F494589

General Info

Members Datasets Scaffolds Average Seq Length
1529 533 1506 199

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10464690|Ga0105237_104646901
Length 240
Sequence MFVRRAAHRWSCYDAHGRRKAWGKRMLQSFTPSLLPAYAAALAFGYLCGSVPFGLIITRLAGTRDIRSIGSGNIGATNVLRTGRKGLAAATLVGDALKGTFAVLAIYYYYGPEYRYFAHDLAIPAAFGAFLGHLFPVWLGFKGGKGVATYIGLLLALAWPVAIAFCLVWLAVAAATRYSSLAALVASAATPFALWLLGYWPEPALFALLTALLWIMHRANIARLVNGTEGKIGKTTASET

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
4 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
5 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
6 2773857925 Microvirga vignae BR3299 Isolate Unclassified
7 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
8 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
9 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
10 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
11 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
12 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
13 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
14 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
15 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
16 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
17 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
18 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
19 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
20 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
21 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
22 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
23 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
24 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
25 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
26 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
27 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
28 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
29 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
30 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
34 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
35 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
36 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
37 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
38 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
39 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
40 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
90 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
91 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
92 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
124 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
132 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
133 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
134 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
135 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
136 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
137 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
145 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
146 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
147 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
150 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
152 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
153 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
154 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
155 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
156 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
157 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
159 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
160 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
172 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
173 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
174 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
175 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
176 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
177 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
178 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
193 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
194 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
275 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
279 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
280 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
285 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
286 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
287 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
288 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
289 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
290 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
291 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
292 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
293 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
294 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
295 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
298 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
299 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
300 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
301 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
302 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
303 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
304 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
305 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
306 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
307 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
308 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
309 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
310 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
311 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
312 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
313 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
314 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
315 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
317 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
318 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
319 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
320 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
321 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
322 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
323 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
324 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
325 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
326 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
327 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
328 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
329 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
330 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
332 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
333 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
334 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
335 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
338 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
339 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
340 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
341 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
342 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
343 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
344 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
345 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
346 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
347 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
350 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
351 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
352 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
353 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
354 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
355 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
356 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
357 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
360 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
362 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
363 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
364 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
365 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
366 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
367 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
368 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
369 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
370 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
371 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
372 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
373 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
374 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
375 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
376 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
377 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
378 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
379 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
380 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
381 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
384 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
385 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
386 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
387 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
388 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
389 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
390 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
391 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
392 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
395 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
396 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
397 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
398 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
399 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
400 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
401 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
402 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
407 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
408 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
409 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
410 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
411 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
412 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
413 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
414 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
415 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
416 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
417 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
418 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
419 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
420 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
421 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
422 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
423 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
424 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
425 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
426 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
427 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
428 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
429 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
432 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
433 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
434 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
435 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
437 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
438 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
439 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
440 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
441 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
442 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
443 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
444 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
445 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
446 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
447 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
453 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
454 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
455 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
456 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
458 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
474 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
475 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
476 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
477 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
478 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
479 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
480 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
481 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
482 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
483 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
484 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
485 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
486 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
487 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
490 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
491 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
492 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
493 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
494 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
495 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
496 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
497 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
498 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
499 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
500 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
501 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
502 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
503 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
504 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
505 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
506 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
507 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
508 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
509 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
510 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
511 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
512 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
513 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
514 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
515 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
516 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
517 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
518 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
519 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
520 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
521 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
522 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
523 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
524 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
525 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
526 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
527 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
528 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
529 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
530 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
531 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
532 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
533 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0.13
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0.39
Rhizoplane 8.11
Rhizosphere 85.02
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214856315 2209111006 Bacteria 8009
2 ARcpr5oldR_c000202 3300000041 Bacteria 10028
3 ARSoilYngRDRAFT_c00201 3300000042 Bacteria 9997
4 ARcpr5yngRDRAFT_c000176 3300000043 Bacteria 10012
5 ARSoilOldRDRAFT_c000187 3300000044 Bacteria 10022
6 ARCol0oldRDRAFT_c02347 3300000045 Bacteria 870
7 ARCol0yngRDRAFT_1000204 3300000652 Bacteria 10000
8 JGI24032J14994_100577 3300001430 Bacteria 1912
9 JGI24752J21851_1004412 3300001976 Bacteria 1845
10 JGI24746J21847_1002942 3300001977 Bacteria 2681
11 JGI24739J22299_10012807 3300001989 Bacteria 3074
12 JGI24737J22298_10003419 3300001990 Bacteria 5615
13 JGI24737J22298_10031013 3300001990 Bacteria 1670
14 JGI24743J22301_10004649 3300001991 Bacteria 2248
15 JGI24750J21931_1002092 3300002070 Bacteria 2428
16 JGI24748J21848_1003313 3300002074 Bacteria 1837
17 JGI24738J21930_10002133 3300002075 Bacteria 5275
18 JGI24738J21930_10002848 3300002075 Bacteria 4431
19 JGI24738J21930_10011716 3300002075 Bacteria 1924
20 JGI24744J21845_10013759 3300002077 Bacteria 1630
21 JGI24033J26618_1002523 3300002155 Bacteria 1880
22 JGI24034J26672_10001569 3300002239 Bacteria 3046
23 JGI24034J26672_10004883 3300002239 Bacteria 1910
24 JGI24742J22300_10006556 3300002244 Bacteria 1921
25 JGI24742J22300_10007189 3300002244 Bacteria 1836
26 Ga0006562J51391_1072694 3300003578 Bacteria 5040
27 Ga0065716_1002368 3300005277 Bacteria 1848
28 Ga0065704_10005364 3300005289 Bacteria 3677
29 Ga0065712_10002565 3300005290 Bacteria 10146
30 Ga0065715_10000602 3300005293 Bacteria 13727
31 Ga0065715_10000779 3300005293 Bacteria 11809
32 Ga0065707_10119681 3300005295 Bacteria 2153
33 Ga0065707_10519568 3300005295 Bacteria 743
34 Ga0070658_10304524 3300005327 Bacteria 1359
35 Ga0070658_10542866 3300005327 Bacteria 1006
36 Ga0070676_10000170 3300005328 Bacteria 26484
37 Ga0070676_10048243 3300005328 Bacteria 2489
38 Ga0070676_10055775 3300005328 Bacteria 2333
39 Ga0070683_100007194 3300005329 Bacteria 9385
40 Ga0070683_100025517 3300005329 Bacteria 5309
41 Ga0070683_100267388 3300005329 Bacteria 1626
42 Ga0070683_100776329 3300005329 Bacteria 918
43 Ga0070690_100000533 3300005330 Bacteria 19053
44 Ga0070690_100007785 3300005330 Bacteria 6140
45 Ga0070690_100037856 3300005330 Bacteria 3041
46 Ga0070690_100375674 3300005330 Bacteria 1038
47 Ga0070670_100001563 3300005331 Bacteria 18448
48 Ga0070670_100007710 3300005331 Bacteria 9151
49 Ga0070670_100018981 3300005331 Bacteria 5897
50 Ga0070670_100183906 3300005331 Bacteria 1814
51 Ga0070677_10000320 3300005333 Bacteria 16762
52 Ga0068869_100000181 3300005334 Bacteria 32256
53 Ga0068869_100014062 3300005334 Bacteria 5341
54 Ga0068869_100023059 3300005334 Bacteria 4294
55 Ga0068869_100079064 3300005334 Bacteria 2450
56 Ga0068869_100081008 3300005334 Bacteria 2423
57 Ga0068869_100464313 3300005334 Bacteria 1051
58 Ga0068869_100555443 3300005334 Bacteria 965
59 Ga0068869_100580816 3300005334 Bacteria 945
60 Ga0068869_100956081 3300005334 Bacteria 744
61 Ga0070666_10000893 3300005335 Bacteria 18149
62 Ga0070666_10021002 3300005335 Bacteria 4228
63 Ga0070666_10109278 3300005335 Bacteria 1911
64 Ga0070666_10336369 3300005335 Bacteria 1079
65 Ga0070680_100016082 3300005336 Bacteria 5878
66 Ga0070680_100203803 3300005336 Bacteria 1668
67 Ga0070680_100359363 3300005336 Bacteria 1239
68 Ga0070680_100397581 3300005336 Bacteria 1174
69 Ga0070680_100650272 3300005336 Bacteria 906
70 Ga0070682_100000573 3300005337 Bacteria 22607
71 Ga0070682_100000903 3300005337 Bacteria 17347
72 Ga0070682_100016960 3300005337 Bacteria 4240
73 Ga0070682_100044961 3300005337 Bacteria 2735
74 Ga0070682_100171307 3300005337 Bacteria 1509
75 Ga0068868_100000287 3300005338 Bacteria 33828
76 Ga0068868_100002842 3300005338 Bacteria 11998
77 Ga0068868_100053941 3300005338 Bacteria 3167
78 Ga0068868_100078297 3300005338 Bacteria 2646
79 Ga0068868_100143378 3300005338 Bacteria 1963
80 Ga0068868_100511377 3300005338 Bacteria 1053
81 Ga0070660_100003177 3300005339 Bacteria 11288
82 Ga0070660_100023149 3300005339 Bacteria 4601
83 Ga0070660_100379450 3300005339 Bacteria 1167
84 Ga0070689_100000136 3300005340 Bacteria 42853
85 Ga0070689_100001256 3300005340 Bacteria 16143
86 Ga0070689_100018095 3300005340 Bacteria 5184
87 Ga0070689_100549246 3300005340 Bacteria 995
88 Ga0070691_10000085 3300005341 Bacteria 26262
89 Ga0070691_10000418 3300005341 Bacteria 15566
90 Ga0070691_10323580 3300005341 Bacteria 849
91 Ga0070687_100002615 3300005343 Bacteria 6803
92 Ga0070687_100011861 3300005343 Bacteria 3828
93 Ga0070687_100219702 3300005343 Bacteria 1163
94 Ga0070661_100002616 3300005344 Bacteria 12337
95 Ga0070661_100520801 3300005344 Bacteria 954
96 Ga0070661_100705230 3300005344 Bacteria 822
97 Ga0070661_100894393 3300005344 Bacteria 733
98 Ga0070692_10002091 3300005345 Bacteria 7619
99 Ga0070692_10010746 3300005345 Bacteria 4180
100 Ga0070692_10083630 3300005345 Bacteria 1723
101 Ga0070668_100000188 3300005347 Bacteria 40404
102 Ga0070668_100001169 3300005347 Bacteria 18553
103 Ga0070668_100303584 3300005347 Bacteria 1339
104 Ga0070668_100639276 3300005347 Bacteria 934
105 Ga0070669_100001556 3300005353 Bacteria 16608
106 Ga0070669_100019772 3300005353 Bacteria 4812
107 Ga0070669_100023221 3300005353 Bacteria 4441
108 Ga0070669_101043520 3300005353 Bacteria 703
109 Ga0070675_100038119 3300005354 Bacteria 3916
110 Ga0070675_100045291 3300005354 Bacteria 3599
111 Ga0070675_100049831 3300005354 Bacteria 3438
112 Ga0070671_100005621 3300005355 Bacteria 9984
113 Ga0070671_100008445 3300005355 Bacteria 8256
114 Ga0070671_100085669 3300005355 Bacteria 2636
115 Ga0070671_100484614 3300005355 Bacteria 1063
116 Ga0070671_100619743 3300005355 Bacteria 936
117 Ga0070671_101024128 3300005355 Bacteria 724
118 Ga0070674_100032220 3300005356 Bacteria 3479
119 Ga0070674_100039583 3300005356 Bacteria 3184
120 Ga0070674_100044252 3300005356 Bacteria 3034
121 Ga0070674_100216926 3300005356 Bacteria 1486
122 Ga0070674_101064527 3300005356 Bacteria 713
123 Ga0070673_100000191 3300005364 Bacteria 30135
124 Ga0070673_100003390 3300005364 Bacteria 9911
125 Ga0070688_100000981 3300005365 Bacteria 14298
126 Ga0070688_100009109 3300005365 Bacteria 5414
127 Ga0070688_100067111 3300005365 Bacteria 2284
128 Ga0070688_100113882 3300005365 Bacteria 1802
129 Ga0070688_100141008 3300005365 Bacteria 1637
130 Ga0070688_100152339 3300005365 Bacteria 1581
131 Ga0070688_100214272 3300005365 Bacteria 1354
132 Ga0070688_100559243 3300005365 Bacteria 871
133 Ga0070659_100001504 3300005366 Bacteria 16803
134 Ga0070659_100041455 3300005366 Bacteria 3598
135 Ga0070659_100306809 3300005366 Bacteria 1325
136 Ga0070667_100001681 3300005367 Bacteria 19789
137 Ga0070667_100032349 3300005367 Bacteria 4362
138 Ga0070667_100062837 3300005367 Bacteria 3146
139 Ga0070667_100168830 3300005367 Bacteria 1930
140 Ga0070667_100183834 3300005367 Bacteria 1849
141 Ga0070667_100236644 3300005367 Bacteria 1629
142 Ga0070667_100365985 3300005367 Bacteria 1307
143 Ga0070703_10014931 3300005406 Bacteria 2217
144 Ga0070709_10004792 3300005434 Bacteria 7307
145 Ga0070709_10015140 3300005434 Bacteria 4382
146 Ga0070709_10029345 3300005434 Bacteria 3289
147 Ga0070709_10204030 3300005434 Bacteria 1402
148 Ga0070709_10775126 3300005434 Bacteria 751
149 Ga0070714_100009596 3300005435 Bacteria 7616
150 Ga0070714_100009986 3300005435 Bacteria 7485
151 Ga0070713_100010983 3300005436 Bacteria 6569
152 Ga0070713_100296138 3300005436 Bacteria 1488
153 Ga0070710_10005069 3300005437 Bacteria 6236
154 Ga0070710_10010865 3300005437 Bacteria 4483
155 Ga0070710_10024828 3300005437 Bacteria 3166
156 Ga0070710_10401382 3300005437 Bacteria 919
157 Ga0070701_10000454 3300005438 Bacteria 14002
158 Ga0070701_10001284 3300005438 Bacteria 9228
159 Ga0070701_10046339 3300005438 Bacteria 2234
160 Ga0070711_100000961 3300005439 Bacteria 15267
161 Ga0070711_100034363 3300005439 Bacteria 3381
162 Ga0070711_100099922 3300005439 Bacteria 2109
163 Ga0070711_100140869 3300005439 Bacteria 1808
164 Ga0070705_100006964 3300005440 Bacteria 5557
165 Ga0070705_100009498 3300005440 Bacteria 4838
166 Ga0070705_100014665 3300005440 Bacteria 4037
167 Ga0070705_100149248 3300005440 Bacteria 1549
168 Ga0070705_100364976 3300005440 Bacteria 1058
169 Ga0070700_100001181 3300005441 Bacteria 12914
170 Ga0070700_100004996 3300005441 Bacteria 6987
171 Ga0070700_100026485 3300005441 Bacteria 3424
172 Ga0070700_100046465 3300005441 Bacteria 2682
173 Ga0070694_100000659 3300005444 Bacteria 19066
174 Ga0070694_100005471 3300005444 Bacteria 7691
175 Ga0070694_100026966 3300005444 Bacteria 3727
176 Ga0070694_100168255 3300005444 Bacteria 1613
177 Ga0070694_100258671 3300005444 Bacteria 1320
178 Ga0070708_100012815 3300005445 Bacteria 6849
179 Ga0070708_100217296 3300005445 Bacteria 1792
180 Ga0070708_100301609 3300005445 Bacteria 1508
181 Ga0070708_100541419 3300005445 Bacteria 1098
182 Ga0070663_100001220 3300005455 Bacteria 14123
183 Ga0070663_100001277 3300005455 Bacteria 13788
184 Ga0070663_100020947 3300005455 Bacteria 4338
185 Ga0070663_100026167 3300005455 Bacteria 3948
186 Ga0070663_100084716 3300005455 Bacteria 2337
187 Ga0070663_100256998 3300005455 Bacteria 1384
188 Ga0070663_100544340 3300005455 Bacteria 969
189 Ga0070678_100000682 3300005456 Bacteria 16729
190 Ga0070678_100051447 3300005456 Bacteria 2986
191 Ga0070678_100098678 3300005456 Bacteria 2259
192 Ga0070678_100547881 3300005456 Bacteria 1026
193 Ga0070678_100684868 3300005456 Bacteria 922
194 Ga0070662_100000339 3300005457 Bacteria 28034
195 Ga0070662_100009258 3300005457 Bacteria 6435
196 Ga0070662_100025609 3300005457 Bacteria 4075
197 Ga0070662_100049937 3300005457 Bacteria 3017
198 Ga0070681_10002441 3300005458 Bacteria 17015
199 Ga0070681_10024612 3300005458 Bacteria 6057
200 Ga0070681_10045062 3300005458 Bacteria 4414
201 Ga0068867_100003651 3300005459 Bacteria 10826
202 Ga0068867_100005776 3300005459 Bacteria 8778
203 Ga0068867_100066847 3300005459 Bacteria 2678
204 Ga0068867_100119450 3300005459 Bacteria 2035
205 Ga0070685_10001020 3300005466 Bacteria 15067
206 Ga0070685_10047091 3300005466 Bacteria 2478
207 Ga0070685_10116531 3300005466 Bacteria 1653
208 Ga0070685_10356442 3300005466 Bacteria 1001
209 Ga0070685_10551607 3300005466 Bacteria 823
210 Ga0070706_100409282 3300005467 Bacteria 1263
211 Ga0070707_100247698 3300005468 Bacteria 1734
212 Ga0070698_100520643 3300005471 Bacteria 1128
213 Ga0070699_100003740 3300005518 Bacteria 13438
214 Ga0070699_100005151 3300005518 Bacteria 11496
215 Ga0070699_100243455 3300005518 Bacteria 1606
216 Ga0070699_100265772 3300005518 Bacteria 1535
217 Ga0070679_100002397 3300005530 Bacteria 16994
218 Ga0070679_100205962 3300005530 Bacteria 1932
219 Ga0070679_100363214 3300005530 Bacteria 1395
220 Ga0070684_100023896 3300005535 Bacteria 5120
221 Ga0070684_100129882 3300005535 Bacteria 2272
222 Ga0070697_100180051 3300005536 Bacteria 1792
223 Ga0070697_100180676 3300005536 Bacteria 1788
224 Ga0068853_100002127 3300005539 Bacteria 14736
225 Ga0068853_100285340 3300005539 Bacteria 1522
226 Ga0068853_100363022 3300005539 Bacteria 1349
227 Ga0070672_100008180 3300005543 Bacteria 7146
228 Ga0070672_100104924 3300005543 Bacteria 2297
229 Ga0070672_100129901 3300005543 Bacteria 2069
230 Ga0070686_100000707 3300005544 Bacteria 19394
231 Ga0070686_100001852 3300005544 Bacteria 11801
232 Ga0070686_100010885 3300005544 Bacteria 5148
233 Ga0070686_100026881 3300005544 Bacteria 3477
234 Ga0070686_100043297 3300005544 Bacteria 2824
235 Ga0070695_100000995 3300005545 Bacteria 15425
236 Ga0070695_100017667 3300005545 Bacteria 4327
237 Ga0070695_100029096 3300005545 Bacteria 3431
238 Ga0070696_100000743 3300005546 Bacteria 20824
239 Ga0070696_100030172 3300005546 Bacteria 3711
240 Ga0070696_100059761 3300005546 Bacteria 2664
241 Ga0070696_100180766 3300005546 Bacteria 1565
242 Ga0070696_100196382 3300005546 Bacteria 1504
243 Ga0070696_100551444 3300005546 Bacteria 924
244 Ga0070693_100000993 3300005547 Bacteria 12644
245 Ga0070693_100003405 3300005547 Bacteria 7408
246 Ga0070693_100193224 3300005547 Bacteria 1318
247 Ga0070665_100011802 3300005548 Bacteria 8824
248 Ga0070665_100012968 3300005548 Bacteria 8394
249 Ga0070665_100015770 3300005548 Bacteria 7591
250 Ga0070665_100031231 3300005548 Bacteria 5361
251 Ga0070665_100172863 3300005548 Bacteria 2161
252 Ga0070665_100223967 3300005548 Bacteria 1881
253 Ga0070704_100000607 3300005549 Bacteria 17259
254 Ga0070704_100129790 3300005549 Bacteria 1951
255 Ga0070704_100179847 3300005549 Bacteria 1690
256 Ga0068855_100003471 3300005563 Bacteria 19298
257 Ga0068855_100012458 3300005563 Bacteria 10267
258 Ga0068855_100065612 3300005563 Bacteria 4232
259 Ga0070664_100044843 3300005564 Bacteria 3734
260 Ga0070664_100144557 3300005564 Bacteria 2097
261 Ga0070664_100163030 3300005564 Bacteria 1973
262 Ga0070664_100234239 3300005564 Bacteria 1647
263 Ga0070664_100485787 3300005564 Bacteria 1137
264 Ga0068857_100007472 3300005577 Bacteria 9408
265 Ga0068857_100288465 3300005577 Bacteria 1511
266 Ga0068854_100005622 3300005578 Bacteria 7920
267 Ga0068854_100007745 3300005578 Bacteria 6866
268 Ga0068854_100112874 3300005578 Bacteria 2052
269 Ga0068854_100444423 3300005578 Bacteria 1082
270 Ga0068856_100004777 3300005614 Bacteria 13428
271 Ga0068856_100059691 3300005614 Bacteria 3767
272 Ga0068856_100071204 3300005614 Bacteria 3441
273 Ga0070702_100000022 3300005615 Bacteria 44333
274 Ga0070702_100002122 3300005615 Bacteria 8421
275 Ga0070702_100046887 3300005615 Bacteria 2452
276 Ga0070702_100125969 3300005615 Bacteria 1611
277 Ga0070702_100141601 3300005615 Bacteria 1532
278 Ga0068852_100006412 3300005616 Bacteria 8501
279 Ga0068852_100073978 3300005616 Bacteria 2999
280 Ga0068852_100191180 3300005616 Bacteria 1932
281 Ga0068859_100002296 3300005617 Bacteria 19413
282 Ga0068859_100038396 3300005617 Bacteria 4804
283 Ga0068859_100043181 3300005617 Bacteria 4530
284 Ga0068859_100451919 3300005617 Bacteria 1381
285 Ga0068864_100002090 3300005618 Bacteria 16498
286 Ga0068864_100004252 3300005618 Bacteria 11784
287 Ga0068864_100030933 3300005618 Bacteria 4539
288 Ga0068866_10002715 3300005718 Bacteria 7301
289 Ga0068866_10010382 3300005718 Bacteria 3990
290 Ga0068866_10066835 3300005718 Bacteria 1885
291 Ga0068861_100001574 3300005719 Bacteria 14514
292 Ga0068861_100001910 3300005719 Bacteria 13413
293 Ga0068861_100142225 3300005719 Bacteria 1959
294 Ga0068861_100145140 3300005719 Bacteria 1941
295 Ga0068861_100456140 3300005719 Bacteria 1146
296 Ga0068861_100579863 3300005719 Bacteria 1026
297 Ga0068861_100596011 3300005719 Bacteria 1013
298 Ga0068851_10012493 3300005834 Bacteria 4005
299 Ga0068851_10244094 3300005834 Bacteria 1017
300 Ga0068870_10000133 3300005840 Bacteria 25631
301 Ga0068870_10078105 3300005840 Bacteria 1822
302 Ga0068870_10103020 3300005840 Bacteria 1617
303 Ga0068863_100001307 3300005841 Bacteria 24847
304 Ga0068863_100010858 3300005841 Bacteria 8831
305 Ga0068863_100050785 3300005841 Bacteria 3930
306 Ga0068863_100118460 3300005841 Bacteria 2524
307 Ga0068863_100156523 3300005841 Bacteria 2182
308 Ga0068858_100001450 3300005842 Bacteria 24400
309 Ga0068858_100029162 3300005842 Bacteria 5124
310 Ga0068858_100047364 3300005842 Bacteria 3985
311 Ga0068858_100055131 3300005842 Bacteria 3674
312 Ga0068858_100103118 3300005842 Bacteria 2661
313 Ga0068860_100003358 3300005843 Bacteria 16477
314 Ga0068860_100011366 3300005843 Bacteria 8773
315 Ga0068860_100040861 3300005843 Bacteria 4431
316 Ga0068860_100067009 3300005843 Bacteria 3411
317 Ga0068860_100119726 3300005843 Bacteria 2520
318 Ga0068860_100146466 3300005843 Bacteria 2272
319 Ga0068862_100006524 3300005844 Bacteria 9686
320 Ga0068862_100013206 3300005844 Bacteria 6830
321 Ga0068862_100188553 3300005844 Bacteria 1854
322 Ga0081455_10000009 3300005937 Bacteria 249885
323 Ga0081455_10006075 3300005937 Bacteria 13071
324 Ga0081455_10034040 3300005937 Bacteria 4570
325 Ga0081455_10039510 3300005937 Bacteria 4169
326 Ga0081455_10072301 3300005937 Bacteria 2856
327 Ga0081538_10001263 3300005981 Bacteria 26406
328 Ga0081540_1005549 3300005983 Bacteria 9399
329 Ga0081540_1007633 3300005983 Bacteria 7676
330 Ga0081540_1008834 3300005983 Bacteria 6997
331 Ga0081540_1015330 3300005983 Bacteria 4856
332 Ga0081540_1059689 3300005983 Bacteria 1829
333 Ga0070717_10012313 3300006028 Bacteria 6520
334 Ga0070717_10150544 3300006028 Bacteria 2013
335 Ga0075365_10034820 3300006038 Bacteria 3254
336 Ga0075365_10049225 3300006038 Bacteria 2776
337 Ga0075365_10063140 3300006038 Bacteria 2479
338 Ga0075365_10086232 3300006038 Bacteria 2134
339 Ga0075365_10393029 3300006038 Bacteria 978
340 Ga0075368_10062213 3300006042 Bacteria 1496
341 Ga0075363_100002157 3300006048 Bacteria 7916
342 Ga0075363_100038988 3300006048 Bacteria 2499
343 Ga0075364_10176770 3300006051 Bacteria 1444
344 Ga0075364_10281845 3300006051 Bacteria 1130
345 Ga0075364_10362623 3300006051 Bacteria 988
346 Ga0075432_10009083 3300006058 Bacteria 3386
347 Ga0075432_10050851 3300006058 Bacteria 1462
348 Ga0070715_10001233 3300006163 Bacteria 7360
349 Ga0070715_10001884 3300006163 Bacteria 6287
350 Ga0070715_10010881 3300006163 Bacteria 3256
351 Ga0070716_100001144 3300006173 Bacteria 11698
352 Ga0070716_100003890 3300006173 Bacteria 7086
353 Ga0070716_100225011 3300006173 Bacteria 1263
354 Ga0070712_100006971 3300006175 Bacteria 7045
355 Ga0070712_100012714 3300006175 Bacteria 5358
356 Ga0070712_100083832 3300006175 Bacteria 2316
357 Ga0070712_100150703 3300006175 Bacteria 1785
358 Ga0070712_100158544 3300006175 Bacteria 1745
359 Ga0070712_100519742 3300006175 Bacteria 1000
360 Ga0075362_10059913 3300006177 Bacteria 1720
361 Ga0075367_10017457 3300006178 Bacteria 3940
362 Ga0075367_10161551 3300006178 Bacteria 1393
363 Ga0075369_10009009 3300006186 Bacteria 3862
364 Ga0075427_10000933 3300006194 Bacteria 3598
365 Ga0075366_10095588 3300006195 Bacteria 1781
366 Ga0075366_10346061 3300006195 Bacteria 912
367 Ga0097621_100000616 3300006237 Bacteria 25167
368 Ga0097621_100067560 3300006237 Bacteria 2946
369 Ga0097621_100130845 3300006237 Bacteria 2136
370 Ga0097621_100451891 3300006237 Bacteria 1158
371 Ga0075370_10051098 3300006353 Bacteria 2345
372 Ga0075370_10405111 3300006353 Bacteria 818
373 Ga0068871_100016286 3300006358 Bacteria 5594
374 Ga0068871_100031874 3300006358 Bacteria 4159
375 Ga0068871_100045370 3300006358 Bacteria 3538
376 Ga0068871_100116665 3300006358 Bacteria 2251
377 Ga0075428_100009524 3300006844 Bacteria 10786
378 Ga0075428_100093645 3300006844 Bacteria 3276
379 Ga0075428_100319812 3300006844 Bacteria 1667
380 Ga0075428_100697545 3300006844 Bacteria 1081
381 Ga0075428_100914195 3300006844 Bacteria 931
382 Ga0075430_100053356 3300006846 Bacteria 3404
383 Ga0075430_100077845 3300006846 Bacteria 2780
384 Ga0075431_100004032 3300006847 Bacteria 14306
385 Ga0075431_100025139 3300006847 Bacteria 6104
386 Ga0075431_100312229 3300006847 Bacteria 1587
387 Ga0075433_10000876 3300006852 Bacteria 21135
388 Ga0075433_10061884 3300006852 Bacteria 3279
389 Ga0075433_10156830 3300006852 Bacteria 2025
390 Ga0075433_10327623 3300006852 Bacteria 1355
391 Ga0075433_10464983 3300006852 Bacteria 1115
392 Ga0075433_10975308 3300006852 Bacteria 738
393 Ga0075434_100003784 3300006871 Bacteria 13520
394 Ga0075434_100026789 3300006871 Bacteria 5653
395 Ga0075434_100056876 3300006871 Bacteria 3887
396 Ga0075434_100103418 3300006871 Bacteria 2856
397 Ga0075434_100237368 3300006871 Bacteria 1843
398 Ga0075434_100326636 3300006871 Bacteria 1555
399 Ga0075434_100453414 3300006871 Bacteria 1304
400 Ga0075434_100465532 3300006871 Bacteria 1285
401 Ga0075429_100178387 3300006880 Bacteria 1861
402 Ga0075429_100207320 3300006880 Bacteria 1717
403 Ga0068865_100001101 3300006881 Bacteria 15599
404 Ga0068865_100039979 3300006881 Bacteria 3184
405 Ga0068865_100053184 3300006881 Bacteria 2809
406 Ga0068865_100448001 3300006881 Bacteria 1067
407 Ga0075436_100027016 3300006914 Bacteria 3952
408 Ga0075436_100131444 3300006914 Bacteria 1756
409 Ga0075436_100254770 3300006914 Bacteria 1250
410 Ga0075436_100272646 3300006914 Bacteria 1209
411 Ga0097620_100002296 3300006931 Bacteria 19413
412 Ga0097620_100038394 3300006931 Bacteria 4804
413 Ga0097620_100043182 3300006931 Bacteria 4530
414 Ga0097620_100451932 3300006931 Bacteria 1381
415 Ga0075435_100020401 3300007076 Bacteria 5078
416 Ga0075435_100024050 3300007076 Bacteria 4721
417 Ga0075435_100032996 3300007076 Bacteria 4091
418 Ga0075435_100041844 3300007076 Bacteria 3663
419 Ga0075435_100063268 3300007076 Bacteria 3005
420 Ga0075435_100114060 3300007076 Bacteria 2250
421 Ga0075435_100117179 3300007076 Bacteria 2219
422 Ga0099795_10000155 3300007788 Bacteria 11496
423 Ga0105251_10037175 3300009011 Bacteria 2391
424 Ga0105251_10051478 3300009011 Bacteria 1964
425 Ga0105244_10061434 3300009036 Bacteria 1891
426 Ga0105250_10026850 3300009092 Bacteria 2320
427 Ga0105250_10137392 3300009092 Bacteria 1012
428 Ga0105250_10327236 3300009092 Bacteria 667
429 Ga0105240_10011690 3300009093 Bacteria 12198
430 Ga0105240_10031786 3300009093 Bacteria 6839
431 Ga0105240_11715710 3300009093 Bacteria 655
432 Ga0111539_10003401 3300009094 Bacteria 20957
433 Ga0111539_10035433 3300009094 Bacteria 6042
434 Ga0111539_10042647 3300009094 Bacteria 5446
435 Ga0111539_10171638 3300009094 Bacteria 2533
436 Ga0111539_10174268 3300009094 Bacteria 2513
437 Ga0111539_10391019 3300009094 Bacteria 1619
438 Ga0111539_11144462 3300009094 Bacteria 904
439 Ga0111539_12097479 3300009094 Bacteria 656
440 Ga0105245_10002367 3300009098 Bacteria 17040
441 Ga0105245_10056051 3300009098 Bacteria 3541
442 Ga0105245_10157650 3300009098 Bacteria 2151
443 Ga0105245_10601755 3300009098 Bacteria 1126
444 Ga0105247_10001141 3300009101 Bacteria 19671
445 Ga0105247_10007741 3300009101 Bacteria 6574
446 Ga0105247_10008319 3300009101 Bacteria 6328
447 Ga0105247_10011047 3300009101 Bacteria 5448
448 Ga0105247_10018808 3300009101 Bacteria 4147
449 Ga0105247_10028441 3300009101 Bacteria 3383
450 Ga0105247_10775489 3300009101 Bacteria 729
451 Ga0114129_10018611 3300009147 Bacteria 9888
452 Ga0114129_10058921 3300009147 Bacteria 5370
453 Ga0114129_10141666 3300009147 Bacteria 3295
454 Ga0114129_10207555 3300009147 Bacteria 2650
455 Ga0114129_10679670 3300009147 Bacteria 1325
456 Ga0105243_10000417 3300009148 Bacteria 44794
457 Ga0105243_10002317 3300009148 Bacteria 15945
458 Ga0105243_10015545 3300009148 Bacteria 5753
459 Ga0105241_10000456 3300009174 Bacteria 30774
460 Ga0105241_10003767 3300009174 Bacteria 11245
461 Ga0105241_10072284 3300009174 Bacteria 2680
462 Ga0105241_10205607 3300009174 Bacteria 1647
463 Ga0105241_10344256 3300009174 Bacteria 1293
464 Ga0105242_10000990 3300009176 Bacteria 22224
465 Ga0105242_10002247 3300009176 Bacteria 15232
466 Ga0105242_10137941 3300009176 Bacteria 2113
467 Ga0105242_10329538 3300009176 Bacteria 1403
468 Ga0105242_10600087 3300009176 Bacteria 1063
469 Ga0105242_10816779 3300009176 Bacteria 924
470 Ga0105248_10000293 3300009177 Bacteria 59383
471 Ga0105248_10013733 3300009177 Bacteria 8914
472 Ga0105248_10047103 3300009177 Bacteria 4834
473 Ga0105248_10064060 3300009177 Bacteria 4127
474 Ga0105248_10067752 3300009177 Bacteria 4007
475 Ga0105248_10083940 3300009177 Bacteria 3583
476 Ga0105248_10089844 3300009177 Bacteria 3458
477 Ga0105248_10198164 3300009177 Bacteria 2262
478 Ga0105248_10955660 3300009177 Bacteria 968
479 Ga0105237_10000712 3300009545 Bacteria 46011
480 Ga0105237_10024092 3300009545 Bacteria 6227
481 Ga0105237_10338448 3300009545 Bacteria 1509
482 Ga0105237_10464690 3300009545 Bacteria 1271
483 Ga0105238_10008146 3300009551 Bacteria 10483
484 Ga0105238_10088824 3300009551 Bacteria 3077
485 Ga0105238_10757331 3300009551 Bacteria 985
486 Ga0105249_10001033 3300009553 Bacteria 24619
487 Ga0105249_10025232 3300009553 Bacteria 5348
488 Ga0105249_10049172 3300009553 Bacteria 3845
489 Ga0105249_10137387 3300009553 Bacteria 2341
490 Ga0099796_10000545 3300010159 Bacteria 6436
491 Ga0105239_10024373 3300010375 Bacteria 6666
492 Ga0105239_10121234 3300010375 Bacteria 2904
493 Ga0105239_10135993 3300010375 Bacteria 2736
494 Ga0105239_10402983 3300010375 Bacteria 1548
495 Ga0105246_10000118 3300011119 Bacteria 35893
496 Ga0105246_10001800 3300011119 Bacteria 12824
497 Ga0105246_10030840 3300011119 Bacteria 3544
498 Ga0105246_10237213 3300011119 Bacteria 1440
499 Ga0105246_10466612 3300011119 Bacteria 1065
500 Ga0157344_1000799 3300012476 Bacteria 1343
501 Ga0157346_1002141 3300012480 Bacteria 1002
502 Ga0157335_1002311 3300012492 Bacteria 1140
503 Ga0157341_1006083 3300012494 Bacteria 924
504 Ga0157313_1001600 3300012503 Bacteria 1245
505 Ga0157316_1003972 3300012510 Bacteria 1097
506 Ga0157338_1011623 3300012515 Bacteria 908
507 Ga0157373_10027665 3300013100 Bacteria 4091
508 Ga0157373_10619101 3300013100 Bacteria 789
509 Ga0157371_10005561 3300013102 Bacteria 10597
510 Ga0157371_10164975 3300013102 Bacteria 1582
511 Ga0157370_10014874 3300013104 Bacteria 7940
512 Ga0157369_10034660 3300013105 Bacteria 5537
513 Ga0157369_10524924 3300013105 Bacteria 1225
514 Ga0157374_10004169 3300013296 Bacteria 12136
515 Ga0157374_10067658 3300013296 Bacteria 3359
516 Ga0157374_10068417 3300013296 Bacteria 3341
517 Ga0157374_10775036 3300013296 Bacteria 974
518 Ga0157378_10000643 3300013297 Bacteria 32822
519 Ga0157378_10047383 3300013297 Bacteria 3822
520 Ga0157378_10075985 3300013297 Bacteria 3025
521 Ga0157378_10369456 3300013297 Bacteria 1406
522 Ga0163162_10003401 3300013306 Bacteria 15185
523 Ga0163162_10009748 3300013306 Bacteria 9350
524 Ga0163162_10009782 3300013306 Bacteria 9332
525 Ga0163162_10181804 3300013306 Bacteria 2229
526 Ga0163162_10206364 3300013306 Bacteria 2094
527 Ga0163162_10285414 3300013306 Bacteria 1782
528 Ga0163162_10622692 3300013306 Bacteria 1204
529 Ga0163162_10661123 3300013306 Bacteria 1168
530 Ga0163162_11180439 3300013306 Bacteria 868
531 Ga0157372_10001248 3300013307 Bacteria 27510
532 Ga0157372_10014509 3300013307 Bacteria 8432
533 Ga0157372_10116252 3300013307 Bacteria 3067
534 Ga0157372_10405850 3300013307 Bacteria 1588
535 Ga0157375_10002635 3300013308 Bacteria 15534
536 Ga0157375_10039024 3300013308 Bacteria 4565
537 Ga0157375_10063052 3300013308 Bacteria 3686
538 Ga0157375_10124184 3300013308 Bacteria 2694
539 Ga0157375_10419068 3300013308 Bacteria 1505
540 Ga0157375_10461012 3300013308 Bacteria 1436
541 Ga0163163_10005028 3300014325 Bacteria 11396
542 Ga0163163_10005155 3300014325 Bacteria 11267
543 Ga0163163_10047249 3300014325 Bacteria 4231
544 Ga0163163_10096909 3300014325 Bacteria 2970
545 Ga0163163_10176164 3300014325 Bacteria 2185
546 Ga0163163_10196977 3300014325 Bacteria 2063
547 Ga0163163_10227523 3300014325 Bacteria 1914
548 Ga0163163_10471930 3300014325 Bacteria 1315
549 Ga0157380_10001138 3300014326 Bacteria 17181
550 Ga0157380_10001301 3300014326 Bacteria 16225
551 Ga0157380_10449421 3300014326 Bacteria 1237
552 Ga0157380_10492797 3300014326 Bacteria 1188
553 Ga0157380_10554899 3300014326 Bacteria 1128
554 Ga0157377_10000982 3300014745 Bacteria 12022
555 Ga0157377_10001682 3300014745 Bacteria 9646
556 Ga0157377_10024270 3300014745 Bacteria 3222
557 Ga0157377_10117432 3300014745 Bacteria 1608
558 Ga0157377_10321503 3300014745 Bacteria 1028
559 Ga0157379_10000275 3300014968 Bacteria 40524
560 Ga0157379_10000933 3300014968 Bacteria 23653
561 Ga0157379_10010341 3300014968 Bacteria 8127
562 Ga0157379_10018203 3300014968 Bacteria 6190
563 Ga0157379_10097828 3300014968 Bacteria 2635
564 Ga0157379_10162654 3300014968 Bacteria 2015
565 Ga0157379_10173780 3300014968 Bacteria 1945
566 Ga0157376_10001069 3300014969 Bacteria 17936
567 Ga0157376_10001767 3300014969 Bacteria 14394
568 Ga0157376_10033668 3300014969 Bacteria 4128
569 Ga0157376_10067815 3300014969 Bacteria 3018
570 Ga0157376_10225758 3300014969 Bacteria 1737
571 Ga0157376_10714668 3300014969 Bacteria 1008
572 Ga0157376_10910733 3300014969 Bacteria 898
573 Ga0163161_10044631 3300017792 Bacteria 3193
574 Ga0163161_10115761 3300017792 Bacteria 2010
575 Ga0163161_10138728 3300017792 Bacteria 1840
576 Ga0228598_1003451 3300024227 Bacteria 3400
577 Ga0209677_100646 3300025253 Bacteria 18446
578 Ga0207666_1000149 3300025271 Bacteria 10831
579 Ga0207673_1000068 3300025290 Bacteria 8898
580 Ga0209758_1016560 3300025297 Bacteria 3735
581 Ga0207697_10012080 3300025315 Bacteria 3635
582 Ga0207697_10012377 3300025315 Bacteria 3578
583 Ga0207697_10028933 3300025315 Bacteria 2267
584 Ga0207697_10167940 3300025315 Bacteria 959
585 Ga0207656_10063337 3300025321 Bacteria 1627
586 Ga0207653_10003139 3300025885 Bacteria 5228
587 Ga0207682_10000695 3300025893 Bacteria 15627
588 Ga0207692_10087236 3300025898 Bacteria 1683
589 Ga0207642_10000453 3300025899 Bacteria 12480
590 Ga0207710_10011822 3300025900 Bacteria 3672
591 Ga0207710_10027741 3300025900 Bacteria 2454
592 Ga0207710_10044901 3300025900 Bacteria 1969
593 Ga0207710_10048741 3300025900 Bacteria 1896
594 Ga0207710_10314770 3300025900 Bacteria 793
595 Ga0207688_10000764 3300025901 Bacteria 15995
596 Ga0207688_10008788 3300025901 Bacteria 5496
597 Ga0207688_10064883 3300025901 Bacteria 2062
598 Ga0207680_10044492 3300025903 Bacteria 2611
599 Ga0207680_10056057 3300025903 Bacteria 2379
600 Ga0207680_10137513 3300025903 Bacteria 1616
601 Ga0207680_10240928 3300025903 Bacteria 1246
602 Ga0207680_10431973 3300025903 Bacteria 933
603 Ga0207647_10001565 3300025904 Bacteria 17590
604 Ga0207647_10022486 3300025904 Bacteria 4185
605 Ga0207647_10030550 3300025904 Bacteria 3473
606 Ga0207685_10008128 3300025905 Bacteria 2969
607 Ga0207685_10055588 3300025905 Bacteria 1546
608 Ga0207699_10029787 3300025906 Bacteria 3047
609 Ga0207699_10052606 3300025906 Bacteria 2411
610 Ga0207699_10304265 3300025906 Bacteria 1114
611 Ga0207645_10019429 3300025907 Bacteria 4453
612 Ga0207645_10035619 3300025907 Bacteria 3196
613 Ga0207645_10131127 3300025907 Bacteria 1631
614 Ga0207645_10197517 3300025907 Bacteria 1323
615 Ga0207643_10000523 3300025908 Bacteria 24625
616 Ga0207643_10013330 3300025908 Bacteria 4449
617 Ga0207643_10103051 3300025908 Bacteria 1675
618 Ga0207705_10396043 3300025909 Bacteria 1068
619 Ga0207684_10167323 3300025910 Bacteria 1895
620 Ga0207654_10001610 3300025911 Bacteria 11830
621 Ga0207654_10053975 3300025911 Bacteria 2322
622 Ga0207654_10123326 3300025911 Bacteria 1630
623 Ga0207654_10165849 3300025911 Bacteria 1430
624 Ga0207707_10001147 3300025912 Bacteria 25092
625 Ga0207707_10051812 3300025912 Bacteria 3574
626 Ga0207707_10338101 3300025912 Bacteria 1298
627 Ga0207695_10136425 3300025913 Bacteria 2406
628 Ga0207671_10130803 3300025914 Bacteria 1926
629 Ga0207693_10000703 3300025915 Bacteria 30046
630 Ga0207693_10003911 3300025915 Bacteria 12683
631 Ga0207693_10010627 3300025915 Bacteria 7469
632 Ga0207693_10041415 3300025915 Bacteria 3626
633 Ga0207663_10001248 3300025916 Bacteria 11772
634 Ga0207663_10160475 3300025916 Bacteria 1586
635 Ga0207663_10185141 3300025916 Bacteria 1490
636 Ga0207663_10292068 3300025916 Bacteria 1215
637 Ga0207660_10028108 3300025917 Bacteria 3845
638 Ga0207660_10102335 3300025917 Bacteria 2141
639 Ga0207660_10590809 3300025917 Bacteria 904
640 Ga0207662_10002213 3300025918 Bacteria 9693
641 Ga0207662_10020777 3300025918 Bacteria 3748
642 Ga0207662_10083908 3300025918 Bacteria 1948
643 Ga0207662_10097343 3300025918 Bacteria 1819
644 Ga0207662_10128515 3300025918 Bacteria 1595
645 Ga0207657_10000304 3300025919 Bacteria 52135
646 Ga0207657_10056806 3300025919 Bacteria 3375
647 Ga0207657_10076719 3300025919 Bacteria 2818
648 Ga0207657_10243994 3300025919 Bacteria 1433
649 Ga0207657_10349052 3300025919 Bacteria 1167
650 Ga0207649_10000142 3300025920 Bacteria 60023
651 Ga0207649_10002403 3300025920 Bacteria 10501
652 Ga0207649_10085151 3300025920 Bacteria 2056
653 Ga0207649_10271214 3300025920 Bacteria 1230
654 Ga0207649_10274574 3300025920 Bacteria 1223
655 Ga0207652_10002021 3300025921 Bacteria 17491
656 Ga0207652_10043155 3300025921 Bacteria 3840
657 Ga0207652_10092880 3300025921 Bacteria 2655
658 Ga0207646_10168325 3300025922 Bacteria 1979
659 Ga0207681_10020796 3300025923 Bacteria 4164
660 Ga0207681_10044828 3300025923 Bacteria 2965
661 Ga0207681_10090654 3300025923 Bacteria 2182
662 Ga0207681_10100954 3300025923 Bacteria 2081
663 Ga0207694_10009066 3300025924 Bacteria 7507
664 Ga0207694_10166927 3300025924 Bacteria 1781
665 Ga0207694_10517013 3300025924 Bacteria 1000
666 Ga0207650_10002366 3300025925 Bacteria 13121
667 Ga0207650_10069957 3300025925 Bacteria 2637
668 Ga0207650_10095801 3300025925 Bacteria 2275
669 Ga0207650_10156525 3300025925 Bacteria 1802
670 Ga0207659_10000078 3300025926 Bacteria 61403
671 Ga0207687_10001882 3300025927 Bacteria 14454
672 Ga0207687_10002377 3300025927 Bacteria 12775
673 Ga0207700_10048631 3300025928 Bacteria 3150
674 Ga0207700_10103473 3300025928 Bacteria 2276
675 Ga0207700_10456861 3300025928 Bacteria 1126
676 Ga0207664_10232042 3300025929 Bacteria 1604
677 Ga0207664_10259026 3300025929 Bacteria 1520
678 Ga0207644_10001431 3300025931 Bacteria 15367
679 Ga0207644_10026921 3300025931 Bacteria 3969
680 Ga0207644_10668146 3300025931 Bacteria 865
681 Ga0207690_10002633 3300025932 Bacteria 10810
682 Ga0207690_10003254 3300025932 Bacteria 9744
683 Ga0207690_10233063 3300025932 Bacteria 1414
684 Ga0207690_10345735 3300025932 Bacteria 1175
685 Ga0207706_10000263 3300025933 Bacteria 57106
686 Ga0207706_10120424 3300025933 Bacteria 2307
687 Ga0207706_10134940 3300025933 Bacteria 2171
688 Ga0207706_10235601 3300025933 Bacteria 1600
689 Ga0207686_10003396 3300025934 Bacteria 8551
690 Ga0207686_10027400 3300025934 Bacteria 3337
691 Ga0207686_10310464 3300025934 Bacteria 1174
692 Ga0207709_10004092 3300025935 Bacteria 8489
693 Ga0207709_10009025 3300025935 Bacteria 5498
694 Ga0207709_10036935 3300025935 Bacteria 2899
695 Ga0207709_10437622 3300025935 Bacteria 1008
696 Ga0207670_10003694 3300025936 Bacteria 8121
697 Ga0207670_10004344 3300025936 Bacteria 7619
698 Ga0207670_10147585 3300025936 Bacteria 1741
699 Ga0207670_10217252 3300025936 Bacteria 1461
700 Ga0207669_10001025 3300025937 Bacteria 11929
701 Ga0207669_10001156 3300025937 Bacteria 11247
702 Ga0207669_10138591 3300025937 Bacteria 1685
703 Ga0207669_10263326 3300025937 Bacteria 1291
704 Ga0207669_10335748 3300025937 Bacteria 1162
705 Ga0207704_10085875 3300025938 Bacteria 2050
706 Ga0207704_10274213 3300025938 Bacteria 1279
707 Ga0207704_10397170 3300025938 Bacteria 1087
708 Ga0207665_10000219 3300025939 Bacteria 38754
709 Ga0207665_10001692 3300025939 Bacteria 14821
710 Ga0207665_10010841 3300025939 Bacteria 5984
711 Ga0207665_10041611 3300025939 Bacteria 3069
712 Ga0207691_10002753 3300025940 Bacteria 17136
713 Ga0207691_10008131 3300025940 Bacteria 10069
714 Ga0207691_10064975 3300025940 Bacteria 3304
715 Ga0207691_10159568 3300025940 Bacteria 1979
716 Ga0207711_10008692 3300025941 Bacteria 8496
717 Ga0207711_10037167 3300025941 Bacteria 4134
718 Ga0207711_10040516 3300025941 Bacteria 3963
719 Ga0207711_10089107 3300025941 Bacteria 2710
720 Ga0207711_10567174 3300025941 Bacteria 1059
721 Ga0207689_10001399 3300025942 Bacteria 23007
722 Ga0207689_10010207 3300025942 Bacteria 8094
723 Ga0207689_10013204 3300025942 Bacteria 7050
724 Ga0207689_10073515 3300025942 Bacteria 2808
725 Ga0207689_10076767 3300025942 Bacteria 2746
726 Ga0207689_10236575 3300025942 Bacteria 1510
727 Ga0207689_10668585 3300025942 Bacteria 875
728 Ga0207661_10001264 3300025944 Bacteria 16911
729 Ga0207661_10027285 3300025944 Bacteria 4361
730 Ga0207679_10000064 3300025945 Bacteria 98118
731 Ga0207679_10043430 3300025945 Bacteria 3236
732 Ga0207679_10458704 3300025945 Bacteria 1131
733 Ga0207667_10106805 3300025949 Bacteria 2888
734 Ga0207667_10173810 3300025949 Bacteria 2213
735 Ga0207651_10000420 3300025960 Bacteria 18070
736 Ga0207651_10000820 3300025960 Bacteria 13434
737 Ga0207651_10197490 3300025960 Bacteria 1609
738 Ga0207651_10984408 3300025960 Bacteria 753
739 Ga0207712_10001661 3300025961 Bacteria 14931
740 Ga0207712_10013354 3300025961 Bacteria 5264
741 Ga0207712_10150750 3300025961 Bacteria 1796
742 Ga0207712_10685475 3300025961 Bacteria 893
743 Ga0207668_10000965 3300025972 Bacteria 17301
744 Ga0207668_10025031 3300025972 Bacteria 3858
745 Ga0207668_10047738 3300025972 Bacteria 2933
746 Ga0207668_10102696 3300025972 Bacteria 2127
747 Ga0207668_10257439 3300025972 Bacteria 1420
748 Ga0207668_10542324 3300025972 Bacteria 1006
749 Ga0207640_10001755 3300025981 Bacteria 11643
750 Ga0207640_10039179 3300025981 Bacteria 2997
751 Ga0207640_10819529 3300025981 Bacteria 808
752 Ga0207658_10037471 3300025986 Bacteria 3485
753 Ga0207677_10023844 3300026023 Bacteria 3788
754 Ga0207677_10088811 3300026023 Bacteria 2242
755 Ga0207677_10457550 3300026023 Bacteria 1095
756 Ga0207703_10005045 3300026035 Bacteria 10699
757 Ga0207703_10008946 3300026035 Bacteria 7887
758 Ga0207703_10044466 3300026035 Bacteria 3569
759 Ga0207703_10152745 3300026035 Bacteria 2015
760 Ga0207703_10240532 3300026035 Bacteria 1627
761 Ga0207703_10283672 3300026035 Bacteria 1505
762 Ga0207639_10019760 3300026041 Bacteria 4810
763 Ga0207639_10051164 3300026041 Bacteria 3141
764 Ga0207639_10265540 3300026041 Bacteria 1503
765 Ga0207639_10823749 3300026041 Bacteria 865
766 Ga0207678_10000209 3300026067 Bacteria 51832
767 Ga0207678_10010183 3300026067 Bacteria 8254
768 Ga0207678_10021975 3300026067 Bacteria 5592
769 Ga0207678_10034530 3300026067 Bacteria 4404
770 Ga0207678_10039287 3300026067 Bacteria 4107
771 Ga0207678_10056658 3300026067 Bacteria 3373
772 Ga0207678_10087331 3300026067 Bacteria 2665
773 Ga0207678_10120747 3300026067 Bacteria 2236
774 Ga0207678_10751888 3300026067 Bacteria 859
775 Ga0207708_10000953 3300026075 Bacteria 21674
776 Ga0207708_10002721 3300026075 Bacteria 12989
777 Ga0207708_10020852 3300026075 Bacteria 4944
778 Ga0207708_10193379 3300026075 Bacteria 1620
779 Ga0207702_10003767 3300026078 Bacteria 13697
780 Ga0207702_10007071 3300026078 Bacteria 9599
781 Ga0207702_10044708 3300026078 Bacteria 3723
782 Ga0207641_10007322 3300026088 Bacteria 9193
783 Ga0207641_10034057 3300026088 Bacteria 4234
784 Ga0207641_10200868 3300026088 Bacteria 1838
785 Ga0207641_10235182 3300026088 Bacteria 1705
786 Ga0207641_10802363 3300026088 Bacteria 931
787 Ga0207648_10013547 3300026089 Bacteria 7581
788 Ga0207648_10024588 3300026089 Bacteria 5374
789 Ga0207648_10082742 3300026089 Bacteria 2799
790 Ga0207648_10248865 3300026089 Bacteria 1584
791 Ga0207676_10000079 3300026095 Bacteria 94811
792 Ga0207676_10023198 3300026095 Bacteria 4573
793 Ga0207676_10081013 3300026095 Bacteria 2636
794 Ga0207676_10304493 3300026095 Bacteria 1456
795 Ga0207676_10530292 3300026095 Bacteria 1122
796 Ga0207676_10720567 3300026095 Bacteria 968
797 Ga0207674_10000719 3300026116 Bacteria 43313
798 Ga0207674_10013028 3300026116 Bacteria 9263
799 Ga0207674_10049956 3300026116 Bacteria 4275
800 Ga0207674_10303652 3300026116 Bacteria 1545
801 Ga0207674_10401253 3300026116 Bacteria 1325
802 Ga0207675_100001925 3300026118 Bacteria 20707
803 Ga0207675_100030016 3300026118 Bacteria 5061
804 Ga0207675_100030051 3300026118 Bacteria 5058
805 Ga0207675_100043624 3300026118 Bacteria 4188
806 Ga0207675_100095437 3300026118 Bacteria 2798
807 Ga0207675_100140676 3300026118 Bacteria 2293
808 Ga0207675_100314621 3300026118 Bacteria 1527
809 Ga0207683_10000037 3300026121 Bacteria 100920
810 Ga0207683_10038116 3300026121 Bacteria 4187
811 Ga0207683_10038529 3300026121 Bacteria 4167
812 Ga0207683_10794664 3300026121 Bacteria 878
813 Ga0207698_10725543 3300026142 Bacteria 991
814 Ga0209984_1025295 3300027424 Bacteria 826
815 Ga0210000_1010455 3300027462 Bacteria 1373
816 Ga0209179_1000126 3300027512 Bacteria 8526
817 Ga0210002_1000055 3300027617 Bacteria 17399
818 Ga0209971_1002180 3300027682 Bacteria 4760
819 Ga0209966_1003905 3300027695 Bacteria 2517
820 Ga0209966_1047260 3300027695 Bacteria 909
821 Ga0209998_10001005 3300027717 Bacteria 7098
822 Ga0209998_10012476 3300027717 Bacteria 1764
823 Ga0209974_10003776 3300027876 Bacteria 5426
824 Ga0209974_10006247 3300027876 Bacteria 4167
825 Ga0207428_10000216 3300027907 Bacteria 79777
826 Ga0207428_10000947 3300027907 Bacteria 32277
827 Ga0207428_10029008 3300027907 Bacteria 4592
828 Ga0207428_10034068 3300027907 Bacteria 4177
829 Ga0207428_10209350 3300027907 Bacteria 1465
830 Ga0268266_10002460 3300028379 Bacteria 19801
831 Ga0268266_10004625 3300028379 Bacteria 13124
832 Ga0268266_10028531 3300028379 Bacteria 4742
833 Ga0268266_10159548 3300028379 Bacteria 2039
834 Ga0268266_10222290 3300028379 Bacteria 1736
835 Ga0268266_10426394 3300028379 Bacteria 1257
836 Ga0268266_10865929 3300028379 Bacteria 873
837 Ga0268265_10001593 3300028380 Bacteria 18775
838 Ga0268265_10033810 3300028380 Bacteria 3720
839 Ga0268265_10078341 3300028380 Bacteria 2599
840 Ga0268265_10170919 3300028380 Bacteria 1857
841 Ga0268265_10220075 3300028380 Bacteria 1660
842 Ga0268265_10251496 3300028380 Bacteria 1565
843 Ga0268265_10424725 3300028380 Bacteria 1235
844 Ga0268264_10002487 3300028381 Bacteria 16198
845 Ga0268264_10071239 3300028381 Bacteria 2944
846 Ga0268264_10279821 3300028381 Bacteria 1562
847 Ga0268264_10769378 3300028381 Bacteria 960
848 Ga0307515_10458819 3300028794 Bacteria 889
849 Ga0265338_10016356 3300028800 Bacteria 8078
850 Ga0265760_10103908 3300031090 Bacteria 900
851 Ga0265330_10078554 3300031235 Bacteria 1423
852 Ga0265332_10001833 3300031238 Bacteria 11347
853 Ga0265332_10078189 3300031238 Bacteria 1405
854 Ga0265325_10000104 3300031241 Bacteria 59692
855 Ga0265325_10108939 3300031241 Bacteria 1348
856 Ga0265325_10139555 3300031241 Bacteria 1154
857 Ga0265325_10151187 3300031241 Bacteria 1098
858 Ga0265329_10084020 3300031242 Bacteria 1008
859 Ga0265340_10000912 3300031247 Bacteria 16766
860 Ga0265340_10023714 3300031247 Bacteria 3127
861 Ga0265340_10035724 3300031247 Bacteria 2467
862 Ga0265340_10066991 3300031247 Bacteria 1707
863 Ga0265339_10001873 3300031249 Bacteria 15436
864 Ga0265339_10040092 3300031249 Bacteria 2604
865 Ga0265339_10394257 3300031249 Bacteria 647
866 Ga0265327_10038056 3300031251 Bacteria 2628
867 Ga0265316_10173377 3300031344 Bacteria 1608
868 Ga0265313_10042774 3300031595 Bacteria 2222
869 Ga0316575_10027893 3300031665 Bacteria 2198
870 Ga0316575_10068149 3300031665 Bacteria 1427
871 Ga0265314_10009907 3300031711 Bacteria 7994
872 Ga0265314_10104897 3300031711 Bacteria 1809
873 Ga0265314_10237494 3300031711 Bacteria 1053
874 Ga0265342_10000011 3300031712 Bacteria 208435
875 Ga0265342_10004591 3300031712 Bacteria 10776
876 Ga0265342_10043958 3300031712 Bacteria 2694
877 Ga0316576_10009892 3300031727 Bacteria 6173
878 Ga0307413_10438084 3300031824 Bacteria 1034
879 Ga0307410_10653654 3300031852 Bacteria 882
880 Ga0307416_101000481 3300032002 Bacteria 939
881 Ga0307411_11102927 3300032005 Bacteria 715
882 Ga0307415_100759077 3300032126 Bacteria 881
883 Ga0316583_10060620 3300032133 Bacteria 1326
884 Ga0307510_10000998 3300033180 Bacteria 30010
885 Ga0307510_10070845 3300033180 Bacteria 3478
886 Ga0373948_0024827 3300034817 Bacteria 1172
887 Ga0373950_0001326 3300034818 Bacteria 3210
888 Ga0373950_0032256 3300034818 Bacteria 974
889 Ga0373958_0001110 3300034819 Bacteria 3557
890 Ga0373958_0024100 3300034819 Bacteria 1149
891 Ga0373959_0037895 3300034820 Bacteria 1000
892 Ga0373938_0011760 3300034957 Bacteria 1633
893 Ga0373926_0038931 3300035083 Bacteria 1694
894 Ga0373928_0000621 3300035084 Bacteria 6974
895 Ga0373929_0035100 3300035085 Bacteria 1090
896 Ga0373929_0043985 3300035085 Bacteria 1001
897 Ga0373934_0026332 3300035086 Bacteria 2256
898 Ga0373934_0156211 3300035086 Bacteria 935
899 Ga0373940_0020800 3300035088 Bacteria 1670
900 Ga0373940_0082408 3300035088 Bacteria 953
901 Ga0373944_0004381 3300035089 Bacteria 3674
902 Ga0373944_0051511 3300035089 Bacteria 1298
903 Ga0373949_0054052 3300035090 Bacteria 1018
904 Ga0373951_0025972 3300035091 Bacteria 1362
905 Ga0373951_0088153 3300035091 Bacteria 811
906 Ga0373952_0001248 3300035092 Bacteria 4636
907 Ga0373952_0001666 3300035092 Bacteria 4041
908 Ga0373923_0095776 3300035111 Bacteria 1303
909 Ga0373932_0003010 3300035112 Bacteria 4126
910 Ga0373936_0027457 3300035113 Bacteria 2232
911 Ga0373936_0092131 3300035113 Bacteria 1272
912 Ga0373936_0226977 3300035113 Bacteria 830
913 Ga0373939_0001456 3300035114 Bacteria 5728
914 Ga0373939_0002110 3300035114 Bacteria 4738
915 Ga0373939_0182499 3300035114 Bacteria 784
916 Ga0373941_0000073 3300035115 Bacteria 16016
917 Ga0373945_0003925 3300035116 Bacteria 4702
918 Ga0373945_0032058 3300035116 Bacteria 1860
919 Ga0373945_0070449 3300035116 Bacteria 1322
920 Ga0373945_0138105 3300035116 Bacteria 981
921 Ga0373954_0011780 3300035118 Bacteria 3881
922 Ga0373954_0019118 3300035118 Bacteria 3088
923 Ga0373954_0047850 3300035118 Bacteria 2002
924 Ga0373956_0142368 3300035119 Bacteria 1126
925 Ga0373956_0267467 3300035119 Bacteria 813
926 Ga0373960_0007900 3300035121 Bacteria 2533
927 Ga0373960_0047852 3300035121 Bacteria 1260
928 Ga0373960_0097727 3300035121 Bacteria 948
929 Ga0373960_0206990 3300035121 Bacteria 696
930 Ga0373943_0147418 3300035170 Bacteria 1272
931 Ga0373946_0011386 3300035171 Bacteria 3318
932 Ga0373946_0058208 3300035171 Bacteria 1636
933 Ga0373946_0100684 3300035171 Bacteria 1295
934 Ga0373946_0161101 3300035171 Bacteria 1053
935 Ga0373955_0000596 3300035172 Bacteria 15397
936 Ga0373955_0008707 3300035172 Bacteria 4723
937 Ga0373955_0286793 3300035172 Bacteria 991
938 Ga0373955_0349460 3300035172 Bacteria 895
939 Ga0373942_0004460 3300035207 Bacteria 3247
940 Ga0373942_0031940 3300035207 Bacteria 1396
941 Ga0373961_0002214 3300035241 Bacteria 5141
942 Ga0373961_0002508 3300035241 Bacteria 4739
943 Ga0373961_0028782 3300035241 Bacteria 1534
944 Ga0373962_0011700 3300035242 Bacteria 2202
945 Ga0373962_0038433 3300035242 Bacteria 1339
946 Ga0373962_0127147 3300035242 Bacteria 818
947 Ga0373924_0133752 3300035410 Bacteria 1079
948 Ga0373931_0007352 3300035691 Bacteria 5184
949 Ga0373931_0041535 3300035691 Bacteria 2416
950 Ga0373931_0094083 3300035691 Bacteria 1675
951 Ga0373931_0136999 3300035691 Bacteria 1414
952 Ga0373931_0163090 3300035691 Bacteria 1308
953 Ga0373931_0188535 3300035691 Bacteria 1225
954 Ga0373931_0402821 3300035691 Bacteria 867
955 Ga0373935_0023521 3300035692 Bacteria 3786
956 Ga0373935_0035954 3300035692 Bacteria 3094
957 Ga0373935_0088837 3300035692 Bacteria 2020
958 Ga0373935_0179385 3300035692 Bacteria 1453
959 Ga0373935_0219916 3300035692 Bacteria 1319
960 Ga0373935_0224761 3300035692 Bacteria 1305
961 Ga0373935_0287333 3300035692 Bacteria 1159
962 Ga0373935_0361731 3300035692 Bacteria 1036
963 Ga0373927_0041206 3300035695 Bacteria 2995
964 Ga0373933_0050540 3300035724 Bacteria 2482
965 Ga0373947_0001465 3300035725 Bacteria 14517
966 Ga0373947_0054777 3300035725 Bacteria 2407
967 Ga0373947_0070451 3300035725 Bacteria 2142
968 Ga0373937_0003886 3300036401 Bacteria 12639
969 Ga0373937_0098200 3300036401 Bacteria 2716
970 Ga0373937_0420970 3300036401 Bacteria 1268
971 Ga0373937_1137856 3300036401 Bacteria 729
972 Ga0316582_0311503 3300036647 Bacteria 1082
973 Ga0316584_0013488 3300036712 Bacteria 5786
974 Ga0373925_0276660 3300037068 Bacteria 1351
975 Ga0373925_0402494 3300037068 Bacteria 1116
976 Ga0373925_0475603 3300037068 Bacteria 1024
977 Ga0373925_0744496 3300037068 Bacteria 808
978 Ga0395899_0013207 3300037312 Bacteria 6318
979 Ga0395899_0072948 3300037312 Bacteria 2511
980 Ga0395899_0181356 3300037312 Bacteria 1478
981 Ga0395900_0003303 3300037418 Bacteria 17453
982 Ga0395900_0005284 3300037418 Bacteria 13537
983 Ga0395900_0018616 3300037418 Bacteria 7082
984 Ga0395900_0083563 3300037418 Bacteria 3280
985 Ga0395900_0242349 3300037418 Bacteria 1808
986 Ga0395900_0279491 3300037418 Bacteria 1662
987 Ga0395900_1154503 3300037418 Bacteria 691
988 Ga0395898_0007949 3300037466 Bacteria 11250
989 Ga0395898_0013960 3300037466 Bacteria 8254
990 Ga0395898_0051498 3300037466 Bacteria 4026
991 Ga0395898_0097387 3300037466 Bacteria 2825
992 Ga0395898_0132734 3300037466 Bacteria 2384
993 Ga0395905_0002720 3300037471 Bacteria 19373
994 Ga0395905_0023923 3300037471 Bacteria 5767
995 Ga0395905_0224049 3300037471 Bacteria 1759
996 Ga0395905_0538647 3300037471 Bacteria 1068
997 Ga0395905_0930992 3300037471 Bacteria 772
998 Ga0436364_1400093 3300037853 Bacteria 1564
999 Ga0395901_0011535 3300038443 Bacteria 8954
1000 Ga0395901_0032978 3300038443 Bacteria 5343
1001 Ga0395901_0126562 3300038443 Bacteria 2685
1002 Ga0395901_0173159 3300038443 Bacteria 2264
1003 Ga0395901_0173764 3300038443 Bacteria 2260
1004 Ga0242420_001294 3300038996 Bacteria 3291
1005 Ga0436365_0222599 3300039437 Bacteria 829
1006 Ga0436361_0008631 3300039447 Bacteria 2212
1007 Ga0436361_0134221 3300039447 Bacteria 1943
1008 Ga0436361_0134613 3300039447 Bacteria 2505
1009 Ga0436363_0373741 3300039450 Bacteria 1388
1010 Ga0439465_0100894 3300041413 Bacteria 996
1011 Ga0439450_032555 3300042008 Bacteria 1178
1012 Ga0439463_005398 3300042016 Bacteria 3175
1013 Ga0439464_0008117 3300042439 Bacteria 2753
1014 Ga0451577_0057746 3300042876 Bacteria 3459
1015 Ga0451577_0320187 3300042876 Bacteria 1406
1016 Ga0453684_0083097 3300044712 Bacteria 3987
1017 Ga0466968_0269607 3300044735 Bacteria 812
1018 Ga0451576_0056877 3300045051 Bacteria 4089
1019 Ga0466967_0970447 3300045976 Bacteria 846
1020 Ga0495617_045430 3300046452 Bacteria 1464
1021 Ga0495592_0019655 3300046454 Bacteria 5138
1022 Ga0495592_0069788 3300046454 Bacteria 2561
1023 Ga0495592_0070753 3300046454 Bacteria 2540
1024 Ga0495603_0007479 3300046455 Bacteria 6569
1025 Ga0495603_0033777 3300046455 Bacteria 3077
1026 Ga0495603_0037649 3300046455 Bacteria 2902
1027 Ga0495603_0056689 3300046455 Bacteria 2319
1028 Ga0495603_0057399 3300046455 Bacteria 2303
1029 Ga0495603_0182940 3300046455 Bacteria 1212
1030 Ga0495603_0273410 3300046455 Bacteria 971
1031 Ga0495590_0251140 3300046457 Bacteria 658
1032 Ga0495629_0001773 3300046459 Bacteria 16935
1033 Ga0495629_0003853 3300046459 Bacteria 11310
1034 Ga0495629_0013360 3300046459 Bacteria 5924
1035 Ga0495629_0036202 3300046459 Bacteria 3485
1036 Ga0495629_0086389 3300046459 Bacteria 2188
1037 Ga0495629_0121691 3300046459 Bacteria 1818
1038 Ga0495638_0010149 3300046460 Bacteria 6559
1039 Ga0495638_0040049 3300046460 Bacteria 2970
1040 Ga0495638_0070326 3300046460 Bacteria 2143
1041 Ga0495638_0152367 3300046460 Bacteria 1340
1042 Ga0495641_0011539 3300046461 Bacteria 5023
1043 Ga0495641_0013912 3300046461 Bacteria 4386
1044 Ga0495641_0017570 3300046461 Bacteria 3722
1045 Ga0495641_0067695 3300046461 Bacteria 1606
1046 Ga0495651_0000921 3300046462 Bacteria 22808
1047 Ga0495651_0067157 3300046462 Bacteria 2736
1048 Ga0495651_0084924 3300046462 Bacteria 2384
1049 Ga0495653_0005157 3300046463 Bacteria 10610
1050 Ga0495653_0288821 3300046463 Bacteria 1074
1051 Ga0495580_0000835 3300046472 Bacteria 26710
1052 Ga0495580_0028360 3300046472 Bacteria 4068
1053 Ga0495580_0084572 3300046472 Bacteria 2210
1054 Ga0495580_0407193 3300046472 Bacteria 916
1055 Ga0495582_0007761 3300046473 Bacteria 5933
1056 Ga0495582_0051422 3300046473 Bacteria 2271
1057 Ga0495582_0069273 3300046473 Bacteria 1950
1058 Ga0495582_0334637 3300046473 Bacteria 871
1059 Ga0495639_0012808 3300046475 Bacteria 3618
1060 Ga0495639_0026424 3300046475 Bacteria 2566
1061 Ga0495639_0032725 3300046475 Bacteria 2320
1062 Ga0495639_0048671 3300046475 Bacteria 1923
1063 Ga0495662_0009375 3300046476 Bacteria 4803
1064 Ga0495662_0129337 3300046476 Bacteria 1241
1065 Ga0495664_0031811 3300046477 Bacteria 3093
1066 Ga0495584_0021018 3300046491 Bacteria 3315
1067 Ga0495584_0187363 3300046491 Bacteria 1051
1068 Ga0495584_0222717 3300046491 Bacteria 959
1069 Ga0495585_0011751 3300046492 Bacteria 5175
1070 Ga0495585_0048246 3300046492 Bacteria 2368
1071 Ga0495594_0020228 3300046499 Bacteria 3544
1072 Ga0495594_0035972 3300046499 Bacteria 2699
1073 Ga0495594_0138431 3300046499 Bacteria 1380
1074 Ga0495594_0242279 3300046499 Bacteria 1028
1075 Ga0495594_0277211 3300046499 Bacteria 955
1076 Ga0495607_0020287 3300046501 Bacteria 4205
1077 Ga0495608_0021603 3300046511 Bacteria 4417
1078 Ga0495610_0087255 3300046512 Bacteria 1420
1079 Ga0495616_0133607 3300046513 Bacteria 1135
1080 Ga0495618_0062799 3300046514 Bacteria 2357
1081 Ga0495618_0175740 3300046514 Bacteria 1362
1082 Ga0495620_0106144 3300046515 Bacteria 1116
1083 Ga0495620_0199018 3300046515 Bacteria 771
1084 Ga0495628_0014081 3300046516 Bacteria 6713
1085 Ga0495630_0014066 3300046517 Bacteria 5823
1086 Ga0495630_0025494 3300046517 Bacteria 4373
1087 Ga0495630_0179847 3300046517 Bacteria 1612
1088 Ga0495632_0078302 3300046519 Bacteria 1579
1089 Ga0495632_0111294 3300046519 Bacteria 1285
1090 Ga0495632_0406252 3300046519 Bacteria 594
1091 Ga0495644_0003443 3300046523 Bacteria 6261
1092 Ga0495644_0134612 3300046523 Bacteria 942
1093 Ga0495648_0167164 3300046524 Bacteria 1131
1094 Ga0495648_0285712 3300046524 Bacteria 780
1095 Ga0495663_0094872 3300046525 Bacteria 976
1096 Ga0495666_0010494 3300046526 Bacteria 4619
1097 Ga0495666_0036764 3300046526 Bacteria 2384
1098 Ga0495666_0116339 3300046526 Bacteria 1254
1099 Ga0495652_0010378 3300046529 Bacteria 8442
1100 Ga0495652_0116472 3300046529 Bacteria 2139
1101 Ga0495652_0222660 3300046529 Bacteria 1417
1102 Ga0495652_0469597 3300046529 Bacteria 877
1103 Ga0495665_0016582 3300046531 Bacteria 3968
1104 Ga0495665_0075432 3300046531 Bacteria 1775
1105 Ga0495665_0145503 3300046531 Bacteria 1238
1106 Ga0495665_0228019 3300046531 Bacteria 962
1107 Ga0495640_0082760 3300046533 Bacteria 2130
1108 Ga0495640_0087133 3300046533 Bacteria 2066
1109 Ga0495640_0311774 3300046533 Bacteria 976
1110 Ga0495586_0077699 3300046535 Bacteria 1820
1111 Ga0495586_0381647 3300046535 Bacteria 810
1112 Ga0495587_0001768 3300046536 Bacteria 14451
1113 Ga0495587_0130519 3300046536 Bacteria 1436
1114 Ga0495598_0001247 3300046537 Bacteria 4951
1115 Ga0495598_0088230 3300046537 Bacteria 1007
1116 Ga0495621_0106772 3300046539 Bacteria 1070
1117 Ga0495645_0127864 3300046543 Bacteria 1784
1118 Ga0495645_0135379 3300046543 Bacteria 1724
1119 Ga0495645_0218645 3300046543 Bacteria 1282
1120 Ga0495622_0000576 3300046557 Bacteria 22007
1121 Ga0495622_0016818 3300046557 Bacteria 3407
1122 Ga0495622_0144157 3300046557 Bacteria 1080
1123 Ga0495633_0015379 3300046558 Bacteria 3971
1124 Ga0495633_0050252 3300046558 Bacteria 1966
1125 Ga0495667_0003339 3300046559 Bacteria 10747
1126 Ga0495667_0003637 3300046559 Bacteria 10371
1127 Ga0495667_0534727 3300046559 Bacteria 733
1128 Ga0495656_0035741 3300046615 Bacteria 2042
1129 Ga0495656_0161462 3300046615 Bacteria 1089
1130 Ga0495668_0126421 3300046616 Bacteria 1399
1131 Ga0495634_0050997 3300046642 Bacteria 2777
1132 Ga0495634_0115116 3300046642 Bacteria 1726
1133 Ga0495634_0297486 3300046642 Bacteria 976
1134 Ga0495611_0052551 3300046648 Bacteria 1838
1135 Ga0495611_0176422 3300046648 Bacteria 998
1136 Ga0495611_0202767 3300046648 Bacteria 925
1137 Ga0495625_0177779 3300046660 Bacteria 1417
1138 Ga0495625_0503512 3300046660 Bacteria 740
1139 Ga0495635_0010530 3300046663 Bacteria 6472
1140 Ga0495635_0029945 3300046663 Bacteria 3784
1141 Ga0495635_0033322 3300046663 Bacteria 3573
1142 Ga0495635_0037535 3300046663 Bacteria 3354
1143 Ga0495635_0105746 3300046663 Bacteria 1923
1144 Ga0495659_0003402 3300046664 Bacteria 5087
1145 Ga0495659_0050049 3300046664 Bacteria 1519
1146 Ga0495661_0076857 3300046665 Bacteria 1936
1147 Ga0495661_0169881 3300046665 Bacteria 1164
1148 Ga0495588_0013011 3300046674 Bacteria 3953
1149 Ga0495588_0086347 3300046674 Bacteria 1641
1150 Ga0495588_0121709 3300046674 Bacteria 1375
1151 Ga0495588_0159101 3300046674 Bacteria 1194
1152 Ga0495657_0039832 3300046675 Bacteria 3227
1153 Ga0495599_0002940 3300046678 Bacteria 9906
1154 Ga0495599_0042206 3300046678 Bacteria 2862
1155 Ga0495623_0029465 3300046679 Bacteria 3532
1156 Ga0495646_0014858 3300046680 Bacteria 4945
1157 Ga0495646_0165214 3300046680 Bacteria 1223
1158 Ga0495647_0001850 3300046681 Bacteria 6562
1159 Ga0495647_0036932 3300046681 Bacteria 1841
1160 Ga0495647_0101203 3300046681 Bacteria 1193
1161 Ga0495658_0000874 3300046683 Bacteria 16183
1162 Ga0495658_0014876 3300046683 Bacteria 3983
1163 Ga0495658_0065055 3300046683 Bacteria 2102
1164 Ga0495658_0168145 3300046683 Bacteria 1355
1165 Ga0495658_0175442 3300046683 Bacteria 1328
1166 Ga0495658_0284388 3300046683 Bacteria 1044
1167 Ga0495613_0001504 3300046689 Bacteria 17747
1168 Ga0495613_0020707 3300046689 Bacteria 4903
1169 Ga0495613_0032939 3300046689 Bacteria 3850
1170 Ga0495613_0185829 3300046689 Bacteria 1470
1171 Ga0495624_0035314 3300046690 Bacteria 3227
1172 Ga0495624_0123376 3300046690 Bacteria 1590
1173 Ga0495624_0364417 3300046690 Bacteria 869
1174 Ga0495670_0003793 3300046691 Bacteria 7426
1175 Ga0495670_0010427 3300046691 Bacteria 4565
1176 Ga0495670_0013237 3300046691 Bacteria 4057
1177 Ga0495671_0110284 3300046692 Bacteria 1344
1178 Ga0495649_0155117 3300046694 Bacteria 1202
1179 Ga0495649_0277895 3300046694 Bacteria 856
1180 Ga0495589_0029954 3300046794 Bacteria 2743
1181 Ga0495589_0060396 3300046794 Bacteria 1862
1182 Ga0495589_0086457 3300046794 Bacteria 1523
1183 Ga0495600_0012176 3300046809 Bacteria 5372
1184 Ga0495600_0092106 3300046809 Bacteria 1977
1185 Ga0495600_0094688 3300046809 Bacteria 1947
1186 Ga0495600_0225776 3300046809 Bacteria 1197
1187 Ga0495600_0598294 3300046809 Bacteria 670
1188 Ga0495581_0007632 3300047315 Bacteria 6258
1189 Ga0495581_0022957 3300047315 Bacteria 3613
1190 Ga0495581_0028023 3300047315 Bacteria 3265
1191 Ga0495581_0392897 3300047315 Bacteria 809
1192 Ga0495604_0217693 3300047317 Bacteria 1316
1193 Ga0495636_0026545 3300047318 Bacteria 2356
1194 Ga0495636_0204644 3300047318 Bacteria 902
1195 Ga0495674_0062320 3300047319 Bacteria 3248
1196 Ga0495674_0073520 3300047319 Bacteria 2946
1197 Ga0495674_0140303 3300047319 Bacteria 2032
1198 Ga0495674_0301131 3300047319 Bacteria 1309
1199 Ga0495676_0030696 3300047321 Bacteria 4555
1200 Ga0495676_0038359 3300047321 Bacteria 3978
1201 Ga0495676_0043807 3300047321 Bacteria 3658
1202 Ga0495676_0092609 3300047321 Bacteria 2256
1203 Ga0495676_0261048 3300047321 Bacteria 1178
1204 Ga0495680_0047510 3300047322 Bacteria 3376
1205 Ga0495680_0071429 3300047322 Bacteria 2643
1206 Ga0495680_0076614 3300047322 Bacteria 2535
1207 Ga0495680_0082709 3300047322 Bacteria 2422
1208 Ga0495680_0112322 3300047322 Bacteria 2018
1209 Ga0495683_0114933 3300047323 Bacteria 1282
1210 Ga0495687_001479 3300047443 Bacteria 21478
1211 Ga0495675_0206297 3300047444 Bacteria 1194
1212 Ga0495677_0038434 3300047445 Bacteria 1749
1213 Ga0495677_0168394 3300047445 Bacteria 847
1214 Ga0495685_096831 3300047447 Bacteria 975
1215 Ga0495673_0108827 3300047469 Bacteria 1111
1216 Ga0495684_0002658 3300047471 Bacteria 14168
1217 Ga0495684_0101159 3300047471 Bacteria 2179
1218 Ga0495684_0334461 3300047471 Bacteria 1079
1219 Ga0495686_0298381 3300047472 Bacteria 890
1220 Ga0495593_0002967 3300047673 Bacteria 10205
1221 Ga0495593_0033479 3300047673 Bacteria 2798
1222 Ga0495593_0139249 3300047673 Bacteria 1229
1223 Ga0495602_0000618 3300048088 Bacteria 33441
1224 Ga0495602_0009515 3300048088 Bacteria 10102
1225 Ga0495602_0118855 3300048088 Bacteria 2131
1226 Ga0495614_0154867 3300048089 Bacteria 1023
1227 Ga0495626_0037215 3300048091 Bacteria 2314
1228 Ga0496100_0001418 3300048903 Bacteria 11725
1229 Ga0496100_0018933 3300048903 Bacteria 4097
1230 Ga0496100_0027178 3300048903 Bacteria 3516
1231 Ga0496100_0058013 3300048903 Bacteria 2538
1232 Ga0496100_0116480 3300048903 Bacteria 1865
1233 Ga0496100_0167121 3300048903 Bacteria 1581
1234 Ga0496100_0459083 3300048903 Bacteria 977
1235 Ga0496101_0007889 3300048904 Bacteria 6928
1236 Ga0496101_0023336 3300048904 Bacteria 4272
1237 Ga0496101_0024749 3300048904 Bacteria 4159
1238 Ga0496101_0220075 3300048904 Bacteria 1473
1239 Ga0496101_0545065 3300048904 Bacteria 917
1240 Ga0496102_0005977 3300048905 Bacteria 10367
1241 Ga0496102_0027192 3300048905 Bacteria 5109
1242 Ga0496102_0052345 3300048905 Bacteria 3720
1243 Ga0496102_0071148 3300048905 Bacteria 3193
1244 Ga0496102_0161964 3300048905 Bacteria 2104
1245 Ga0496102_0172508 3300048905 Bacteria 2036
1246 Ga0496102_0182708 3300048905 Bacteria 1976
1247 Ga0496102_0192167 3300048905 Bacteria 1924
1248 Ga0496102_0375422 3300048905 Bacteria 1338
1249 Ga0496102_0434974 3300048905 Bacteria 1231
1250 Ga0496102_0545390 3300048905 Bacteria 1082
1251 Ga0496102_0686753 3300048905 Bacteria 947
1252 Ga0496103_0001402 3300048906 Bacteria 16210
1253 Ga0496103_0031407 3300048906 Bacteria 3235
1254 Ga0496103_0047272 3300048906 Bacteria 2659
1255 Ga0496103_0052786 3300048906 Bacteria 2518
1256 Ga0496103_0119580 3300048906 Bacteria 1677
1257 Ga0496103_0490539 3300048906 Bacteria 786
1258 Ga0496104_0000196 3300048907 Bacteria 53901
1259 Ga0496104_0004505 3300048907 Bacteria 12141
1260 Ga0496104_0023771 3300048907 Bacteria 5635
1261 Ga0496104_0041962 3300048907 Bacteria 4290
1262 Ga0496104_0066033 3300048907 Bacteria 3435
1263 Ga0496104_0096220 3300048907 Bacteria 2832
1264 Ga0496104_0263190 3300048907 Bacteria 1637
1265 Ga0496104_0367667 3300048907 Bacteria 1351
1266 Ga0496104_0406672 3300048907 Bacteria 1273
1267 Ga0496104_1472259 3300048907 Bacteria 584
1268 Ga0496105_0002714 3300048908 Bacteria 12911
1269 Ga0496105_0002806 3300048908 Bacteria 12740
1270 Ga0496105_0023768 3300048908 Bacteria 4975
1271 Ga0496105_0146095 3300048908 Bacteria 1945
1272 Ga0496105_0466777 3300048908 Bacteria 995
1273 Ga0496106_0048565 3300048909 Bacteria 3195
1274 Ga0496106_0049066 3300048909 Bacteria 3179
1275 Ga0496106_0050298 3300048909 Bacteria 3141
1276 Ga0496106_0074338 3300048909 Bacteria 2601
1277 Ga0496106_0094473 3300048909 Bacteria 2312
1278 Ga0496106_0142856 3300048909 Bacteria 1884
1279 Ga0496107_0001255 3300048910 Bacteria 15528
1280 Ga0496107_0002765 3300048910 Bacteria 11554
1281 Ga0496107_0010054 3300048910 Bacteria 6563
1282 Ga0496107_0015989 3300048910 Bacteria 5264
1283 Ga0496107_0019262 3300048910 Bacteria 4815
1284 Ga0496107_0037460 3300048910 Bacteria 3480
1285 Ga0496107_0041642 3300048910 Bacteria 3298
1286 Ga0496107_0441785 3300048910 Bacteria 967
1287 Ga0496107_0548652 3300048910 Bacteria 856
1288 Ga0496108_0002196 3300048911 Bacteria 15629
1289 Ga0496108_0010961 3300048911 Bacteria 7362
1290 Ga0496108_0013177 3300048911 Bacteria 6738
1291 Ga0496108_0041626 3300048911 Bacteria 3836
1292 Ga0496108_0173597 3300048911 Bacteria 1865
1293 Ga0496108_0177570 3300048911 Bacteria 1844
1294 Ga0496108_0191409 3300048911 Bacteria 1773
1295 Ga0496108_0251862 3300048911 Bacteria 1536
1296 Ga0496109_0001302 3300048912 Bacteria 20645
1297 Ga0496109_0010523 3300048912 Bacteria 7906
1298 Ga0496109_0018777 3300048912 Bacteria 6081
1299 Ga0496109_0043056 3300048912 Bacteria 4092
1300 Ga0496109_0068663 3300048912 Bacteria 3248
1301 Ga0496109_0307001 3300048912 Bacteria 1496
1302 Ga0496109_0547109 3300048912 Bacteria 1092
1303 Ga0496110_0043581 3300048913 Bacteria 3918
1304 Ga0496110_0065153 3300048913 Bacteria 3221
1305 Ga0496110_0072015 3300048913 Bacteria 3066
1306 Ga0496110_0170325 3300048913 Bacteria 1975
1307 Ga0496110_0231374 3300048913 Bacteria 1681
1308 Ga0496110_0276644 3300048913 Bacteria 1528
1309 Ga0496110_0426971 3300048913 Bacteria 1208
1310 Ga0496110_0449951 3300048913 Bacteria 1174
1311 Ga0496111_0002435 3300048914 Bacteria 11236
1312 Ga0496111_0008814 3300048914 Bacteria 6700
1313 Ga0496111_0024822 3300048914 Bacteria 4227
1314 Ga0496111_0064305 3300048914 Bacteria 2661
1315 Ga0496111_0226974 3300048914 Bacteria 1387
1316 Ga0496111_0333231 3300048914 Bacteria 1123
1317 Ga0496112_0004880 3300048915 Bacteria 11467
1318 Ga0496112_0005955 3300048915 Bacteria 10636
1319 Ga0496112_0046232 3300048915 Bacteria 4268
1320 Ga0496112_0055656 3300048915 Bacteria 3890
1321 Ga0496112_0075751 3300048915 Bacteria 3327
1322 Ga0496112_0076321 3300048915 Bacteria 3314
1323 Ga0496112_0092714 3300048915 Bacteria 2990
1324 Ga0496112_0133256 3300048915 Bacteria 2455
1325 Ga0496112_0393785 3300048915 Bacteria 1325
1326 Ga0496112_1236967 3300048915 Bacteria 663
1327 Ga0496113_0000394 3300048916 Bacteria 21064
1328 Ga0496113_0002343 3300048916 Bacteria 10959
1329 Ga0496113_0027510 3300048916 Bacteria 4078
1330 Ga0496113_0031970 3300048916 Bacteria 3822
1331 Ga0496113_0064283 3300048916 Bacteria 2774
1332 Ga0496113_0351528 3300048916 Bacteria 1182
1333 Ga0496114_0004563 3300048917 Bacteria 10757
1334 Ga0496114_0011722 3300048917 Bacteria 7011
1335 Ga0496114_0018298 3300048917 Bacteria 5664
1336 Ga0496114_0035965 3300048917 Bacteria 4092
1337 Ga0496114_0081983 3300048917 Bacteria 2725
1338 Ga0496114_0126945 3300048917 Bacteria 2199
1339 Ga0496114_0678046 3300048917 Bacteria 905
1340 Ga0496114_0787267 3300048917 Bacteria 829
1341 Ga0496114_1064643 3300048917 Bacteria 693
1342 Ga0496115_0004440 3300048918 Bacteria 10168
1343 Ga0496115_0005793 3300048918 Bacteria 8995
1344 Ga0496115_0015657 3300048918 Bacteria 5757
1345 Ga0496115_0187663 3300048918 Unclassified 1708
1346 Ga0496115_0214545 3300048918 Bacteria 1589
1347 Ga0496115_0267824 3300048918 Bacteria 1404
1348 Ga0496115_0396035 3300048918 Bacteria 1121
1349 Ga0496115_0484603 3300048918 Bacteria 995
1350 Ga0496116_0182617 3300048919 Bacteria 1121
1351 Ga0496118_0021970 3300048921 Bacteria 5595
1352 Ga0496119_0046748 3300048922 Bacteria 2699
1353 Ga0496121_0065288 3300048924 Bacteria 2962
1354 Ga0496121_0150220 3300048924 Bacteria 1715
1355 Ga0496121_0201088 3300048924 Bacteria 1420
1356 Ga0496121_0261538 3300048924 Bacteria 1194
1357 Ga0496121_0484065 3300048924 Bacteria 789
1358 Ga0496121_0521610 3300048924 Bacteria 749
1359 Ga0496122_0010630 3300048925 Bacteria 9454
1360 Ga0496123_0000699 3300048926 Bacteria 55169
1361 Ga0496124_0150105 3300048927 Bacteria 1829
1362 Ga0496124_0190898 3300048927 Bacteria 1568
1363 Ga0496125_0109970 3300048928 Bacteria 2000
1364 Ga0496126_0007417 3300048929 Bacteria 12031
1365 Ga0496126_0402706 3300048929 Bacteria 1109
1366 Ga0496126_0534638 3300048929 Bacteria 932
1367 Ga0501032_0065356 3300049569 Bacteria 2433
1368 Ga0501034_0065644 3300049571 Bacteria 3642
1369 Ga0501038_0103883 3300049574 Bacteria 2362
1370 Ga0501040_0024567 3300049576 Bacteria 4044
1371 Ga0501041_0096977 3300049577 Bacteria 1823
1372 Ga0501041_0629797 3300049577 Bacteria 685
1373 Ga0501043_0077627 3300049579 Bacteria 2609
1374 Ga0501047_0004728 3300049581 Bacteria 12808
1375 Ga0501048_0485860 3300049582 Bacteria 885
1376 Ga0501067_0163228 3300049583 Bacteria 1241
1377 Ga0501068_0223224 3300049584 Bacteria 1198
1378 Ga0501068_0375953 3300049584 Bacteria 915
1379 Ga0501070_0025239 3300049586 Bacteria 4983
1380 Ga0501070_0186440 3300049586 Bacteria 1706
1381 Ga0501071_0591937 3300049587 Bacteria 853
1382 Ga0501071_0658462 3300049587 Bacteria 806
1383 Ga0501072_0135586 3300049588 Bacteria 1963
1384 Ga0501073_0001633 3300049589 Bacteria 16626
1385 Ga0501074_0547975 3300049590 Bacteria 819
1386 Ga0501075_0030457 3300049591 Bacteria 3997
1387 Ga0501075_0062556 3300049591 Bacteria 2805
1388 Ga0501076_0109343 3300049592 Bacteria 2234
1389 Ga0501077_0014892 3300049593 Bacteria 4889
1390 Ga0501079_0010682 3300049741 Bacteria 6991
1391 Ga0501080_0163363 3300049742 Bacteria 2056
1392 Ga0501080_0253719 3300049742 Bacteria 1604
1393 Ga0501081_0008617 3300049743 Bacteria 6627
1394 Ga0501083_0093812 3300049744 Bacteria 1982
1395 Ga0501083_0095920 3300049744 Bacteria 1957
1396 Ga0501083_0112649 3300049744 Bacteria 1788
1397 Ga0501083_0126768 3300049744 Bacteria 1673
1398 Ga0501035_0224155 3300049822 Bacteria 1604
1399 Ga0501044_0006753 3300049823 Bacteria 12649
1400 Ga0501044_0037948 3300049823 Bacteria 5034
1401 Ga0501044_0346930 3300049823 Bacteria 1405
1402 Ga0501044_0365650 3300049823 Bacteria 1360
1403 Ga0501045_0701279 3300049824 Bacteria 747
1404 nmdc:mga03683_67278_c1 3300050489 Bacteria 1525
1405 nmdc:mga03n38_473825_c1 3300050490 Bacteria 699
1406 nmdc:mga03n38_57888_c1 3300050490 Bacteria 1754
1407 nmdc:mga03n38_900_c1 3300050490 Bacteria 8001
1408 nmdc:mga00v17_216763_c1 3300050491 Bacteria 1239
1409 nmdc:mga0yw44_149487_c1 3300050492 Bacteria 1523
1410 nmdc:mga0yw44_20390_c1 3300050492 Bacteria 3678
1411 nmdc:mga0yw44_2168_c1 3300050492 Bacteria 8242
1412 nmdc:mga0yw44_239384_c1 3300050492 Bacteria 1206
1413 nmdc:mga0k408_110847_c1 3300050493 Bacteria 1622
1414 nmdc:mga0k408_148432_c1 3300050493 Bacteria 1396
1415 nmdc:mga0k408_216802_c1 3300050493 Bacteria 1143
1416 nmdc:mga0k408_459212_c1 3300050493 Bacteria 756
1417 nmdc:mga0k408_493957_c1 3300050493 Bacteria 725
1418 nmdc:mga06z11_385242_c1 3300050494 Bacteria 843
1419 nmdc:mga04h51_35073_c1 3300050495 Bacteria 1606
1420 nmdc:mga04h51_57703_c1 3300050495 Bacteria 1321
1421 nmdc:mga07m45_83242_c1 3300050496 Bacteria 1828
1422 nmdc:mga05p37_129848_c1 3300050507 Bacteria 3092
1423 nmdc:mga05p37_4032_c1 3300050507 Bacteria 5627
1424 nmdc:mga05p37_465051_c1 3300050507 Bacteria 1461
1425 nmdc:mga05p37_595196_c1 3300050507 Bacteria 1249
1426 nmdc:mga05p37_92337_c1 3300050507 Bacteria 3730
1427 nmdc:mga09592_143025_c1 3300050508 Bacteria 2062
1428 nmdc:mga09592_4710_c1 3300050508 Bacteria 11047
1429 nmdc:mga0qj67_150443_c1 3300050509 Bacteria 1888
1430 nmdc:mga0qj67_552735_c1 3300050509 Bacteria 923
1431 nmdc:mga0qj67_646987_c1 3300050509 Bacteria 843
1432 nmdc:mga0qj67_768_c1 3300050509 Bacteria 21815
1433 nmdc:mga06r32_117900_c1 3300050510 Bacteria 2617
1434 nmdc:mga06r32_427368_c1 3300050510 Bacteria 1306
1435 nmdc:mga08y16_13725_c1 3300050511 Bacteria 8530
1436 nmdc:mga08y16_1880010_c1 3300050511 Bacteria 550
1437 nmdc:mga08y16_2116_c1 3300050511 Bacteria 20352
1438 nmdc:mga08y16_321381_c1 3300050511 Bacteria 1593
1439 nmdc:mga08y16_342219_c1 3300050511 Bacteria 1537
1440 nmdc:mga08y16_67671_c1 3300050511 Bacteria 3726
1441 nmdc:mga08y16_77404_c1 3300050511 Bacteria 3468
1442 nmdc:mga0n895_125016_c1 3300050512 Bacteria 2596
1443 nmdc:mga0n895_167480_c1 3300050512 Bacteria 2229
1444 nmdc:mga0n895_211894_c1 3300050512 Bacteria 1968
1445 nmdc:mga0n895_226459_c1 3300050512 Bacteria 1898
1446 nmdc:mga0n895_408739_c1 3300050512 Bacteria 1373
1447 nmdc:mga0rr50_1039_c1 3300050513 Bacteria 15047
1448 nmdc:mga0rr50_19830_c1 3300050513 Bacteria 4549
1449 nmdc:mga0rr50_379266_c1 3300050513 Bacteria 1192
1450 nmdc:mga0rr50_42391_c1 3300050513 Bacteria 3323
1451 nmdc:mga0rr50_85712_c1 3300050513 Bacteria 2442
1452 nmdc:mga0rr50_989646_c1 3300050513 Bacteria 717
1453 nmdc:mga08x19_114924_c1 3300050514 Bacteria 1798
1454 nmdc:mga08x19_157864_c1 3300050514 Bacteria 1539
1455 nmdc:mga08x19_38172_c1 3300050514 Bacteria 3050
1456 nmdc:mga08x19_50158_c1 3300050514 Bacteria 2678
1457 nmdc:mga0a205_12523_c1 3300050515 Bacteria 7851
1458 nmdc:mga0a205_153815_c1 3300050515 Bacteria 2199
1459 nmdc:mga0a205_293311_c1 3300050515 Bacteria 1501
1460 nmdc:mga0a205_719_c1 3300050515 Bacteria 26646
1461 nmdc:mga0sz30_16211_c1 3300050516 Bacteria 2955
1462 Ga0495601_0040671 3300053077 Bacteria 2912
1463 Ga0495601_0224068 3300053077 Bacteria 1228
1464 Ga0495601_0321479 3300053077 Bacteria 1007
1465 Ga0495612_0000795 3300053078 Bacteria 12832
1466 Ga0495612_0001561 3300053078 Bacteria 9432
1467 Ga0495612_0045685 3300053078 Bacteria 1793
1468 Ga0495612_0088008 3300053078 Bacteria 1311
1469 Ga0495655_0048895 3300053083 Bacteria 1111
1470 Ga0495595_0001780 3300053084 Bacteria 8401
1471 Ga0495595_0009392 3300053084 Bacteria 4045
1472 Ga0495595_0108490 3300053084 Bacteria 1344
1473 Ga0495595_0231695 3300053084 Bacteria 923
1474 Ga0495595_0247532 3300053084 Bacteria 892
1475 Ga0495619_0001605 3300053085 Bacteria 14871
1476 Ga0495619_0002808 3300053085 Bacteria 11348
1477 Ga0495619_0010084 3300053085 Bacteria 5948
1478 Ga0495619_0016499 3300053085 Bacteria 4676
1479 Ga0495619_0017496 3300053085 Bacteria 4538
1480 Ga0495619_0027239 3300053085 Bacteria 3680
1481 Ga0500643_068097 3300053087 Bacteria 990
1482 Ga0500644_0002004 3300053088 Bacteria 5187
1483 Ga0500646_0031443 3300053090 Bacteria 1461
1484 Ga0500583_0085791 3300053092 Bacteria 1527
1485 Ga0500583_0102302 3300053092 Bacteria 1404
1486 Ga0500566_0175753 3300053094 Bacteria 1103
1487 Ga0500566_0332379 3300053094 Bacteria 703
1488 Ga0500641_0002828 3300053096 Bacteria 6153
1489 Ga0500650_0242138 3300053098 Bacteria 811
1490 Ga0500555_093027 3300053103 Bacteria 773
1491 Ga0500593_000274 3300053117 Bacteria 21119
1492 Ga0500595_000002 3300053119 Bacteria 1074388
1493 Ga0500595_001169 3300053119 Bacteria 14529
1494 Ga0500595_008303 3300053119 Bacteria 4249
1495 Ga0500652_019791 3300053131 Bacteria 2507
1496 Ga0500652_094295 3300053131 Bacteria 1250
1497 Ga0500655_011673 3300053133 Bacteria 1594
1498 Ga0500658_0438589 3300053134 Bacteria 595
1499 Ga0500577_0065741 3300053142 Bacteria 1409
1500 Ga0500616_0000002 3300053153 Bacteria 1611257
1501 Ga0500616_0169368 3300053153 Bacteria 993
1502 Ga0500645_000410 3300053730 Bacteria 30009
1503 Ga0501084_0119599 3300054114 Bacteria 2214
1504 Ga0501082_0009855 3300060353 Bacteria 8233
1505 Ga0501082_0057803 3300060353 Bacteria 3341
1506 Ga0501082_0359557 3300060353 Bacteria 1270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_11180439 Ga0163162_111804391 155
2 3300037466 Ga0395898_0132734 Ga0395898_0132734_211_936 157
3 3300049743 Ga0501081_0008617 Ga0501081_0008617_4817_5344 157
4 3300005344 Ga0070661_100894393 Ga0070661_1008943931 159
5 3300005539 Ga0068853_100285340 Ga0068853_1002853402 159
6 3300025911 Ga0207654_10165849 Ga0207654_101658492 159
7 3300025920 Ga0207649_10271214 Ga0207649_102712142 159
8 3300025981 Ga0207640_10819529 Ga0207640_108195291 159
9 3300026041 Ga0207639_10823749 Ga0207639_108237492 159
10 3300009176 Ga0105242_10329538 Ga0105242_103295382 163
11 3300031247 Ga0265340_10066991 Ga0265340_100669912 164
12 3300005466 Ga0070685_10551607 Ga0070685_105516071 165
13 3300046674 Ga0495588_0159101 Ga0495588_0159101_242_835 166
14 3300048903 Ga0496100_0167121 Ga0496100_0167121_217_837 167
15 3300048917 Ga0496114_0011722 Ga0496114_0011722_381_1001 167
16 3300049587 Ga0501071_0658462 Ga0501071_0658462_122_742 167
17 3300005434 Ga0070709_10775126 Ga0070709_107751261 168
18 3300006163 Ga0070715_10010881 Ga0070715_100108813 168
19 3300006175 Ga0070712_100150703 Ga0070712_1001507032 168
20 3300025906 Ga0207699_10304265 Ga0207699_103042652 168
21 3300035083 Ga0373926_0038931 Ga0373926_0038931_339_932 168
22 3300035089 Ga0373944_0051511 Ga0373944_0051511_469_1062 168
23 3300035116 Ga0373945_0070449 Ga0373945_0070449_225_818 168
24 3300035171 Ga0373946_0161101 Ga0373946_0161101_61_654 168
25 3300035691 Ga0373931_0094083 Ga0373931_0094083_799_1407 168
26 3300035692 Ga0373935_0179385 Ga0373935_0179385_702_1295 168
27 3300037068 Ga0373925_0402494 Ga0373925_0402494_307_900 168
28 3300046455 Ga0495603_0037649 Ga0495603_0037649_1484_2077 168
29 3300046459 Ga0495629_0013360 Ga0495629_0013360_1867_2460 168
30 3300046463 Ga0495653_0288821 Ga0495653_0288821_289_882 168
31 3300046475 Ga0495639_0026424 Ga0495639_0026424_666_1259 168
32 3300046477 Ga0495664_0031811 Ga0495664_0031811_1467_2060 168
33 3300046499 Ga0495594_0277211 Ga0495594_0277211_151_744 168
34 3300046517 Ga0495630_0179847 Ga0495630_0179847_673_1266 168
35 3300046526 Ga0495666_0036764 Ga0495666_0036764_1766_2359 168
36 3300046529 Ga0495652_0222660 Ga0495652_0222660_599_1192 168
37 3300046531 Ga0495665_0228019 Ga0495665_0228019_355_948 168
38 3300046533 Ga0495640_0082760 Ga0495640_0082760_268_861 168
39 3300046642 Ga0495634_0297486 Ga0495634_0297486_20_613 168
40 3300046683 Ga0495658_0065055 Ga0495658_0065055_655_1248 168
41 3300046690 Ga0495624_0123376 Ga0495624_0123376_218_811 168
42 3300047315 Ga0495581_0392897 Ga0495581_0392897_132_725 168
43 3300047319 Ga0495674_0073520 Ga0495674_0073520_1466_2059 168
44 3300047321 Ga0495676_0030696 Ga0495676_0030696_1401_1994 168
45 3300047322 Ga0495680_0082709 Ga0495680_0082709_1325_1918 168
46 3300047471 Ga0495684_0101159 Ga0495684_0101159_562_1155 168
47 3300047673 Ga0495593_0139249 Ga0495593_0139249_114_707 168
48 3300048089 Ga0495614_0154867 Ga0495614_0154867_37_630 168
49 3300053077 Ga0495601_0040671 Ga0495601_0040671_483_1076 168
50 3300053078 Ga0495612_0088008 Ga0495612_0088008_254_847 168
51 3300053085 Ga0495619_0016499 Ga0495619_0016499_906_1499 168
52 3300037418 Ga0395900_1154503 Ga0395900_1154503_74_667 169
53 3300045976 Ga0466967_0970447 Ga0466967_0970447_204_797 169
54 3300009092 Ga0105250_10327236 Ga0105250_103272361 171
55 3300013297 Ga0157378_10075985 Ga0157378_100759852 171
56 3300025918 Ga0207662_10097343 Ga0207662_100973431 171
57 3300026023 Ga0207677_10457550 Ga0207677_104575502 171
58 3300046519 Ga0495632_0406252 Ga0495632_0406252_59_580 172
59 3300046559 Ga0495667_0534727 Ga0495667_0534727_202_723 172
60 3300046616 Ga0495668_0126421 Ga0495668_0126421_20_541 172
61 3300049571 Ga0501034_0065644 Ga0501034_0065644_2830_3414 172
62 3300049586 Ga0501070_0186440 Ga0501070_0186440_206_790 172
63 3300049742 Ga0501080_0253719 Ga0501080_0253719_992_1576 172
64 3300050511 nmdc:mga08y16_1880010_c1 nmdc:mga08y16_1880010_c1_17_538 172
65 3300053134 Ga0500658_0438589 Ga0500658_0438589_17_538 172
66 3300009098 Ga0105245_10157650 Ga0105245_101576502 173
67 3300014326 Ga0157380_10449421 Ga0157380_104494212 173
68 3300035692 Ga0373935_0219916 Ga0373935_0219916_320_952 173
69 3300048907 Ga0496104_1472259 Ga0496104_1472259_17_541 173
70 3300049824 Ga0501045_0701279 Ga0501045_0701279_65_703 173
71 3300053094 Ga0500566_0332379 Ga0500566_0332379_15_608 175
72 3300048913 Ga0496110_0072015 Ga0496110_0072015_1635_2255 176
73 3300053119 Ga0500595_000002 Ga0500595_000002_345731_346315 176
74 3300048928 Ga0496125_0109970 Ga0496125_0109970_1206_1823 177
75 3300053142 Ga0500577_0065741 Ga0500577_0065741_142_726 177
76 3300006175 Ga0070712_100519742 Ga0070712_1005197421 178
77 3300025906 Ga0207699_10052606 Ga0207699_100526063 178
78 3300025939 Ga0207665_10041611 Ga0207665_100416113 178
79 3300048905 Ga0496102_0375422 Ga0496102_0375422_711_1325 178
80 3300048907 Ga0496104_0406672 Ga0496104_0406672_317_931 178
81 3300048909 Ga0496106_0142856 Ga0496106_0142856_1125_1739 178
82 3300048915 Ga0496112_0092714 Ga0496112_0092714_225_839 178
83 3300048916 Ga0496113_0351528 Ga0496113_0351528_129_743 178
84 3300048918 Ga0496115_0396035 Ga0496115_0396035_301_915 178
85 3300053153 Ga0500616_0000002 Ga0500616_0000002_419564_420148 178
86 3300005327 Ga0070658_10542866 Ga0070658_105428662 179
87 3300005338 Ga0068868_100511377 Ga0068868_1005113772 179
88 3300013307 Ga0157372_10405850 Ga0157372_104058502 179
89 3300037471 Ga0395905_0023923 Ga0395905_0023923_876_1508 179
90 3300048908 Ga0496105_0146095 Ga0496105_0146095_807_1439 179
91 3300053131 Ga0500652_019791 Ga0500652_019791_935_1543 179
92 3300037312 Ga0395899_0072948 Ga0395899_0072948_1151_1786 180
93 3300037418 Ga0395900_0083563 Ga0395900_0083563_166_801 180
94 3300037466 Ga0395898_0007949 Ga0395898_0007949_2724_3359 180
95 3300037471 Ga0395905_0224049 Ga0395905_0224049_31_666 180
96 3300038443 Ga0395901_0173159 Ga0395901_0173159_1013_1648 180
97 3300005366 Ga0070659_100306809 Ga0070659_1003068092 181
98 3300048912 Ga0496109_0043056 Ga0496109_0043056_2297_2917 182
99 3300049569 Ga0501032_0065356 Ga0501032_0065356_1606_2190 182
100 3300005981 Ga0081538_10001263 Ga0081538_1000126313 183
101 3300027682 Ga0209971_1002180 Ga0209971_10021807 183
102 3300049583 Ga0501067_0163228 Ga0501067_0163228_501_1085 183
103 3300049588 Ga0501072_0135586 Ga0501072_0135586_158_742 183
104 3300049744 Ga0501083_0126768 Ga0501083_0126768_303_887 183
105 3300049823 Ga0501044_0037948 Ga0501044_0037948_1805_2389 183
106 3300060353 Ga0501082_0057803 Ga0501082_0057803_456_1040 183
107 3300035086 Ga0373934_0026332 Ga0373934_0026332_1585_2178 184
108 3300035086 Ga0373934_0156211 Ga0373934_0156211_122_745 184
109 3300035089 Ga0373944_0004381 Ga0373944_0004381_180_773 184
110 3300035111 Ga0373923_0095776 Ga0373923_0095776_348_941 184
111 3300035113 Ga0373936_0027457 Ga0373936_0027457_543_1136 184
112 3300035116 Ga0373945_0003925 Ga0373945_0003925_1166_1759 184
113 3300035118 Ga0373954_0019118 Ga0373954_0019118_2376_2969 184
114 3300035119 Ga0373956_0267467 Ga0373956_0267467_79_702 184
115 3300035170 Ga0373943_0147418 Ga0373943_0147418_72_665 184
116 3300035171 Ga0373946_0011386 Ga0373946_0011386_2477_3070 184
117 3300035172 Ga0373955_0349460 Ga0373955_0349460_243_836 184
118 3300035410 Ga0373924_0133752 Ga0373924_0133752_216_809 184
119 3300035692 Ga0373935_0023521 Ga0373935_0023521_1882_2475 184
120 3300035692 Ga0373935_0224761 Ga0373935_0224761_489_1112 184
121 3300035725 Ga0373947_0054777 Ga0373947_0054777_1396_1989 184
122 3300036401 Ga0373937_0003886 Ga0373937_0003886_2108_2731 184
123 3300046452 Ga0495617_045430 Ga0495617_045430_155_748 184
124 3300046454 Ga0495592_0019655 Ga0495592_0019655_3193_3786 184
125 3300046455 Ga0495603_0273410 Ga0495603_0273410_185_778 184
126 3300046459 Ga0495629_0036202 Ga0495629_0036202_419_1012 184
127 3300046461 Ga0495641_0017570 Ga0495641_0017570_1648_2241 184
128 3300046462 Ga0495651_0084924 Ga0495651_0084924_63_656 184
129 3300046463 Ga0495653_0005157 Ga0495653_0005157_1334_1927 184
130 3300046472 Ga0495580_0028360 Ga0495580_0028360_2373_2966 184
131 3300046473 Ga0495582_0334637 Ga0495582_0334637_185_778 184
132 3300046475 Ga0495639_0012808 Ga0495639_0012808_2604_3197 184
133 3300046476 Ga0495662_0009375 Ga0495662_0009375_2424_3017 184
134 3300046491 Ga0495584_0187363 Ga0495584_0187363_392_985 184
135 3300046492 Ga0495585_0011751 Ga0495585_0011751_3486_4079 184
136 3300046499 Ga0495594_0020228 Ga0495594_0020228_1786_2379 184
137 3300046501 Ga0495607_0020287 Ga0495607_0020287_650_1243 184
138 3300046511 Ga0495608_0021603 Ga0495608_0021603_2444_3037 184
139 3300046514 Ga0495618_0062799 Ga0495618_0062799_1347_1940 184
140 3300046517 Ga0495630_0014066 Ga0495630_0014066_4828_5421 184
141 3300046523 Ga0495644_0003443 Ga0495644_0003443_15_614 184
142 3300046526 Ga0495666_0010494 Ga0495666_0010494_2458_3051 184
143 3300046529 Ga0495652_0116472 Ga0495652_0116472_41_634 184
144 3300046531 Ga0495665_0016582 Ga0495665_0016582_2255_2848 184
145 3300046535 Ga0495586_0381647 Ga0495586_0381647_161_754 184
146 3300046536 Ga0495587_0130519 Ga0495587_0130519_601_1194 184
147 3300046543 Ga0495645_0127864 Ga0495645_0127864_1165_1758 184
148 3300046557 Ga0495622_0016818 Ga0495622_0016818_209_802 184
149 3300046558 Ga0495633_0050252 Ga0495633_0050252_974_1567 184
150 3300046559 Ga0495667_0003339 Ga0495667_0003339_9709_10302 184
151 3300046648 Ga0495611_0052551 Ga0495611_0052551_427_1020 184
152 3300046663 Ga0495635_0033322 Ga0495635_0033322_1882_2475 184
153 3300046674 Ga0495588_0121709 Ga0495588_0121709_364_957 184
154 3300046678 Ga0495599_0042206 Ga0495599_0042206_1290_1883 184
155 3300046680 Ga0495646_0014858 Ga0495646_0014858_4284_4877 184
156 3300046681 Ga0495647_0101203 Ga0495647_0101203_416_1009 184
157 3300046683 Ga0495658_0168145 Ga0495658_0168145_722_1315 184
158 3300046689 Ga0495613_0020707 Ga0495613_0020707_2600_3193 184
159 3300046690 Ga0495624_0035314 Ga0495624_0035314_2566_3159 184
160 3300046691 Ga0495670_0010427 Ga0495670_0010427_3595_4188 184
161 3300046794 Ga0495589_0086457 Ga0495589_0086457_150_743 184
162 3300046809 Ga0495600_0012176 Ga0495600_0012176_1539_2132 184
163 3300047315 Ga0495581_0022957 Ga0495581_0022957_324_917 184
164 3300047317 Ga0495604_0217693 Ga0495604_0217693_318_911 184
165 3300047318 Ga0495636_0204644 Ga0495636_0204644_112_705 184
166 3300047319 Ga0495674_0301131 Ga0495674_0301131_243_836 184
167 3300047321 Ga0495676_0038359 Ga0495676_0038359_1996_2589 184
168 3300047322 Ga0495680_0112322 Ga0495680_0112322_185_778 184
169 3300047471 Ga0495684_0002658 Ga0495684_0002658_13244_13837 184
170 3300047673 Ga0495593_0033479 Ga0495593_0033479_418_1011 184
171 3300053078 Ga0495612_0001561 Ga0495612_0001561_7447_8040 184
172 3300053084 Ga0495595_0009392 Ga0495595_0009392_2335_2928 184
173 3300053085 Ga0495619_0010084 Ga0495619_0010084_3992_4585 184
174 3300006852 Ga0075433_10975308 Ga0075433_109753081 185
175 3300035691 Ga0373931_0136999 Ga0373931_0136999_293_877 185
176 3300046683 Ga0495658_0175442 Ga0495658_0175442_24_584 185
177 3300005440 Ga0070705_100014665 Ga0070705_1000146656 186
178 3300005518 Ga0070699_100005151 Ga0070699_1000051513 186
179 3300006914 Ga0075436_100131444 Ga0075436_1001314443 186
180 3300007076 Ga0075435_100114060 Ga0075435_1001140602 186
181 3300007076 Ga0075435_100117179 Ga0075435_1001171791 186
182 3300009147 Ga0114129_10679670 Ga0114129_106796703 186
183 3300025937 Ga0207669_10335748 Ga0207669_103357482 186
184 3300026118 Ga0207675_100030016 Ga0207675_1000300162 186
185 3300035113 Ga0373936_0226977 Ga0373936_0226977_225_785 186
186 3300035692 Ga0373935_0287333 Ga0373935_0287333_356_943 186
187 3300048905 Ga0496102_0052345 Ga0496102_0052345_2967_3620 186
188 3300048907 Ga0496104_0066033 Ga0496104_0066033_266_919 186
189 3300048907 Ga0496104_0263190 Ga0496104_0263190_543_1196 186
190 3300048908 Ga0496105_0466777 Ga0496105_0466777_26_679 186
191 3300048911 Ga0496108_0177570 Ga0496108_0177570_787_1440 186
192 3300048912 Ga0496109_0547109 Ga0496109_0547109_37_690 186
193 3300048913 Ga0496110_0426971 Ga0496110_0426971_362_1015 186
194 3300048914 Ga0496111_0226974 Ga0496111_0226974_628_1281 186
195 3300048915 Ga0496112_0075751 Ga0496112_0075751_165_818 186
196 3300048917 Ga0496114_0678046 Ga0496114_0678046_93_746 186
197 3300050507 nmdc:mga05p37_595196_c1 nmdc:mga05p37_595196_c1_233_874 186
198 3300050513 nmdc:mga0rr50_989646_c1 nmdc:mga0rr50_989646_c1_119_706 186
199 3300050514 nmdc:mga08x19_38172_c1 nmdc:mga08x19_38172_c1_1646_2233 186
200 3300005355 Ga0070671_100484614 Ga0070671_1004846142 187
201 3300005445 Ga0070708_100301609 Ga0070708_1003016093 187
202 3300005536 Ga0070697_100180676 Ga0070697_1001806762 187
203 3300006871 Ga0075434_100326636 Ga0075434_1003266362 187
204 3300009147 Ga0114129_10207555 Ga0114129_102075551 187
205 3300009176 Ga0105242_10137941 Ga0105242_101379412 187
206 3300009177 Ga0105248_10089844 Ga0105248_100898443 187
207 3300025922 Ga0207646_10168325 Ga0207646_101683252 187
208 3300025934 Ga0207686_10310464 Ga0207686_103104642 187
209 3300035691 Ga0373931_0041535 Ga0373931_0041535_1422_2042 187
210 3300036401 Ga0373937_0420970 Ga0373937_0420970_137_730 187
211 3300039447 Ga0436361_0008631 Ga0436361_0008631_1365_2006 187
212 3300046664 Ga0495659_0003402 Ga0495659_0003402_2573_3166 187
213 3300048904 Ga0496101_0545065 Ga0496101_0545065_278_898 187
214 3300048905 Ga0496102_0172508 Ga0496102_0172508_1318_1938 187
215 3300048907 Ga0496104_0004505 Ga0496104_0004505_10756_11376 187
216 3300048909 Ga0496106_0094473 Ga0496106_0094473_16_606 187
217 3300048911 Ga0496108_0191409 Ga0496108_0191409_693_1313 187
218 3300049577 Ga0501041_0629797 Ga0501041_0629797_12_632 187
219 3300049591 Ga0501075_0030457 Ga0501075_0030457_1445_2065 187
220 3300049592 Ga0501076_0109343 Ga0501076_0109343_1395_2015 187
221 3300049593 Ga0501077_0014892 Ga0501077_0014892_47_667 187
222 3300049741 Ga0501079_0010682 Ga0501079_0010682_4203_4823 187
223 3300050513 nmdc:mga0rr50_379266_c1 nmdc:mga0rr50_379266_c1_443_1084 187
224 3300054114 Ga0501084_0119599 Ga0501084_0119599_149_769 187
225 3300060353 Ga0501082_0009855 Ga0501082_0009855_2981_3601 187
226 3300035114 Ga0373939_0182499 Ga0373939_0182499_191_760 188
227 3300035242 Ga0373962_0127147 Ga0373962_0127147_36_659 188
228 3300005844 Ga0068862_100013206 Ga0068862_1000132062 189
229 3300028380 Ga0268265_10170919 Ga0268265_101709192 189
230 3300031711 Ga0265314_10104897 Ga0265314_101048972 189
231 3300046460 Ga0495638_0010149 Ga0495638_0010149_4268_4852 189
232 3300046460 Ga0495638_0152367 Ga0495638_0152367_28_612 189
233 3300048906 Ga0496103_0490539 Ga0496103_0490539_40_612 189
234 3300049574 Ga0501038_0103883 Ga0501038_0103883_1324_1932 189
235 3300049579 Ga0501043_0077627 Ga0501043_0077627_922_1530 189
236 3300049581 Ga0501047_0004728 Ga0501047_0004728_7402_8010 189
237 3300049586 Ga0501070_0025239 Ga0501070_0025239_4226_4834 189
238 3300049742 Ga0501080_0163363 Ga0501080_0163363_13_621 189
239 3300049822 Ga0501035_0224155 Ga0501035_0224155_918_1526 189
240 3300049823 Ga0501044_0006753 Ga0501044_0006753_7834_8442 189
241 iso_pu_bacteria 3003665799 3003672326 189
242 3300046809 Ga0495600_0092106 Ga0495600_0092106_237_821 190
243 3300047322 Ga0495680_0071429 Ga0495680_0071429_1568_2152 190
244 3300053730 Ga0500645_000410 Ga0500645_000410_8652_9260 190
245 3300005329 Ga0070683_100776329 Ga0070683_1007763291 191
246 3300005334 Ga0068869_100079064 Ga0068869_1000790642 191
247 3300005334 Ga0068869_100464313 Ga0068869_1004643131 191
248 3300005340 Ga0070689_100549246 Ga0070689_1005492462 191
249 3300005353 Ga0070669_101043520 Ga0070669_1010435201 191
250 3300005355 Ga0070671_100619743 Ga0070671_1006197431 191
251 3300005356 Ga0070674_101064527 Ga0070674_1010645271 191
252 3300005365 Ga0070688_100152339 Ga0070688_1001523392 191
253 3300005365 Ga0070688_100559243 Ga0070688_1005592431 191
254 3300005367 Ga0070667_100183834 Ga0070667_1001838342 191
255 3300005367 Ga0070667_100365985 Ga0070667_1003659852 191
256 3300005444 Ga0070694_100258671 Ga0070694_1002586711 191
257 3300005455 Ga0070663_100544340 Ga0070663_1005443402 191
258 3300005456 Ga0070678_100547881 Ga0070678_1005478812 191
259 3300005546 Ga0070696_100180766 Ga0070696_1001807662 191
260 3300005548 Ga0070665_100012968 Ga0070665_1000129683 191
261 3300005577 Ga0068857_100288465 Ga0068857_1002884651 191
262 3300005615 Ga0070702_100125969 Ga0070702_1001259692 191
263 3300005719 Ga0068861_100142225 Ga0068861_1001422252 191
264 3300005719 Ga0068861_100456140 Ga0068861_1004561402 191
265 3300005719 Ga0068861_100579863 Ga0068861_1005798632 191
266 3300005719 Ga0068861_100596011 Ga0068861_1005960112 191
267 3300005840 Ga0068870_10078105 Ga0068870_100781052 191
268 3300005841 Ga0068863_100118460 Ga0068863_1001184602 191
269 3300005842 Ga0068858_100103118 Ga0068858_1001031182 191
270 3300005843 Ga0068860_100146466 Ga0068860_1001464663 191
271 3300006178 Ga0075367_10161551 Ga0075367_101615511 191
272 3300006195 Ga0075366_10346061 Ga0075366_103460611 191
273 3300006844 Ga0075428_100914195 Ga0075428_1009141952 191
274 3300006871 Ga0075434_100453414 Ga0075434_1004534142 191
275 3300006881 Ga0068865_100448001 Ga0068865_1004480011 191
276 3300009101 Ga0105247_10007741 Ga0105247_100077418 191
277 3300009101 Ga0105247_10775489 Ga0105247_107754891 191
278 3300013306 Ga0163162_10206364 Ga0163162_102063641 191
279 3300013306 Ga0163162_10661123 Ga0163162_106611231 191
280 3300014325 Ga0163163_10227523 Ga0163163_102275232 191
281 3300014968 Ga0157379_10097828 Ga0157379_100978282 191
282 3300025900 Ga0207710_10027741 Ga0207710_100277413 191
283 3300025900 Ga0207710_10314770 Ga0207710_103147701 191
284 3300025907 Ga0207645_10197517 Ga0207645_101975172 191
285 3300025908 Ga0207643_10103051 Ga0207643_101030512 191
286 3300025910 Ga0207684_10167323 Ga0207684_101673232 191
287 3300025919 Ga0207657_10243994 Ga0207657_102439941 191
288 3300025923 Ga0207681_10100954 Ga0207681_101009542 191
289 3300025932 Ga0207690_10345735 Ga0207690_103457351 191
290 3300025937 Ga0207669_10138591 Ga0207669_101385912 191
291 3300025938 Ga0207704_10274213 Ga0207704_102742132 191
292 3300025942 Ga0207689_10076767 Ga0207689_100767672 191
293 3300025942 Ga0207689_10236575 Ga0207689_102365752 191
294 3300025960 Ga0207651_10984408 Ga0207651_109844081 191
295 3300025961 Ga0207712_10685475 Ga0207712_106854752 191
296 3300025972 Ga0207668_10025031 Ga0207668_100250312 191
297 3300025972 Ga0207668_10257439 Ga0207668_102574391 191
298 3300026035 Ga0207703_10008946 Ga0207703_100089462 191
299 3300026067 Ga0207678_10056658 Ga0207678_100566583 191
300 3300026118 Ga0207675_100043624 Ga0207675_1000436243 191
301 3300026118 Ga0207675_100314621 Ga0207675_1003146212 191
302 3300028379 Ga0268266_10004625 Ga0268266_100046257 191
303 3300028379 Ga0268266_10028531 Ga0268266_100285314 191
304 3300028379 Ga0268266_10865929 Ga0268266_108659291 191
305 3300028380 Ga0268265_10220075 Ga0268265_102200751 191
306 3300028381 Ga0268264_10279821 Ga0268264_102798212 191
307 3300028381 Ga0268264_10769378 Ga0268264_107693782 191
308 3300031852 Ga0307410_10653654 Ga0307410_106536541 191
309 3300032002 Ga0307416_101000481 Ga0307416_1010004811 191
310 3300032005 Ga0307411_11102927 Ga0307411_111029271 191
311 3300032126 Ga0307415_100759077 Ga0307415_1007590772 191
312 3300035113 Ga0373936_0092131 Ga0373936_0092131_210_797 191
313 3300035691 Ga0373931_0402821 Ga0373931_0402821_219_842 191
314 3300037068 Ga0373925_0744496 Ga0373925_0744496_100_687 191
315 3300046455 Ga0495603_0056689 Ga0495603_0056689_1234_1821 191
316 3300046455 Ga0495603_0057399 Ga0495603_0057399_849_1436 191
317 3300046459 Ga0495629_0121691 Ga0495629_0121691_869_1456 191
318 3300046460 Ga0495638_0040049 Ga0495638_0040049_1633_2220 191
319 3300046492 Ga0495585_0048246 Ga0495585_0048246_1386_1973 191
320 3300046512 Ga0495610_0087255 Ga0495610_0087255_651_1238 191
321 3300046515 Ga0495620_0106144 Ga0495620_0106144_150_737 191
322 3300046519 Ga0495632_0078302 Ga0495632_0078302_404_991 191
323 3300046519 Ga0495632_0111294 Ga0495632_0111294_564_1151 191
324 3300046523 Ga0495644_0134612 Ga0495644_0134612_255_842 191
325 3300046524 Ga0495648_0167164 Ga0495648_0167164_374_961 191
326 3300046525 Ga0495663_0094872 Ga0495663_0094872_279_866 191
327 3300046526 Ga0495666_0116339 Ga0495666_0116339_606_1193 191
328 3300046537 Ga0495598_0088230 Ga0495598_0088230_269_856 191
329 3300046539 Ga0495621_0106772 Ga0495621_0106772_57_644 191
330 3300046615 Ga0495656_0035741 Ga0495656_0035741_375_962 191
331 3300046615 Ga0495656_0161462 Ga0495656_0161462_122_709 191
332 3300046648 Ga0495611_0176422 Ga0495611_0176422_83_670 191
333 3300046660 Ga0495625_0177779 Ga0495625_0177779_604_1191 191
334 3300046660 Ga0495625_0503512 Ga0495625_0503512_133_720 191
335 3300046663 Ga0495635_0105746 Ga0495635_0105746_96_683 191
336 3300046664 Ga0495659_0050049 Ga0495659_0050049_840_1427 191
337 3300046665 Ga0495661_0169881 Ga0495661_0169881_518_1105 191
338 3300046681 Ga0495647_0036932 Ga0495647_0036932_644_1231 191
339 3300046691 Ga0495670_0013237 Ga0495670_0013237_2791_3378 191
340 3300046694 Ga0495649_0277895 Ga0495649_0277895_247_834 191
341 3300047318 Ga0495636_0026545 Ga0495636_0026545_423_1010 191
342 3300047447 Ga0495685_096831 Ga0495685_096831_15_602 191
343 3300048907 Ga0496104_0367667 Ga0496104_0367667_272_859 191
344 3300048910 Ga0496107_0441785 Ga0496107_0441785_370_957 191
345 3300048913 Ga0496110_0231374 Ga0496110_0231374_897_1484 191
346 3300048918 Ga0496115_0187663 Ga0496115_0187663_996_1598 191
347 3300048924 Ga0496121_0150220 Ga0496121_0150220_978_1565 191
348 3300048924 Ga0496121_0201088 Ga0496121_0201088_811_1398 191
349 3300048924 Ga0496121_0261538 Ga0496121_0261538_568_1155 191
350 3300048924 Ga0496121_0521610 Ga0496121_0521610_11_598 191
351 3300048927 Ga0496124_0150105 Ga0496124_0150105_825_1412 191
352 3300048929 Ga0496126_0007417 Ga0496126_0007417_61_648 191
353 3300048929 Ga0496126_0534638 Ga0496126_0534638_321_908 191
354 3300050492 nmdc:mga0yw44_239384_c1 nmdc:mga0yw44_239384_c1_118_705 191
355 3300050493 nmdc:mga0k408_459212_c1 nmdc:mga0k408_459212_c1_129_716 191
356 3300053087 Ga0500643_068097 Ga0500643_068097_203_790 191
357 3300053090 Ga0500646_0031443 Ga0500646_0031443_595_1182 191
358 3300053092 Ga0500583_0085791 Ga0500583_0085791_533_1120 191
359 3300053092 Ga0500583_0102302 Ga0500583_0102302_108_695 191
360 3300053119 Ga0500595_001169 Ga0500595_001169_3052_3639 191
361 3300053133 Ga0500655_011673 Ga0500655_011673_988_1575 191
362 iso_pu_bacteria 2773857925 2774868500 191
363 iso_pu_bacteria 2876808645 2876813191 191
364 iso_pu_bacteria 2879110137 2879110355 191
365 iso_pu_bacteria 2882456835 2882460511 191
366 iso_pu_bacteria 2922386360 2922392233 191
367 iso_pu_bacteria 8006984368 8006990550 191
368 3300005330 Ga0070690_100375674 Ga0070690_1003756742 192
369 3300005334 Ga0068869_100023059 Ga0068869_1000230595 192
370 3300005338 Ga0068868_100053941 Ga0068868_1000539412 192
371 3300005345 Ga0070692_10083630 Ga0070692_100836301 192
372 3300005355 Ga0070671_101024128 Ga0070671_1010241281 192
373 3300005437 Ga0070710_10010865 Ga0070710_100108653 192
374 3300005439 Ga0070711_100140869 Ga0070711_1001408692 192
375 3300005455 Ga0070663_100020947 Ga0070663_1000209472 192
376 3300005456 Ga0070678_100051447 Ga0070678_1000514474 192
377 3300005467 Ga0070706_100409282 Ga0070706_1004092821 192
378 3300005547 Ga0070693_100193224 Ga0070693_1001932242 192
379 3300005548 Ga0070665_100015770 Ga0070665_1000157707 192
380 3300005548 Ga0070665_100031231 Ga0070665_1000312318 192
381 3300005563 Ga0068855_100065612 Ga0068855_1000656124 192
382 3300005564 Ga0070664_100234239 Ga0070664_1002342392 192
383 3300005614 Ga0068856_100059691 Ga0068856_1000596913 192
384 3300005616 Ga0068852_100191180 Ga0068852_1001911802 192
385 3300005834 Ga0068851_10244094 Ga0068851_102440942 192
386 3300005937 Ga0081455_10006075 Ga0081455_100060754 192
387 3300005937 Ga0081455_10034040 Ga0081455_100340402 192
388 3300005983 Ga0081540_1005549 Ga0081540_10055492 192
389 3300005983 Ga0081540_1008834 Ga0081540_10088347 192
390 3300005983 Ga0081540_1059689 Ga0081540_10596892 192
391 3300006038 Ga0075365_10049225 Ga0075365_100492253 192
392 3300006038 Ga0075365_10063140 Ga0075365_100631403 192
393 3300006042 Ga0075368_10062213 Ga0075368_100622132 192
394 3300006048 Ga0075363_100002157 Ga0075363_1000021572 192
395 3300006048 Ga0075363_100038988 Ga0075363_1000389882 192
396 3300006051 Ga0075364_10176770 Ga0075364_101767702 192
397 3300006051 Ga0075364_10281845 Ga0075364_102818451 192
398 3300006058 Ga0075432_10050851 Ga0075432_100508511 192
399 3300006175 Ga0070712_100012714 Ga0070712_1000127142 192
400 3300006177 Ga0075362_10059913 Ga0075362_100599132 192
401 3300006186 Ga0075369_10009009 Ga0075369_100090093 192
402 3300006195 Ga0075366_10095588 Ga0075366_100955882 192
403 3300006237 Ga0097621_100451891 Ga0097621_1004518912 192
404 3300006353 Ga0075370_10405111 Ga0075370_104051111 192
405 3300006844 Ga0075428_100093645 Ga0075428_1000936452 192
406 3300009093 Ga0105240_11715710 Ga0105240_117157101 192
407 3300009147 Ga0114129_10141666 Ga0114129_101416663 192
408 3300009174 Ga0105241_10344256 Ga0105241_103442562 192
409 3300009545 Ga0105237_10338448 Ga0105237_103384482 192
410 3300011119 Ga0105246_10030840 Ga0105246_100308402 192
411 3300013100 Ga0157373_10619101 Ga0157373_106191011 192
412 3300013104 Ga0157370_10014874 Ga0157370_100148749 192
413 3300014325 Ga0163163_10096909 Ga0163163_100969093 192
414 3300014325 Ga0163163_10176164 Ga0163163_101761642 192
415 3300025297 Ga0209758_1016560 Ga0209758_10165602 192
416 3300025915 Ga0207693_10003911 Ga0207693_100039113 192
417 3300025916 Ga0207663_10160475 Ga0207663_101604752 192
418 3300025920 Ga0207649_10274574 Ga0207649_102745742 192
419 3300025924 Ga0207694_10166927 Ga0207694_101669272 192
420 3300025931 Ga0207644_10668146 Ga0207644_106681462 192
421 3300025942 Ga0207689_10013204 Ga0207689_100132049 192
422 3300025945 Ga0207679_10043430 Ga0207679_100434302 192
423 3300025949 Ga0207667_10106805 Ga0207667_101068052 192
424 3300025972 Ga0207668_10102696 Ga0207668_101026962 192
425 3300026035 Ga0207703_10283672 Ga0207703_102836722 192
426 3300026067 Ga0207678_10021975 Ga0207678_100219752 192
427 3300026067 Ga0207678_10751888 Ga0207678_107518882 192
428 3300026078 Ga0207702_10044708 Ga0207702_100447083 192
429 3300026088 Ga0207641_10235182 Ga0207641_102351822 192
430 3300026095 Ga0207676_10304493 Ga0207676_103044932 192
431 3300026116 Ga0207674_10401253 Ga0207674_104012532 192
432 3300026121 Ga0207683_10794664 Ga0207683_107946642 192
433 3300028379 Ga0268266_10002460 Ga0268266_1000246024 192
434 3300028379 Ga0268266_10426394 Ga0268266_104263942 192
435 3300028380 Ga0268265_10078341 Ga0268265_100783412 192
436 3300028794 Ga0307515_10458819 Ga0307515_104588192 192
437 3300031665 Ga0316575_10068149 Ga0316575_100681492 192
438 3300031824 Ga0307413_10438084 Ga0307413_104380842 192
439 3300032133 Ga0316583_10060620 Ga0316583_100606202 192
440 3300033180 Ga0307510_10000998 Ga0307510_1000099824 192
441 3300035121 Ga0373960_0097727 Ga0373960_0097727_176_766 192
442 3300036401 Ga0373937_1137856 Ga0373937_1137856_70_657 192
443 3300037471 Ga0395905_0538647 Ga0395905_0538647_222_866 192
444 3300039437 Ga0436365_0222599 Ga0436365_0222599_27_629 192
445 3300039450 Ga0436363_0373741 Ga0436363_0373741_68_700 192
446 3300041413 Ga0439465_0100894 Ga0439465_0100894_319_909 192
447 3300044735 Ga0466968_0269607 Ga0466968_0269607_124_723 192
448 3300046455 Ga0495603_0182940 Ga0495603_0182940_90_680 192
449 3300046472 Ga0495580_0084572 Ga0495580_0084572_1254_1877 192
450 3300046524 Ga0495648_0285712 Ga0495648_0285712_57_647 192
451 3300046531 Ga0495665_0145503 Ga0495665_0145503_58_648 192
452 3300046557 Ga0495622_0144157 Ga0495622_0144157_442_1050 192
453 3300047445 Ga0495677_0168394 Ga0495677_0168394_58_648 192
454 3300047469 Ga0495673_0108827 Ga0495673_0108827_29_619 192
455 3300047472 Ga0495686_0298381 Ga0495686_0298381_73_663 192
456 3300048903 Ga0496100_0116480 Ga0496100_0116480_908_1498 192
457 3300048905 Ga0496102_0182708 Ga0496102_0182708_895_1485 192
458 3300048905 Ga0496102_0686753 Ga0496102_0686753_37_627 192
459 3300048909 Ga0496106_0050298 Ga0496106_0050298_1480_2070 192
460 3300048910 Ga0496107_0548652 Ga0496107_0548652_55_645 192
461 3300048911 Ga0496108_0251862 Ga0496108_0251862_349_939 192
462 3300048917 Ga0496114_1064643 Ga0496114_1064643_32_622 192
463 3300048918 Ga0496115_0267824 Ga0496115_0267824_308_898 192
464 3300048924 Ga0496121_0065288 Ga0496121_0065288_86_676 192
465 3300048925 Ga0496122_0010630 Ga0496122_0010630_8596_9201 192
466 3300048926 Ga0496123_0000699 Ga0496123_0000699_47780_48385 192
467 3300048927 Ga0496124_0190898 Ga0496124_0190898_77_667 192
468 3300049584 Ga0501068_0375953 Ga0501068_0375953_101_691 192
469 3300049589 Ga0501073_0001633 Ga0501073_0001633_9469_10086 192
470 3300049744 Ga0501083_0093812 Ga0501083_0093812_1372_1971 192
471 3300049823 Ga0501044_0346930 Ga0501044_0346930_650_1243 192
472 3300050489 nmdc:mga03683_67278_c1 nmdc:mga03683_67278_c1_69_659 192
473 3300050490 nmdc:mga03n38_473825_c1 nmdc:mga03n38_473825_c1_27_641 192
474 3300050490 nmdc:mga03n38_57888_c1 nmdc:mga03n38_57888_c1_675_1265 192
475 3300050490 nmdc:mga03n38_900_c1 nmdc:mga03n38_900_c1_858_1448 192
476 3300050491 nmdc:mga00v17_216763_c1 nmdc:mga00v17_216763_c1_173_763 192
477 3300050492 nmdc:mga0yw44_20390_c1 nmdc:mga0yw44_20390_c1_43_633 192
478 3300050492 nmdc:mga0yw44_2168_c1 nmdc:mga0yw44_2168_c1_7607_8197 192
479 3300050493 nmdc:mga0k408_110847_c1 nmdc:mga0k408_110847_c1_531_1121 192
480 3300050493 nmdc:mga0k408_148432_c1 nmdc:mga0k408_148432_c1_72_662 192
481 3300050493 nmdc:mga0k408_216802_c1 nmdc:mga0k408_216802_c1_357_947 192
482 3300050494 nmdc:mga06z11_385242_c1 nmdc:mga06z11_385242_c1_208_798 192
483 3300050495 nmdc:mga04h51_35073_c1 nmdc:mga04h51_35073_c1_523_1113 192
484 3300050507 nmdc:mga05p37_92337_c1 nmdc:mga05p37_92337_c1_1207_1797 192
485 3300050509 nmdc:mga0qj67_646987_c1 nmdc:mga0qj67_646987_c1_240_830 192
486 3300050516 nmdc:mga0sz30_16211_c1 nmdc:mga0sz30_16211_c1_90_680 192
487 3300053078 Ga0495612_0045685 Ga0495612_0045685_661_1248 192
488 3300053084 Ga0495595_0247532 Ga0495595_0247532_15_602 192
489 3300053103 Ga0500555_093027 Ga0500555_093027_128_718 192
490 iso_pu_bacteria 2721755755 2723845924 192
491 iso_pu_bacteria 2765235802 2765465450 192
492 iso_pu_bacteria 2767802442 2770197687 192
493 iso_pu_bacteria 2775506902 2776271712 192
494 iso_pu_bacteria 2775506904 2776279775 192
495 iso_pu_bacteria 2839993093 2839995691 192
496 iso_pu_bacteria 2840764183 2840769965 192
497 iso_pu_bacteria 2842871566 2842872802 192
498 iso_pu_bacteria 2874604998 2874609423 192
499 iso_pu_bacteria 2894652903 2894654623 192
500 iso_pu_bacteria 2904578770 2904581592 192
501 iso_pu_bacteria 2919119836 2919122826 192
502 iso_pu_bacteria 8006994254 8006996307 192
503 3300002075 JGI24738J21930_10011716 JGI24738J21930_100117161 193
504 3300002077 JGI24744J21845_10013759 JGI24744J21845_100137591 193
505 3300003578 Ga0006562J51391_1072694 Ga0006562J51391_10726943 193
506 3300005295 Ga0065707_10519568 Ga0065707_105195681 193
507 3300005327 Ga0070658_10304524 Ga0070658_103045242 193
508 3300005328 Ga0070676_10048243 Ga0070676_100482434 193
509 3300005329 Ga0070683_100025517 Ga0070683_1000255173 193
510 3300005330 Ga0070690_100000533 Ga0070690_1000005334 193
511 3300005331 Ga0070670_100001563 Ga0070670_1000015633 193
512 3300005334 Ga0068869_100014062 Ga0068869_1000140624 193
513 3300005335 Ga0070666_10000893 Ga0070666_100008932 193
514 3300005336 Ga0070680_100016082 Ga0070680_1000160822 193
515 3300005337 Ga0070682_100000573 Ga0070682_10000057322 193
516 3300005338 Ga0068868_100002842 Ga0068868_10000284211 193
517 3300005339 Ga0070660_100003177 Ga0070660_1000031774 193
518 3300005340 Ga0070689_100000136 Ga0070689_10000013613 193
519 3300005341 Ga0070691_10000418 Ga0070691_100004183 193
520 3300005343 Ga0070687_100002615 Ga0070687_1000026153 193
521 3300005344 Ga0070661_100002616 Ga0070661_1000026164 193
522 3300005345 Ga0070692_10002091 Ga0070692_100020911 193
523 3300005347 Ga0070668_100000188 Ga0070668_10000018815 193
524 3300005353 Ga0070669_100001556 Ga0070669_10000155610 193
525 3300005354 Ga0070675_100045291 Ga0070675_1000452914 193
526 3300005355 Ga0070671_100008445 Ga0070671_1000084453 193
527 3300005356 Ga0070674_100032220 Ga0070674_1000322203 193
528 3300005364 Ga0070673_100003390 Ga0070673_1000033906 193
529 3300005365 Ga0070688_100000981 Ga0070688_1000009814 193
530 3300005366 Ga0070659_100041455 Ga0070659_1000414552 193
531 3300005367 Ga0070667_100001681 Ga0070667_1000016814 193
532 3300005434 Ga0070709_10004792 Ga0070709_100047923 193
533 3300005435 Ga0070714_100009986 Ga0070714_1000099865 193
534 3300005438 Ga0070701_10001284 Ga0070701_100012844 193
535 3300005439 Ga0070711_100000961 Ga0070711_10000096116 193
536 3300005440 Ga0070705_100009498 Ga0070705_1000094981 193
537 3300005441 Ga0070700_100004996 Ga0070700_1000049962 193
538 3300005444 Ga0070694_100000659 Ga0070694_10000065917 193
539 3300005445 Ga0070708_100541419 Ga0070708_1005414192 193
540 3300005455 Ga0070663_100001220 Ga0070663_10000122016 193
541 3300005456 Ga0070678_100000682 Ga0070678_10000068218 193
542 3300005456 Ga0070678_100684868 Ga0070678_1006848682 193
543 3300005457 Ga0070662_100000339 Ga0070662_1000003393 193
544 3300005458 Ga0070681_10024612 Ga0070681_100246123 193
545 3300005459 Ga0068867_100005776 Ga0068867_10000577610 193
546 3300005466 Ga0070685_10047091 Ga0070685_100470911 193
547 3300005518 Ga0070699_100243455 Ga0070699_1002434552 193
548 3300005530 Ga0070679_100363214 Ga0070679_1003632142 193
549 3300005535 Ga0070684_100023896 Ga0070684_1000238962 193
550 3300005539 Ga0068853_100002127 Ga0068853_10000212713 193
551 3300005543 Ga0070672_100008180 Ga0070672_1000081804 193
552 3300005544 Ga0070686_100000707 Ga0070686_1000007073 193
553 3300005545 Ga0070695_100000995 Ga0070695_1000009953 193
554 3300005546 Ga0070696_100000743 Ga0070696_1000007434 193
555 3300005547 Ga0070693_100000993 Ga0070693_10000099310 193
556 3300005548 Ga0070665_100011802 Ga0070665_1000118022 193
557 3300005549 Ga0070704_100000607 Ga0070704_10000060714 193
558 3300005563 Ga0068855_100003471 Ga0068855_10000347116 193
559 3300005564 Ga0070664_100044843 Ga0070664_1000448433 193
560 3300005578 Ga0068854_100005622 Ga0068854_1000056224 193
561 3300005614 Ga0068856_100004777 Ga0068856_1000047777 193
562 3300005615 Ga0070702_100000022 Ga0070702_10000002224 193
563 3300005616 Ga0068852_100006412 Ga0068852_1000064124 193
564 3300005617 Ga0068859_100043181 Ga0068859_1000431814 193
565 3300005618 Ga0068864_100004252 Ga0068864_1000042523 193
566 3300005718 Ga0068866_10010382 Ga0068866_100103824 193
567 3300005719 Ga0068861_100001574 Ga0068861_1000015748 193
568 3300005834 Ga0068851_10012493 Ga0068851_100124934 193
569 3300005841 Ga0068863_100001307 Ga0068863_10000130722 193
570 3300005842 Ga0068858_100001450 Ga0068858_10000145016 193
571 3300005843 Ga0068860_100067009 Ga0068860_1000670094 193
572 3300005983 Ga0081540_1007633 Ga0081540_10076334 193
573 3300006051 Ga0075364_10362623 Ga0075364_103626232 193
574 3300006058 Ga0075432_10009083 Ga0075432_100090832 193
575 3300006163 Ga0070715_10001884 Ga0070715_100018844 193
576 3300006173 Ga0070716_100001144 Ga0070716_1000011444 193
577 3300006175 Ga0070712_100006971 Ga0070712_1000069714 193
578 3300006237 Ga0097621_100130845 Ga0097621_1001308453 193
579 3300006358 Ga0068871_100116665 Ga0068871_1001166652 193
580 3300006844 Ga0075428_100697545 Ga0075428_1006975452 193
581 3300006847 Ga0075431_100025139 Ga0075431_1000251393 193
582 3300006852 Ga0075433_10156830 Ga0075433_101568302 193
583 3300006871 Ga0075434_100103418 Ga0075434_1001034183 193
584 3300006880 Ga0075429_100178387 Ga0075429_1001783874 193
585 3300006914 Ga0075436_100027016 Ga0075436_1000270164 193
586 3300006931 Ga0097620_100043182 Ga0097620_1000431824 193
587 3300007076 Ga0075435_100020401 Ga0075435_1000204014 193
588 3300009092 Ga0105250_10026850 Ga0105250_100268503 193
589 3300009093 Ga0105240_10031786 Ga0105240_100317862 193
590 3300009094 Ga0111539_10391019 Ga0111539_103910192 193
591 3300009098 Ga0105245_10002367 Ga0105245_100023676 193
592 3300009101 Ga0105247_10001141 Ga0105247_100011417 193
593 3300009148 Ga0105243_10000417 Ga0105243_1000041731 193
594 3300009174 Ga0105241_10000456 Ga0105241_1000045611 193
595 3300009176 Ga0105242_10002247 Ga0105242_1000224712 193
596 3300009177 Ga0105248_10000293 Ga0105248_1000029317 193
597 3300009545 Ga0105237_10000712 Ga0105237_1000071212 193
598 3300009551 Ga0105238_10008146 Ga0105238_100081465 193
599 3300009553 Ga0105249_10049172 Ga0105249_100491724 193
600 3300010375 Ga0105239_10024373 Ga0105239_100243734 193
601 3300011119 Ga0105246_10000118 Ga0105246_1000011821 193
602 3300013102 Ga0157371_10005561 Ga0157371_100055612 193
603 3300013105 Ga0157369_10034660 Ga0157369_100346604 193
604 3300013296 Ga0157374_10004169 Ga0157374_100041693 193
605 3300013297 Ga0157378_10000643 Ga0157378_1000064325 193
606 3300013306 Ga0163162_10009748 Ga0163162_100097486 193
607 3300013307 Ga0157372_10001248 Ga0157372_1000124823 193
608 3300013308 Ga0157375_10124184 Ga0157375_101241841 193
609 3300014325 Ga0163163_10005028 Ga0163163_100050285 193
610 3300014325 Ga0163163_10471930 Ga0163163_104719302 193
611 3300014326 Ga0157380_10001138 Ga0157380_1000113822 193
612 3300014745 Ga0157377_10000982 Ga0157377_100009829 193
613 3300014968 Ga0157379_10000933 Ga0157379_1000093321 193
614 3300014969 Ga0157376_10001069 Ga0157376_100010695 193
615 3300014969 Ga0157376_10714668 Ga0157376_107146682 193
616 3300025253 Ga0209677_100646 Ga0209677_10064611 193
617 3300025315 Ga0207697_10012377 Ga0207697_100123774 193
618 3300025321 Ga0207656_10063337 Ga0207656_100633372 193
619 3300025901 Ga0207688_10000764 Ga0207688_100007642 193
620 3300025903 Ga0207680_10240928 Ga0207680_102409282 193
621 3300025904 Ga0207647_10001565 Ga0207647_1000156519 193
622 3300025906 Ga0207699_10029787 Ga0207699_100297873 193
623 3300025907 Ga0207645_10035619 Ga0207645_100356194 193
624 3300025909 Ga0207705_10396043 Ga0207705_103960432 193
625 3300025911 Ga0207654_10053975 Ga0207654_100539752 193
626 3300025912 Ga0207707_10051812 Ga0207707_100518123 193
627 3300025915 Ga0207693_10000703 Ga0207693_1000070312 193
628 3300025916 Ga0207663_10001248 Ga0207663_1000124811 193
629 3300025917 Ga0207660_10028108 Ga0207660_100281083 193
630 3300025918 Ga0207662_10002213 Ga0207662_100022133 193
631 3300025919 Ga0207657_10000304 Ga0207657_1000030439 193
632 3300025920 Ga0207649_10002403 Ga0207649_100024034 193
633 3300025921 Ga0207652_10043155 Ga0207652_100431552 193
634 3300025923 Ga0207681_10044828 Ga0207681_100448281 193
635 3300025924 Ga0207694_10009066 Ga0207694_100090664 193
636 3300025925 Ga0207650_10069957 Ga0207650_100699572 193
637 3300025927 Ga0207687_10001882 Ga0207687_1000188214 193
638 3300025929 Ga0207664_10232042 Ga0207664_102320421 193
639 3300025931 Ga0207644_10001431 Ga0207644_1000143115 193
640 3300025932 Ga0207690_10003254 Ga0207690_100032544 193
641 3300025933 Ga0207706_10000263 Ga0207706_1000026338 193
642 3300025934 Ga0207686_10027400 Ga0207686_100274004 193
643 3300025935 Ga0207709_10004092 Ga0207709_100040924 193
644 3300025936 Ga0207670_10004344 Ga0207670_100043444 193
645 3300025937 Ga0207669_10001156 Ga0207669_100011566 193
646 3300025939 Ga0207665_10000219 Ga0207665_1000021910 193
647 3300025940 Ga0207691_10002753 Ga0207691_1000275314 193
648 3300025941 Ga0207711_10008692 Ga0207711_100086924 193
649 3300025942 Ga0207689_10010207 Ga0207689_100102074 193
650 3300025944 Ga0207661_10027285 Ga0207661_100272854 193
651 3300025960 Ga0207651_10000820 Ga0207651_1000082011 193
652 3300025961 Ga0207712_10013354 Ga0207712_100133544 193
653 3300025972 Ga0207668_10047738 Ga0207668_100477383 193
654 3300025981 Ga0207640_10039179 Ga0207640_100391794 193
655 3300025986 Ga0207658_10037471 Ga0207658_100374713 193
656 3300026035 Ga0207703_10005045 Ga0207703_100050453 193
657 3300026041 Ga0207639_10051164 Ga0207639_100511643 193
658 3300026067 Ga0207678_10000209 Ga0207678_1000020917 193
659 3300026075 Ga0207708_10000953 Ga0207708_1000095321 193
660 3300026078 Ga0207702_10007071 Ga0207702_100070718 193
661 3300026088 Ga0207641_10007322 Ga0207641_100073223 193
662 3300026089 Ga0207648_10013547 Ga0207648_100135477 193
663 3300026095 Ga0207676_10081013 Ga0207676_100810133 193
664 3300026116 Ga0207674_10000719 Ga0207674_1000071924 193
665 3300026118 Ga0207675_100001925 Ga0207675_10000192524 193
666 3300027907 Ga0207428_10029008 Ga0207428_100290082 193
667 3300028380 Ga0268265_10033810 Ga0268265_100338103 193
668 3300031247 Ga0265340_10023714 Ga0265340_100237143 193
669 3300031711 Ga0265314_10009907 Ga0265314_100099073 193
670 3300031727 Ga0316576_10009892 Ga0316576_100098922 193
671 3300034817 Ga0373948_0024827 Ga0373948_0024827_317_931 193
672 3300035116 Ga0373945_0138105 Ga0373945_0138105_53_670 193
673 3300035171 Ga0373946_0058208 Ga0373946_0058208_631_1245 193
674 3300035691 Ga0373931_0007352 Ga0373931_0007352_2268_2882 193
675 3300035691 Ga0373931_0163090 Ga0373931_0163090_52_690 193
676 3300035692 Ga0373935_0361731 Ga0373935_0361731_281_898 193
677 3300035695 Ga0373927_0041206 Ga0373927_0041206_512_1126 193
678 3300035725 Ga0373947_0001465 Ga0373947_0001465_390_1004 193
679 3300036647 Ga0316582_0311503 Ga0316582_0311503_315_923 193
680 3300036712 Ga0316584_0013488 Ga0316584_0013488_584_1192 193
681 3300037068 Ga0373925_0475603 Ga0373925_0475603_237_851 193
682 3300037418 Ga0395900_0018616 Ga0395900_0018616_4786_5400 193
683 3300037466 Ga0395898_0051498 Ga0395898_0051498_101_715 193
684 3300037471 Ga0395905_0002720 Ga0395905_0002720_2382_2996 193
685 3300037471 Ga0395905_0930992 Ga0395905_0930992_107_724 193
686 3300037853 Ga0436364_1400093 Ga0436364_1400093_429_1016 193
687 3300038443 Ga0395901_0126562 Ga0395901_0126562_1197_1811 193
688 3300042876 Ga0451577_0320187 Ga0451577_0320187_159_776 193
689 3300044712 Ga0453684_0083097 Ga0453684_0083097_1032_1649 193
690 3300045051 Ga0451576_0056877 Ga0451576_0056877_1972_2586 193
691 3300046455 Ga0495603_0007479 Ga0495603_0007479_1268_1882 193
692 3300046459 Ga0495629_0003853 Ga0495629_0003853_687_1301 193
693 3300046461 Ga0495641_0011539 Ga0495641_0011539_1321_1935 193
694 3300046472 Ga0495580_0000835 Ga0495580_0000835_16203_16817 193
695 3300046473 Ga0495582_0007761 Ga0495582_0007761_1165_1779 193
696 3300046475 Ga0495639_0032725 Ga0495639_0032725_518_1132 193
697 3300046476 Ga0495662_0129337 Ga0495662_0129337_448_1074 193
698 3300046499 Ga0495594_0035972 Ga0495594_0035972_763_1377 193
699 3300046531 Ga0495665_0075432 Ga0495665_0075432_955_1569 193
700 3300046533 Ga0495640_0311774 Ga0495640_0311774_248_865 193
701 3300046535 Ga0495586_0077699 Ga0495586_0077699_193_819 193
702 3300046557 Ga0495622_0000576 Ga0495622_0000576_6334_6948 193
703 3300046642 Ga0495634_0050997 Ga0495634_0050997_1648_2262 193
704 3300046663 Ga0495635_0037535 Ga0495635_0037535_1754_2368 193
705 3300046674 Ga0495588_0013011 Ga0495588_0013011_1159_1773 193
706 3300046681 Ga0495647_0001850 Ga0495647_0001850_155_769 193
707 3300046683 Ga0495658_0014876 Ga0495658_0014876_985_1599 193
708 3300046689 Ga0495613_0001504 Ga0495613_0001504_16384_16998 193
709 3300047315 Ga0495581_0007632 Ga0495581_0007632_891_1505 193
710 3300047319 Ga0495674_0140303 Ga0495674_0140303_569_1195 193
711 3300047321 Ga0495676_0043807 Ga0495676_0043807_2646_3260 193
712 3300047673 Ga0495593_0002967 Ga0495593_0002967_751_1365 193
713 3300048903 Ga0496100_0018933 Ga0496100_0018933_2412_3026 193
714 3300048903 Ga0496100_0459083 Ga0496100_0459083_11_625 193
715 3300048904 Ga0496101_0007889 Ga0496101_0007889_2748_3362 193
716 3300048905 Ga0496102_0434974 Ga0496102_0434974_469_1083 193
717 3300048910 Ga0496107_0010054 Ga0496107_0010054_4878_5492 193
718 3300048912 Ga0496109_0018777 Ga0496109_0018777_5127_5741 193
719 3300048914 Ga0496111_0333231 Ga0496111_0333231_41_655 193
720 3300048915 Ga0496112_0055656 Ga0496112_0055656_2333_2947 193
721 3300048917 Ga0496114_0126945 Ga0496114_0126945_149_763 193
722 3300048918 Ga0496115_0005793 Ga0496115_0005793_469_1083 193
723 3300048919 Ga0496116_0182617 Ga0496116_0182617_256_852 193
724 3300048921 Ga0496118_0021970 Ga0496118_0021970_2620_3216 193
725 3300048922 Ga0496119_0046748 Ga0496119_0046748_1998_2594 193
726 3300048924 Ga0496121_0484065 Ga0496121_0484065_94_690 193
727 3300048929 Ga0496126_0402706 Ga0496126_0402706_395_997 193
728 3300050508 nmdc:mga09592_143025_c1 nmdc:mga09592_143025_c1_1357_1971 193
729 3300050509 nmdc:mga0qj67_552735_c1 nmdc:mga0qj67_552735_c1_268_882 193
730 3300050510 nmdc:mga06r32_427368_c1 nmdc:mga06r32_427368_c1_551_1165 193
731 3300050511 nmdc:mga08y16_67671_c1 nmdc:mga08y16_67671_c1_1437_2051 193
732 3300050513 nmdc:mga0rr50_85712_c1 nmdc:mga0rr50_85712_c1_1086_1700 193
733 3300050514 nmdc:mga08x19_50158_c1 nmdc:mga08x19_50158_c1_625_1239 193
734 3300050515 nmdc:mga0a205_293311_c1 nmdc:mga0a205_293311_c1_337_951 193
735 3300053084 Ga0495595_0108490 Ga0495595_0108490_28_645 193
736 3300053085 Ga0495619_0002808 Ga0495619_0002808_9728_10345 193
737 3300053088 Ga0500644_0002004 Ga0500644_0002004_2265_2849 193
738 3300053094 Ga0500566_0175753 Ga0500566_0175753_103_717 193
739 3300053119 Ga0500595_008303 Ga0500595_008303_2946_3530 193
740 3300053153 Ga0500616_0169368 Ga0500616_0169368_98_682 193
741 iso_pu_bacteria 2643221547 2643756579 193
742 iso_pu_bacteria 2828305725 2828305786 193
743 iso_pu_bacteria 8056689827 8056695786 193
744 3300005365 Ga0070688_100141008 Ga0070688_1001410081 194
745 3300005434 Ga0070709_10029345 Ga0070709_100293453 194
746 3300005435 Ga0070714_100009596 Ga0070714_1000095963 194
747 3300005436 Ga0070713_100010983 Ga0070713_1000109834 194
748 3300005437 Ga0070710_10024828 Ga0070710_100248283 194
749 3300005459 Ga0068867_100119450 Ga0068867_1001194502 194
750 3300005518 Ga0070699_100003740 Ga0070699_1000037401 194
751 3300005546 Ga0070696_100551444 Ga0070696_1005514441 194
752 3300005548 Ga0070665_100223967 Ga0070665_1002239672 194
753 3300006173 Ga0070716_100003890 Ga0070716_1000038909 194
754 3300006852 Ga0075433_10464983 Ga0075433_104649832 194
755 3300006871 Ga0075434_100465532 Ga0075434_1004655322 194
756 3300009094 Ga0111539_11144462 Ga0111539_111444621 194
757 3300009101 Ga0105247_10028441 Ga0105247_100284414 194
758 3300009176 Ga0105242_10816779 Ga0105242_108167792 194
759 3300009177 Ga0105248_10064060 Ga0105248_100640605 194
760 3300009551 Ga0105238_10757331 Ga0105238_107573312 194
761 3300012515 Ga0157338_1011623 Ga0157338_10116231 194
762 3300013297 Ga0157378_10369456 Ga0157378_103694562 194
763 3300013308 Ga0157375_10002635 Ga0157375_1000263520 194
764 3300014326 Ga0157380_10492797 Ga0157380_104927971 194
765 3300014968 Ga0157379_10173780 Ga0157379_101737802 194
766 3300014969 Ga0157376_10067815 Ga0157376_100678156 194
767 3300025900 Ga0207710_10011822 Ga0207710_100118224 194
768 3300025905 Ga0207685_10008128 Ga0207685_100081283 194
769 3300025924 Ga0207694_10517013 Ga0207694_105170132 194
770 3300025928 Ga0207700_10456861 Ga0207700_104568612 194
771 3300025929 Ga0207664_10259026 Ga0207664_102590263 194
772 3300025939 Ga0207665_10001692 Ga0207665_100016925 194
773 3300026035 Ga0207703_10152745 Ga0207703_101527451 194
774 3300026041 Ga0207639_10019760 Ga0207639_100197606 194
775 3300026095 Ga0207676_10530292 Ga0207676_105302921 194
776 3300031090 Ga0265760_10103908 Ga0265760_101039081 194
777 3300048903 Ga0496100_0027178 Ga0496100_0027178_2533_3162 194
778 3300048904 Ga0496101_0024749 Ga0496101_0024749_2660_3289 194
779 3300048904 Ga0496101_0220075 Ga0496101_0220075_580_1221 194
780 3300048905 Ga0496102_0027192 Ga0496102_0027192_3394_4023 194
781 3300048905 Ga0496102_0192167 Ga0496102_0192167_805_1446 194
782 3300048906 Ga0496103_0052786 Ga0496103_0052786_1103_1732 194
783 3300048907 Ga0496104_0023771 Ga0496104_0023771_1144_1773 194
784 3300048908 Ga0496105_0023768 Ga0496105_0023768_1652_2281 194
785 3300048909 Ga0496106_0049066 Ga0496106_0049066_145_774 194
786 3300048910 Ga0496107_0041642 Ga0496107_0041642_151_780 194
787 3300048911 Ga0496108_0041626 Ga0496108_0041626_1973_2602 194
788 3300048912 Ga0496109_0010523 Ga0496109_0010523_245_874 194
789 3300048913 Ga0496110_0449951 Ga0496110_0449951_431_1072 194
790 3300048915 Ga0496112_0076321 Ga0496112_0076321_2184_2813 194
791 3300048916 Ga0496113_0064283 Ga0496113_0064283_1291_1920 194
792 3300048917 Ga0496114_0035965 Ga0496114_0035965_992_1621 194
793 3300048918 Ga0496115_0484603 Ga0496115_0484603_214_843 194
794 3300049744 Ga0501083_0112649 Ga0501083_0112649_530_1138 194
795 3300050512 nmdc:mga0n895_226459_c1 nmdc:mga0n895_226459_c1_115_756 194
796 3300053098 Ga0500650_0242138 Ga0500650_0242138_24_656 194
797 3300053117 Ga0500593_000274 Ga0500593_000274_6210_6842 194
798 3300007788 Ga0099795_10000155 Ga0099795_100001555 195
799 3300010159 Ga0099796_10000545 Ga0099796_100005455 195
800 3300027512 Ga0209179_1000126 Ga0209179_10001263 195
801 3300031251 Ga0265327_10038056 Ga0265327_100380562 195
802 3300031665 Ga0316575_10027893 Ga0316575_100278932 195
803 3300049823 Ga0501044_0365650 Ga0501044_0365650_478_1077 195
804 3300053096 Ga0500641_0002828 Ga0500641_0002828_4338_4967 195
805 3300005331 Ga0070670_100018981 Ga0070670_1000189812 196
806 3300005334 Ga0068869_100081008 Ga0068869_1000810081 196
807 3300005334 Ga0068869_100956081 Ga0068869_1009560811 196
808 3300005336 Ga0070680_100359363 Ga0070680_1003593632 196
809 3300005336 Ga0070680_100650272 Ga0070680_1006502721 196
810 3300005337 Ga0070682_100044961 Ga0070682_1000449611 196
811 3300005338 Ga0068868_100078297 Ga0068868_1000782971 196
812 3300005340 Ga0070689_100018095 Ga0070689_1000180951 196
813 3300005341 Ga0070691_10323580 Ga0070691_103235801 196
814 3300005347 Ga0070668_100303584 Ga0070668_1003035841 196
815 3300005354 Ga0070675_100038119 Ga0070675_1000381193 196
816 3300005356 Ga0070674_100044252 Ga0070674_1000442523 196
817 3300005365 Ga0070688_100113882 Ga0070688_1001138821 196
818 3300005367 Ga0070667_100062837 Ga0070667_1000628374 196
819 3300005438 Ga0070701_10046339 Ga0070701_100463393 196
820 3300005440 Ga0070705_100149248 Ga0070705_1001492482 196
821 3300005441 Ga0070700_100046465 Ga0070700_1000464653 196
822 3300005444 Ga0070694_100168255 Ga0070694_1001682552 196
823 3300005455 Ga0070663_100084716 Ga0070663_1000847163 196
824 3300005457 Ga0070662_100049937 Ga0070662_1000499373 196
825 3300005459 Ga0068867_100066847 Ga0068867_1000668473 196
826 3300005466 Ga0070685_10116531 Ga0070685_101165312 196
827 3300005468 Ga0070707_100247698 Ga0070707_1002476982 196
828 3300005539 Ga0068853_100363022 Ga0068853_1003630221 196
829 3300005543 Ga0070672_100129901 Ga0070672_1001299011 196
830 3300005544 Ga0070686_100026881 Ga0070686_1000268813 196
831 3300005564 Ga0070664_100163030 Ga0070664_1001630302 196
832 3300005578 Ga0068854_100444423 Ga0068854_1004444231 196
833 3300005614 Ga0068856_100071204 Ga0068856_1000712042 196
834 3300005615 Ga0070702_100002122 Ga0070702_1000021228 196
835 3300005617 Ga0068859_100038396 Ga0068859_1000383963 196
836 3300005718 Ga0068866_10002715 Ga0068866_100027153 196
837 3300005719 Ga0068861_100145140 Ga0068861_1001451402 196
838 3300005840 Ga0068870_10103020 Ga0068870_101030202 196
839 3300005841 Ga0068863_100050785 Ga0068863_1000507853 196
840 3300005842 Ga0068858_100055131 Ga0068858_1000551314 196
841 3300005843 Ga0068860_100011366 Ga0068860_10001136613 196
842 3300005937 Ga0081455_10039510 Ga0081455_100395102 196
843 3300005937 Ga0081455_10072301 Ga0081455_100723012 196
844 3300005983 Ga0081540_1015330 Ga0081540_10153302 196
845 3300006028 Ga0070717_10150544 Ga0070717_101505441 196
846 3300006038 Ga0075365_10034820 Ga0075365_100348202 196
847 3300006038 Ga0075365_10086232 Ga0075365_100862323 196
848 3300006038 Ga0075365_10393029 Ga0075365_103930291 196
849 3300006194 Ga0075427_10000933 Ga0075427_100009332 196
850 3300006358 Ga0068871_100045370 Ga0068871_1000453701 196
851 3300006844 Ga0075428_100009524 Ga0075428_10000952410 196
852 3300006844 Ga0075428_100319812 Ga0075428_1003198122 196
853 3300006846 Ga0075430_100053356 Ga0075430_1000533562 196
854 3300006846 Ga0075430_100077845 Ga0075430_1000778452 196
855 3300006847 Ga0075431_100004032 Ga0075431_10000403213 196
856 3300006847 Ga0075431_100312229 Ga0075431_1003122292 196
857 3300006852 Ga0075433_10000876 Ga0075433_1000087611 196
858 3300006852 Ga0075433_10327623 Ga0075433_103276231 196
859 3300006871 Ga0075434_100003784 Ga0075434_1000037843 196
860 3300006871 Ga0075434_100056876 Ga0075434_1000568764 196
861 3300006871 Ga0075434_100237368 Ga0075434_1002373682 196
862 3300006880 Ga0075429_100207320 Ga0075429_1002073202 196
863 3300006881 Ga0068865_100039979 Ga0068865_1000399792 196
864 3300006931 Ga0097620_100038394 Ga0097620_1000383943 196
865 3300007076 Ga0075435_100024050 Ga0075435_1000240503 196
866 3300007076 Ga0075435_100032996 Ga0075435_1000329962 196
867 3300009094 Ga0111539_10042647 Ga0111539_100426477 196
868 3300009094 Ga0111539_10174268 Ga0111539_101742682 196
869 3300009101 Ga0105247_10018808 Ga0105247_100188084 196
870 3300009147 Ga0114129_10018611 Ga0114129_100186116 196
871 3300009147 Ga0114129_10058921 Ga0114129_100589212 196
872 3300009176 Ga0105242_10600087 Ga0105242_106000872 196
873 3300009177 Ga0105248_10083940 Ga0105248_100839402 196
874 3300009177 Ga0105248_10955660 Ga0105248_109556602 196
875 3300009545 Ga0105237_10464690 Ga0105237_104646901 196
876 3300009553 Ga0105249_10137387 Ga0105249_101373872 196
877 3300011119 Ga0105246_10237213 Ga0105246_102372132 196
878 3300013105 Ga0157369_10524924 Ga0157369_105249242 196
879 3300013296 Ga0157374_10068417 Ga0157374_100684172 196
880 3300013306 Ga0163162_10181804 Ga0163162_101818042 196
881 3300013306 Ga0163162_10285414 Ga0163162_102854143 196
882 3300013306 Ga0163162_10622692 Ga0163162_106226921 196
883 3300013308 Ga0157375_10063052 Ga0157375_100630523 196
884 3300014325 Ga0163163_10047249 Ga0163163_100472495 196
885 3300014745 Ga0157377_10024270 Ga0157377_100242703 196
886 3300014968 Ga0157379_10162654 Ga0157379_101626542 196
887 3300014969 Ga0157376_10225758 Ga0157376_102257582 196
888 3300017792 Ga0163161_10115761 Ga0163161_101157612 196
889 3300024227 Ga0228598_1003451 Ga0228598_10034512 196
890 3300025900 Ga0207710_10048741 Ga0207710_100487412 196
891 3300025901 Ga0207688_10008788 Ga0207688_100087883 196
892 3300025908 Ga0207643_10013330 Ga0207643_100133302 196
893 3300025915 Ga0207693_10010627 Ga0207693_100106278 196
894 3300025916 Ga0207663_10292068 Ga0207663_102920682 196
895 3300025918 Ga0207662_10020777 Ga0207662_100207773 196
896 3300025919 Ga0207657_10349052 Ga0207657_103490521 196
897 3300025920 Ga0207649_10085151 Ga0207649_100851512 196
898 3300025925 Ga0207650_10095801 Ga0207650_100958012 196
899 3300025925 Ga0207650_10156525 Ga0207650_101565252 196
900 3300025928 Ga0207700_10103473 Ga0207700_101034732 196
901 3300025933 Ga0207706_10120424 Ga0207706_101204242 196
902 3300025940 Ga0207691_10159568 Ga0207691_101595683 196
903 3300025941 Ga0207711_10040516 Ga0207711_100405163 196
904 3300025941 Ga0207711_10089107 Ga0207711_100891072 196
905 3300025942 Ga0207689_10073515 Ga0207689_100735151 196
906 3300025960 Ga0207651_10197490 Ga0207651_101974903 196
907 3300025961 Ga0207712_10150750 Ga0207712_101507502 196
908 3300026023 Ga0207677_10088811 Ga0207677_100888112 196
909 3300026067 Ga0207678_10034530 Ga0207678_100345304 196
910 3300026067 Ga0207678_10087331 Ga0207678_100873312 196
911 3300026075 Ga0207708_10002721 Ga0207708_1000272112 196
912 3300026089 Ga0207648_10024588 Ga0207648_100245883 196
913 3300026095 Ga0207676_10023198 Ga0207676_100231983 196
914 3300026116 Ga0207674_10049956 Ga0207674_100499563 196
915 3300026118 Ga0207675_100030051 Ga0207675_1000300514 196
916 3300026121 Ga0207683_10038116 Ga0207683_100381163 196
917 3300027907 Ga0207428_10000216 Ga0207428_1000021618 196
918 3300028379 Ga0268266_10159548 Ga0268266_101595481 196
919 3300028380 Ga0268265_10424725 Ga0268265_104247251 196
920 3300028800 Ga0265338_10016356 Ga0265338_1001635610 196
921 3300031235 Ga0265330_10078554 Ga0265330_100785542 196
922 3300031238 Ga0265332_10001833 Ga0265332_100018334 196
923 3300031238 Ga0265332_10078189 Ga0265332_100781892 196
924 3300031241 Ga0265325_10108939 Ga0265325_101089392 196
925 3300031241 Ga0265325_10151187 Ga0265325_101511872 196
926 3300031242 Ga0265329_10084020 Ga0265329_100840202 196
927 3300031247 Ga0265340_10000912 Ga0265340_100009124 196
928 3300031247 Ga0265340_10035724 Ga0265340_100357244 196
929 3300031249 Ga0265339_10001873 Ga0265339_100018734 196
930 3300031249 Ga0265339_10040092 Ga0265339_100400922 196
931 3300031249 Ga0265339_10394257 Ga0265339_103942571 196
932 3300031344 Ga0265316_10173377 Ga0265316_101733771 196
933 3300031595 Ga0265313_10042774 Ga0265313_100427743 196
934 3300031711 Ga0265314_10237494 Ga0265314_102374942 196
935 3300031712 Ga0265342_10000011 Ga0265342_10000011120 196
936 3300031712 Ga0265342_10004591 Ga0265342_100045913 196
937 3300031712 Ga0265342_10043958 Ga0265342_100439584 196
938 3300035091 Ga0373951_0088153 Ga0373951_0088153_53_700 196
939 3300035121 Ga0373960_0206990 Ga0373960_0206990_29_676 196
940 3300035172 Ga0373955_0286793 Ga0373955_0286793_259_906 196
941 3300035692 Ga0373935_0088837 Ga0373935_0088837_740_1387 196
942 3300037312 Ga0395899_0013207 Ga0395899_0013207_3689_4282 196
943 3300037312 Ga0395899_0181356 Ga0395899_0181356_804_1397 196
944 3300037418 Ga0395900_0003303 Ga0395900_0003303_5218_5811 196
945 3300037418 Ga0395900_0005284 Ga0395900_0005284_5179_5772 196
946 3300037418 Ga0395900_0242349 Ga0395900_0242349_181_774 196
947 3300037418 Ga0395900_0279491 Ga0395900_0279491_478_1071 196
948 3300037466 Ga0395898_0013960 Ga0395898_0013960_7428_8021 196
949 3300037466 Ga0395898_0097387 Ga0395898_0097387_660_1253 196
950 3300038443 Ga0395901_0011535 Ga0395901_0011535_7641_8234 196
951 3300038443 Ga0395901_0032978 Ga0395901_0032978_2009_2602 196
952 3300038443 Ga0395901_0173764 Ga0395901_0173764_146_739 196
953 3300039447 Ga0436361_0134221 Ga0436361_0134221_202_831 196
954 3300046459 Ga0495629_0086389 Ga0495629_0086389_452_1099 196
955 3300046460 Ga0495638_0070326 Ga0495638_0070326_1443_2090 196
956 3300046461 Ga0495641_0067695 Ga0495641_0067695_326_973 196
957 3300046473 Ga0495582_0051422 Ga0495582_0051422_1558_2205 196
958 3300046475 Ga0495639_0048671 Ga0495639_0048671_832_1479 196
959 3300046491 Ga0495584_0021018 Ga0495584_0021018_1693_2340 196
960 3300046491 Ga0495584_0222717 Ga0495584_0222717_54_701 196
961 3300046499 Ga0495594_0138431 Ga0495594_0138431_342_989 196
962 3300046513 Ga0495616_0133607 Ga0495616_0133607_238_885 196
963 3300046514 Ga0495618_0175740 Ga0495618_0175740_93_740 196
964 3300046515 Ga0495620_0199018 Ga0495620_0199018_50_697 196
965 3300046529 Ga0495652_0469597 Ga0495652_0469597_106_738 196
966 3300046537 Ga0495598_0001247 Ga0495598_0001247_1722_2369 196
967 3300046543 Ga0495645_0135379 Ga0495645_0135379_349_981 196
968 3300046558 Ga0495633_0015379 Ga0495633_0015379_335_982 196
969 3300046648 Ga0495611_0202767 Ga0495611_0202767_194_841 196
970 3300046665 Ga0495661_0076857 Ga0495661_0076857_431_1078 196
971 3300046674 Ga0495588_0086347 Ga0495588_0086347_337_984 196
972 3300046683 Ga0495658_0284388 Ga0495658_0284388_162_809 196
973 3300046689 Ga0495613_0185829 Ga0495613_0185829_227_874 196
974 3300046690 Ga0495624_0364417 Ga0495624_0364417_135_782 196
975 3300046691 Ga0495670_0003793 Ga0495670_0003793_2528_3175 196
976 3300046692 Ga0495671_0110284 Ga0495671_0110284_589_1236 196
977 3300046694 Ga0495649_0155117 Ga0495649_0155117_460_1107 196
978 3300046794 Ga0495589_0029954 Ga0495589_0029954_1725_2372 196
979 3300046794 Ga0495589_0060396 Ga0495589_0060396_972_1619 196
980 3300046809 Ga0495600_0225776 Ga0495600_0225776_435_1082 196
981 3300047315 Ga0495581_0028023 Ga0495581_0028023_88_735 196
982 3300047321 Ga0495676_0261048 Ga0495676_0261048_417_1064 196
983 3300047323 Ga0495683_0114933 Ga0495683_0114933_435_1082 196
984 3300047445 Ga0495677_0038434 Ga0495677_0038434_604_1251 196
985 3300048088 Ga0495602_0118855 Ga0495602_0118855_679_1326 196
986 3300048091 Ga0495626_0037215 Ga0495626_0037215_96_743 196
987 3300048905 Ga0496102_0005977 Ga0496102_0005977_3723_4370 196
988 3300048905 Ga0496102_0161964 Ga0496102_0161964_785_1432 196
989 3300048906 Ga0496103_0047272 Ga0496103_0047272_527_1177 196
990 3300048906 Ga0496103_0119580 Ga0496103_0119580_226_873 196
991 3300048907 Ga0496104_0041962 Ga0496104_0041962_2259_2906 196
992 3300048907 Ga0496104_0096220 Ga0496104_0096220_2156_2803 196
993 3300048908 Ga0496105_0002806 Ga0496105_0002806_2595_3242 196
994 3300048909 Ga0496106_0074338 Ga0496106_0074338_456_1103 196
995 3300048910 Ga0496107_0001255 Ga0496107_0001255_10900_11547 196
996 3300048910 Ga0496107_0037460 Ga0496107_0037460_2558_3205 196
997 3300048911 Ga0496108_0013177 Ga0496108_0013177_1720_2367 196
998 3300048911 Ga0496108_0173597 Ga0496108_0173597_934_1581 196
999 3300048912 Ga0496109_0001302 Ga0496109_0001302_6672_7319 196
1000 3300048912 Ga0496109_0307001 Ga0496109_0307001_76_723 196
1001 3300048913 Ga0496110_0170325 Ga0496110_0170325_458_1105 196
1002 3300048914 Ga0496111_0002435 Ga0496111_0002435_931_1578 196
1003 3300048914 Ga0496111_0008814 Ga0496111_0008814_3384_4034 196
1004 3300048915 Ga0496112_0004880 Ga0496112_0004880_5194_5844 196
1005 3300048915 Ga0496112_0005955 Ga0496112_0005955_3753_4400 196
1006 3300048916 Ga0496113_0000394 Ga0496113_0000394_2289_2936 196
1007 3300048917 Ga0496114_0018298 Ga0496114_0018298_3467_4114 196
1008 3300048917 Ga0496114_0787267 Ga0496114_0787267_122_769 196
1009 3300048918 Ga0496115_0004440 Ga0496115_0004440_3442_4089 196
1010 3300048918 Ga0496115_0015657 Ga0496115_0015657_61_708 196
1011 3300049576 Ga0501040_0024567 Ga0501040_0024567_3303_3950 196
1012 3300049577 Ga0501041_0096977 Ga0501041_0096977_920_1567 196
1013 3300049582 Ga0501048_0485860 Ga0501048_0485860_29_676 196
1014 3300049584 Ga0501068_0223224 Ga0501068_0223224_233_880 196
1015 3300049590 Ga0501074_0547975 Ga0501074_0547975_159_752 196
1016 3300049591 Ga0501075_0062556 Ga0501075_0062556_2110_2757 196
1017 3300049744 Ga0501083_0095920 Ga0501083_0095920_1311_1937 196
1018 3300050492 nmdc:mga0yw44_149487_c1 nmdc:mga0yw44_149487_c1_694_1341 196
1019 3300050493 nmdc:mga0k408_493957_c1 nmdc:mga0k408_493957_c1_16_663 196
1020 3300050495 nmdc:mga04h51_57703_c1 nmdc:mga04h51_57703_c1_633_1280 196
1021 3300050507 nmdc:mga05p37_129848_c1 nmdc:mga05p37_129848_c1_430_1077 196
1022 3300050507 nmdc:mga05p37_4032_c1 nmdc:mga05p37_4032_c1_4559_5149 196
1023 3300050507 nmdc:mga05p37_465051_c1 nmdc:mga05p37_465051_c1_639_1229 196
1024 3300050508 nmdc:mga09592_4710_c1 nmdc:mga09592_4710_c1_5899_6489 196
1025 3300050509 nmdc:mga0qj67_150443_c1 nmdc:mga0qj67_150443_c1_1188_1838 196
1026 3300050509 nmdc:mga0qj67_768_c1 nmdc:mga0qj67_768_c1_16423_17013 196
1027 3300050510 nmdc:mga06r32_117900_c1 nmdc:mga06r32_117900_c1_2013_2603 196
1028 3300050511 nmdc:mga08y16_2116_c1 nmdc:mga08y16_2116_c1_8626_9216 196
1029 3300050511 nmdc:mga08y16_321381_c1 nmdc:mga08y16_321381_c1_526_1173 196
1030 3300050511 nmdc:mga08y16_342219_c1 nmdc:mga08y16_342219_c1_160_807 196
1031 3300050512 nmdc:mga0n895_125016_c1 nmdc:mga0n895_125016_c1_605_1195 196
1032 3300050512 nmdc:mga0n895_167480_c1 nmdc:mga0n895_167480_c1_867_1514 196
1033 3300050513 nmdc:mga0rr50_1039_c1 nmdc:mga0rr50_1039_c1_3533_4123 196
1034 3300050513 nmdc:mga0rr50_42391_c1 nmdc:mga0rr50_42391_c1_460_1050 196
1035 3300050514 nmdc:mga08x19_114924_c1 nmdc:mga08x19_114924_c1_434_1024 196
1036 3300050515 nmdc:mga0a205_153815_c1 nmdc:mga0a205_153815_c1_62_652 196
1037 3300050515 nmdc:mga0a205_719_c1 nmdc:mga0a205_719_c1_16747_17337 196
1038 3300053077 Ga0495601_0321479 Ga0495601_0321479_126_758 196
1039 3300053083 Ga0495655_0048895 Ga0495655_0048895_47_694 196
1040 3300053085 Ga0495619_0027239 Ga0495619_0027239_2308_2955 196
1041 2209111006 2214856315 2213902568 197
1042 3300000041 ARcpr5oldR_c000202 ARcpr5oldR_0002025 197
1043 3300000042 ARSoilYngRDRAFT_c00201 ARSoilYngRDRAFT_002015 197
1044 3300000043 ARcpr5yngRDRAFT_c000176 ARcpr5yngRDRAFT_0001765 197
1045 3300000044 ARSoilOldRDRAFT_c000187 ARSoilOldRDRAFT_0001875 197
1046 3300000045 ARCol0oldRDRAFT_c02347 ARCol0oldRDRAFT_023472 197
1047 3300000652 ARCol0yngRDRAFT_1000204 ARCol0yngRDRAFT_10002045 197
1048 3300001430 JGI24032J14994_100577 JGI24032J14994_1005772 197
1049 3300001976 JGI24752J21851_1004412 JGI24752J21851_10044122 197
1050 3300001977 JGI24746J21847_1002942 JGI24746J21847_10029424 197
1051 3300001989 JGI24739J22299_10012807 JGI24739J22299_100128072 197
1052 3300001990 JGI24737J22298_10003419 JGI24737J22298_100034192 197
1053 3300001990 JGI24737J22298_10031013 JGI24737J22298_100310132 197
1054 3300001991 JGI24743J22301_10004649 JGI24743J22301_100046492 197
1055 3300002070 JGI24750J21931_1002092 JGI24750J21931_10020921 197
1056 3300002074 JGI24748J21848_1003313 JGI24748J21848_10033132 197
1057 3300002075 JGI24738J21930_10002133 JGI24738J21930_100021333 197
1058 3300002075 JGI24738J21930_10002848 JGI24738J21930_100028487 197
1059 3300002155 JGI24033J26618_1002523 JGI24033J26618_10025232 197
1060 3300002239 JGI24034J26672_10001569 JGI24034J26672_100015694 197
1061 3300002239 JGI24034J26672_10004883 JGI24034J26672_100048832 197
1062 3300002244 JGI24742J22300_10006556 JGI24742J22300_100065562 197
1063 3300002244 JGI24742J22300_10007189 JGI24742J22300_100071892 197
1064 3300005277 Ga0065716_1002368 Ga0065716_10023681 197
1065 3300005289 Ga0065704_10005364 Ga0065704_100053644 197
1066 3300005290 Ga0065712_10002565 Ga0065712_100025657 197
1067 3300005293 Ga0065715_10000602 Ga0065715_100006023 197
1068 3300005293 Ga0065715_10000779 Ga0065715_100007794 197
1069 3300005295 Ga0065707_10119681 Ga0065707_101196812 197
1070 3300005328 Ga0070676_10000170 Ga0070676_1000017012 197
1071 3300005328 Ga0070676_10055775 Ga0070676_100557752 197
1072 3300005329 Ga0070683_100007194 Ga0070683_1000071946 197
1073 3300005329 Ga0070683_100267388 Ga0070683_1002673881 197
1074 3300005330 Ga0070690_100007785 Ga0070690_1000077852 197
1075 3300005330 Ga0070690_100037856 Ga0070690_1000378562 197
1076 3300005331 Ga0070670_100007710 Ga0070670_1000077107 197
1077 3300005331 Ga0070670_100183906 Ga0070670_1001839062 197
1078 3300005333 Ga0070677_10000320 Ga0070677_100003203 197
1079 3300005334 Ga0068869_100000181 Ga0068869_1000001815 197
1080 3300005334 Ga0068869_100555443 Ga0068869_1005554431 197
1081 3300005334 Ga0068869_100580816 Ga0068869_1005808162 197
1082 3300005335 Ga0070666_10021002 Ga0070666_100210023 197
1083 3300005335 Ga0070666_10109278 Ga0070666_101092782 197
1084 3300005335 Ga0070666_10336369 Ga0070666_103363692 197
1085 3300005336 Ga0070680_100203803 Ga0070680_1002038031 197
1086 3300005336 Ga0070680_100397581 Ga0070680_1003975812 197
1087 3300005337 Ga0070682_100000903 Ga0070682_1000009032 197
1088 3300005337 Ga0070682_100016960 Ga0070682_1000169605 197
1089 3300005337 Ga0070682_100171307 Ga0070682_1001713072 197
1090 3300005338 Ga0068868_100000287 Ga0068868_10000028734 197
1091 3300005338 Ga0068868_100143378 Ga0068868_1001433782 197
1092 3300005339 Ga0070660_100023149 Ga0070660_1000231492 197
1093 3300005339 Ga0070660_100379450 Ga0070660_1003794502 197
1094 3300005340 Ga0070689_100001256 Ga0070689_10000125618 197
1095 3300005341 Ga0070691_10000085 Ga0070691_1000008524 197
1096 3300005343 Ga0070687_100011861 Ga0070687_1000118612 197
1097 3300005343 Ga0070687_100219702 Ga0070687_1002197022 197
1098 3300005344 Ga0070661_100520801 Ga0070661_1005208012 197
1099 3300005344 Ga0070661_100705230 Ga0070661_1007052301 197
1100 3300005345 Ga0070692_10010746 Ga0070692_100107463 197
1101 3300005347 Ga0070668_100001169 Ga0070668_10000116912 197
1102 3300005347 Ga0070668_100639276 Ga0070668_1006392762 197
1103 3300005353 Ga0070669_100019772 Ga0070669_1000197726 197
1104 3300005353 Ga0070669_100023221 Ga0070669_1000232213 197
1105 3300005354 Ga0070675_100049831 Ga0070675_1000498312 197
1106 3300005355 Ga0070671_100005621 Ga0070671_1000056212 197
1107 3300005355 Ga0070671_100085669 Ga0070671_1000856692 197
1108 3300005356 Ga0070674_100039583 Ga0070674_1000395832 197
1109 3300005356 Ga0070674_100216926 Ga0070674_1002169262 197
1110 3300005364 Ga0070673_100000191 Ga0070673_10000019123 197
1111 3300005365 Ga0070688_100009109 Ga0070688_1000091092 197
1112 3300005365 Ga0070688_100067111 Ga0070688_1000671113 197
1113 3300005365 Ga0070688_100214272 Ga0070688_1002142722 197
1114 3300005366 Ga0070659_100001504 Ga0070659_10000150421 197
1115 3300005367 Ga0070667_100032349 Ga0070667_1000323494 197
1116 3300005367 Ga0070667_100168830 Ga0070667_1001688302 197
1117 3300005367 Ga0070667_100236644 Ga0070667_1002366442 197
1118 3300005406 Ga0070703_10014931 Ga0070703_100149312 197
1119 3300005434 Ga0070709_10015140 Ga0070709_100151403 197
1120 3300005434 Ga0070709_10204030 Ga0070709_102040302 197
1121 3300005436 Ga0070713_100296138 Ga0070713_1002961381 197
1122 3300005437 Ga0070710_10005069 Ga0070710_100050695 197
1123 3300005437 Ga0070710_10401382 Ga0070710_104013821 197
1124 3300005438 Ga0070701_10000454 Ga0070701_1000045413 197
1125 3300005439 Ga0070711_100034363 Ga0070711_1000343634 197
1126 3300005439 Ga0070711_100099922 Ga0070711_1000999222 197
1127 3300005440 Ga0070705_100006964 Ga0070705_1000069644 197
1128 3300005440 Ga0070705_100364976 Ga0070705_1003649761 197
1129 3300005441 Ga0070700_100001181 Ga0070700_10000118115 197
1130 3300005441 Ga0070700_100026485 Ga0070700_1000264852 197
1131 3300005444 Ga0070694_100005471 Ga0070694_1000054713 197
1132 3300005444 Ga0070694_100026966 Ga0070694_1000269664 197
1133 3300005445 Ga0070708_100012815 Ga0070708_1000128156 197
1134 3300005445 Ga0070708_100217296 Ga0070708_1002172962 197
1135 3300005455 Ga0070663_100001277 Ga0070663_1000012775 197
1136 3300005455 Ga0070663_100026167 Ga0070663_1000261672 197
1137 3300005455 Ga0070663_100256998 Ga0070663_1002569981 197
1138 3300005456 Ga0070678_100098678 Ga0070678_1000986782 197
1139 3300005457 Ga0070662_100009258 Ga0070662_1000092583 197
1140 3300005457 Ga0070662_100025609 Ga0070662_1000256096 197
1141 3300005458 Ga0070681_10002441 Ga0070681_1000244122 197
1142 3300005458 Ga0070681_10045062 Ga0070681_100450624 197
1143 3300005459 Ga0068867_100003651 Ga0068867_1000036512 197
1144 3300005466 Ga0070685_10001020 Ga0070685_1000102013 197
1145 3300005466 Ga0070685_10356442 Ga0070685_103564422 197
1146 3300005471 Ga0070698_100520643 Ga0070698_1005206432 197
1147 3300005518 Ga0070699_100265772 Ga0070699_1002657722 197
1148 3300005530 Ga0070679_100002397 Ga0070679_1000023973 197
1149 3300005530 Ga0070679_100205962 Ga0070679_1002059622 197
1150 3300005535 Ga0070684_100129882 Ga0070684_1001298822 197
1151 3300005536 Ga0070697_100180051 Ga0070697_1001800512 197
1152 3300005543 Ga0070672_100104924 Ga0070672_1001049242 197
1153 3300005544 Ga0070686_100001852 Ga0070686_1000018524 197
1154 3300005544 Ga0070686_100010885 Ga0070686_1000108854 197
1155 3300005544 Ga0070686_100043297 Ga0070686_1000432975 197
1156 3300005545 Ga0070695_100017667 Ga0070695_1000176674 197
1157 3300005545 Ga0070695_100029096 Ga0070695_1000290962 197
1158 3300005546 Ga0070696_100030172 Ga0070696_1000301723 197
1159 3300005546 Ga0070696_100059761 Ga0070696_1000597612 197
1160 3300005546 Ga0070696_100196382 Ga0070696_1001963822 197
1161 3300005547 Ga0070693_100003405 Ga0070693_1000034054 197
1162 3300005548 Ga0070665_100172863 Ga0070665_1001728632 197
1163 3300005549 Ga0070704_100129790 Ga0070704_1001297902 197
1164 3300005549 Ga0070704_100179847 Ga0070704_1001798471 197
1165 3300005563 Ga0068855_100012458 Ga0068855_1000124583 197
1166 3300005564 Ga0070664_100144557 Ga0070664_1001445572 197
1167 3300005564 Ga0070664_100485787 Ga0070664_1004857872 197
1168 3300005577 Ga0068857_100007472 Ga0068857_1000074724 197
1169 3300005578 Ga0068854_100007745 Ga0068854_1000077455 197
1170 3300005578 Ga0068854_100112874 Ga0068854_1001128743 197
1171 3300005615 Ga0070702_100046887 Ga0070702_1000468872 197
1172 3300005615 Ga0070702_100141601 Ga0070702_1001416012 197
1173 3300005616 Ga0068852_100073978 Ga0068852_1000739782 197
1174 3300005617 Ga0068859_100002296 Ga0068859_10000229619 197
1175 3300005617 Ga0068859_100451919 Ga0068859_1004519192 197
1176 3300005618 Ga0068864_100002090 Ga0068864_10000209025 197
1177 3300005618 Ga0068864_100030933 Ga0068864_1000309336 197
1178 3300005718 Ga0068866_10066835 Ga0068866_100668352 197
1179 3300005719 Ga0068861_100001910 Ga0068861_1000019104 197
1180 3300005840 Ga0068870_10000133 Ga0068870_1000013311 197
1181 3300005841 Ga0068863_100010858 Ga0068863_1000108582 197
1182 3300005841 Ga0068863_100156523 Ga0068863_1001565232 197
1183 3300005842 Ga0068858_100029162 Ga0068858_1000291623 197
1184 3300005842 Ga0068858_100047364 Ga0068858_1000473642 197
1185 3300005843 Ga0068860_100003358 Ga0068860_10000335824 197
1186 3300005843 Ga0068860_100040861 Ga0068860_1000408614 197
1187 3300005843 Ga0068860_100119726 Ga0068860_1001197262 197
1188 3300005844 Ga0068862_100006524 Ga0068862_1000065243 197
1189 3300005844 Ga0068862_100188553 Ga0068862_1001885532 197
1190 3300005937 Ga0081455_10000009 Ga0081455_10000009236 197
1191 3300006028 Ga0070717_10012313 Ga0070717_100123139 197
1192 3300006163 Ga0070715_10001233 Ga0070715_100012333 197
1193 3300006173 Ga0070716_100225011 Ga0070716_1002250111 197
1194 3300006175 Ga0070712_100083832 Ga0070712_1000838322 197
1195 3300006175 Ga0070712_100158544 Ga0070712_1001585442 197
1196 3300006178 Ga0075367_10017457 Ga0075367_100174574 197
1197 3300006237 Ga0097621_100000616 Ga0097621_10000061624 197
1198 3300006237 Ga0097621_100067560 Ga0097621_1000675602 197
1199 3300006353 Ga0075370_10051098 Ga0075370_100510982 197
1200 3300006358 Ga0068871_100016286 Ga0068871_1000162864 197
1201 3300006358 Ga0068871_100031874 Ga0068871_1000318746 197
1202 3300006852 Ga0075433_10061884 Ga0075433_100618842 197
1203 3300006871 Ga0075434_100026789 Ga0075434_1000267892 197
1204 3300006881 Ga0068865_100001101 Ga0068865_1000011014 197
1205 3300006881 Ga0068865_100053184 Ga0068865_1000531842 197
1206 3300006914 Ga0075436_100254770 Ga0075436_1002547702 197
1207 3300006914 Ga0075436_100272646 Ga0075436_1002726462 197
1208 3300006931 Ga0097620_100002296 Ga0097620_10000229619 197
1209 3300006931 Ga0097620_100451932 Ga0097620_1004519322 197
1210 3300007076 Ga0075435_100041844 Ga0075435_1000418442 197
1211 3300007076 Ga0075435_100063268 Ga0075435_1000632682 197
1212 3300009011 Ga0105251_10037175 Ga0105251_100371751 197
1213 3300009011 Ga0105251_10051478 Ga0105251_100514781 197
1214 3300009036 Ga0105244_10061434 Ga0105244_100614342 197
1215 3300009092 Ga0105250_10137392 Ga0105250_101373921 197
1216 3300009093 Ga0105240_10011690 Ga0105240_1001169012 197
1217 3300009094 Ga0111539_10003401 Ga0111539_1000340113 197
1218 3300009094 Ga0111539_10035433 Ga0111539_100354336 197
1219 3300009094 Ga0111539_10171638 Ga0111539_101716381 197
1220 3300009094 Ga0111539_12097479 Ga0111539_120974791 197
1221 3300009098 Ga0105245_10056051 Ga0105245_100560513 197
1222 3300009098 Ga0105245_10601755 Ga0105245_106017552 197
1223 3300009101 Ga0105247_10008319 Ga0105247_1000831912 197
1224 3300009101 Ga0105247_10011047 Ga0105247_100110471 197
1225 3300009148 Ga0105243_10002317 Ga0105243_100023173 197
1226 3300009148 Ga0105243_10015545 Ga0105243_100155455 197
1227 3300009174 Ga0105241_10003767 Ga0105241_100037672 197
1228 3300009174 Ga0105241_10072284 Ga0105241_100722844 197
1229 3300009174 Ga0105241_10205607 Ga0105241_102056072 197
1230 3300009176 Ga0105242_10000990 Ga0105242_1000099015 197
1231 3300009177 Ga0105248_10013733 Ga0105248_1001373312 197
1232 3300009177 Ga0105248_10047103 Ga0105248_100471036 197
1233 3300009177 Ga0105248_10067752 Ga0105248_100677526 197
1234 3300009177 Ga0105248_10198164 Ga0105248_101981642 197
1235 3300009545 Ga0105237_10024092 Ga0105237_100240925 197
1236 3300009551 Ga0105238_10088824 Ga0105238_100888244 197
1237 3300009553 Ga0105249_10001033 Ga0105249_1000103321 197
1238 3300009553 Ga0105249_10025232 Ga0105249_100252323 197
1239 3300010375 Ga0105239_10121234 Ga0105239_101212342 197
1240 3300010375 Ga0105239_10135993 Ga0105239_101359933 197
1241 3300010375 Ga0105239_10402983 Ga0105239_104029832 197
1242 3300011119 Ga0105246_10001800 Ga0105246_1000180015 197
1243 3300011119 Ga0105246_10466612 Ga0105246_104666121 197
1244 3300012476 Ga0157344_1000799 Ga0157344_10007992 197
1245 3300012480 Ga0157346_1002141 Ga0157346_10021411 197
1246 3300012492 Ga0157335_1002311 Ga0157335_10023112 197
1247 3300012494 Ga0157341_1006083 Ga0157341_10060832 197
1248 3300012503 Ga0157313_1001600 Ga0157313_10016002 197
1249 3300012510 Ga0157316_1003972 Ga0157316_10039722 197
1250 3300013100 Ga0157373_10027665 Ga0157373_100276653 197
1251 3300013102 Ga0157371_10164975 Ga0157371_101649752 197
1252 3300013296 Ga0157374_10067658 Ga0157374_100676581 197
1253 3300013296 Ga0157374_10775036 Ga0157374_107750361 197
1254 3300013297 Ga0157378_10047383 Ga0157378_100473836 197
1255 3300013306 Ga0163162_10003401 Ga0163162_1000340113 197
1256 3300013306 Ga0163162_10009782 Ga0163162_1000978212 197
1257 3300013307 Ga0157372_10014509 Ga0157372_100145097 197
1258 3300013307 Ga0157372_10116252 Ga0157372_101162523 197
1259 3300013308 Ga0157375_10039024 Ga0157375_100390243 197
1260 3300013308 Ga0157375_10419068 Ga0157375_104190682 197
1261 3300013308 Ga0157375_10461012 Ga0157375_104610122 197
1262 3300014325 Ga0163163_10005155 Ga0163163_100051552 197
1263 3300014325 Ga0163163_10196977 Ga0163163_101969772 197
1264 3300014326 Ga0157380_10001301 Ga0157380_1000130121 197
1265 3300014326 Ga0157380_10554899 Ga0157380_105548992 197
1266 3300014745 Ga0157377_10001682 Ga0157377_100016822 197
1267 3300014745 Ga0157377_10117432 Ga0157377_101174322 197
1268 3300014745 Ga0157377_10321503 Ga0157377_103215031 197
1269 3300014968 Ga0157379_10000275 Ga0157379_1000027539 197
1270 3300014968 Ga0157379_10010341 Ga0157379_100103413 197
1271 3300014968 Ga0157379_10018203 Ga0157379_1001820313 197
1272 3300014969 Ga0157376_10001767 Ga0157376_100017672 197
1273 3300014969 Ga0157376_10033668 Ga0157376_100336686 197
1274 3300014969 Ga0157376_10910733 Ga0157376_109107332 197
1275 3300017792 Ga0163161_10044631 Ga0163161_100446311 197
1276 3300017792 Ga0163161_10138728 Ga0163161_101387282 197
1277 3300025271 Ga0207666_1000149 Ga0207666_10001496 197
1278 3300025290 Ga0207673_1000068 Ga0207673_100006811 197
1279 3300025315 Ga0207697_10012080 Ga0207697_100120804 197
1280 3300025315 Ga0207697_10028933 Ga0207697_100289332 197
1281 3300025315 Ga0207697_10167940 Ga0207697_101679402 197
1282 3300025885 Ga0207653_10003139 Ga0207653_100031394 197
1283 3300025893 Ga0207682_10000695 Ga0207682_100006954 197
1284 3300025898 Ga0207692_10087236 Ga0207692_100872362 197
1285 3300025899 Ga0207642_10000453 Ga0207642_100004533 197
1286 3300025900 Ga0207710_10044901 Ga0207710_100449012 197
1287 3300025901 Ga0207688_10064883 Ga0207688_100648832 197
1288 3300025903 Ga0207680_10044492 Ga0207680_100444922 197
1289 3300025903 Ga0207680_10056057 Ga0207680_100560571 197
1290 3300025903 Ga0207680_10137513 Ga0207680_101375132 197
1291 3300025903 Ga0207680_10431973 Ga0207680_104319732 197
1292 3300025904 Ga0207647_10022486 Ga0207647_100224862 197
1293 3300025904 Ga0207647_10030550 Ga0207647_100305503 197
1294 3300025905 Ga0207685_10055588 Ga0207685_100555881 197
1295 3300025907 Ga0207645_10019429 Ga0207645_100194292 197
1296 3300025907 Ga0207645_10131127 Ga0207645_101311272 197
1297 3300025908 Ga0207643_10000523 Ga0207643_100005232 197
1298 3300025911 Ga0207654_10001610 Ga0207654_100016106 197
1299 3300025911 Ga0207654_10123326 Ga0207654_101233262 197
1300 3300025912 Ga0207707_10001147 Ga0207707_1000114713 197
1301 3300025912 Ga0207707_10338101 Ga0207707_103381012 197
1302 3300025913 Ga0207695_10136425 Ga0207695_101364252 197
1303 3300025914 Ga0207671_10130803 Ga0207671_101308032 197
1304 3300025915 Ga0207693_10041415 Ga0207693_100414154 197
1305 3300025916 Ga0207663_10185141 Ga0207663_101851412 197
1306 3300025917 Ga0207660_10102335 Ga0207660_101023352 197
1307 3300025917 Ga0207660_10590809 Ga0207660_105908092 197
1308 3300025918 Ga0207662_10083908 Ga0207662_100839082 197
1309 3300025918 Ga0207662_10128515 Ga0207662_101285151 197
1310 3300025919 Ga0207657_10056806 Ga0207657_100568063 197
1311 3300025919 Ga0207657_10076719 Ga0207657_100767193 197
1312 3300025920 Ga0207649_10000142 Ga0207649_1000014259 197
1313 3300025921 Ga0207652_10002021 Ga0207652_100020214 197
1314 3300025921 Ga0207652_10092880 Ga0207652_100928802 197
1315 3300025923 Ga0207681_10020796 Ga0207681_100207962 197
1316 3300025923 Ga0207681_10090654 Ga0207681_100906542 197
1317 3300025925 Ga0207650_10002366 Ga0207650_1000236612 197
1318 3300025926 Ga0207659_10000078 Ga0207659_100000782 197
1319 3300025927 Ga0207687_10002377 Ga0207687_100023775 197
1320 3300025928 Ga0207700_10048631 Ga0207700_100486313 197
1321 3300025931 Ga0207644_10026921 Ga0207644_100269214 197
1322 3300025932 Ga0207690_10002633 Ga0207690_1000263312 197
1323 3300025932 Ga0207690_10233063 Ga0207690_102330632 197
1324 3300025933 Ga0207706_10134940 Ga0207706_101349402 197
1325 3300025933 Ga0207706_10235601 Ga0207706_102356011 197
1326 3300025934 Ga0207686_10003396 Ga0207686_100033962 197
1327 3300025935 Ga0207709_10009025 Ga0207709_100090254 197
1328 3300025935 Ga0207709_10036935 Ga0207709_100369351 197
1329 3300025935 Ga0207709_10437622 Ga0207709_104376222 197
1330 3300025936 Ga0207670_10003694 Ga0207670_100036942 197
1331 3300025936 Ga0207670_10147585 Ga0207670_101475851 197
1332 3300025936 Ga0207670_10217252 Ga0207670_102172522 197
1333 3300025937 Ga0207669_10001025 Ga0207669_100010252 197
1334 3300025937 Ga0207669_10263326 Ga0207669_102633261 197
1335 3300025938 Ga0207704_10085875 Ga0207704_100858753 197
1336 3300025938 Ga0207704_10397170 Ga0207704_103971702 197
1337 3300025939 Ga0207665_10010841 Ga0207665_100108413 197
1338 3300025940 Ga0207691_10008131 Ga0207691_100081312 197
1339 3300025940 Ga0207691_10064975 Ga0207691_100649752 197
1340 3300025941 Ga0207711_10037167 Ga0207711_100371675 197
1341 3300025941 Ga0207711_10567174 Ga0207711_105671742 197
1342 3300025942 Ga0207689_10001399 Ga0207689_100013992 197
1343 3300025942 Ga0207689_10668585 Ga0207689_106685851 197
1344 3300025944 Ga0207661_10001264 Ga0207661_100012642 197
1345 3300025945 Ga0207679_10000064 Ga0207679_10000064104 197
1346 3300025945 Ga0207679_10458704 Ga0207679_104587042 197
1347 3300025949 Ga0207667_10173810 Ga0207667_101738102 197
1348 3300025960 Ga0207651_10000420 Ga0207651_1000042021 197
1349 3300025961 Ga0207712_10001661 Ga0207712_1000166117 197
1350 3300025972 Ga0207668_10000965 Ga0207668_1000096515 197
1351 3300025972 Ga0207668_10542324 Ga0207668_105423241 197
1352 3300025981 Ga0207640_10001755 Ga0207640_1000175514 197
1353 3300026023 Ga0207677_10023844 Ga0207677_100238443 197
1354 3300026035 Ga0207703_10044466 Ga0207703_100444664 197
1355 3300026035 Ga0207703_10240532 Ga0207703_102405322 197
1356 3300026041 Ga0207639_10265540 Ga0207639_102655402 197
1357 3300026067 Ga0207678_10010183 Ga0207678_100101839 197
1358 3300026067 Ga0207678_10039287 Ga0207678_100392873 197
1359 3300026067 Ga0207678_10120747 Ga0207678_101207472 197
1360 3300026075 Ga0207708_10020852 Ga0207708_100208524 197
1361 3300026075 Ga0207708_10193379 Ga0207708_101933791 197
1362 3300026078 Ga0207702_10003767 Ga0207702_100037673 197
1363 3300026088 Ga0207641_10034057 Ga0207641_100340572 197
1364 3300026088 Ga0207641_10200868 Ga0207641_102008682 197
1365 3300026088 Ga0207641_10802363 Ga0207641_108023631 197
1366 3300026089 Ga0207648_10082742 Ga0207648_100827422 197
1367 3300026089 Ga0207648_10248865 Ga0207648_102488652 197
1368 3300026095 Ga0207676_10000079 Ga0207676_1000007998 197
1369 3300026095 Ga0207676_10720567 Ga0207676_107205672 197
1370 3300026116 Ga0207674_10013028 Ga0207674_100130282 197
1371 3300026116 Ga0207674_10303652 Ga0207674_103036522 197
1372 3300026118 Ga0207675_100095437 Ga0207675_1000954373 197
1373 3300026118 Ga0207675_100140676 Ga0207675_1001406761 197
1374 3300026121 Ga0207683_10000037 Ga0207683_100000372 197
1375 3300026121 Ga0207683_10038529 Ga0207683_100385291 197
1376 3300026142 Ga0207698_10725543 Ga0207698_107255432 197
1377 3300027424 Ga0209984_1025295 Ga0209984_10252952 197
1378 3300027462 Ga0210000_1010455 Ga0210000_10104552 197
1379 3300027617 Ga0210002_1000055 Ga0210002_100005516 197
1380 3300027695 Ga0209966_1003905 Ga0209966_10039052 197
1381 3300027695 Ga0209966_1047260 Ga0209966_10472601 197
1382 3300027717 Ga0209998_10001005 Ga0209998_100010053 197
1383 3300027717 Ga0209998_10012476 Ga0209998_100124762 197
1384 3300027876 Ga0209974_10003776 Ga0209974_100037763 197
1385 3300027876 Ga0209974_10006247 Ga0209974_100062473 197
1386 3300027907 Ga0207428_10000947 Ga0207428_1000094716 197
1387 3300027907 Ga0207428_10034068 Ga0207428_100340681 197
1388 3300027907 Ga0207428_10209350 Ga0207428_102093502 197
1389 3300028379 Ga0268266_10222290 Ga0268266_102222901 197
1390 3300028380 Ga0268265_10001593 Ga0268265_100015932 197
1391 3300028380 Ga0268265_10251496 Ga0268265_102514962 197
1392 3300028381 Ga0268264_10002487 Ga0268264_100024872 197
1393 3300028381 Ga0268264_10071239 Ga0268264_100712391 197
1394 3300031241 Ga0265325_10000104 Ga0265325_1000010416 197
1395 3300031241 Ga0265325_10139555 Ga0265325_101395552 197
1396 3300033180 Ga0307510_10070845 Ga0307510_100708452 197
1397 3300034818 Ga0373950_0001326 Ga0373950_0001326_2321_2914 197
1398 3300034818 Ga0373950_0032256 Ga0373950_0032256_79_675 197
1399 3300034819 Ga0373958_0001110 Ga0373958_0001110_2906_3499 197
1400 3300034819 Ga0373958_0024100 Ga0373958_0024100_92_685 197
1401 3300034820 Ga0373959_0037895 Ga0373959_0037895_257_850 197
1402 3300034957 Ga0373938_0011760 Ga0373938_0011760_81_674 197
1403 3300035084 Ga0373928_0000621 Ga0373928_0000621_3897_4490 197
1404 3300035085 Ga0373929_0035100 Ga0373929_0035100_155_748 197
1405 3300035085 Ga0373929_0043985 Ga0373929_0043985_387_983 197
1406 3300035088 Ga0373940_0020800 Ga0373940_0020800_166_759 197
1407 3300035088 Ga0373940_0082408 Ga0373940_0082408_295_891 197
1408 3300035090 Ga0373949_0054052 Ga0373949_0054052_183_776 197
1409 3300035091 Ga0373951_0025972 Ga0373951_0025972_82_675 197
1410 3300035092 Ga0373952_0001248 Ga0373952_0001248_3826_4419 197
1411 3300035092 Ga0373952_0001666 Ga0373952_0001666_2602_3195 197
1412 3300035112 Ga0373932_0003010 Ga0373932_0003010_1208_1801 197
1413 3300035114 Ga0373939_0001456 Ga0373939_0001456_2585_3178 197
1414 3300035114 Ga0373939_0002110 Ga0373939_0002110_1367_1960 197
1415 3300035115 Ga0373941_0000073 Ga0373941_0000073_10655_11248 197
1416 3300035116 Ga0373945_0032058 Ga0373945_0032058_48_644 197
1417 3300035118 Ga0373954_0011780 Ga0373954_0011780_2136_2729 197
1418 3300035118 Ga0373954_0047850 Ga0373954_0047850_116_709 197
1419 3300035119 Ga0373956_0142368 Ga0373956_0142368_359_952 197
1420 3300035121 Ga0373960_0007900 Ga0373960_0007900_1778_2371 197
1421 3300035121 Ga0373960_0047852 Ga0373960_0047852_397_993 197
1422 3300035171 Ga0373946_0100684 Ga0373946_0100684_678_1274 197
1423 3300035172 Ga0373955_0000596 Ga0373955_0000596_622_1218 197
1424 3300035172 Ga0373955_0008707 Ga0373955_0008707_2080_2673 197
1425 3300035207 Ga0373942_0004460 Ga0373942_0004460_2414_3007 197
1426 3300035207 Ga0373942_0031940 Ga0373942_0031940_706_1314 197
1427 3300035241 Ga0373961_0002214 Ga0373961_0002214_315_908 197
1428 3300035241 Ga0373961_0002508 Ga0373961_0002508_4080_4673 197
1429 3300035241 Ga0373961_0028782 Ga0373961_0028782_353_949 197
1430 3300035242 Ga0373962_0011700 Ga0373962_0011700_179_775 197
1431 3300035242 Ga0373962_0038433 Ga0373962_0038433_234_827 197
1432 3300035691 Ga0373931_0188535 Ga0373931_0188535_558_1151 197
1433 3300035692 Ga0373935_0035954 Ga0373935_0035954_28_624 197
1434 3300035724 Ga0373933_0050540 Ga0373933_0050540_559_1152 197
1435 3300035725 Ga0373947_0070451 Ga0373947_0070451_174_770 197
1436 3300036401 Ga0373937_0098200 Ga0373937_0098200_19_612 197
1437 3300037068 Ga0373925_0276660 Ga0373925_0276660_520_1113 197
1438 3300038996 Ga0242420_001294 Ga0242420_001294_1424_2017 197
1439 3300039447 Ga0436361_0134613 Ga0436361_0134613_190_843 197
1440 3300042008 Ga0439450_032555 Ga0439450_032555_369_962 197
1441 3300042016 Ga0439463_005398 Ga0439463_005398_573_1166 197
1442 3300042439 Ga0439464_0008117 Ga0439464_0008117_1031_1624 197
1443 3300042876 Ga0451577_0057746 Ga0451577_0057746_315_908 197
1444 3300046454 Ga0495592_0069788 Ga0495592_0069788_1846_2442 197
1445 3300046454 Ga0495592_0070753 Ga0495592_0070753_523_1116 197
1446 3300046455 Ga0495603_0033777 Ga0495603_0033777_1814_2410 197
1447 3300046457 Ga0495590_0251140 Ga0495590_0251140_24_617 197
1448 3300046459 Ga0495629_0001773 Ga0495629_0001773_15854_16450 197
1449 3300046461 Ga0495641_0013912 Ga0495641_0013912_2276_2872 197
1450 3300046462 Ga0495651_0000921 Ga0495651_0000921_20271_20867 197
1451 3300046462 Ga0495651_0067157 Ga0495651_0067157_670_1263 197
1452 3300046472 Ga0495580_0407193 Ga0495580_0407193_244_840 197
1453 3300046473 Ga0495582_0069273 Ga0495582_0069273_527_1123 197
1454 3300046499 Ga0495594_0242279 Ga0495594_0242279_285_881 197
1455 3300046516 Ga0495628_0014081 Ga0495628_0014081_5095_5688 197
1456 3300046517 Ga0495630_0025494 Ga0495630_0025494_3612_4208 197
1457 3300046529 Ga0495652_0010378 Ga0495652_0010378_5411_6004 197
1458 3300046533 Ga0495640_0087133 Ga0495640_0087133_1406_1999 197
1459 3300046536 Ga0495587_0001768 Ga0495587_0001768_13281_13877 197
1460 3300046543 Ga0495645_0218645 Ga0495645_0218645_30_623 197
1461 3300046559 Ga0495667_0003637 Ga0495667_0003637_569_1162 197
1462 3300046642 Ga0495634_0115116 Ga0495634_0115116_800_1396 197
1463 3300046663 Ga0495635_0010530 Ga0495635_0010530_1519_2115 197
1464 3300046663 Ga0495635_0029945 Ga0495635_0029945_732_1325 197
1465 3300046675 Ga0495657_0039832 Ga0495657_0039832_1748_2341 197
1466 3300046678 Ga0495599_0002940 Ga0495599_0002940_3025_3618 197
1467 3300046679 Ga0495623_0029465 Ga0495623_0029465_1281_1874 197
1468 3300046680 Ga0495646_0165214 Ga0495646_0165214_567_1160 197
1469 3300046683 Ga0495658_0000874 Ga0495658_0000874_9384_9980 197
1470 3300046689 Ga0495613_0032939 Ga0495613_0032939_3170_3766 197
1471 3300046809 Ga0495600_0094688 Ga0495600_0094688_856_1449 197
1472 3300046809 Ga0495600_0598294 Ga0495600_0598294_51_647 197
1473 3300047319 Ga0495674_0062320 Ga0495674_0062320_2464_3057 197
1474 3300047321 Ga0495676_0092609 Ga0495676_0092609_1577_2173 197
1475 3300047322 Ga0495680_0047510 Ga0495680_0047510_2758_3351 197
1476 3300047322 Ga0495680_0076614 Ga0495680_0076614_41_637 197
1477 3300047443 Ga0495687_001479 Ga0495687_001479_721_1398 197
1478 3300047444 Ga0495675_0206297 Ga0495675_0206297_493_1086 197
1479 3300047471 Ga0495684_0334461 Ga0495684_0334461_297_893 197
1480 3300048088 Ga0495602_0000618 Ga0495602_0000618_31323_31919 197
1481 3300048088 Ga0495602_0009515 Ga0495602_0009515_2483_3076 197
1482 3300048903 Ga0496100_0001418 Ga0496100_0001418_426_1019 197
1483 3300048903 Ga0496100_0058013 Ga0496100_0058013_452_1048 197
1484 3300048904 Ga0496101_0023336 Ga0496101_0023336_2545_3138 197
1485 3300048905 Ga0496102_0071148 Ga0496102_0071148_56_649 197
1486 3300048905 Ga0496102_0545390 Ga0496102_0545390_392_985 197
1487 3300048906 Ga0496103_0001402 Ga0496103_0001402_14839_15432 197
1488 3300048906 Ga0496103_0031407 Ga0496103_0031407_1016_1612 197
1489 3300048907 Ga0496104_0000196 Ga0496104_0000196_9519_10112 197
1490 3300048908 Ga0496105_0002714 Ga0496105_0002714_4574_5167 197
1491 3300048909 Ga0496106_0048565 Ga0496106_0048565_2184_2777 197
1492 3300048910 Ga0496107_0002765 Ga0496107_0002765_56_649 197
1493 3300048910 Ga0496107_0015989 Ga0496107_0015989_2766_3362 197
1494 3300048910 Ga0496107_0019262 Ga0496107_0019262_1807_2400 197
1495 3300048911 Ga0496108_0002196 Ga0496108_0002196_7667_8260 197
1496 3300048911 Ga0496108_0010961 Ga0496108_0010961_39_632 197
1497 3300048912 Ga0496109_0068663 Ga0496109_0068663_432_1025 197
1498 3300048913 Ga0496110_0043581 Ga0496110_0043581_3270_3863 197
1499 3300048913 Ga0496110_0065153 Ga0496110_0065153_709_1302 197
1500 3300048913 Ga0496110_0276644 Ga0496110_0276644_473_1069 197
1501 3300048914 Ga0496111_0024822 Ga0496111_0024822_456_1052 197
1502 3300048914 Ga0496111_0064305 Ga0496111_0064305_29_622 197
1503 3300048915 Ga0496112_0046232 Ga0496112_0046232_2361_2954 197
1504 3300048915 Ga0496112_0133256 Ga0496112_0133256_42_638 197
1505 3300048915 Ga0496112_0393785 Ga0496112_0393785_30_626 197
1506 3300048915 Ga0496112_1236967 Ga0496112_1236967_24_617 197
1507 3300048916 Ga0496113_0002343 Ga0496113_0002343_4878_5471 197
1508 3300048916 Ga0496113_0027510 Ga0496113_0027510_1125_1718 197
1509 3300048916 Ga0496113_0031970 Ga0496113_0031970_1052_1648 197
1510 3300048917 Ga0496114_0004563 Ga0496114_0004563_9479_10072 197
1511 3300048917 Ga0496114_0081983 Ga0496114_0081983_312_908 197
1512 3300048918 Ga0496115_0214545 Ga0496115_0214545_147_740 197
1513 3300049587 Ga0501071_0591937 Ga0501071_0591937_214_807 197
1514 3300050496 nmdc:mga07m45_83242_c1 nmdc:mga07m45_83242_c1_956_1549 197
1515 3300050511 nmdc:mga08y16_13725_c1 nmdc:mga08y16_13725_c1_4052_4645 197
1516 3300050511 nmdc:mga08y16_77404_c1 nmdc:mga08y16_77404_c1_1587_2180 197
1517 3300050512 nmdc:mga0n895_211894_c1 nmdc:mga0n895_211894_c1_1189_1782 197
1518 3300050512 nmdc:mga0n895_408739_c1 nmdc:mga0n895_408739_c1_503_1099 197
1519 3300050513 nmdc:mga0rr50_19830_c1 nmdc:mga0rr50_19830_c1_1560_2153 197
1520 3300050514 nmdc:mga08x19_157864_c1 nmdc:mga08x19_157864_c1_430_1026 197
1521 3300050515 nmdc:mga0a205_12523_c1 nmdc:mga0a205_12523_c1_4593_5186 197
1522 3300053077 Ga0495601_0224068 Ga0495601_0224068_355_1014 197
1523 3300053078 Ga0495612_0000795 Ga0495612_0000795_10670_11263 197
1524 3300053084 Ga0495595_0001780 Ga0495595_0001780_5167_5760 197
1525 3300053084 Ga0495595_0231695 Ga0495595_0231695_264_860 197
1526 3300053085 Ga0495619_0001605 Ga0495619_0001605_1447_2040 197
1527 3300053085 Ga0495619_0017496 Ga0495619_0017496_920_1516 197
1528 3300053131 Ga0500652_094295 Ga0500652_094295_405_1079 197
1529 3300060353 Ga0501082_0359557 Ga0501082_0359557_518_1141 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

44

224

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.9282 1 190
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.9277 3 192
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.892 3 192
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8919 1 190
8e0m-assembly1.cif.gz_B homotrimeric variant of tctrp9, bgl15 0.364 41 182
ID Description Score Start End Superfamily
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9234 10 180 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.901 10 180 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8816 10 180 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.861 10 180 1.10.1760.20
af_Q2FVK0_1_153_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3647 62 183 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A1E3H611-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9734 2 194 GO:0005886
GO:0008654
GO:0043772
AF-A0A6N8T7P6-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9717 2 193 GO:0005886
GO:0008654
GO:0043772
AF-A0A6B8KE78-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9707 2 193 GO:0005886
GO:0008654
GO:0043772
AF-A0A530APE1-F1-model_v4 Glycerol-3-phosphate 1-O-acyltransferase PlsY (EC 2.3.1.15) 0.9693 1 165 GO:0004366
GO:0005886
GO:0008654
GO:0043772
AF-A0A3C0ME81-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9688 2 180 GO:0005886
GO:0008654
GO:0043772

Feature Viewer

pLDDT pTM Quality
94.62 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map