | Ga0466962_0601038 | 3300061719 | Bacteria | 561 |
| 1539 | Ga0530510_0051747 | 3300061734 | Bacteria | 2968 |
| 1540 | 2528205978 | 2527291627 | Bacteria | 5309833 |
| 1541 | 2528215642 | 2527291629 | Bacteria | 5267418 |
| 1542 | 2546951158 | 2546825537 | Bacteria | 5389291 |
| 1543 | 2558906592 | 2558860112 | Bacteria | 9931328 |
| 1544 | 2579750830 | 2576861822 | Bacteria | 5004595 |
| 1545 | 2734968320 | 2734482000 | Bacteria | 5525167 |
| 1546 | 2774866829 | 2773857924 | Bacteria | 5256821 |
| 1547 | 2795785159 | 2795385470 | Bacteria | 8317180 |
| 1548 | 3003003853 | 3002998708 | Bacteria | 11715108 |
| 1549 | 637879847 | 637000116 | Bacteria | 5433628 |
| 1550 | 8054474609 | 8054472261 | Bacteria | 7464355 |
| 1551 | LJQas_1007275 | |||
| 1552 | bgg_mtDRAFT_1037018 | |||
| 1553 | JGI24739J22299_10100985 | |||
| 1554 | JGI24737J22298_10154805 | |||
| 1555 | JGI24743J22301_10006549 | |||
| 1556 | JGI24743J22301_10010932 | |||
| 1557 | JGI24744J21845_10032804 | |||
| 1558 | Ga0006765J45826_106115 | |||
| 1559 | Ga0006770J48903_1024152 | |||
| 1560 | Ga0006770J48903_1036028 | |||
| 1561 | Ga0006770J48903_1044414 | |||
| 1562 | rootH2_10037862 | |||
| 1563 | JGI25407J50210_10010461 | |||
| 1564 | JGI25407J50210_10022104 | |||
| 1565 | JGI25407J50210_10058016 | |||
| 1566 | JGI25407J50210_10068958 | |||
| 1567 | Ga0007417J51691_1011844 | |||
| 1568 | Ga0007417J51691_1020894 | |||
| 1569 | Ga0007417J51691_1023789 | |||
| 1570 | Ga0007417J51691_1029232 | |||
| 1571 | Ga0007417J51691_1031395 | |||
| 1572 | Ga0007417J51691_1032285 | |||
| 1573 | Ga0007417J51691_1033691 | |||
| 1574 | Ga0006781J51513_1006097 | |||
| 1575 | Ga0006781J51513_1013153 | |||
| 1576 | Ga0006781J51513_1016077 | |||
| 1577 | Ga0007410J51695_1008856 | |||
| 1578 | Ga0007410J51695_1018389 | |||
| 1579 | Ga0007410J51695_1042192 | |||
| 1580 | Ga0007409J51694_1007741 | |||
| 1581 | Ga0007409J51694_1007742 | |||
| 1582 | Ga0007409J51694_1011577 | |||
| 1583 | Ga0007409J51694_1019397 | |||
| 1584 | Ga0007409J51694_1022556 | |||
| 1585 | Ga0007409J51694_1041078 | |||
| 1586 | Ga0007416J51690_1009019 | |||
| 1587 | Ga0007416J51690_1011696 | |||
| 1588 | Ga0007416J51690_1018488 | |||
| 1589 | Ga0007416J51690_1021822 | |||
| 1590 | Ga0007416J51690_1050276 | |||
| 1591 | Ga0007429J51699_1013820 | |||
| 1592 | Ga0007429J51699_1020887 | |||
| 1593 | Ga0007429J51699_1021803 | |||
| 1594 | Ga0007429J51699_1034151 | |||
| 1595 | Ga0007429J51699_1039154 | |||
| 1596 | Ga0007429J51699_1080258 | |||
| 1597 | Ga0032354_1003417 | |||
| 1598 | Ga0032354_1023209 | |||
| 1599 | Ga0032354_1033193 | |||
| 1600 | Ga0032354_1037363 | |||
| 1601 | Ga0032354_1043219 | |||
| 1602 | Ga0032354_1048438 | |||
| 1603 | Ga0058858_1001640 | |||
| 1604 | Ga0058858_1035079 | |||
| 1605 | Ga0058858_1428512 | |||
| 1606 | Ga0058858_1438279 | |||
| 1607 | Ga0058859_10007395 | |||
| 1608 | Ga0058859_10039925 | |||
| 1609 | Ga0058859_10052612 | |||
| 1610 | Ga0058859_10056563 | |||
| 1611 | Ga0058859_10095538 | |||
| 1612 | Ga0058859_11773704 | |||
| 1613 | Ga0058863_10003259 | |||
| 1614 | Ga0058863_10055411 | |||
| 1615 | Ga0058863_10088008 | |||
| 1616 | Ga0058863_11727525 | |||
| 1617 | Ga0058863_11902200 | |||
| 1618 | Ga0058863_11942052 | |||
| 1619 | Ga0058863_11943932 | |||
| 1620 | Ga0058861_10024395 | |||
| 1621 | Ga0058861_10024951 | |||
| 1622 | Ga0058861_10043603 | |||
| 1623 | Ga0058861_10071225 | |||
| 1624 | Ga0058861_10075982 | |||
| 1625 | Ga0058861_10083556 | |||
| 1626 | Ga0058861_10150641 | |||
| 1627 | Ga0058861_11798679 | |||
| 1628 | Ga0058861_11977214 | |||
| 1629 | Ga0058861_12056731 | |||
| 1630 | Ga0058860_10041629 | |||
| 1631 | Ga0058860_10053668 | |||
| 1632 | Ga0058860_10134167 | |||
| 1633 | Ga0058860_10154251 | |||
| 1634 | Ga0058860_12159347 | |||
| 1635 | Ga0058860_12212618 | |||
| 1636 | Ga0058862_10048961 | |||
| 1637 | Ga0058862_10053678 | |||
| 1638 | Ga0058862_10057100 | |||
| 1639 | Ga0058862_10060482 | |||
| 1640 | Ga0058862_10060744 | |||
| 1641 | Ga0058862_10105153 | |||
| 1642 | Ga0058862_10253325 | |||
| 1643 | Ga0058862_10270879 | |||
| 1644 | Ga0058862_12828490 | |||
| 1645 | Ga0058862_12840016 | |||
| 1646 | Ga0058862_12863248 | |||
| 1647 | Ga0070658_10599438 | |||
| 1648 | Ga0070676_10435713 | |||
| 1649 | Ga0070683_100072328 | |||
| 1650 | Ga0070683_100202443 | |||
| 1651 | Ga0070683_100609912 | |||
| 1652 | Ga0070683_100627640 | |||
| 1653 | Ga0070683_100839796 | |||
| 1654 | Ga0070683_100959124 | |||
| 1655 | Ga0070690_100855116 | |||
| 1656 | Ga0070690_101576115 | |||
| 1657 | Ga0070670_100368653 | |||
| 1658 | Ga0070677_10109300 | |||
| 1659 | Ga0068869_100495114 | |||
| 1660 | Ga0068869_102018736 | |||
| 1661 | Ga0070666_10633179 | |||
| 1662 | Ga0070680_101448709 | |||
| 1663 | Ga0070680_101506020 | |||
| 1664 | Ga0070682_100685631 | |||
| 1665 | Ga0070682_100924541 | |||
| 1666 | Ga0070682_101001488 | |||
| 1667 | Ga0070682_101190278 | |||
| 1668 | Ga0070682_101774655 | |||
| 1669 | Ga0068868_100035170 | |||
| 1670 | Ga0068868_100055544 | |||
| 1671 | Ga0068868_100666726 | |||
| 1672 | Ga0068868_100754730 | |||
| 1673 | Ga0068868_100875139 | |||
| 1674 | Ga0068868_101154274 | |||
| 1675 | Ga0068868_101376143 | |||
| 1676 | Ga0068868_102153452 | |||
| 1677 | Ga0070660_100456127 | |||
| 1678 | Ga0070660_100599909 | |||
| 1679 | Ga0070660_101375065 | |||
| 1680 | Ga0070660_101539022 | |||
| 1681 | Ga0070689_100604638 | |||
| 1682 | Ga0070691_10145866 | |||
| 1683 | Ga0070691_10244589 | |||
| 1684 | Ga0070687_100142621 | |||
| 1685 | Ga0070661_100624402 | |||
| 1686 | Ga0070661_100837144 | |||
| 1687 | Ga0070661_100862549 | |||
| 1688 | Ga0070661_101215586 | |||
| 1689 | Ga0070692_10150862 | |||
| 1690 | Ga0070668_100228838 | |||
| 1691 | Ga0070668_101426143 | |||
| 1692 | Ga0070668_101532898 | |||
| 1693 | Ga0070669_100125620 | |||
| 1694 | Ga0070669_100148199 | |||
| 1695 | Ga0070669_101363192 | |||
| 1696 | Ga0070671_100147713 | |||
| 1697 | Ga0070671_100940707 | |||
| 1698 | Ga0070671_101122269 | |||
| 1699 | Ga0070674_100459216 | |||
| 1700 | Ga0070674_101090667 | |||
| 1701 | Ga0070674_101599540 | |||
| 1702 | Ga0070673_100065020 | |||
| 1703 | Ga0070673_100326373 | |||
| 1704 | Ga0070688_100157089 | |||
| 1705 | Ga0070659_100097958 | |||
| 1706 | Ga0070659_100112896 | |||
| 1707 | Ga0070659_100513301 | |||
| 1708 | Ga0070659_101540267 | |||
| 1709 | Ga0070667_100068700 | |||
| 1710 | Ga0070667_100328191 | |||
| 1711 | Ga0070667_100517309 | |||
| 1712 | Ga0070667_100964915 | |||
| 1713 | Ga0070709_10883544 | |||
| 1714 | Ga0070709_11117971 | |||
| 1715 | Ga0070714_100199986 | |||
| 1716 | Ga0070714_100233213 | |||
| 1717 | Ga0070713_100554814 | |||
| 1718 | Ga0070713_100878073 | |||
| 1719 | Ga0070710_10910099 | |||
| 1720 | Ga0070701_10015984 | |||
| 1721 | Ga0070701_10630101 | |||
| 1722 | Ga0070705_100055200 | |||
| 1723 | Ga0070700_100140647 | |||
| 1724 | Ga0070700_100156908 | |||
| 1725 | Ga0070700_100302245 | |||
| 1726 | Ga0070700_100329018 | |||
| 1727 | Ga0070700_100466207 | |||
| 1728 | Ga0070700_100555027 | |||
| 1729 | Ga0070700_100568357 | |||
| 1730 | Ga0070700_100703542 | |||
| 1731 | Ga0070694_100095580 | |||
| 1732 | Ga0070694_100470840 | |||
| 1733 | Ga0070663_100262783 | |||
| 1734 | Ga0070663_100511201 | |||
| 1735 | Ga0070663_101170247 | |||
| 1736 | Ga0070678_100518942 | |||
| 1737 | Ga0070678_100755865 | |||
| 1738 | Ga0070662_100162562 | |||
| 1739 | Ga0070662_100191026 | |||
| 1740 | Ga0068867_100342253 | |||
| 1741 | Ga0070685_10379059 | |||
| 1742 | Ga0070685_10406983 | |||
| 1743 | Ga0070706_101703484 | |||
| 1744 | Ga0070679_101300920 | |||
| 1745 | Ga0070679_101577828 | |||
| 1746 | Ga0070679_101669664 | |||
| 1747 | Ga0070684_100047435 | |||
| 1748 | Ga0070684_100314713 | |||
| 1749 | Ga0070684_100398936 | |||
| 1750 | Ga0070684_100538851 | |||
| 1751 | Ga0070684_100570603 | |||
| 1752 | Ga0070684_101270674 | |||
| 1753 | Ga0070697_100907460 | |||
| 1754 | Ga0068853_100112495 | |||
| 1755 | Ga0068853_100753506 | |||
| 1756 | Ga0068853_101215439 | |||
| 1757 | Ga0070672_100405697 | |||
| 1758 | Ga0070672_102041055 | |||
| 1759 | Ga0070686_100385048 | |||
| 1760 | Ga0070695_101035449 | |||
| 1761 | Ga0070696_100195216 | |||
| 1762 | Ga0070696_101386851 | |||
| 1763 | Ga0070693_100732703 | |||
| 1764 | Ga0070665_101663393 | |||
| 1765 | Ga0068855_100467800 | |||
| 1766 | Ga0070664_100038021 | |||
| 1767 | Ga0070664_100326428 | |||
| 1768 | Ga0070664_100356458 | |||
| 1769 | Ga0070664_100542883 | |||
| 1770 | Ga0070664_100547388 | |||
| 1771 | Ga0070664_100588177 | |||
| 1772 | Ga0068857_101170658 | |||
| 1773 | Ga0068857_101435059 | |||
| 1774 | Ga0068857_101501003 | |||
| 1775 | Ga0068854_100133284 | |||
| 1776 | Ga0068854_100192331 | |||
| 1777 | Ga0068854_100208031 | |||
| 1778 | Ga0068856_100156611 | |||
| 1779 | Ga0070702_100005968 | |||
| 1780 | Ga0070702_100094856 | |||
| 1781 | Ga0070702_100100036 | |||
| 1782 | Ga0070702_100148753 | |||
| 1783 | Ga0070702_100215487 | |||
| 1784 | Ga0070702_100753777 | |||
| 1785 | Ga0070702_100829735 | |||
| 1786 | Ga0070702_100873534 | |||
| 1787 | Ga0068852_100148741 | |||
| 1788 | Ga0068852_100169066 | |||
| 1789 | Ga0068852_100486021 | |||
| 1790 | Ga0068859_100238473 | |||
| 1791 | Ga0068859_100443167 | |||
| 1792 | Ga0068859_101302505 | |||
| 1793 | Ga0068864_100178065 | |||
| 1794 | Ga0068864_100215043 | |||
| 1795 | Ga0068864_100632467 | |||
| 1796 | Ga0068864_101953739 | |||
| 1797 | Ga0068864_102048266 | |||
| 1798 | Ga0068866_10019649 | |||
| 1799 | Ga0068866_10290617 | |||
| 1800 | Ga0068866_10774535 | |||
| 1801 | Ga0068861_100028854 | |||
| 1802 | Ga0068861_100267341 | |||
| 1803 | Ga0068861_102141785 | |||
| 1804 | Ga0068861_102240874 | |||
| 1805 | Ga0068861_102376794 | |||
| 1806 | Ga0068851_10159693 | |||
| 1807 | Ga0068851_10481159 | |||
| 1808 | Ga0068870_10169519 | |||
| 1809 | Ga0068870_10572242 | |||
| 1810 | Ga0068870_10848555 | |||
| 1811 | Ga0068870_11076824 | |||
| 1812 | Ga0068863_100748762 | |||
| 1813 | Ga0068863_100827451 | |||
| 1814 | Ga0068863_101904246 | |||
| 1815 | Ga0068858_100047141 | |||
| 1816 | Ga0068858_100437264 | |||
| 1817 | Ga0068858_101085829 | |||
| 1818 | Ga0068858_101928464 | |||
| 1819 | Ga0068860_100380868 | |||
| 1820 | Ga0068860_101387967 | |||
| 1821 | Ga0068862_100174048 | |||
| 1822 | Ga0068862_100485760 | |||
| 1823 | Ga0081455_10066477 | |||
| 1824 | Ga0081455_10125348 | |||
| 1825 | Ga0081455_10128478 | |||
| 1826 | Ga0081455_10268510 | |||
| 1827 | Ga0081455_10269260 | |||
| 1828 | Ga0081455_10407928 | |||
| 1829 | Ga0081538_10000664 | |||
| 1830 | Ga0081538_10008845 | |||
| 1831 | Ga0081538_10009398 | |||
| 1832 | Ga0081538_10030120 | |||
| 1833 | Ga0081538_10052198 | |||
| 1834 | Ga0081538_10170267 | |||
| 1835 | Ga0081540_1022450 | |||
| 1836 | Ga0081540_1331141 | |||
| 1837 | Ga0081539_10121012 | |||
| 1838 | Ga0081539_10245063 | |||
| 1839 | Ga0070717_10062040 | |||
| 1840 | Ga0070717_10110108 | |||
| 1841 | Ga0070717_11117588 | |||
| 1842 | Ga0075365_10202400 | |||
| 1843 | Ga0075365_10224296 | |||
| 1844 | Ga0075365_10285206 | |||
| 1845 | Ga0075363_100741067 | |||
| 1846 | Ga0075432_10441052 | |||
| 1847 | Ga0070712_100383841 | |||
| 1848 | Ga0097621_100244419 | |||
| 1849 | Ga0097621_101929724 | |||
| 1850 | Ga0068871_100528844 | |||
| 1851 | Ga0068871_100833751 | |||
| 1852 | Ga0075431_100347623 | |||
| 1853 | Ga0075433_10491591 | |||
| 1854 | Ga0068865_100113770 | |||
| 1855 | Ga0068865_100338298 | |||
| 1856 | Ga0068865_100951209 | |||
| 1857 | Ga0068865_102140123 | |||
| 1858 | Ga0097620_100238483 | |||
| 1859 | Ga0097620_100443170 | |||
| 1860 | Ga0097620_101302375 | |||
| 1861 | Ga0099795_10000516 | |||
| 1862 | Ga0105244_10045580 | |||
| 1863 | Ga0105240_12152258 | |||
| 1864 | Ga0111539_10007452 | |||
| 1865 | Ga0111539_10084596 | |||
| 1866 | Ga0111539_10437064 | |||
| 1867 | Ga0111539_10560598 | |||
| 1868 | Ga0111539_11025554 | |||
| 1869 | Ga0111539_11770868 | |||
| 1870 | Ga0105245_10022555 | |||
| 1871 | Ga0105245_10630595 | |||
| 1872 | Ga0105245_11361976 | |||
| 1873 | Ga0105245_11912945 | |||
| 1874 | Ga0105245_12286903 | |||
| 1875 | Ga0105245_12339952 | |||
| 1876 | Ga0105245_12950837 | |||
| 1877 | Ga0105247_10368293 | |||
| 1878 | Ga0105247_10403907 | |||
| 1879 | Ga0105247_10734927 | |||
| 1880 | Ga0114129_12214805 | |||
| 1881 | Ga0114129_13055305 | |||
| 1882 | Ga0105243_10048410 | |||
| 1883 | Ga0105243_10071897 | |||
| 1884 | Ga0105243_10179357 | |||
| 1885 | Ga0105243_10213753 | |||
| 1886 | Ga0105243_10304961 | |||
| 1887 | Ga0105243_11315281 | |||
| 1888 | Ga0105243_11734047 | |||
| 1889 | Ga0105241_10173608 | |||
| 1890 | Ga0105241_10638040 | |||
| 1891 | Ga0105241_10641548 | |||
| 1892 | Ga0105241_11691031 | |||
| 1893 | Ga0105242_10042742 | |||
| 1894 | Ga0105242_10379605 | |||
| 1895 | Ga0105242_10509902 | |||
| 1896 | Ga0105242_11128143 | |||
| 1897 | Ga0105248_11377886 | |||
| 1898 | Ga0105248_13301844 | |||
| 1899 | Ga0105237_11732556 | |||
| 1900 | Ga0105237_11850821 | |||
| 1901 | Ga0105238_10056515 | |||
| 1902 | Ga0105238_11351259 | |||
| 1903 | Ga0105238_11446994 | |||
| 1904 | Ga0105249_10080410 | |||
| 1905 | Ga0105249_10263012 | |||
| 1906 | Ga0105249_10341069 | |||
| 1907 | Ga0105249_10459598 | |||
| 1908 | Ga0105249_11165937 | |||
| 1909 | Ga0105035_100266 | |||
| 1910 | Ga0099796_10014450 | |||
| 1911 | Ga0105239_10225017 | |||
| 1912 | Ga0105239_10335464 | |||
| 1913 | Ga0105239_10366509 | |||
| 1914 | Ga0105239_10601639 | |||
| 1915 | Ga0105239_11030401 | |||
| 1916 | Ga0105239_11478105 | |||
| 1917 | Ga0105246_10160157 | |||
| 1918 | Ga0105246_10165043 | |||
| 1919 | Ga0105246_10557737 | |||
| 1920 | Ga0105246_10603067 | |||
| 1921 | Ga0105246_12111238 | |||
| 1922 | Ga0157341_1020259 | |||
| 1923 | Ga0157373_10257737 | |||
| 1924 | Ga0157371_10109900 | |||
| 1925 | Ga0157371_10710014 | |||
| 1926 | Ga0157371_10838035 | |||
| 1927 | Ga0157371_11192176 | |||
| 1928 | Ga0157369_10394030 | |||
| 1929 | Ga0157369_10883201 | |||
| 1930 | Ga0157374_10113464 | |||
| 1931 | Ga0157374_11407785 | |||
| 1932 | Ga0157374_11680570 | |||
| 1933 | Ga0157374_11940134 | |||
| 1934 | Ga0157374_11954601 | |||
| 1935 | Ga0157374_12446891 | |||
| 1936 | Ga0157378_10618109 | |||
| 1937 | Ga0157378_10748200 | |||
| 1938 | Ga0157378_10887486 | |||
| 1939 | Ga0157378_10894874 | |||
| 1940 | Ga0163162_10412857 | |||
| 1941 | Ga0163162_11490716 | |||
| 1942 | Ga0163162_12088732 | |||
| 1943 | Ga0163162_12089425 | |||
| 1944 | Ga0163162_12236230 | |||
| 1945 | Ga0163162_12291519 | |||
| 1946 | Ga0157372_10104427 | |||
| 1947 | Ga0157372_10504305 | |||
| 1948 | Ga0157372_10578628 | |||
| 1949 | Ga0157372_10716473 | |||
| 1950 | Ga0157372_12126498 | |||
| 1951 | Ga0157375_10174399 | |||
| 1952 | Ga0157375_10429033 | |||
| 1953 | Ga0157375_10494744 | |||
| 1954 | Ga0157375_13175425 | |||
| 1955 | Ga0163163_13295134 | |||
| 1956 | Ga0157380_10109278 | |||
| 1957 | Ga0157380_10403373 | |||
| 1958 | Ga0157380_12030140 | |||
| 1959 | Ga0182008_10436448 | |||
| 1960 | Ga0182008_10568077 | |||
| 1961 | Ga0157377_10150374 | |||
| 1962 | Ga0157377_10458470 | |||
| 1963 | Ga0157377_10520742 | |||
| 1964 | Ga0157377_11189267 | |||
| 1965 | Ga0157379_10291540 | |||
| 1966 | Ga0157379_11165340 | |||
| 1967 | Ga0157379_11686778 | |||
| 1968 | Ga0157376_10720216 | |||
| 1969 | Ga0157376_10809898 | |||
| 1970 | Ga0163161_10228459 | |||
| 1971 | Ga0163161_10609151 | |||
| 1972 | Ga0163161_11021927 | |||
| 1973 | Ga0163161_11062866 | |||
| 1974 | Ga0163161_11726911 | |||
| 1975 | Ga0163161_11953049 | |||
| 1976 | Ga0197907_10559423 | |||
| 1977 | Ga0197907_10685680 | |||
| 1978 | Ga0197907_11395746 | |||
| 1979 | Ga0206356_10170539 | |||
| 1980 | Ga0206356_10275481 | |||
| 1981 | Ga0206356_10811388 | |||
| 1982 | Ga0206356_11208272 | |||
| 1983 | Ga0206356_11567341 | |||
| 1984 | Ga0206349_1383806 | |||
| 1985 | Ga0206355_1021710 | |||
| 1986 | Ga0206352_10107249 | |||
| 1987 | Ga0206352_10590329 | |||
| 1988 | Ga0206352_10818017 | |||
| 1989 | Ga0206350_10917422 | |||
| 1990 | Ga0206350_11505953 | |||
| 1991 | Ga0206350_11570365 | |||
| 1992 | Ga0206354_10732226 | |||
| 1993 | Ga0206354_10751741 | |||
| 1994 | Ga0206354_11379949 | |||
| 1995 | Ga0206353_10241100 | |||
| 1996 | Ga0206353_10477591 | |||
| 1997 | Ga0206353_11170794 | |||
| 1998 | Ga0206353_11391376 | |||
| 1999 | Ga0206353_11649880 | |||
| 2000 | Ga0213875_10000186 | |||
| 2001 | Ga0224712_10371560 | |||
| 2002 | Ga0207426_1018112 | |||
| 2003 | Ga0207426_1124550 | |||
| 2004 | Ga0207697_10284075 | |||
| 2005 | Ga0207656_10087858 | |||
| 2006 | Ga0207656_10373081 | |||
| 2007 | Ga0207653_10345804 | |||
| 2008 | Ga0207682_10075049 | |||
| 2009 | Ga0207692_10086812 | |||
| 2010 | Ga0207692_10429837 | |||
| 2011 | Ga0207692_10766509 | |||
| 2012 | Ga0207642_10115606 | |||
| 2013 | Ga0207642_10226435 | |||
| 2014 | Ga0207642_10343382 | |||
| 2015 | Ga0207710_10066252 | |||
| 2016 | Ga0207688_10006305 | |||
| 2017 | Ga0207688_10149196 | |||
| 2018 | Ga0207647_10130772 | |||
| 2019 | Ga0207647_10419278 | |||
| 2020 | Ga0207685_10060235 | |||
| 2021 | Ga0207645_10081146 | |||
| 2022 | Ga0207645_10226161 | |||
| 2023 | Ga0207643_10061448 | |||
| 2024 | Ga0207643_10104243 | |||
| 2025 | Ga0207643_10117336 | |||
| 2026 | Ga0207643_10138730 | |||
| 2027 | Ga0207705_10054463 | |||
| 2028 | Ga0207654_10240415 | |||
| 2029 | Ga0207654_10328311 | |||
| 2030 | Ga0207707_11454280 | |||
| 2031 | Ga0207695_10406402 | |||
| 2032 | Ga0207671_10611250 | |||
| 2033 | Ga0207663_10599426 | |||
| 2034 | Ga0207660_11157018 | |||
| 2035 | Ga0207660_11483633 | |||
| 2036 | Ga0207662_10030208 | |||
| 2037 | Ga0207662_10097614 | |||
| 2038 | Ga0207662_10182117 | |||
| 2039 | Ga0207662_10408059 | |||
| 2040 | Ga0207657_10060828 | |||
| 2041 | Ga0207657_10273336 | |||
| 2042 | Ga0207657_10437776 | |||
| 2043 | Ga0207649_10207360 | |||
| 2044 | Ga0207649_10318788 | |||
| 2045 | Ga0207652_11405623 | |||
| 2046 | Ga0207646_10342955 | |||
| 2047 | Ga0207681_10296625 | |||
| 2048 | Ga0207681_10438408 | |||
| 2049 | Ga0207681_11130789 | |||
| 2050 | Ga0207694_10082177 | |||
| 2051 | Ga0207694_10161392 | |||
| 2052 | Ga0207694_10301109 | |||
| 2053 | Ga0207694_10905386 | |||
| 2054 | Ga0207659_10218490 | |||
| 2055 | Ga0207659_10607951 | |||
| 2056 | Ga0207687_10065756 | |||
| 2057 | Ga0207687_10096654 | |||
| 2058 | Ga0207687_10255396 | |||
| 2059 | Ga0207687_10274063 | |||
| 2060 | Ga0207687_10387045 | |||
| 2061 | Ga0207687_11285005 | |||
| 2062 | Ga0207700_10081286 | |||
| 2063 | Ga0207700_11151663 | |||
| 2064 | Ga0207664_10239794 | |||
| 2065 | Ga0207664_10249508 | |||
| 2066 | Ga0207644_10814765 | |||
| 2067 | Ga0207644_11475183 | |||
| 2068 | Ga0207644_11504483 | |||
| 2069 | Ga0207690_10117990 | |||
| 2070 | Ga0207690_10193012 | |||
| 2071 | Ga0207690_10350225 | |||
| 2072 | Ga0207690_11018432 | |||
| 2073 | Ga0207690_11507783 | |||
| 2074 | Ga0207706_10342067 | |||
| 2075 | Ga0207706_10416919 | |||
| 2076 | Ga0207706_10567251 | |||
| 2077 | Ga0207706_10683154 | |||
| 2078 | Ga0207706_11015186 | |||
| 2079 | Ga0207686_10219923 | |||
| 2080 | Ga0207686_10319424 | |||
| 2081 | Ga0207709_10016973 | |||
| 2082 | Ga0207709_10150636 | |||
| 2083 | Ga0207709_10252942 | |||
| 2084 | Ga0207709_10261617 | |||
| 2085 | Ga0207709_10267706 | |||
| 2086 | Ga0207709_10506832 | |||
| 2087 | Ga0207670_10015950 | |||
| 2088 | Ga0207670_10558913 | |||
| 2089 | Ga0207670_11655283 | |||
| 2090 | Ga0207669_10465844 | |||
| 2091 | Ga0207704_10046576 | |||
| 2092 | Ga0207704_10568324 | |||
| 2093 | Ga0207704_11473372 | |||
| 2094 | Ga0207704_11703365 | |||
| 2095 | Ga0207665_11215471 | |||
| 2096 | Ga0207691_10128791 | |||
| 2097 | Ga0207691_10222398 | |||
| 2098 | Ga0207691_10231547 | |||
| 2099 | Ga0207711_10598136 | |||
| 2100 | Ga0207689_10385010 | |||
| 2101 | Ga0207689_10523120 | |||
| 2102 | Ga0207689_10623572 | |||
| 2103 | Ga0207661_10073549 | |||
| 2104 | Ga0207661_10367696 | |||
| 2105 | Ga0207661_10562315 | |||
| 2106 | Ga0207661_10626967 | |||
| 2107 | Ga0207661_11013008 | |||
| 2108 | Ga0207661_11068171 | |||
| 2109 | Ga0207661_11448385 | |||
| 2110 | Ga0207679_10098467 | |||
| 2111 | Ga0207679_10139564 | |||
| 2112 | Ga0207679_10293666 | |||
| 2113 | Ga0207679_10310375 | |||
| 2114 | Ga0207679_10379276 | |||
| 2115 | Ga0207679_10565132 | |||
| 2116 | Ga0207679_10706117 | |||
| 2117 | Ga0207667_10209220 | |||
| 2118 | Ga0207667_10632047 | |||
| 2119 | Ga0207651_10749441 | |||
| 2120 | Ga0207651_10899179 | |||
| 2121 | Ga0207651_12092025 | |||
| 2122 | Ga0207712_10345794 | |||
| 2123 | Ga0207712_10583914 | |||
| 2124 | Ga0207712_10971442 | |||
| 2125 | Ga0207712_11164936 | |||
| 2126 | Ga0207668_10165750 | |||
| 2127 | Ga0207668_10241147 | |||
| 2128 | Ga0207668_11422266 | |||
| 2129 | Ga0207640_10090771 | |||
| 2130 | Ga0207640_10119204 | |||
| 2131 | Ga0207640_10749486 | |||
| 2132 | Ga0207640_10871815 | |||
| 2133 | Ga0207640_11093040 | |||
| 2134 | Ga0207658_10077177 | |||
| 2135 | Ga0207658_10415697 | |||
| 2136 | Ga0207677_10119823 | |||
| 2137 | Ga0207677_10265266 | |||
| 2138 | Ga0207677_10282281 | |||
| 2139 | Ga0207677_10394617 | |||
| 2140 | Ga0207677_10462761 | |||
| 2141 | Ga0207677_11539043 | |||
| 2142 | Ga0207703_10457821 | |||
| 2143 | Ga0207703_11702061 | |||
| 2144 | Ga0207703_11726728 | |||
| 2145 | Ga0207639_10327841 | |||
| 2146 | Ga0207678_10091030 | |||
| 2147 | Ga0207678_10135952 | |||
| 2148 | Ga0207678_10337880 | |||
| 2149 | Ga0207678_10471933 | |||
| 2150 | Ga0207678_10780579 | |||
| 2151 | Ga0207708_10006747 | |||
| 2152 | Ga0207708_10021676 | |||
| 2153 | Ga0207708_10117707 | |||
| 2154 | Ga0207708_10212189 | |||
| 2155 | Ga0207708_10435132 | |||
| 2156 | Ga0207708_10491497 | |||
| 2157 | Ga0207702_10385135 | |||
| 2158 | Ga0207702_11030810 | |||
| 2159 | Ga0207641_10410437 | |||
| 2160 | Ga0207641_10602444 | |||
| 2161 | Ga0207648_10036106 | |||
| 2162 | Ga0207648_10069143 | |||
| 2163 | Ga0207648_11031103 | |||
| 2164 | Ga0207648_11370253 | |||
| 2165 | Ga0207676_10160438 | |||
| 2166 | Ga0207676_10330611 | |||
| 2167 | Ga0207676_10364529 | |||
| 2168 | Ga0207676_10558008 | |||
| 2169 | Ga0207676_11799746 | |||
| 2170 | Ga0207674_10189996 | |||
| 2171 | Ga0207674_10268034 | |||
| 2172 | Ga0207674_10309208 | |||
| 2173 | Ga0207674_10772180 | |||
| 2174 | Ga0207674_11517907 | |||
| 2175 | Ga0207675_100015029 | |||
| 2176 | Ga0207675_100027033 | |||
| 2177 | Ga0207675_100386488 | |||
| 2178 | Ga0207675_100626540 | |||
| 2179 | Ga0207675_101905379 | |||
| 2180 | Ga0207683_10146311 | |||
| 2181 | Ga0207683_10427290 | |||
| 2182 | Ga0207698_10025487 | |||
| 2183 | Ga0207698_10332046 | |||
| 2184 | Ga0207698_10451066 | |||
| 2185 | Ga0207698_10600255 | |||
| 2186 | Ga0207698_10863129 | |||
| 2187 | Ga0210002_1026614 | |||
| 2188 | Ga0207428_10035062 | |||
| 2189 | Ga0207428_10064577 | |||
| 2190 | Ga0207428_10230917 | |||
| 2191 | Ga0207428_11253473 | |||
| 2192 | Ga0268266_12191820 | |||
| 2193 | Ga0268265_10220765 | |||
| 2194 | Ga0268265_10243786 | |||
| 2195 | Ga0268265_11122965 | |||
| 2196 | Ga0268264_10236003 | |||
| 2197 | Ga0268264_10372871 | |||
| 2198 | Ga0268264_10567988 | |||
| 2199 | Ga0307515_10282807 | |||
| 2200 | Ga0311001_1068448 | |||
| 2201 | Ga0265766_1000621 | |||
| 2202 | Ga0307513_10001463 | |||
| 2203 | Ga0307509_10324242 | |||
| 2204 | Ga0307408_100099408 | |||
| 2205 | Ga0307408_100673465 | |||
| 2206 | Ga0307405_10035279 | |||
| 2207 | Ga0307405_11429335 | |||
| 2208 | Ga0307405_11947356 | |||
| 2209 | Ga0307413_11549141 | |||
| 2210 | Ga0307410_10235915 | |||
| 2211 | Ga0307410_10373024 | |||
| 2212 | Ga0307410_10874195 | |||
| 2213 | Ga0307410_11037735 | |||
| 2214 | Ga0307410_11313617 | |||
| 2215 | Ga0307406_10324856 | |||
| 2216 | Ga0307406_10455891 | |||
| 2217 | Ga0307406_11128299 | |||
| 2218 | Ga0307406_11797948 | |||
| 2219 | Ga0307406_11820032 | |||
| 2220 | Ga0307407_10028596 | |||
| 2221 | Ga0307407_10401120 | |||
| 2222 | Ga0307407_10840084 | |||
| 2223 | Ga0307407_10859732 | |||
| 2224 | Ga0307412_11248457 | |||
| 2225 | Ga0307412_11556021 | |||
| 2226 | Ga0307409_100065027 | |||
| 2227 | Ga0307409_100088553 | |||
| 2228 | Ga0307416_100096931 | |||
| 2229 | Ga0307416_100596372 | |||
| 2230 | Ga0307416_100745749 | |||
| 2231 | Ga0307416_101215646 | |||
| 2232 | Ga0307416_101728795 | |||
| 2233 | Ga0307416_102232325 | |||
| 2234 | Ga0307414_10159495 | |||
| 2235 | Ga0307414_10302843 | |||
| 2236 | Ga0307411_10212720 | |||
| 2237 | Ga0307411_10399537 | |||
| 2238 | Ga0307411_10765883 | |||
| 2239 | Ga0307411_11520559 | |||
| 2240 | Ga0307415_100046422 | |||
| 2241 | Ga0307415_100080155 | |||
| 2242 | Ga0307415_100217910 | |||
| 2243 | Ga0307415_100360563 | |||
| 2244 | Ga0307415_100676615 | |||
| 2245 | Ga0307415_100781586 | |||
| 2246 | Ga0307415_100867099 | |||
| 2247 | Ga0307415_101126391 | |||
| 2248 | Ga0307507_10016447 | |||
| 2249 | Ga0307507_10421610 | |||
| 2250 | Ga0307510_10128745 | |||
| 2251 | Ga0373948_0052903 | |||
| 2252 | Ga0373952_0035304 | |||
| 2253 | Ga0373960_0224769 | |||
| 2254 | Ga0373962_0069926 | |||
| 2255 | Ga0373931_0762600 | |||
| 2256 | Ga0395900_0262505 | |||
| 2257 | Ga0395900_0480304 | |||
| 2258 | Ga0395900_1437529 | |||
| 2259 | Ga0395898_0082059 | |||
| 2260 | Ga0395898_0203609 | |||
| 2261 | Ga0395898_0607035 | |||
| 2262 | Ga0395898_1059989 | |||
| 2263 | Ga0395898_1703167 | |||
| 2264 | Ga0436364_1040466 | |||
| 2265 | Ga0395901_0016549 | |||
| 2266 | Ga0395901_0378307 | |||
| 2267 | Ga0395901_1517126 | |||
| 2268 | Ga0451789_0128125 | |||
| 2269 | Ga0451791_0134196 | |||
| 2270 | Ga0451801_20889 | |||
| 2271 | Ga0451798_0205759 | |||
| 2272 | Ga0451800_0529711 | |||
| 2273 | Ga0451800_0798604 | |||
| 2274 | Ga0451802_0283187 | |||
| 2275 | Ga0451802_1367216 | |||
| 2276 | Ga0451805_092273 | |||
| 2277 | Ga0451804_0654268 | |||
| 2278 | Ga0451807_1200229 | |||
| 2279 | Ga0451839_0954223 | |||
| 2280 | Ga0451841_0722847 | |||
| 2281 | Ga0451845_0883599 | |||
| 2282 | Ga0451847_0240470 | |||
| 2283 | Ga0451851_0564806 | |||
| 2284 | Ga0451843_0427164 | |||
| 2285 | Ga0451843_0898051 | |||
| 2286 | Ga0451853_3042107 | |||
| 2287 | Ga0439455_0013690 | |||
| 2288 | Ga0439456_032747 | |||
| 2289 | Ga0439463_015388 | |||
| 2290 | Ga0450913_012317 | |||
| 2291 | Ga0439440_0008620 | |||
| 2292 | Ga0466969_0334174 | |||
| 2293 | Ga0466972_0010066 | |||
| 2294 | Ga0466965_0001592 | |||
| 2295 | Ga0466965_0166270 | |||
| 2296 | Ga0466965_0169076 | |||
| 2297 | Ga0466966_0010823 | |||
| 2298 | Ga0466963_0023118 | |||
| 2299 | Ga0466963_0080919 | |||
| 2300 | Ga0466963_0137997 | |||
| 2301 | Ga0466963_0652069 | |||
| 2302 | Ga0466964_0148680 | |||
| 2303 | Ga0466971_0036627 | |||
| 2304 | Ga0466971_0106427 | |||
| 2305 | Ga0466970_0011374 | |||
| 2306 | Ga0466970_0622520 | |||
| 2307 | Ga0466957_0097592 | |||
| 2308 | Ga0466957_0606913 | |||
| 2309 | Ga0466957_0611034 | |||
| 2310 | Ga0466957_0810454 | |||
| 2311 | Ga0466960_0002139 | |||
| 2312 | Ga0466960_0024310 | |||
| 2313 | Ga0466960_0223944 | |||
| 2314 | Ga0466959_0039373 | |||
| 2315 | Ga0466959_0755709 | |||
| 2316 | Ga0466958_0007347 | |||
| 2317 | Ga0466958_0571255 | |||
| 2318 | Ga0466967_0040750 | |||
| 2319 | Ga0466967_0057831 | |||
| 2320 | Ga0466967_0110602 | |||
| 2321 | Ga0466967_0119187 | |||
| 2322 | Ga0466967_0125309 | |||
| 2323 | Ga0466967_0198901 | |||
| 2324 | Ga0466967_0207520 | |||
| 2325 | Ga0466967_0623831 | |||
| 2326 | Ga0466967_0694611 | |||
| 2327 | Ga0466967_0929966 | |||
| 2328 | Ga0466967_1002136 | |||
| 2329 | Ga0495592_0246836 | |||
| 2330 | Ga0495650_0000121 | |||
| 2331 | Ga0495582_0648186 | |||
| 2332 | Ga0495605_0206732 | |||
| 2333 | Ga0495664_0199755 | |||
| 2334 | Ga0495584_0105725 | |||
| 2335 | Ga0495584_0424660 | |||
| 2336 | Ga0495596_0391688 | |||
| 2337 | Ga0495620_0152288 | |||
| 2338 | Ga0495620_0248283 | |||
| 2339 | Ga0495628_0782046 | |||
| 2340 | Ga0495631_0073623 | |||
| 2341 | Ga0495643_0189256 | |||
| 2342 | Ga0495643_0292210 | |||
| 2343 | Ga0495643_0483711 | |||
| 2344 | Ga0495663_0190944 | |||
| 2345 | Ga0495652_0197519 | |||
| 2346 | Ga0495640_0284809 | |||
| 2347 | Ga0495609_0183579 | |||
| 2348 | Ga0495597_0234214 | |||
| 2349 | Ga0495656_0200638 | |||
| 2350 | Ga0495656_0531202 | |||
| 2351 | Ga0495668_0298181 | |||
| 2352 | Ga0495661_0214353 | |||
| 2353 | Ga0495657_0316103 | |||
| 2354 | Ga0495670_0193902 | |||
| 2355 | Ga0495660_0430780 | |||
| 2356 | Ga0495604_0868413 | |||
| 2357 | Ga0495680_0440993 | |||
| 2358 | Ga0495685_204320 | |||
| 2359 | Ga0495686_0129578 | |||
| 2360 | Ga0495602_0288454 | |||
| 2361 | Ga0495615_0121571 | |||
| 2362 | Ga0496100_0002773 | |||
| 2363 | Ga0496100_0536201 | |||
| 2364 | Ga0496100_0956149 | |||
| 2365 | Ga0496100_1431507 | |||
| 2366 | Ga0496100_1572317 | |||
| 2367 | Ga0496101_0191749 | |||
| 2368 | Ga0496101_0420541 | |||
| 2369 | Ga0496102_0028096 | |||
| 2370 | Ga0496102_0069677 | |||
| 2371 | Ga0496102_0207279 | |||
| 2372 | Ga0496102_0374613 | |||
| 2373 | Ga0496102_1124164 | |||
| 2374 | Ga0496103_0179030 | |||
| 2375 | Ga0496103_0228643 | |||
| 2376 | Ga0496104_0001942 | |||
| 2377 | Ga0496105_0038675 | |||
| 2378 | Ga0496105_0137245 | |||
| 2379 | Ga0496105_0411382 | |||
| 2380 | Ga0496105_0542447 | |||
| 2381 | Ga0496106_0003395 | |||
| 2382 | Ga0496106_0034087 | |||
| 2383 | Ga0496106_0089222 | |||
| 2384 | Ga0496106_0196797 | |||
| 2385 | Ga0496106_0203841 | |||
| 2386 | Ga0496106_0347174 | |||
| 2387 | Ga0496106_0648786 | |||
| 2388 | Ga0496106_0916898 | |||
| 2389 | Ga0496107_0007662 | |||
| 2390 | Ga0496107_0096234 | |||
| 2391 | Ga0496107_0462601 | |||
| 2392 | Ga0496107_0987831 | |||
| 2393 | Ga0496108_0004397 | |||
| 2394 | Ga0496108_0029625 | |||
| 2395 | Ga0496108_0066759 | |||
| 2396 | Ga0496108_0427467 | |||
| 2397 | Ga0496108_0715708 | |||
| 2398 | Ga0496108_1007796 | |||
| 2399 | Ga0496108_1325997 | |||
| 2400 | Ga0496109_0003783 | |||
| 2401 | Ga0496109_0049151 | |||
| 2402 | Ga0496109_0084275 | |||
| 2403 | Ga0496109_0160470 | |||
| 2404 | Ga0496109_1894731 | |||
| 2405 | Ga0496110_0008810 | |||
| 2406 | Ga0496110_0047545 | |||
| 2407 | Ga0496110_0211714 | |||
| 2408 | Ga0496110_0256135 | |||
| 2409 | Ga0496110_0486024 | |||
| 2410 | Ga0496110_1326046 | |||
| 2411 | Ga0496111_0009446 | |||
| 2412 | Ga0496111_0013162 | |||
| 2413 | Ga0496111_0042251 | |||
| 2414 | Ga0496111_0072961 | |||
| 2415 | Ga0496111_1047855 | |||
| 2416 | Ga0496112_0070989 | |||
| 2417 | Ga0496112_0076375 | |||
| 2418 | Ga0496112_0098271 | |||
| 2419 | Ga0496112_0336580 | |||
| 2420 | Ga0496113_0046394 | |||
| 2421 | Ga0496113_0168713 | |||
| 2422 | Ga0496114_0293864 | |||
| 2423 | Ga0496114_0744443 | |||
| 2424 | Ga0496115_0019085 | |||
| 2425 | Ga0496121_0895015 | |||
| 2426 | Ga0496122_0245040 | |||
| 2427 | Ga0496126_0841011 | |||
| 2428 | Ga0501306_101553 | |||
| 2429 | Ga0501308_014011 | |||
| 2430 | Ga0501308_021415 | |||
| 2431 | Ga0501308_051846 | |||
| 2432 | Ga0501308_086363 | |||
| 2433 | Ga0501305_092585 | |||
| 2434 | Ga0501307_012450 | |||
| 2435 | Ga0495682_0362415 | |||
| 2436 | Ga0501291_166445 | |||
| 2437 | Ga0501311_004211 | |||
| 2438 | Ga0501311_011671 | |||
| 2439 | Ga0501311_054662 | |||
| 2440 | Ga0501311_074607 | |||
| 2441 | Ga0501312_038468 | |||
| 2442 | Ga0501315_023215 | |||
| 2443 | Ga0501315_040578 | |||
| 2444 | Ga0501317_082713 | |||
| 2445 | Ga0501318_001018 | |||
| 2446 | Ga0501318_003795 | |||
| 2447 | Ga0501321_007936 | |||
| 2448 | Ga0501321_018462 | |||
| 2449 | Ga0501321_069983 | |||
| 2450 | Ga0501325_001897 | |||
| 2451 | Ga0501325_001985 | |||
| 2452 | Ga0501325_017902 | |||
| 2453 | Ga0501329_16827 | |||
| 2454 | Ga0501031_0023483 | |||
| 2455 | Ga0501031_0901149 | |||
| 2456 | Ga0501032_0052260 | |||
| 2457 | Ga0501032_0307944 | |||
| 2458 | Ga0501033_0007388 | |||
| 2459 | Ga0501033_0147150 | |||
| 2460 | Ga0501034_0042646 | |||
| 2461 | Ga0501034_0071807 | |||
| 2462 | Ga0501036_0047556 | |||
| 2463 | Ga0501036_0049091 | |||
| 2464 | Ga0501036_0171983 | |||
| 2465 | Ga0501036_0255412 | |||
| 2466 | Ga0501037_0077521 | |||
| 2467 | Ga0501037_0725049 | |||
| 2468 | Ga0501037_1126678 | |||
| 2469 | Ga0501038_0001079 | |||
| 2470 | Ga0501038_0034050 | |||
| 2471 | Ga0501038_0545548 | |||
| 2472 | Ga0501039_0120994 | |||
| 2473 | Ga0501039_0203613 | |||
| 2474 | Ga0501039_0920492 | |||
| 2475 | Ga0501042_0059447 | |||
| 2476 | Ga0501042_0109869 | |||
| 2477 | Ga0501042_0828630 | |||
| 2478 | Ga0501043_0024370 | |||
| 2479 | Ga0501043_0185597 | |||
| 2480 | Ga0501043_0223253 | |||
| 2481 | Ga0501046_0041339 | |||
| 2482 | Ga0501047_0052072 | |||
| 2483 | Ga0501048_0051421 | |||
| 2484 | Ga0501048_0091402 | |||
| 2485 | Ga0501048_0798079 | |||
| 2486 | Ga0501067_0051694 | |||
| 2487 | Ga0501067_0260731 | |||
| 2488 | Ga0501068_0348196 | |||
| 2489 | Ga0501068_0754843 | |||
| 2490 | Ga0501068_0827420 | |||
| 2491 | Ga0501069_0150182 | |||
| 2492 | Ga0501069_0622417 | |||
| 2493 | Ga0501070_0319174 | |||
| 2494 | Ga0501070_0381825 | |||
| 2495 | Ga0501070_0547027 | |||
| 2496 | Ga0501070_1493524 | |||
| 2497 | Ga0501071_0058388 | |||
| 2498 | Ga0501071_0216372 | |||
| 2499 | Ga0501071_1373206 | |||
| 2500 | Ga0501072_0097294 | |||
| 2501 | Ga0501072_0168191 | |||
| 2502 | Ga0501072_0476709 | |||
| 2503 | Ga0501073_1194656 | |||
| 2504 | Ga0501074_0323500 | |||
| 2505 | Ga0501075_0037970 | |||
| 2506 | Ga0501076_0016442 | |||
| 2507 | Ga0501076_0141130 | |||
| 2508 | Ga0501076_0237550 | |||
| 2509 | Ga0501076_0273975 | |||
| 2510 | Ga0501077_0078396 | |||
| 2511 | Ga0501077_0702772 | |||
| 2512 | Ga0501221_216078 | |||
| 2513 | Ga0501079_0082392 | |||
| 2514 | Ga0501079_0226162 | |||
| 2515 | Ga0501081_0082339 | |||
| 2516 | Ga0501081_0306217 | |||
| 2517 | Ga0501083_0400704 | |||
| 2518 | Ga0501280_088980 | |||
| 2519 | Ga0501035_0036974 | |||
| 2520 | Ga0501035_0039260 | |||
| 2521 | Ga0501035_0327522 | |||
| 2522 | Ga0501035_1030741 | |||
| 2523 | Ga0501044_0016796 | |||
| 2524 | Ga0501044_0576948 | |||
| 2525 | Ga0501045_0103926 | |||
| 2526 | Ga0501045_0162626 | |||
| 2527 | Ga0501045_0256265 | |||
| 2528 | nmdc:mga0yw44_426241_c1 | |||
| 2529 | nmdc:mga05p37_1163961_c1 | |||
| 2530 | nmdc:mga05p37_715917_c1 | |||
| 2531 | nmdc:mga0qj67_428572_c2 | |||
| 2532 | nmdc:mga06r32_339037_c1 | |||
| 2533 | nmdc:mga08y16_1242772_c1 | |||
| 2534 | nmdc:mga08y16_1849565_c1 | |||
| 2535 | nmdc:mga08y16_196471_c1 | |||
| 2536 | nmdc:mga08y16_285749_c1 | |||
| 2537 | nmdc:mga08y16_67959_c1 | |||
| 2538 | nmdc:mga0n895_293134_c1 | |||
| 2539 | nmdc:mga0rr50_807485_c1 | |||
| 2540 | nmdc:mga0a205_1215050_c1 | |||
| 2541 | nmdc:mga0a205_291709_c1 | |||
| 2542 | Ga0495601_0151786 | |||
| 2543 | Ga0495655_0002245 | |||
| 2544 | Ga0495655_0043056 | |||
| 2545 | Ga0495655_0366240 | |||
| 2546 | Ga0500556_0000795 | |||
| 2547 | Ga0500652_259146 | |||
| 2548 | Ga0500588_0413632 | |||
| 2549 | Ga0500589_277848 | |||
| 2550 | Ga0500604_0058002 | |||
| 2551 | Ga0500616_0006750 | |||
| 2552 | Ga0500616_0019028 | |||
| 2553 | Ga0500616_0070509 | |||
| 2554 | Ga0500599_000599 | |||
| 2555 | Ga0501084_0125615 | |||
| 2556 | Ga0501084_0160909 | |||
| 2557 | Ga0501084_0228000 | |||
| 2558 | Ga0501084_0236930 | |||
| 2559 | Ga0587084_002055 | |||
| 2560 | Ga0587084_003660 | |||
| 2561 | Ga0587084_009573 | |||
| 2562 | Ga0587084_013874 | |||
| 2563 | Ga0587084_014910 | |||
| 2564 | Ga0587084_019828 | |||
| 2565 | Ga0587084_039621 | |||
| 2566 | Ga0587084_047051 | |||
| 2567 | Ga0587084_097922 | |||
| 2568 | Ga0587084_109442 | |||
| 2569 | Ga0587084_111349 | |||
| 2570 | Ga0587084_118767 | |||
| 2571 | Ga0587084_119440 | |||
| 2572 | Ga0587093_003172 | |||
| 2573 | Ga0587093_012761 | |||
| 2574 | Ga0587093_013733 | |||
| 2575 | Ga0587093_017042 | |||
| 2576 | Ga0587093_022758 | |||
| 2577 | Ga0587093_023948 | |||
| 2578 | Ga0587093_034077 | |||
| 2579 | Ga0587093_047461 | |||
| 2580 | Ga0587093_055045 | |||
| 2581 | Ga0587093_056664 | |||
| 2582 | Ga0587093_060095 | |||
| 2583 | Ga0587093_063100 | |||
| 2584 | Ga0587066_000991 | |||
| 2585 | Ga0587066_006908 | |||
| 2586 | Ga0587066_007921 | |||
| 2587 | Ga0587066_017346 | |||
| 2588 | Ga0587066_102556 | |||
| 2589 | Ga0587066_113046 | |||
| 2590 | Ga0587066_145128 | |||
| 2591 | Ga0587066_149429 | |||
| 2592 | Ga0587066_152284 | |||
| 2593 | Ga0587066_172249 | |||
| 2594 | Ga0587066_189410 | |||
| 2595 | Ga0587066_190848 | |||
| 2596 | Ga0587066_226182 | |||
| 2597 | Ga0587070_000518 | |||
| 2598 | Ga0587070_015780 | |||
| 2599 | Ga0587070_027402 | |||
| 2600 | Ga0587070_041652 | |||
| 2601 | Ga0587070_045163 | |||
| 2602 | Ga0587070_074895 | |||
| 2603 | Ga0587070_075993 | |||
| 2604 | Ga0587070_076079 | |||
| 2605 | Ga0587070_089163 | |||
| 2606 | Ga0587070_141789 | |||
| 2607 | Ga0587070_165846 | |||
| 2608 | Ga0587070_170806 | |||
| 2609 | Ga0587073_0002621 | |||
| 2610 | Ga0587073_0010685 | |||
| 2611 | Ga0587073_0014258 | |||
| 2612 | Ga0587073_0028145 | |||
| 2613 | Ga0587073_0065717 | |||
| 2614 | Ga0587073_0070705 | |||
| 2615 | Ga0587073_0088168 | |||
| 2616 | Ga0587073_0169030 | |||
| 2617 | Ga0587073_0184224 | |||
| 2618 | Ga0587073_0240939 | |||
| 2619 | Ga0587073_0247866 | |||
| 2620 | Ga0587073_0252309 | |||
| 2621 | Ga0587073_0294384 | |||
| 2622 | Ga0587073_0306433 | |||
| 2623 | Ga0587077_006352 | |||
| 2624 | Ga0587077_017451 | |||
| 2625 | Ga0587077_027933 | |||
| 2626 | Ga0587077_037489 | |||
| 2627 | Ga0587077_067252 | |||
| 2628 | Ga0587077_068909 | |||
| 2629 | Ga0587077_069421 | |||
| 2630 | Ga0587077_089792 | |||
| 2631 | Ga0587077_112682 | |||
| 2632 | Ga0587077_119469 | |||
| 2633 | Ga0587077_134889 | |||
| 2634 | Ga0587077_170803 | |||
| 2635 | Ga0587077_186729 | |||
| 2636 | Ga0587077_195201 | |||
| 2637 | Ga0587077_268703 | |||
| 2638 | Ga0587080_001432 | |||
| 2639 | Ga0587080_006193 | |||
| 2640 | Ga0587080_017952 | |||
| 2641 | Ga0587080_018687 | |||
| 2642 | Ga0587080_038060 | |||
| 2643 | Ga0587080_040393 | |||
| 2644 | Ga0587080_048491 | |||
| 2645 | Ga0587080_056586 | |||
| 2646 | Ga0587080_060521 | |||
| 2647 | Ga0587080_076416 | |||
| 2648 | Ga0587080_077941 | |||
| 2649 | Ga0587080_081553 | |||
| 2650 | Ga0587080_088942 | |||
| 2651 | Ga0587080_117060 | |||
| 2652 | Ga0587082_001111 | |||
| 2653 | Ga0587082_004844 | |||
| 2654 | Ga0587082_009673 | |||
| 2655 | Ga0587082_010472 | |||
| 2656 | Ga0587082_013344 | |||
| 2657 | Ga0587082_015319 | |||
| 2658 | Ga0587082_018137 | |||
| 2659 | Ga0587082_021999 | |||
| 2660 | Ga0587082_030084 | |||
| 2661 | Ga0587082_041570 | |||
| 2662 | Ga0587082_045566 | |||
| 2663 | Ga0587082_049528 | |||
| 2664 | Ga0587082_105971 | |||
| 2665 | Ga0587082_118390 | |||
| 2666 | Ga0587082_135994 | |||
| 2667 | Ga0587082_143228 | |||
| 2668 | Ga0587082_154109 | |||
| 2669 | Ga0587082_188488 | |||
| 2670 | Ga0587083_0001379 | |||
| 2671 | Ga0587083_0006855 | |||
| 2672 | Ga0587083_0011164 | |||
| 2673 | Ga0587083_0042637 | |||
| 2674 | Ga0587083_0070280 | |||
| 2675 | Ga0587083_0073650 | |||
| 2676 | Ga0587083_0078531 | |||
| 2677 | Ga0587083_0095407 | |||
| 2678 | Ga0587083_0095757 | |||
| 2679 | Ga0587083_0152895 | |||
| 2680 | Ga0587083_0153467 | |||
| 2681 | Ga0587083_0154286 | |||
| 2682 | Ga0587083_0189731 | |||
| 2683 | Ga0587083_0199813 | |||
| 2684 | Ga0587083_0236452 | |||
| 2685 | Ga0587085_001378 | |||
| 2686 | Ga0587085_003216 | |||
| 2687 | Ga0587085_005971 | |||
| 2688 | Ga0587085_006596 | |||
| 2689 | Ga0587085_016647 | |||
| 2690 | Ga0587085_017025 | |||
| 2691 | Ga0587085_027271 | |||
| 2692 | Ga0587085_047544 | |||
| 2693 | Ga0587085_048064 | |||
| 2694 | Ga0587085_049374 | |||
| 2695 | Ga0587085_086528 | |||
| 2696 | Ga0587085_088692 | |||
| 2697 | Ga0587085_093283 | |||
| 2698 | Ga0587085_098081 | |||
| 2699 | Ga0587085_099099 | |||
| 2700 | Ga0587085_105327 | |||
| 2701 | Ga0587085_105371 | |||
| 2702 | Ga0587086_000408 | |||
| 2703 | Ga0587086_005146 | |||
| 2704 | Ga0587086_005932 | |||
| 2705 | Ga0587086_008361 | |||
| 2706 | Ga0587086_012257 | |||
| 2707 | Ga0587086_012570 | |||
| 2708 | Ga0587086_012832 | |||
| 2709 | Ga0587086_014606 | |||
| 2710 | Ga0587086_020108 | |||
| 2711 | Ga0587086_032746 | |||
| 2712 | Ga0587086_037365 | |||
| 2713 | Ga0587086_043191 | |||
| 2714 | Ga0587086_056206 | |||
| 2715 | Ga0587086_057662 | |||
| 2716 | Ga0587086_060283 | |||
| 2717 | Ga0587086_061017 | |||
| 2718 | Ga0587086_063111 | |||
| 2719 | Ga0587086_079563 | |||
| 2720 | Ga0587086_087548 | |||
| 2721 | Ga0587086_115562 | |||
| 2722 | Ga0587088_001042 | |||
| 2723 | Ga0587088_006273 | |||
| 2724 | Ga0587088_013179 | |||
| 2725 | Ga0587088_017968 | |||
| 2726 | Ga0587088_022812 | |||
| 2727 | Ga0587088_048841 | |||
| 2728 | Ga0587088_052035 | |||
| 2729 | Ga0587088_054429 | |||
| 2730 | Ga0587088_057035 | |||
| 2731 | Ga0587088_061253 | |||
| 2732 | Ga0587088_075191 | |||
| 2733 | Ga0587088_083279 | |||
| 2734 | Ga0587088_090946 | |||
| 2735 | Ga0587088_117280 | |||
| 2736 | Ga0587088_144040 | |||
| 2737 | Ga0587088_145770 | |||
| 2738 | Ga0587088_166442 | |||
| 2739 | Ga0587088_193201 | |||
| 2740 | Ga0587088_205416 | |||
| 2741 | Ga0587089_004290 | |||
| 2742 | Ga0587089_015444 | |||
| 2743 | Ga0587089_019399 | |||
| 2744 | Ga0587089_025444 | |||
| 2745 | Ga0587089_045265 | |||
| 2746 | Ga0587089_055838 | |||
| 2747 | Ga0587089_071133 | |||
| 2748 | Ga0587089_071646 | |||
| 2749 | Ga0587089_075152 | |||
| 2750 | Ga0587090_005126 | |||
| 2751 | Ga0587090_005193 | |||
| 2752 | Ga0587090_005325 | |||
| 2753 | Ga0587090_049008 | |||
| 2754 | Ga0587090_074004 | |||
| 2755 | Ga0587090_075476 | |||
| 2756 | Ga0587090_094876 | |||
| 2757 | Ga0587090_127665 | |||
| 2758 | Ga0587091_002505 | |||
| 2759 | Ga0587091_008700 | |||
| 2760 | Ga0587091_018026 | |||
| 2761 | Ga0587091_021312 | |||
| 2762 | Ga0587091_034332 | |||
| 2763 | Ga0587091_048831 | |||
| 2764 | Ga0587091_050337 | |||
| 2765 | Ga0587091_074737 | |||
| 2766 | Ga0587091_075465 | |||
| 2767 | Ga0587091_089238 | |||
| 2768 | Ga0587091_091133 | |||
| 2769 | Ga0587091_103726 | |||
| 2770 | Ga0587091_116421 | |||
| 2771 | Ga0587091_132112 | |||
| 2772 | Ga0587091_206281 | |||
| 2773 | Ga0587092_002129 | |||
| 2774 | Ga0587092_029016 | |||
| 2775 | Ga0587092_030847 | |||
| 2776 | Ga0587092_032419 | |||
| 2777 | Ga0587092_042202 | |||
| 2778 | Ga0587092_101496 | |||
| 2779 | Ga0587092_103414 | |||
| 2780 | Ga0587092_159350 | |||
| 2781 | Ga0587094_004792 | |||
| 2782 | Ga0587094_018680 | |||
| 2783 | Ga0587094_023287 | |||
| 2784 | Ga0587094_029836 | |||
| 2785 | Ga0587094_052605 | |||
| 2786 | Ga0587094_066133 | |||
| 2787 | Ga0587094_077640 | |||
| 2788 | Ga0587094_109586 | |||
| 2789 | Ga0587094_124374 | |||
| 2790 | Ga0587094_127555 | |||
| 2791 | Ga0587095_000831 | |||
| 2792 | Ga0587095_002808 | |||
| 2793 | Ga0587095_005790 | |||
| 2794 | Ga0587095_019725 | |||
| 2795 | Ga0587095_021141 | |||
| 2796 | Ga0587095_022555 | |||
| 2797 | Ga0587097_04508 | |||
| 2798 | Ga0587097_05058 | |||
| 2799 | Ga0587098_002988 | |||
| 2800 | Ga0587098_005150 | |||
| 2801 | Ga0587098_033869 | |||
| 2802 | Ga0587098_050618 | |||
| 2803 | Ga0587106_002015 | |||
| 2804 | Ga0587106_003903 | |||
| 2805 | Ga0587106_016693 | |||
| 2806 | Ga0587106_027646 | |||
| 2807 | Ga0587106_041694 | |||
| 2808 | Ga0587106_062531 | |||
| 2809 | Ga0587106_110024 | |||
| 2810 | Ga0587106_139145 | |||
| 2811 | Ga0587121_09004 | |||
| 2812 | Ga0587125_001367 | |||
| 2813 | Ga0587125_007431 | |||
| 2814 | Ga0587125_008670 | |||
| 2815 | Ga0587125_008709 | |||
| 2816 | Ga0587125_010054 | |||
| 2817 | Ga0587125_057886 | |||
| 2818 | Ga0587125_079621 | |||
| 2819 | Ga0587129_005518 | |||
| 2820 | Ga0587129_007589 | |||
| 2821 | Ga0587129_009139 | |||
| 2822 | Ga0587129_010014 | |||
| 2823 | Ga0587129_022676 | |||
| 2824 | Ga0587131_001126 | |||
| 2825 | Ga0587131_013108 | |||
| 2826 | Ga0587099_000608 | |||
| 2827 | Ga0587099_011787 | |||
| 2828 | Ga0587099_013191 | |||
| 2829 | Ga0587099_018936 | |||
| 2830 | Ga0587099_025886 | |||
| 2831 | Ga0587099_046410 | |||
| 2832 | Ga0587099_050321 | |||
| 2833 | Ga0587099_054770 | |||
| 2834 | Ga0587099_059533 | |||
| 2835 | Ga0587099_059763 | |||
| 2836 | Ga0587099_062389 | |||
| 2837 | Ga0587101_005266 | |||
| 2838 | Ga0587101_012858 | |||
| 2839 | Ga0587101_017226 | |||
| 2840 | Ga0587101_022110 | |||
| 2841 | Ga0587101_022480 | |||
| 2842 | Ga0587101_027769 | |||
| 2843 | Ga0587101_033011 | |||
| 2844 | Ga0587101_117599 | |||
| 2845 | Ga0587101_123985 | |||
| 2846 | Ga0587109_007537 | |||
| 2847 | Ga0587109_017415 | |||
| 2848 | Ga0587109_048179 | |||
| 2849 | Ga0587109_066185 | |||
| 2850 | Ga0587109_072152 | |||
| 2851 | Ga0587109_092590 | |||
| 2852 | Ga0587109_133232 | |||
| 2853 | Ga0587109_165335 | |||
| 2854 | Ga0587109_202801 | |||
| 2855 | Ga0587113_005567 | |||
| 2856 | Ga0587113_007174 | |||
| 2857 | Ga0587113_015837 | |||
| 2858 | Ga0587113_032049 | |||
| 2859 | Ga0587113_037226 | |||
| 2860 | Ga0587115_002485 | |||
| 2861 | Ga0587115_003264 | |||
| 2862 | Ga0587115_010849 | |||
| 2863 | Ga0587115_022387 | |||
| 2864 | Ga0587115_025173 | |||
| 2865 | Ga0587115_062328 | |||
| 2866 | Ga0587115_068568 | |||
| 2867 | Ga0587115_080511 | |||
| 2868 | Ga0587115_096174 | |||
| 2869 | Ga0587117_004775 | |||
| 2870 | Ga0587117_004960 | |||
| 2871 | Ga0587117_034019 | |||
| 2872 | Ga0587117_038117 | |||
| 2873 | Ga0587117_055042 | |||
| 2874 | Ga0587117_084311 | |||
| 2875 | Ga0587117_084439 | |||
| 2876 | Ga0587117_096261 | |||
| 2877 | Ga0587117_128286 | |||
| 2878 | Ga0587122_006423 | |||
| 2879 | Ga0587122_024214 | |||
| 2880 | Ga0587122_027635 | |||
| 2881 | Ga0587127_012912 | |||
| 2882 | Ga0587127_013803 | |||
| 2883 | Ga0587127_020843 | |||
| 2884 | Ga0587127_020846 | |||
| 2885 | Ga0587128_000231 | |||
| 2886 | Ga0587128_002976 | |||
| 2887 | Ga0587128_019167 | |||
| 2888 | Ga0587128_023505 | |||
| 2889 | Ga0587128_025419 | |||
| 2890 | Ga0587128_037450 | |||
| 2891 | Ga0587128_044396 | |||
| 2892 | Ga0587128_094006 | |||
| 2893 | Ga0587130_009508 | |||
| 2894 | Ga0587130_015055 | |||
| 2895 | Ga0587062_003510 | |||
| 2896 | Ga0587062_014697 | |||
| 2897 | Ga0587062_032954 | |||
| 2898 | Ga0587062_036146 | |||
| 2899 | Ga0587062_040297 | |||
| 2900 | Ga0587062_078730 | |||
| 2901 | Ga0587062_108832 | |||
| 2902 | Ga0587062_125905 | |||
| 2903 | Ga0587067_008983 | |||
| 2904 | Ga0587067_042822 | |||
| 2905 | Ga0587067_045468 | |||
| 2906 | Ga0587067_053094 | |||
| 2907 | Ga0587067_055569 | |||
| 2908 | Ga0587067_067753 | |||
| 2909 | Ga0587067_097622 | |||
| 2910 | Ga0587067_104445 | |||
| 2911 | Ga0587067_160563 | |||
| 2912 | Ga0587067_191387 | |||
| 2913 | Ga0587068_006412 | |||
| 2914 | Ga0587068_007578 | |||
| 2915 | Ga0587068_011196 | |||
| 2916 | Ga0587068_016956 | |||
| 2917 | Ga0587068_024329 | |||
| 2918 | Ga0587068_027484 | |||
| 2919 | Ga0587068_031544 | |||
| 2920 | Ga0587068_054018 | |||
| 2921 | Ga0587068_084048 | |||
| 2922 | Ga0587068_105858 | |||
| 2923 | Ga0587068_115752 | |||
| 2924 | Ga0587068_172780 | |||
| 2925 | Ga0587069_000423 | |||
| 2926 | Ga0587069_022579 | |||
| 2927 | Ga0587069_025016 | |||
| 2928 | Ga0587069_038770 | |||
| 2929 | Ga0587069_063709 | |||
| 2930 | Ga0587069_065948 | |||
| 2931 | Ga0587069_078342 | |||
| 2932 | Ga0587069_094022 | |||
| 2933 | Ga0587069_098278 | |||
| 2934 | Ga0587069_101177 | |||
| 2935 | Ga0587069_119762 | |||
| 2936 | Ga0587069_155105 | |||
| 2937 | Ga0587072_007163 | |||
| 2938 | Ga0587072_010385 | |||
| 2939 | Ga0587072_032506 | |||
| 2940 | Ga0587072_040730 | |||
| 2941 | Ga0587072_052886 | |||
| 2942 | Ga0587072_082533 | |||
| 2943 | Ga0587072_103157 | |||
| 2944 | Ga0587072_132483 | |||
| 2945 | Ga0587072_151346 | |||
| 2946 | Ga0587075_000942 | |||
| 2947 | Ga0587075_001141 | |||
| 2948 | Ga0587075_015215 | |||
| 2949 | Ga0587075_020016 | |||
| 2950 | Ga0587075_026001 | |||
| 2951 | Ga0587075_048705 | |||
| 2952 | Ga0587075_065329 | |||
| 2953 | Ga0587075_083329 | |||
| 2954 | Ga0587075_107925 | |||
| 2955 | Ga0587075_119878 | |||
| 2956 | Ga0587076_001738 | |||
| 2957 | Ga0587076_002239 | |||
| 2958 | Ga0587076_003512 | |||
| 2959 | Ga0587076_018915 | |||
| 2960 | Ga0587076_018999 | |||
| 2961 | Ga0587076_032650 | |||
| 2962 | Ga0587076_034114 | |||
| 2963 | Ga0587076_048973 | |||
| 2964 | Ga0587076_056070 | |||
| 2965 | Ga0587076_088978 | |||
| 2966 | Ga0587076_097806 | |||
| 2967 | Ga0587076_107574 | |||
| 2968 | Ga0587078_002836 | |||
| 2969 | Ga0587078_026198 | |||
| 2970 | Ga0587078_035613 | |||
| 2971 | Ga0587078_053953 | |||
| 2972 | Ga0587078_060681 | |||
| 2973 | Ga0587078_083937 | |||
| 2974 | Ga0587078_086781 | |||
| 2975 | Ga0587079_001277 | |||
| 2976 | Ga0587079_007543 | |||
| 2977 | Ga0587079_008150 | |||
| 2978 | Ga0587079_008584 | |||
| 2979 | Ga0587079_013901 | |||
| 2980 | Ga0587079_019197 | |||
| 2981 | Ga0587079_020407 | |||
| 2982 | Ga0587079_024036 | |||
| 2983 | Ga0587079_041959 | |||
| 2984 | Ga0587079_049661 | |||
| 2985 | Ga0587079_080950 | |||
| 2986 | Ga0587079_083553 | |||
| 2987 | Ga0587079_083715 | |||
| 2988 | Ga0587079_091965 | |||
| 2989 | Ga0587079_104607 | |||
| 2990 | Ga0587079_106599 | |||
| 2991 | Ga0587079_116810 | |||
| 2992 | Ga0587079_130581 | |||
| 2993 | Ga0587079_160316 | |||
| 2994 | Ga0587079_213699 | |||
| 2995 | Ga0587079_234985 | |||
| 2996 | Ga0587100_001025 | |||
| 2997 | Ga0587100_001642 | |||
| 2998 | Ga0587100_002716 | |||
| 2999 | Ga0587100_003045 | |||
| 3000 | Ga0587100_039625 | |||
| 3001 | Ga0587100_046374 | |||
| 3002 | Ga0587102_002171 | |||
| 3003 | Ga0587102_004939 | |||
| 3004 | Ga0587102_016609 | |||
| 3005 | Ga0587102_018048 | |||
| 3006 | Ga0587102_019065 | |||
| 3007 | Ga0587102_023351 | |||
| 3008 | Ga0587102_030170 | |||
| 3009 | Ga0587102_044030 | |||
| 3010 | Ga0587102_046947 | |||
| 3011 | Ga0587104_006205 | |||
| 3012 | Ga0587104_010995 | |||
| 3013 | Ga0587105_011039 | |||
| 3014 | Ga0587105_021148 | |||
| 3015 | Ga0587105_031492 | |||
| 3016 | Ga0587107_001773 | |||
| 3017 | Ga0587107_005621 | |||
| 3018 | Ga0587107_009040 | |||
| 3019 | Ga0587107_026966 | |||
| 3020 | Ga0587107_056122 | |||
| 3021 | Ga0587107_056366 | |||
| 3022 | Ga0587107_058032 | |||
| 3023 | Ga0587107_074147 | |||
| 3024 | Ga0587108_020281 | |||
| 3025 | Ga0587108_027844 | |||
| 3026 | Ga0587108_039353 | |||
| 3027 | Ga0587110_003344 | |||
| 3028 | Ga0587110_019685 | |||
| 3029 | Ga0587110_028756 | |||
| 3030 | Ga0587114_001018 | |||
| 3031 | Ga0587114_006659 | |||
| 3032 | Ga0587114_021119 | |||
| 3033 | Ga0587114_059950 | |||
| 3034 | Ga0587114_084231 | |||
| 3035 | Ga0587116_01217 | |||
| 3036 | Ga0587116_17275 | |||
| 3037 | Ga0587119_001808 | |||
| 3038 | Ga0587119_005015 | |||
| 3039 | Ga0587119_008110 | |||
| 3040 | Ga0587119_015334 | |||
| 3041 | Ga0587119_045009 | |||
| 3042 | Ga0587119_068161 | |||
| 3043 | Ga0587119_079085 | |||
| 3044 | Ga0587120_003320 | |||
| 3045 | Ga0587120_016986 | |||
| 3046 | Ga0587120_022896 | |||
| 3047 | Ga0587071_003723 | |||
| 3048 | Ga0587071_009573 | |||
| 3049 | Ga0587071_011816 | |||
| 3050 | Ga0587071_012420 | |||
| 3051 | Ga0587071_042401 | |||
| 3052 | Ga0587071_073640 | |||
| 3053 | Ga0587071_086010 | |||
| 3054 | Ga0587071_103454 | |||
| 3055 | Ga0587071_105515 | |||
| 3056 | Ga0587071_106314 | |||
| 3057 | Ga0587071_109830 | |||
| 3058 | Ga0587071_110550 | |||
| 3059 | Ga0587071_224144 | |||
| 3060 | Ga0587111_0002392 | |||
| 3061 | Ga0587111_0004349 | |||
| 3062 | Ga0587111_0006892 | |||
| 3063 | Ga0587111_0010132 | |||
| 3064 | Ga0587111_0010639 | |||
| 3065 | Ga0587111_0010952 | |||
| 3066 | Ga0587111_0012560 | |||
| 3067 | Ga0587111_0016715 | |||
| 3068 | Ga0587111_0025685 | |||
| 3069 | Ga0587111_0029964 | |||
| 3070 | Ga0587111_0032277 | |||
| 3071 | Ga0587111_0070436 | |||
| 3072 | Ga0587111_0073385 | |||
| 3073 | Ga0587111_0082601 | |||
| 3074 | Ga0587111_0083066 | |||
| 3075 | Ga0587111_0149340 | |||
| 3076 | Ga0587111_0164445 | |||
| 3077 | Ga0587111_0167768 | |||
| 3078 | Ga0587111_0186118 | |||
| 3079 | Ga0587111_0192093 | |||
| 3080 | Ga0587111_0196665 | |||
| 3081 | Ga0587111_0205514 | |||
| 3082 | Ga0587111_0254075 | |||
| 3083 | Ga0501082_0116201 | |||
| 3084 | Ga0501082_0469068 | |||
| 3085 | Ga0466962_0016446 | |||
| 3086 | Ga0466962_0066031 | |||
| 3087 | Ga0466962_0089480 | |||
| 3088 | Ga0466962_0601038 | |||
| 3089 | Ga0530510_0051747 | |||
| 3090 | 2528205978 | |||
| 3091 | 2528215642 | |||
| 3092 | 2546951158 | |||
| 3093 | 2558906592 | |||
| 3094 | 2579750830 | |||
| 3095 | 2734968320 | |||
| 3096 | 2774866829 | |||
| 3097 | 2795785159 | |||
| 3098 | 3003003853 | |||
| 3099 | 637879847 | |||
| 3100 | 8054474609 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2inn-assembly1.cif.gz_L | structure of the phenol hydroxyalse-regulatory protein complex | 0.8904 | 13 | 98 |
| 2bf3-assembly1.cif.gz_A | crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing ten n-terminal residues (delta-n10 t4mod) | 0.8832 | 13 | 96 |
| 7s6s-assembly1.cif.gz_D | complex structure of methane monooxygenase hydroxylase and regulatory subunit dbl1 | 0.8747 | 11 | 99 |
| 6yd0-assembly1.cif.gz_G | xfel structure of the soluble methane monooxygenase hydroxylase and regulatory subunit complex, from methylosinus trichosporium ob3b, diferric state | 0.8735 | 11 | 99 |
| 2inn-assembly1.cif.gz_L | structure of the phenol hydroxyalse-regulatory protein complex | 0.8718 | 13 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F8M0_152_249_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9205 | 37 | 50 | 2.60.40.10 |
| 2innL00 | Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM | 0.8803 | 13 | 98 | 3.90.56.10 |
| 2bf5B00 | Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM | 0.8767 | 13 | 99 | 3.90.56.10 |
| 4gamI00 | Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM | 0.8665 | 11 | 98 | 3.90.56.10 |
| 2inpL00 | Alpha Beta;Alpha-Beta Complex;Phenol Hydroxylase P2 Protein;Monooxygenase component MmoB/DmpM | 0.8643 | 13 | 96 | 3.90.56.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535ZU68-F1-model_v4 | Monooxygenase | 0.986 | 18 | 101 |
GO:0004497
|
| AF-A0A6N7YSN1-F1-model_v4 | Monooxygenase | 0.9653 | 13 | 107 |
GO:0004497
|
| AF-A0A349M0P0-F1-model_v4 | Monooxygenase | 0.9638 | 18 | 113 |
GO:0004497
|
| AF-Q768T2-F1-model_v4 | Propane 2-monooxygenase, effector component (Prm) (Propane 2-monooxygenase, coupling protein component) | 0.9549 | 3 | 113 |
GO:0004497
|
| AF-A0A523PBT7-F1-model_v4 | Monooxygenase | 0.9548 | 8 | 105 |
GO:0004497
|