F494589
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1529 | 533 | 1506 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10464690|Ga0105237_104646901 |
| Length | 240 |
| Sequence | MFVRRAAHRWSCYDAHGRRKAWGKRMLQSFTPSLLPAYAAALAFGYLCGSVPFGLIITRLAGTRDIRSIGSGNIGATNVLRTGRKGLAAATLVGDALKGTFAVLAIYYYYGPEYRYFAHDLAIPAAFGAFLGHLFPVWLGFKGGKGVATYIGLLLALAWPVAIAFCLVWLAVAAATRYSSLAALVASAATPFALWLLGYWPEPALFALLTALLWIMHRANIARLVNGTEGKIGKTTASET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 4 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 5 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 6 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 7 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 8 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 9 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 10 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 11 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 12 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 13 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 14 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 15 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 16 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 17 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 18 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 19 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 20 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 21 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 22 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 23 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 24 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 25 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 26 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 27 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 28 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 29 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 30 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 33 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 34 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 35 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 36 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 37 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 38 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 39 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 40 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 41 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 42 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 45 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 89 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 110 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 113 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 114 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 115 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 116 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 117 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 123 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 124 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 125 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 127 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 128 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 129 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 130 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 131 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 135 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 136 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 137 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 141 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 142 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 143 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 144 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 145 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 146 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 147 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 148 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 149 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 150 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 152 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 153 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 169 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 172 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 173 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 174 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 175 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 176 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 177 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 178 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 194 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 275 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 279 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 280 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 284 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 285 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 286 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 287 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 288 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 289 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 290 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 291 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 292 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 293 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 294 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 295 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 296 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 297 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 298 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 299 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 300 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 301 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 302 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 303 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 304 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 305 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 306 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 307 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 308 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 309 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 310 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 312 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 313 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 314 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 315 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 318 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 319 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 320 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 321 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 322 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 323 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 324 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 325 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 327 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 329 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 330 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 331 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 332 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 333 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 334 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 335 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 336 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 338 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 339 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 340 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 341 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 342 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 343 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 344 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 345 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 346 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 347 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 348 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 349 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 350 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 351 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 352 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 353 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 354 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 355 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 356 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 357 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 443 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 444 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 445 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 446 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 447 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 448 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 451 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 452 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 453 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 454 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 455 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 456 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 457 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 458 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 459 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 460 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 461 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 462 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 463 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 464 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 465 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 491 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 492 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 493 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 494 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 495 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 496 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 497 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 498 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 508 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 514 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 515 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 516 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 517 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 518 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 519 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 520 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 521 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 522 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 523 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 524 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 525 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 526 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 527 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 528 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 529 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 532 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 533 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.36 |
| Metatranscriptomes | 0.13 |
| Isolates | 1.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.05 |
| Nodule | 0.39 |
| Rhizoplane | 8.11 |
| Rhizosphere | 85.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214856315 | 2209111006 | Bacteria | 8009 |
| 2 | ARcpr5oldR_c000202 | 3300000041 | Bacteria | 10028 |
| 3 | ARSoilYngRDRAFT_c00201 | 3300000042 | Bacteria | 9997 |
| 4 | ARcpr5yngRDRAFT_c000176 | 3300000043 | Bacteria | 10012 |
| 5 | ARSoilOldRDRAFT_c000187 | 3300000044 | Bacteria | 10022 |
| 6 | ARCol0oldRDRAFT_c02347 | 3300000045 | Bacteria | 870 |
| 7 | ARCol0yngRDRAFT_1000204 | 3300000652 | Bacteria | 10000 |
| 8 | JGI24032J14994_100577 | 3300001430 | Bacteria | 1912 |
| 9 | JGI24752J21851_1004412 | 3300001976 | Bacteria | 1845 |
| 10 | JGI24746J21847_1002942 | 3300001977 | Bacteria | 2681 |
| 11 | JGI24739J22299_10012807 | 3300001989 | Bacteria | 3074 |
| 12 | JGI24737J22298_10003419 | 3300001990 | Bacteria | 5615 |
| 13 | JGI24737J22298_10031013 | 3300001990 | Bacteria | 1670 |
| 14 | JGI24743J22301_10004649 | 3300001991 | Bacteria | 2248 |
| 15 | JGI24750J21931_1002092 | 3300002070 | Bacteria | 2428 |
| 16 | JGI24748J21848_1003313 | 3300002074 | Bacteria | 1837 |
| 17 | JGI24738J21930_10002133 | 3300002075 | Bacteria | 5275 |
| 18 | JGI24738J21930_10002848 | 3300002075 | Bacteria | 4431 |
| 19 | JGI24738J21930_10011716 | 3300002075 | Bacteria | 1924 |
| 20 | JGI24744J21845_10013759 | 3300002077 | Bacteria | 1630 |
| 21 | JGI24033J26618_1002523 | 3300002155 | Bacteria | 1880 |
| 22 | JGI24034J26672_10001569 | 3300002239 | Bacteria | 3046 |
| 23 | JGI24034J26672_10004883 | 3300002239 | Bacteria | 1910 |
| 24 | JGI24742J22300_10006556 | 3300002244 | Bacteria | 1921 |
| 25 | JGI24742J22300_10007189 | 3300002244 | Bacteria | 1836 |
| 26 | Ga0006562J51391_1072694 | 3300003578 | Bacteria | 5040 |
| 27 | Ga0065716_1002368 | 3300005277 | Bacteria | 1848 |
| 28 | Ga0065704_10005364 | 3300005289 | Bacteria | 3677 |
| 29 | Ga0065712_10002565 | 3300005290 | Bacteria | 10146 |
| 30 | Ga0065715_10000602 | 3300005293 | Bacteria | 13727 |
| 31 | Ga0065715_10000779 | 3300005293 | Bacteria | 11809 |
| 32 | Ga0065707_10119681 | 3300005295 | Bacteria | 2153 |
| 33 | Ga0065707_10519568 | 3300005295 | Bacteria | 743 |
| 34 | Ga0070658_10304524 | 3300005327 | Bacteria | 1359 |
| 35 | Ga0070658_10542866 | 3300005327 | Bacteria | 1006 |
| 36 | Ga0070676_10000170 | 3300005328 | Bacteria | 26484 |
| 37 | Ga0070676_10048243 | 3300005328 | Bacteria | 2489 |
| 38 | Ga0070676_10055775 | 3300005328 | Bacteria | 2333 |
| 39 | Ga0070683_100007194 | 3300005329 | Bacteria | 9385 |
| 40 | Ga0070683_100025517 | 3300005329 | Bacteria | 5309 |
| 41 | Ga0070683_100267388 | 3300005329 | Bacteria | 1626 |
| 42 | Ga0070683_100776329 | 3300005329 | Bacteria | 918 |
| 43 | Ga0070690_100000533 | 3300005330 | Bacteria | 19053 |
| 44 | Ga0070690_100007785 | 3300005330 | Bacteria | 6140 |
| 45 | Ga0070690_100037856 | 3300005330 | Bacteria | 3041 |
| 46 | Ga0070690_100375674 | 3300005330 | Bacteria | 1038 |
| 47 | Ga0070670_100001563 | 3300005331 | Bacteria | 18448 |
| 48 | Ga0070670_100007710 | 3300005331 | Bacteria | 9151 |
| 49 | Ga0070670_100018981 | 3300005331 | Bacteria | 5897 |
| 50 | Ga0070670_100183906 | 3300005331 | Bacteria | 1814 |
| 51 | Ga0070677_10000320 | 3300005333 | Bacteria | 16762 |
| 52 | Ga0068869_100000181 | 3300005334 | Bacteria | 32256 |
| 53 | Ga0068869_100014062 | 3300005334 | Bacteria | 5341 |
| 54 | Ga0068869_100023059 | 3300005334 | Bacteria | 4294 |
| 55 | Ga0068869_100079064 | 3300005334 | Bacteria | 2450 |
| 56 | Ga0068869_100081008 | 3300005334 | Bacteria | 2423 |
| 57 | Ga0068869_100464313 | 3300005334 | Bacteria | 1051 |
| 58 | Ga0068869_100555443 | 3300005334 | Bacteria | 965 |
| 59 | Ga0068869_100580816 | 3300005334 | Bacteria | 945 |
| 60 | Ga0068869_100956081 | 3300005334 | Bacteria | 744 |
| 61 | Ga0070666_10000893 | 3300005335 | Bacteria | 18149 |
| 62 | Ga0070666_10021002 | 3300005335 | Bacteria | 4228 |
| 63 | Ga0070666_10109278 | 3300005335 | Bacteria | 1911 |
| 64 | Ga0070666_10336369 | 3300005335 | Bacteria | 1079 |
| 65 | Ga0070680_100016082 | 3300005336 | Bacteria | 5878 |
| 66 | Ga0070680_100203803 | 3300005336 | Bacteria | 1668 |
| 67 | Ga0070680_100359363 | 3300005336 | Bacteria | 1239 |
| 68 | Ga0070680_100397581 | 3300005336 | Bacteria | 1174 |
| 69 | Ga0070680_100650272 | 3300005336 | Bacteria | 906 |
| 70 | Ga0070682_100000573 | 3300005337 | Bacteria | 22607 |
| 71 | Ga0070682_100000903 | 3300005337 | Bacteria | 17347 |
| 72 | Ga0070682_100016960 | 3300005337 | Bacteria | 4240 |
| 73 | Ga0070682_100044961 | 3300005337 | Bacteria | 2735 |
| 74 | Ga0070682_100171307 | 3300005337 | Bacteria | 1509 |
| 75 | Ga0068868_100000287 | 3300005338 | Bacteria | 33828 |
| 76 | Ga0068868_100002842 | 3300005338 | Bacteria | 11998 |
| 77 | Ga0068868_100053941 | 3300005338 | Bacteria | 3167 |
| 78 | Ga0068868_100078297 | 3300005338 | Bacteria | 2646 |
| 79 | Ga0068868_100143378 | 3300005338 | Bacteria | 1963 |
| 80 | Ga0068868_100511377 | 3300005338 | Bacteria | 1053 |
| 81 | Ga0070660_100003177 | 3300005339 | Bacteria | 11288 |
| 82 | Ga0070660_100023149 | 3300005339 | Bacteria | 4601 |
| 83 | Ga0070660_100379450 | 3300005339 | Bacteria | 1167 |
| 84 | Ga0070689_100000136 | 3300005340 | Bacteria | 42853 |
| 85 | Ga0070689_100001256 | 3300005340 | Bacteria | 16143 |
| 86 | Ga0070689_100018095 | 3300005340 | Bacteria | 5184 |
| 87 | Ga0070689_100549246 | 3300005340 | Bacteria | 995 |
| 88 | Ga0070691_10000085 | 3300005341 | Bacteria | 26262 |
| 89 | Ga0070691_10000418 | 3300005341 | Bacteria | 15566 |
| 90 | Ga0070691_10323580 | 3300005341 | Bacteria | 849 |
| 91 | Ga0070687_100002615 | 3300005343 | Bacteria | 6803 |
| 92 | Ga0070687_100011861 | 3300005343 | Bacteria | 3828 |
| 93 | Ga0070687_100219702 | 3300005343 | Bacteria | 1163 |
| 94 | Ga0070661_100002616 | 3300005344 | Bacteria | 12337 |
| 95 | Ga0070661_100520801 | 3300005344 | Bacteria | 954 |
| 96 | Ga0070661_100705230 | 3300005344 | Bacteria | 822 |
| 97 | Ga0070661_100894393 | 3300005344 | Bacteria | 733 |
| 98 | Ga0070692_10002091 | 3300005345 | Bacteria | 7619 |
| 99 | Ga0070692_10010746 | 3300005345 | Bacteria | 4180 |
| 100 | Ga0070692_10083630 | 3300005345 | Bacteria | 1723 |
| 101 | Ga0070668_100000188 | 3300005347 | Bacteria | 40404 |
| 102 | Ga0070668_100001169 | 3300005347 | Bacteria | 18553 |
| 103 | Ga0070668_100303584 | 3300005347 | Bacteria | 1339 |
| 104 | Ga0070668_100639276 | 3300005347 | Bacteria | 934 |
| 105 | Ga0070669_100001556 | 3300005353 | Bacteria | 16608 |
| 106 | Ga0070669_100019772 | 3300005353 | Bacteria | 4812 |
| 107 | Ga0070669_100023221 | 3300005353 | Bacteria | 4441 |
| 108 | Ga0070669_101043520 | 3300005353 | Bacteria | 703 |
| 109 | Ga0070675_100038119 | 3300005354 | Bacteria | 3916 |
| 110 | Ga0070675_100045291 | 3300005354 | Bacteria | 3599 |
| 111 | Ga0070675_100049831 | 3300005354 | Bacteria | 3438 |
| 112 | Ga0070671_100005621 | 3300005355 | Bacteria | 9984 |
| 113 | Ga0070671_100008445 | 3300005355 | Bacteria | 8256 |
| 114 | Ga0070671_100085669 | 3300005355 | Bacteria | 2636 |
| 115 | Ga0070671_100484614 | 3300005355 | Bacteria | 1063 |
| 116 | Ga0070671_100619743 | 3300005355 | Bacteria | 936 |
| 117 | Ga0070671_101024128 | 3300005355 | Bacteria | 724 |
| 118 | Ga0070674_100032220 | 3300005356 | Bacteria | 3479 |
| 119 | Ga0070674_100039583 | 3300005356 | Bacteria | 3184 |
| 120 | Ga0070674_100044252 | 3300005356 | Bacteria | 3034 |
| 121 | Ga0070674_100216926 | 3300005356 | Bacteria | 1486 |
| 122 | Ga0070674_101064527 | 3300005356 | Bacteria | 713 |
| 123 | Ga0070673_100000191 | 3300005364 | Bacteria | 30135 |
| 124 | Ga0070673_100003390 | 3300005364 | Bacteria | 9911 |
| 125 | Ga0070688_100000981 | 3300005365 | Bacteria | 14298 |
| 126 | Ga0070688_100009109 | 3300005365 | Bacteria | 5414 |
| 127 | Ga0070688_100067111 | 3300005365 | Bacteria | 2284 |
| 128 | Ga0070688_100113882 | 3300005365 | Bacteria | 1802 |
| 129 | Ga0070688_100141008 | 3300005365 | Bacteria | 1637 |
| 130 | Ga0070688_100152339 | 3300005365 | Bacteria | 1581 |
| 131 | Ga0070688_100214272 | 3300005365 | Bacteria | 1354 |
| 132 | Ga0070688_100559243 | 3300005365 | Bacteria | 871 |
| 133 | Ga0070659_100001504 | 3300005366 | Bacteria | 16803 |
| 134 | Ga0070659_100041455 | 3300005366 | Bacteria | 3598 |
| 135 | Ga0070659_100306809 | 3300005366 | Bacteria | 1325 |
| 136 | Ga0070667_100001681 | 3300005367 | Bacteria | 19789 |
| 137 | Ga0070667_100032349 | 3300005367 | Bacteria | 4362 |
| 138 | Ga0070667_100062837 | 3300005367 | Bacteria | 3146 |
| 139 | Ga0070667_100168830 | 3300005367 | Bacteria | 1930 |
| 140 | Ga0070667_100183834 | 3300005367 | Bacteria | 1849 |
| 141 | Ga0070667_100236644 | 3300005367 | Bacteria | 1629 |
| 142 | Ga0070667_100365985 | 3300005367 | Bacteria | 1307 |
| 143 | Ga0070703_10014931 | 3300005406 | Bacteria | 2217 |
| 144 | Ga0070709_10004792 | 3300005434 | Bacteria | 7307 |
| 145 | Ga0070709_10015140 | 3300005434 | Bacteria | 4382 |
| 146 | Ga0070709_10029345 | 3300005434 | Bacteria | 3289 |
| 147 | Ga0070709_10204030 | 3300005434 | Bacteria | 1402 |
| 148 | Ga0070709_10775126 | 3300005434 | Bacteria | 751 |
| 149 | Ga0070714_100009596 | 3300005435 | Bacteria | 7616 |
| 150 | Ga0070714_100009986 | 3300005435 | Bacteria | 7485 |
| 151 | Ga0070713_100010983 | 3300005436 | Bacteria | 6569 |
| 152 | Ga0070713_100296138 | 3300005436 | Bacteria | 1488 |
| 153 | Ga0070710_10005069 | 3300005437 | Bacteria | 6236 |
| 154 | Ga0070710_10010865 | 3300005437 | Bacteria | 4483 |
| 155 | Ga0070710_10024828 | 3300005437 | Bacteria | 3166 |
| 156 | Ga0070710_10401382 | 3300005437 | Bacteria | 919 |
| 157 | Ga0070701_10000454 | 3300005438 | Bacteria | 14002 |
| 158 | Ga0070701_10001284 | 3300005438 | Bacteria | 9228 |
| 159 | Ga0070701_10046339 | 3300005438 | Bacteria | 2234 |
| 160 | Ga0070711_100000961 | 3300005439 | Bacteria | 15267 |
| 161 | Ga0070711_100034363 | 3300005439 | Bacteria | 3381 |
| 162 | Ga0070711_100099922 | 3300005439 | Bacteria | 2109 |
| 163 | Ga0070711_100140869 | 3300005439 | Bacteria | 1808 |
| 164 | Ga0070705_100006964 | 3300005440 | Bacteria | 5557 |
| 165 | Ga0070705_100009498 | 3300005440 | Bacteria | 4838 |
| 166 | Ga0070705_100014665 | 3300005440 | Bacteria | 4037 |
| 167 | Ga0070705_100149248 | 3300005440 | Bacteria | 1549 |
| 168 | Ga0070705_100364976 | 3300005440 | Bacteria | 1058 |
| 169 | Ga0070700_100001181 | 3300005441 | Bacteria | 12914 |
| 170 | Ga0070700_100004996 | 3300005441 | Bacteria | 6987 |
| 171 | Ga0070700_100026485 | 3300005441 | Bacteria | 3424 |
| 172 | Ga0070700_100046465 | 3300005441 | Bacteria | 2682 |
| 173 | Ga0070694_100000659 | 3300005444 | Bacteria | 19066 |
| 174 | Ga0070694_100005471 | 3300005444 | Bacteria | 7691 |
| 175 | Ga0070694_100026966 | 3300005444 | Bacteria | 3727 |
| 176 | Ga0070694_100168255 | 3300005444 | Bacteria | 1613 |
| 177 | Ga0070694_100258671 | 3300005444 | Bacteria | 1320 |
| 178 | Ga0070708_100012815 | 3300005445 | Bacteria | 6849 |
| 179 | Ga0070708_100217296 | 3300005445 | Bacteria | 1792 |
| 180 | Ga0070708_100301609 | 3300005445 | Bacteria | 1508 |
| 181 | Ga0070708_100541419 | 3300005445 | Bacteria | 1098 |
| 182 | Ga0070663_100001220 | 3300005455 | Bacteria | 14123 |
| 183 | Ga0070663_100001277 | 3300005455 | Bacteria | 13788 |
| 184 | Ga0070663_100020947 | 3300005455 | Bacteria | 4338 |
| 185 | Ga0070663_100026167 | 3300005455 | Bacteria | 3948 |
| 186 | Ga0070663_100084716 | 3300005455 | Bacteria | 2337 |
| 187 | Ga0070663_100256998 | 3300005455 | Bacteria | 1384 |
| 188 | Ga0070663_100544340 | 3300005455 | Bacteria | 969 |
| 189 | Ga0070678_100000682 | 3300005456 | Bacteria | 16729 |
| 190 | Ga0070678_100051447 | 3300005456 | Bacteria | 2986 |
| 191 | Ga0070678_100098678 | 3300005456 | Bacteria | 2259 |
| 192 | Ga0070678_100547881 | 3300005456 | Bacteria | 1026 |
| 193 | Ga0070678_100684868 | 3300005456 | Bacteria | 922 |
| 194 | Ga0070662_100000339 | 3300005457 | Bacteria | 28034 |
| 195 | Ga0070662_100009258 | 3300005457 | Bacteria | 6435 |
| 196 | Ga0070662_100025609 | 3300005457 | Bacteria | 4075 |
| 197 | Ga0070662_100049937 | 3300005457 | Bacteria | 3017 |
| 198 | Ga0070681_10002441 | 3300005458 | Bacteria | 17015 |
| 199 | Ga0070681_10024612 | 3300005458 | Bacteria | 6057 |
| 200 | Ga0070681_10045062 | 3300005458 | Bacteria | 4414 |
| 201 | Ga0068867_100003651 | 3300005459 | Bacteria | 10826 |
| 202 | Ga0068867_100005776 | 3300005459 | Bacteria | 8778 |
| 203 | Ga0068867_100066847 | 3300005459 | Bacteria | 2678 |
| 204 | Ga0068867_100119450 | 3300005459 | Bacteria | 2035 |
| 205 | Ga0070685_10001020 | 3300005466 | Bacteria | 15067 |
| 206 | Ga0070685_10047091 | 3300005466 | Bacteria | 2478 |
| 207 | Ga0070685_10116531 | 3300005466 | Bacteria | 1653 |
| 208 | Ga0070685_10356442 | 3300005466 | Bacteria | 1001 |
| 209 | Ga0070685_10551607 | 3300005466 | Bacteria | 823 |
| 210 | Ga0070706_100409282 | 3300005467 | Bacteria | 1263 |
| 211 | Ga0070707_100247698 | 3300005468 | Bacteria | 1734 |
| 212 | Ga0070698_100520643 | 3300005471 | Bacteria | 1128 |
| 213 | Ga0070699_100003740 | 3300005518 | Bacteria | 13438 |
| 214 | Ga0070699_100005151 | 3300005518 | Bacteria | 11496 |
| 215 | Ga0070699_100243455 | 3300005518 | Bacteria | 1606 |
| 216 | Ga0070699_100265772 | 3300005518 | Bacteria | 1535 |
| 217 | Ga0070679_100002397 | 3300005530 | Bacteria | 16994 |
| 218 | Ga0070679_100205962 | 3300005530 | Bacteria | 1932 |
| 219 | Ga0070679_100363214 | 3300005530 | Bacteria | 1395 |
| 220 | Ga0070684_100023896 | 3300005535 | Bacteria | 5120 |
| 221 | Ga0070684_100129882 | 3300005535 | Bacteria | 2272 |
| 222 | Ga0070697_100180051 | 3300005536 | Bacteria | 1792 |
| 223 | Ga0070697_100180676 | 3300005536 | Bacteria | 1788 |
| 224 | Ga0068853_100002127 | 3300005539 | Bacteria | 14736 |
| 225 | Ga0068853_100285340 | 3300005539 | Bacteria | 1522 |
| 226 | Ga0068853_100363022 | 3300005539 | Bacteria | 1349 |
| 227 | Ga0070672_100008180 | 3300005543 | Bacteria | 7146 |
| 228 | Ga0070672_100104924 | 3300005543 | Bacteria | 2297 |
| 229 | Ga0070672_100129901 | 3300005543 | Bacteria | 2069 |
| 230 | Ga0070686_100000707 | 3300005544 | Bacteria | 19394 |
| 231 | Ga0070686_100001852 | 3300005544 | Bacteria | 11801 |
| 232 | Ga0070686_100010885 | 3300005544 | Bacteria | 5148 |
| 233 | Ga0070686_100026881 | 3300005544 | Bacteria | 3477 |
| 234 | Ga0070686_100043297 | 3300005544 | Bacteria | 2824 |
| 235 | Ga0070695_100000995 | 3300005545 | Bacteria | 15425 |
| 236 | Ga0070695_100017667 | 3300005545 | Bacteria | 4327 |
| 237 | Ga0070695_100029096 | 3300005545 | Bacteria | 3431 |
| 238 | Ga0070696_100000743 | 3300005546 | Bacteria | 20824 |
| 239 | Ga0070696_100030172 | 3300005546 | Bacteria | 3711 |
| 240 | Ga0070696_100059761 | 3300005546 | Bacteria | 2664 |
| 241 | Ga0070696_100180766 | 3300005546 | Bacteria | 1565 |
| 242 | Ga0070696_100196382 | 3300005546 | Bacteria | 1504 |
| 243 | Ga0070696_100551444 | 3300005546 | Bacteria | 924 |
| 244 | Ga0070693_100000993 | 3300005547 | Bacteria | 12644 |
| 245 | Ga0070693_100003405 | 3300005547 | Bacteria | 7408 |
| 246 | Ga0070693_100193224 | 3300005547 | Bacteria | 1318 |
| 247 | Ga0070665_100011802 | 3300005548 | Bacteria | 8824 |
| 248 | Ga0070665_100012968 | 3300005548 | Bacteria | 8394 |
| 249 | Ga0070665_100015770 | 3300005548 | Bacteria | 7591 |
| 250 | Ga0070665_100031231 | 3300005548 | Bacteria | 5361 |
| 251 | Ga0070665_100172863 | 3300005548 | Bacteria | 2161 |
| 252 | Ga0070665_100223967 | 3300005548 | Bacteria | 1881 |
| 253 | Ga0070704_100000607 | 3300005549 | Bacteria | 17259 |
| 254 | Ga0070704_100129790 | 3300005549 | Bacteria | 1951 |
| 255 | Ga0070704_100179847 | 3300005549 | Bacteria | 1690 |
| 256 | Ga0068855_100003471 | 3300005563 | Bacteria | 19298 |
| 257 | Ga0068855_100012458 | 3300005563 | Bacteria | 10267 |
| 258 | Ga0068855_100065612 | 3300005563 | Bacteria | 4232 |
| 259 | Ga0070664_100044843 | 3300005564 | Bacteria | 3734 |
| 260 | Ga0070664_100144557 | 3300005564 | Bacteria | 2097 |
| 261 | Ga0070664_100163030 | 3300005564 | Bacteria | 1973 |
| 262 | Ga0070664_100234239 | 3300005564 | Bacteria | 1647 |
| 263 | Ga0070664_100485787 | 3300005564 | Bacteria | 1137 |
| 264 | Ga0068857_100007472 | 3300005577 | Bacteria | 9408 |
| 265 | Ga0068857_100288465 | 3300005577 | Bacteria | 1511 |
| 266 | Ga0068854_100005622 | 3300005578 | Bacteria | 7920 |
| 267 | Ga0068854_100007745 | 3300005578 | Bacteria | 6866 |
| 268 | Ga0068854_100112874 | 3300005578 | Bacteria | 2052 |
| 269 | Ga0068854_100444423 | 3300005578 | Bacteria | 1082 |
| 270 | Ga0068856_100004777 | 3300005614 | Bacteria | 13428 |
| 271 | Ga0068856_100059691 | 3300005614 | Bacteria | 3767 |
| 272 | Ga0068856_100071204 | 3300005614 | Bacteria | 3441 |
| 273 | Ga0070702_100000022 | 3300005615 | Bacteria | 44333 |
| 274 | Ga0070702_100002122 | 3300005615 | Bacteria | 8421 |
| 275 | Ga0070702_100046887 | 3300005615 | Bacteria | 2452 |
| 276 | Ga0070702_100125969 | 3300005615 | Bacteria | 1611 |
| 277 | Ga0070702_100141601 | 3300005615 | Bacteria | 1532 |
| 278 | Ga0068852_100006412 | 3300005616 | Bacteria | 8501 |
| 279 | Ga0068852_100073978 | 3300005616 | Bacteria | 2999 |
| 280 | Ga0068852_100191180 | 3300005616 | Bacteria | 1932 |
| 281 | Ga0068859_100002296 | 3300005617 | Bacteria | 19413 |
| 282 | Ga0068859_100038396 | 3300005617 | Bacteria | 4804 |
| 283 | Ga0068859_100043181 | 3300005617 | Bacteria | 4530 |
| 284 | Ga0068859_100451919 | 3300005617 | Bacteria | 1381 |
| 285 | Ga0068864_100002090 | 3300005618 | Bacteria | 16498 |
| 286 | Ga0068864_100004252 | 3300005618 | Bacteria | 11784 |
| 287 | Ga0068864_100030933 | 3300005618 | Bacteria | 4539 |
| 288 | Ga0068866_10002715 | 3300005718 | Bacteria | 7301 |
| 289 | Ga0068866_10010382 | 3300005718 | Bacteria | 3990 |
| 290 | Ga0068866_10066835 | 3300005718 | Bacteria | 1885 |
| 291 | Ga0068861_100001574 | 3300005719 | Bacteria | 14514 |
| 292 | Ga0068861_100001910 | 3300005719 | Bacteria | 13413 |
| 293 | Ga0068861_100142225 | 3300005719 | Bacteria | 1959 |
| 294 | Ga0068861_100145140 | 3300005719 | Bacteria | 1941 |
| 295 | Ga0068861_100456140 | 3300005719 | Bacteria | 1146 |
| 296 | Ga0068861_100579863 | 3300005719 | Bacteria | 1026 |
| 297 | Ga0068861_100596011 | 3300005719 | Bacteria | 1013 |
| 298 | Ga0068851_10012493 | 3300005834 | Bacteria | 4005 |
| 299 | Ga0068851_10244094 | 3300005834 | Bacteria | 1017 |
| 300 | Ga0068870_10000133 | 3300005840 | Bacteria | 25631 |
| 301 | Ga0068870_10078105 | 3300005840 | Bacteria | 1822 |
| 302 | Ga0068870_10103020 | 3300005840 | Bacteria | 1617 |
| 303 | Ga0068863_100001307 | 3300005841 | Bacteria | 24847 |
| 304 | Ga0068863_100010858 | 3300005841 | Bacteria | 8831 |
| 305 | Ga0068863_100050785 | 3300005841 | Bacteria | 3930 |
| 306 | Ga0068863_100118460 | 3300005841 | Bacteria | 2524 |
| 307 | Ga0068863_100156523 | 3300005841 | Bacteria | 2182 |
| 308 | Ga0068858_100001450 | 3300005842 | Bacteria | 24400 |
| 309 | Ga0068858_100029162 | 3300005842 | Bacteria | 5124 |
| 310 | Ga0068858_100047364 | 3300005842 | Bacteria | 3985 |
| 311 | Ga0068858_100055131 | 3300005842 | Bacteria | 3674 |
| 312 | Ga0068858_100103118 | 3300005842 | Bacteria | 2661 |
| 313 | Ga0068860_100003358 | 3300005843 | Bacteria | 16477 |
| 314 | Ga0068860_100011366 | 3300005843 | Bacteria | 8773 |
| 315 | Ga0068860_100040861 | 3300005843 | Bacteria | 4431 |
| 316 | Ga0068860_100067009 | 3300005843 | Bacteria | 3411 |
| 317 | Ga0068860_100119726 | 3300005843 | Bacteria | 2520 |
| 318 | Ga0068860_100146466 | 3300005843 | Bacteria | 2272 |
| 319 | Ga0068862_100006524 | 3300005844 | Bacteria | 9686 |
| 320 | Ga0068862_100013206 | 3300005844 | Bacteria | 6830 |
| 321 | Ga0068862_100188553 | 3300005844 | Bacteria | 1854 |
| 322 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 323 | Ga0081455_10006075 | 3300005937 | Bacteria | 13071 |
| 324 | Ga0081455_10034040 | 3300005937 | Bacteria | 4570 |
| 325 | Ga0081455_10039510 | 3300005937 | Bacteria | 4169 |
| 326 | Ga0081455_10072301 | 3300005937 | Bacteria | 2856 |
| 327 | Ga0081538_10001263 | 3300005981 | Bacteria | 26406 |
| 328 | Ga0081540_1005549 | 3300005983 | Bacteria | 9399 |
| 329 | Ga0081540_1007633 | 3300005983 | Bacteria | 7676 |
| 330 | Ga0081540_1008834 | 3300005983 | Bacteria | 6997 |
| 331 | Ga0081540_1015330 | 3300005983 | Bacteria | 4856 |
| 332 | Ga0081540_1059689 | 3300005983 | Bacteria | 1829 |
| 333 | Ga0070717_10012313 | 3300006028 | Bacteria | 6520 |
| 334 | Ga0070717_10150544 | 3300006028 | Bacteria | 2013 |
| 335 | Ga0075365_10034820 | 3300006038 | Bacteria | 3254 |
| 336 | Ga0075365_10049225 | 3300006038 | Bacteria | 2776 |
| 337 | Ga0075365_10063140 | 3300006038 | Bacteria | 2479 |
| 338 | Ga0075365_10086232 | 3300006038 | Bacteria | 2134 |
| 339 | Ga0075365_10393029 | 3300006038 | Bacteria | 978 |
| 340 | Ga0075368_10062213 | 3300006042 | Bacteria | 1496 |
| 341 | Ga0075363_100002157 | 3300006048 | Bacteria | 7916 |
| 342 | Ga0075363_100038988 | 3300006048 | Bacteria | 2499 |
| 343 | Ga0075364_10176770 | 3300006051 | Bacteria | 1444 |
| 344 | Ga0075364_10281845 | 3300006051 | Bacteria | 1130 |
| 345 | Ga0075364_10362623 | 3300006051 | Bacteria | 988 |
| 346 | Ga0075432_10009083 | 3300006058 | Bacteria | 3386 |
| 347 | Ga0075432_10050851 | 3300006058 | Bacteria | 1462 |
| 348 | Ga0070715_10001233 | 3300006163 | Bacteria | 7360 |
| 349 | Ga0070715_10001884 | 3300006163 | Bacteria | 6287 |
| 350 | Ga0070715_10010881 | 3300006163 | Bacteria | 3256 |
| 351 | Ga0070716_100001144 | 3300006173 | Bacteria | 11698 |
| 352 | Ga0070716_100003890 | 3300006173 | Bacteria | 7086 |
| 353 | Ga0070716_100225011 | 3300006173 | Bacteria | 1263 |
| 354 | Ga0070712_100006971 | 3300006175 | Bacteria | 7045 |
| 355 | Ga0070712_100012714 | 3300006175 | Bacteria | 5358 |
| 356 | Ga0070712_100083832 | 3300006175 | Bacteria | 2316 |
| 357 | Ga0070712_100150703 | 3300006175 | Bacteria | 1785 |
| 358 | Ga0070712_100158544 | 3300006175 | Bacteria | 1745 |
| 359 | Ga0070712_100519742 | 3300006175 | Bacteria | 1000 |
| 360 | Ga0075362_10059913 | 3300006177 | Bacteria | 1720 |
| 361 | Ga0075367_10017457 | 3300006178 | Bacteria | 3940 |
| 362 | Ga0075367_10161551 | 3300006178 | Bacteria | 1393 |
| 363 | Ga0075369_10009009 | 3300006186 | Bacteria | 3862 |
| 364 | Ga0075427_10000933 | 3300006194 | Bacteria | 3598 |
| 365 | Ga0075366_10095588 | 3300006195 | Bacteria | 1781 |
| 366 | Ga0075366_10346061 | 3300006195 | Bacteria | 912 |
| 367 | Ga0097621_100000616 | 3300006237 | Bacteria | 25167 |
| 368 | Ga0097621_100067560 | 3300006237 | Bacteria | 2946 |
| 369 | Ga0097621_100130845 | 3300006237 | Bacteria | 2136 |
| 370 | Ga0097621_100451891 | 3300006237 | Bacteria | 1158 |
| 371 | Ga0075370_10051098 | 3300006353 | Bacteria | 2345 |
| 372 | Ga0075370_10405111 | 3300006353 | Bacteria | 818 |
| 373 | Ga0068871_100016286 | 3300006358 | Bacteria | 5594 |
| 374 | Ga0068871_100031874 | 3300006358 | Bacteria | 4159 |
| 375 | Ga0068871_100045370 | 3300006358 | Bacteria | 3538 |
| 376 | Ga0068871_100116665 | 3300006358 | Bacteria | 2251 |
| 377 | Ga0075428_100009524 | 3300006844 | Bacteria | 10786 |
| 378 | Ga0075428_100093645 | 3300006844 | Bacteria | 3276 |
| 379 | Ga0075428_100319812 | 3300006844 | Bacteria | 1667 |
| 380 | Ga0075428_100697545 | 3300006844 | Bacteria | 1081 |
| 381 | Ga0075428_100914195 | 3300006844 | Bacteria | 931 |
| 382 | Ga0075430_100053356 | 3300006846 | Bacteria | 3404 |
| 383 | Ga0075430_100077845 | 3300006846 | Bacteria | 2780 |
| 384 | Ga0075431_100004032 | 3300006847 | Bacteria | 14306 |
| 385 | Ga0075431_100025139 | 3300006847 | Bacteria | 6104 |
| 386 | Ga0075431_100312229 | 3300006847 | Bacteria | 1587 |
| 387 | Ga0075433_10000876 | 3300006852 | Bacteria | 21135 |
| 388 | Ga0075433_10061884 | 3300006852 | Bacteria | 3279 |
| 389 | Ga0075433_10156830 | 3300006852 | Bacteria | 2025 |
| 390 | Ga0075433_10327623 | 3300006852 | Bacteria | 1355 |
| 391 | Ga0075433_10464983 | 3300006852 | Bacteria | 1115 |
| 392 | Ga0075433_10975308 | 3300006852 | Bacteria | 738 |
| 393 | Ga0075434_100003784 | 3300006871 | Bacteria | 13520 |
| 394 | Ga0075434_100026789 | 3300006871 | Bacteria | 5653 |
| 395 | Ga0075434_100056876 | 3300006871 | Bacteria | 3887 |
| 396 | Ga0075434_100103418 | 3300006871 | Bacteria | 2856 |
| 397 | Ga0075434_100237368 | 3300006871 | Bacteria | 1843 |
| 398 | Ga0075434_100326636 | 3300006871 | Bacteria | 1555 |
| 399 | Ga0075434_100453414 | 3300006871 | Bacteria | 1304 |
| 400 | Ga0075434_100465532 | 3300006871 | Bacteria | 1285 |
| 401 | Ga0075429_100178387 | 3300006880 | Bacteria | 1861 |
| 402 | Ga0075429_100207320 | 3300006880 | Bacteria | 1717 |
| 403 | Ga0068865_100001101 | 3300006881 | Bacteria | 15599 |
| 404 | Ga0068865_100039979 | 3300006881 | Bacteria | 3184 |
| 405 | Ga0068865_100053184 | 3300006881 | Bacteria | 2809 |
| 406 | Ga0068865_100448001 | 3300006881 | Bacteria | 1067 |
| 407 | Ga0075436_100027016 | 3300006914 | Bacteria | 3952 |
| 408 | Ga0075436_100131444 | 3300006914 | Bacteria | 1756 |
| 409 | Ga0075436_100254770 | 3300006914 | Bacteria | 1250 |
| 410 | Ga0075436_100272646 | 3300006914 | Bacteria | 1209 |
| 411 | Ga0097620_100002296 | 3300006931 | Bacteria | 19413 |
| 412 | Ga0097620_100038394 | 3300006931 | Bacteria | 4804 |
| 413 | Ga0097620_100043182 | 3300006931 | Bacteria | 4530 |
| 414 | Ga0097620_100451932 | 3300006931 | Bacteria | 1381 |
| 415 | Ga0075435_100020401 | 3300007076 | Bacteria | 5078 |
| 416 | Ga0075435_100024050 | 3300007076 | Bacteria | 4721 |
| 417 | Ga0075435_100032996 | 3300007076 | Bacteria | 4091 |
| 418 | Ga0075435_100041844 | 3300007076 | Bacteria | 3663 |
| 419 | Ga0075435_100063268 | 3300007076 | Bacteria | 3005 |
| 420 | Ga0075435_100114060 | 3300007076 | Bacteria | 2250 |
| 421 | Ga0075435_100117179 | 3300007076 | Bacteria | 2219 |
| 422 | Ga0099795_10000155 | 3300007788 | Bacteria | 11496 |
| 423 | Ga0105251_10037175 | 3300009011 | Bacteria | 2391 |
| 424 | Ga0105251_10051478 | 3300009011 | Bacteria | 1964 |
| 425 | Ga0105244_10061434 | 3300009036 | Bacteria | 1891 |
| 426 | Ga0105250_10026850 | 3300009092 | Bacteria | 2320 |
| 427 | Ga0105250_10137392 | 3300009092 | Bacteria | 1012 |
| 428 | Ga0105250_10327236 | 3300009092 | Bacteria | 667 |
| 429 | Ga0105240_10011690 | 3300009093 | Bacteria | 12198 |
| 430 | Ga0105240_10031786 | 3300009093 | Bacteria | 6839 |
| 431 | Ga0105240_11715710 | 3300009093 | Bacteria | 655 |
| 432 | Ga0111539_10003401 | 3300009094 | Bacteria | 20957 |
| 433 | Ga0111539_10035433 | 3300009094 | Bacteria | 6042 |
| 434 | Ga0111539_10042647 | 3300009094 | Bacteria | 5446 |
| 435 | Ga0111539_10171638 | 3300009094 | Bacteria | 2533 |
| 436 | Ga0111539_10174268 | 3300009094 | Bacteria | 2513 |
| 437 | Ga0111539_10391019 | 3300009094 | Bacteria | 1619 |
| 438 | Ga0111539_11144462 | 3300009094 | Bacteria | 904 |
| 439 | Ga0111539_12097479 | 3300009094 | Bacteria | 656 |
| 440 | Ga0105245_10002367 | 3300009098 | Bacteria | 17040 |
| 441 | Ga0105245_10056051 | 3300009098 | Bacteria | 3541 |
| 442 | Ga0105245_10157650 | 3300009098 | Bacteria | 2151 |
| 443 | Ga0105245_10601755 | 3300009098 | Bacteria | 1126 |
| 444 | Ga0105247_10001141 | 3300009101 | Bacteria | 19671 |
| 445 | Ga0105247_10007741 | 3300009101 | Bacteria | 6574 |
| 446 | Ga0105247_10008319 | 3300009101 | Bacteria | 6328 |
| 447 | Ga0105247_10011047 | 3300009101 | Bacteria | 5448 |
| 448 | Ga0105247_10018808 | 3300009101 | Bacteria | 4147 |
| 449 | Ga0105247_10028441 | 3300009101 | Bacteria | 3383 |
| 450 | Ga0105247_10775489 | 3300009101 | Bacteria | 729 |
| 451 | Ga0114129_10018611 | 3300009147 | Bacteria | 9888 |
| 452 | Ga0114129_10058921 | 3300009147 | Bacteria | 5370 |
| 453 | Ga0114129_10141666 | 3300009147 | Bacteria | 3295 |
| 454 | Ga0114129_10207555 | 3300009147 | Bacteria | 2650 |
| 455 | Ga0114129_10679670 | 3300009147 | Bacteria | 1325 |
| 456 | Ga0105243_10000417 | 3300009148 | Bacteria | 44794 |
| 457 | Ga0105243_10002317 | 3300009148 | Bacteria | 15945 |
| 458 | Ga0105243_10015545 | 3300009148 | Bacteria | 5753 |
| 459 | Ga0105241_10000456 | 3300009174 | Bacteria | 30774 |
| 460 | Ga0105241_10003767 | 3300009174 | Bacteria | 11245 |
| 461 | Ga0105241_10072284 | 3300009174 | Bacteria | 2680 |
| 462 | Ga0105241_10205607 | 3300009174 | Bacteria | 1647 |
| 463 | Ga0105241_10344256 | 3300009174 | Bacteria | 1293 |
| 464 | Ga0105242_10000990 | 3300009176 | Bacteria | 22224 |
| 465 | Ga0105242_10002247 | 3300009176 | Bacteria | 15232 |
| 466 | Ga0105242_10137941 | 3300009176 | Bacteria | 2113 |
| 467 | Ga0105242_10329538 | 3300009176 | Bacteria | 1403 |
| 468 | Ga0105242_10600087 | 3300009176 | Bacteria | 1063 |
| 469 | Ga0105242_10816779 | 3300009176 | Bacteria | 924 |
| 470 | Ga0105248_10000293 | 3300009177 | Bacteria | 59383 |
| 471 | Ga0105248_10013733 | 3300009177 | Bacteria | 8914 |
| 472 | Ga0105248_10047103 | 3300009177 | Bacteria | 4834 |
| 473 | Ga0105248_10064060 | 3300009177 | Bacteria | 4127 |
| 474 | Ga0105248_10067752 | 3300009177 | Bacteria | 4007 |
| 475 | Ga0105248_10083940 | 3300009177 | Bacteria | 3583 |
| 476 | Ga0105248_10089844 | 3300009177 | Bacteria | 3458 |
| 477 | Ga0105248_10198164 | 3300009177 | Bacteria | 2262 |
| 478 | Ga0105248_10955660 | 3300009177 | Bacteria | 968 |
| 479 | Ga0105237_10000712 | 3300009545 | Bacteria | 46011 |
| 480 | Ga0105237_10024092 | 3300009545 | Bacteria | 6227 |
| 481 | Ga0105237_10338448 | 3300009545 | Bacteria | 1509 |
| 482 | Ga0105237_10464690 | 3300009545 | Bacteria | 1271 |
| 483 | Ga0105238_10008146 | 3300009551 | Bacteria | 10483 |
| 484 | Ga0105238_10088824 | 3300009551 | Bacteria | 3077 |
| 485 | Ga0105238_10757331 | 3300009551 | Bacteria | 985 |
| 486 | Ga0105249_10001033 | 3300009553 | Bacteria | 24619 |
| 487 | Ga0105249_10025232 | 3300009553 | Bacteria | 5348 |
| 488 | Ga0105249_10049172 | 3300009553 | Bacteria | 3845 |
| 489 | Ga0105249_10137387 | 3300009553 | Bacteria | 2341 |
| 490 | Ga0099796_10000545 | 3300010159 | Bacteria | 6436 |
| 491 | Ga0105239_10024373 | 3300010375 | Bacteria | 6666 |
| 492 | Ga0105239_10121234 | 3300010375 | Bacteria | 2904 |
| 493 | Ga0105239_10135993 | 3300010375 | Bacteria | 2736 |
| 494 | Ga0105239_10402983 | 3300010375 | Bacteria | 1548 |
| 495 | Ga0105246_10000118 | 3300011119 | Bacteria | 35893 |
| 496 | Ga0105246_10001800 | 3300011119 | Bacteria | 12824 |
| 497 | Ga0105246_10030840 | 3300011119 | Bacteria | 3544 |
| 498 | Ga0105246_10237213 | 3300011119 | Bacteria | 1440 |
| 499 | Ga0105246_10466612 | 3300011119 | Bacteria | 1065 |
| 500 | Ga0157344_1000799 | 3300012476 | Bacteria | 1343 |
| 501 | Ga0157346_1002141 | 3300012480 | Bacteria | 1002 |
| 502 | Ga0157335_1002311 | 3300012492 | Bacteria | 1140 |
| 503 | Ga0157341_1006083 | 3300012494 | Bacteria | 924 |
| 504 | Ga0157313_1001600 | 3300012503 | Bacteria | 1245 |
| 505 | Ga0157316_1003972 | 3300012510 | Bacteria | 1097 |
| 506 | Ga0157338_1011623 | 3300012515 | Bacteria | 908 |
| 507 | Ga0157373_10027665 | 3300013100 | Bacteria | 4091 |
| 508 | Ga0157373_10619101 | 3300013100 | Bacteria | 789 |
| 509 | Ga0157371_10005561 | 3300013102 | Bacteria | 10597 |
| 510 | Ga0157371_10164975 | 3300013102 | Bacteria | 1582 |
| 511 | Ga0157370_10014874 | 3300013104 | Bacteria | 7940 |
| 512 | Ga0157369_10034660 | 3300013105 | Bacteria | 5537 |
| 513 | Ga0157369_10524924 | 3300013105 | Bacteria | 1225 |
| 514 | Ga0157374_10004169 | 3300013296 | Bacteria | 12136 |
| 515 | Ga0157374_10067658 | 3300013296 | Bacteria | 3359 |
| 516 | Ga0157374_10068417 | 3300013296 | Bacteria | 3341 |
| 517 | Ga0157374_10775036 | 3300013296 | Bacteria | 974 |
| 518 | Ga0157378_10000643 | 3300013297 | Bacteria | 32822 |
| 519 | Ga0157378_10047383 | 3300013297 | Bacteria | 3822 |
| 520 | Ga0157378_10075985 | 3300013297 | Bacteria | 3025 |
| 521 | Ga0157378_10369456 | 3300013297 | Bacteria | 1406 |
| 522 | Ga0163162_10003401 | 3300013306 | Bacteria | 15185 |
| 523 | Ga0163162_10009748 | 3300013306 | Bacteria | 9350 |
| 524 | Ga0163162_10009782 | 3300013306 | Bacteria | 9332 |
| 525 | Ga0163162_10181804 | 3300013306 | Bacteria | 2229 |
| 526 | Ga0163162_10206364 | 3300013306 | Bacteria | 2094 |
| 527 | Ga0163162_10285414 | 3300013306 | Bacteria | 1782 |
| 528 | Ga0163162_10622692 | 3300013306 | Bacteria | 1204 |
| 529 | Ga0163162_10661123 | 3300013306 | Bacteria | 1168 |
| 530 | Ga0163162_11180439 | 3300013306 | Bacteria | 868 |
| 531 | Ga0157372_10001248 | 3300013307 | Bacteria | 27510 |
| 532 | Ga0157372_10014509 | 3300013307 | Bacteria | 8432 |
| 533 | Ga0157372_10116252 | 3300013307 | Bacteria | 3067 |
| 534 | Ga0157372_10405850 | 3300013307 | Bacteria | 1588 |
| 535 | Ga0157375_10002635 | 3300013308 | Bacteria | 15534 |
| 536 | Ga0157375_10039024 | 3300013308 | Bacteria | 4565 |
| 537 | Ga0157375_10063052 | 3300013308 | Bacteria | 3686 |
| 538 | Ga0157375_10124184 | 3300013308 | Bacteria | 2694 |
| 539 | Ga0157375_10419068 | 3300013308 | Bacteria | 1505 |
| 540 | Ga0157375_10461012 | 3300013308 | Bacteria | 1436 |
| 541 | Ga0163163_10005028 | 3300014325 | Bacteria | 11396 |
| 542 | Ga0163163_10005155 | 3300014325 | Bacteria | 11267 |
| 543 | Ga0163163_10047249 | 3300014325 | Bacteria | 4231 |
| 544 | Ga0163163_10096909 | 3300014325 | Bacteria | 2970 |
| 545 | Ga0163163_10176164 | 3300014325 | Bacteria | 2185 |
| 546 | Ga0163163_10196977 | 3300014325 | Bacteria | 2063 |
| 547 | Ga0163163_10227523 | 3300014325 | Bacteria | 1914 |
| 548 | Ga0163163_10471930 | 3300014325 | Bacteria | 1315 |
| 549 | Ga0157380_10001138 | 3300014326 | Bacteria | 17181 |
| 550 | Ga0157380_10001301 | 3300014326 | Bacteria | 16225 |
| 551 | Ga0157380_10449421 | 3300014326 | Bacteria | 1237 |
| 552 | Ga0157380_10492797 | 3300014326 | Bacteria | 1188 |
| 553 | Ga0157380_10554899 | 3300014326 | Bacteria | 1128 |
| 554 | Ga0157377_10000982 | 3300014745 | Bacteria | 12022 |
| 555 | Ga0157377_10001682 | 3300014745 | Bacteria | 9646 |
| 556 | Ga0157377_10024270 | 3300014745 | Bacteria | 3222 |
| 557 | Ga0157377_10117432 | 3300014745 | Bacteria | 1608 |
| 558 | Ga0157377_10321503 | 3300014745 | Bacteria | 1028 |
| 559 | Ga0157379_10000275 | 3300014968 | Bacteria | 40524 |
| 560 | Ga0157379_10000933 | 3300014968 | Bacteria | 23653 |
| 561 | Ga0157379_10010341 | 3300014968 | Bacteria | 8127 |
| 562 | Ga0157379_10018203 | 3300014968 | Bacteria | 6190 |
| 563 | Ga0157379_10097828 | 3300014968 | Bacteria | 2635 |
| 564 | Ga0157379_10162654 | 3300014968 | Bacteria | 2015 |
| 565 | Ga0157379_10173780 | 3300014968 | Bacteria | 1945 |
| 566 | Ga0157376_10001069 | 3300014969 | Bacteria | 17936 |
| 567 | Ga0157376_10001767 | 3300014969 | Bacteria | 14394 |
| 568 | Ga0157376_10033668 | 3300014969 | Bacteria | 4128 |
| 569 | Ga0157376_10067815 | 3300014969 | Bacteria | 3018 |
| 570 | Ga0157376_10225758 | 3300014969 | Bacteria | 1737 |
| 571 | Ga0157376_10714668 | 3300014969 | Bacteria | 1008 |
| 572 | Ga0157376_10910733 | 3300014969 | Bacteria | 898 |
| 573 | Ga0163161_10044631 | 3300017792 | Bacteria | 3193 |
| 574 | Ga0163161_10115761 | 3300017792 | Bacteria | 2010 |
| 575 | Ga0163161_10138728 | 3300017792 | Bacteria | 1840 |
| 576 | Ga0228598_1003451 | 3300024227 | Bacteria | 3400 |
| 577 | Ga0209677_100646 | 3300025253 | Bacteria | 18446 |
| 578 | Ga0207666_1000149 | 3300025271 | Bacteria | 10831 |
| 579 | Ga0207673_1000068 | 3300025290 | Bacteria | 8898 |
| 580 | Ga0209758_1016560 | 3300025297 | Bacteria | 3735 |
| 581 | Ga0207697_10012080 | 3300025315 | Bacteria | 3635 |
| 582 | Ga0207697_10012377 | 3300025315 | Bacteria | 3578 |
| 583 | Ga0207697_10028933 | 3300025315 | Bacteria | 2267 |
| 584 | Ga0207697_10167940 | 3300025315 | Bacteria | 959 |
| 585 | Ga0207656_10063337 | 3300025321 | Bacteria | 1627 |
| 586 | Ga0207653_10003139 | 3300025885 | Bacteria | 5228 |
| 587 | Ga0207682_10000695 | 3300025893 | Bacteria | 15627 |
| 588 | Ga0207692_10087236 | 3300025898 | Bacteria | 1683 |
| 589 | Ga0207642_10000453 | 3300025899 | Bacteria | 12480 |
| 590 | Ga0207710_10011822 | 3300025900 | Bacteria | 3672 |
| 591 | Ga0207710_10027741 | 3300025900 | Bacteria | 2454 |
| 592 | Ga0207710_10044901 | 3300025900 | Bacteria | 1969 |
| 593 | Ga0207710_10048741 | 3300025900 | Bacteria | 1896 |
| 594 | Ga0207710_10314770 | 3300025900 | Bacteria | 793 |
| 595 | Ga0207688_10000764 | 3300025901 | Bacteria | 15995 |
| 596 | Ga0207688_10008788 | 3300025901 | Bacteria | 5496 |
| 597 | Ga0207688_10064883 | 3300025901 | Bacteria | 2062 |
| 598 | Ga0207680_10044492 | 3300025903 | Bacteria | 2611 |
| 599 | Ga0207680_10056057 | 3300025903 | Bacteria | 2379 |
| 600 | Ga0207680_10137513 | 3300025903 | Bacteria | 1616 |
| 601 | Ga0207680_10240928 | 3300025903 | Bacteria | 1246 |
| 602 | Ga0207680_10431973 | 3300025903 | Bacteria | 933 |
| 603 | Ga0207647_10001565 | 3300025904 | Bacteria | 17590 |
| 604 | Ga0207647_10022486 | 3300025904 | Bacteria | 4185 |
| 605 | Ga0207647_10030550 | 3300025904 | Bacteria | 3473 |
| 606 | Ga0207685_10008128 | 3300025905 | Bacteria | 2969 |
| 607 | Ga0207685_10055588 | 3300025905 | Bacteria | 1546 |
| 608 | Ga0207699_10029787 | 3300025906 | Bacteria | 3047 |
| 609 | Ga0207699_10052606 | 3300025906 | Bacteria | 2411 |
| 610 | Ga0207699_10304265 | 3300025906 | Bacteria | 1114 |
| 611 | Ga0207645_10019429 | 3300025907 | Bacteria | 4453 |
| 612 | Ga0207645_10035619 | 3300025907 | Bacteria | 3196 |
| 613 | Ga0207645_10131127 | 3300025907 | Bacteria | 1631 |
| 614 | Ga0207645_10197517 | 3300025907 | Bacteria | 1323 |
| 615 | Ga0207643_10000523 | 3300025908 | Bacteria | 24625 |
| 616 | Ga0207643_10013330 | 3300025908 | Bacteria | 4449 |
| 617 | Ga0207643_10103051 | 3300025908 | Bacteria | 1675 |
| 618 | Ga0207705_10396043 | 3300025909 | Bacteria | 1068 |
| 619 | Ga0207684_10167323 | 3300025910 | Bacteria | 1895 |
| 620 | Ga0207654_10001610 | 3300025911 | Bacteria | 11830 |
| 621 | Ga0207654_10053975 | 3300025911 | Bacteria | 2322 |
| 622 | Ga0207654_10123326 | 3300025911 | Bacteria | 1630 |
| 623 | Ga0207654_10165849 | 3300025911 | Bacteria | 1430 |
| 624 | Ga0207707_10001147 | 3300025912 | Bacteria | 25092 |
| 625 | Ga0207707_10051812 | 3300025912 | Bacteria | 3574 |
| 626 | Ga0207707_10338101 | 3300025912 | Bacteria | 1298 |
| 627 | Ga0207695_10136425 | 3300025913 | Bacteria | 2406 |
| 628 | Ga0207671_10130803 | 3300025914 | Bacteria | 1926 |
| 629 | Ga0207693_10000703 | 3300025915 | Bacteria | 30046 |
| 630 | Ga0207693_10003911 | 3300025915 | Bacteria | 12683 |
| 631 | Ga0207693_10010627 | 3300025915 | Bacteria | 7469 |
| 632 | Ga0207693_10041415 | 3300025915 | Bacteria | 3626 |
| 633 | Ga0207663_10001248 | 3300025916 | Bacteria | 11772 |
| 634 | Ga0207663_10160475 | 3300025916 | Bacteria | 1586 |
| 635 | Ga0207663_10185141 | 3300025916 | Bacteria | 1490 |
| 636 | Ga0207663_10292068 | 3300025916 | Bacteria | 1215 |
| 637 | Ga0207660_10028108 | 3300025917 | Bacteria | 3845 |
| 638 | Ga0207660_10102335 | 3300025917 | Bacteria | 2141 |
| 639 | Ga0207660_10590809 | 3300025917 | Bacteria | 904 |
| 640 | Ga0207662_10002213 | 3300025918 | Bacteria | 9693 |
| 641 | Ga0207662_10020777 | 3300025918 | Bacteria | 3748 |
| 642 | Ga0207662_10083908 | 3300025918 | Bacteria | 1948 |
| 643 | Ga0207662_10097343 | 3300025918 | Bacteria | 1819 |
| 644 | Ga0207662_10128515 | 3300025918 | Bacteria | 1595 |
| 645 | Ga0207657_10000304 | 3300025919 | Bacteria | 52135 |
| 646 | Ga0207657_10056806 | 3300025919 | Bacteria | 3375 |
| 647 | Ga0207657_10076719 | 3300025919 | Bacteria | 2818 |
| 648 | Ga0207657_10243994 | 3300025919 | Bacteria | 1433 |
| 649 | Ga0207657_10349052 | 3300025919 | Bacteria | 1167 |
| 650 | Ga0207649_10000142 | 3300025920 | Bacteria | 60023 |
| 651 | Ga0207649_10002403 | 3300025920 | Bacteria | 10501 |
| 652 | Ga0207649_10085151 | 3300025920 | Bacteria | 2056 |
| 653 | Ga0207649_10271214 | 3300025920 | Bacteria | 1230 |
| 654 | Ga0207649_10274574 | 3300025920 | Bacteria | 1223 |
| 655 | Ga0207652_10002021 | 3300025921 | Bacteria | 17491 |
| 656 | Ga0207652_10043155 | 3300025921 | Bacteria | 3840 |
| 657 | Ga0207652_10092880 | 3300025921 | Bacteria | 2655 |
| 658 | Ga0207646_10168325 | 3300025922 | Bacteria | 1979 |
| 659 | Ga0207681_10020796 | 3300025923 | Bacteria | 4164 |
| 660 | Ga0207681_10044828 | 3300025923 | Bacteria | 2965 |
| 661 | Ga0207681_10090654 | 3300025923 | Bacteria | 2182 |
| 662 | Ga0207681_10100954 | 3300025923 | Bacteria | 2081 |
| 663 | Ga0207694_10009066 | 3300025924 | Bacteria | 7507 |
| 664 | Ga0207694_10166927 | 3300025924 | Bacteria | 1781 |
| 665 | Ga0207694_10517013 | 3300025924 | Bacteria | 1000 |
| 666 | Ga0207650_10002366 | 3300025925 | Bacteria | 13121 |
| 667 | Ga0207650_10069957 | 3300025925 | Bacteria | 2637 |
| 668 | Ga0207650_10095801 | 3300025925 | Bacteria | 2275 |
| 669 | Ga0207650_10156525 | 3300025925 | Bacteria | 1802 |
| 670 | Ga0207659_10000078 | 3300025926 | Bacteria | 61403 |
| 671 | Ga0207687_10001882 | 3300025927 | Bacteria | 14454 |
| 672 | Ga0207687_10002377 | 3300025927 | Bacteria | 12775 |
| 673 | Ga0207700_10048631 | 3300025928 | Bacteria | 3150 |
| 674 | Ga0207700_10103473 | 3300025928 | Bacteria | 2276 |
| 675 | Ga0207700_10456861 | 3300025928 | Bacteria | 1126 |
| 676 | Ga0207664_10232042 | 3300025929 | Bacteria | 1604 |
| 677 | Ga0207664_10259026 | 3300025929 | Bacteria | 1520 |
| 678 | Ga0207644_10001431 | 3300025931 | Bacteria | 15367 |
| 679 | Ga0207644_10026921 | 3300025931 | Bacteria | 3969 |
| 680 | Ga0207644_10668146 | 3300025931 | Bacteria | 865 |
| 681 | Ga0207690_10002633 | 3300025932 | Bacteria | 10810 |
| 682 | Ga0207690_10003254 | 3300025932 | Bacteria | 9744 |
| 683 | Ga0207690_10233063 | 3300025932 | Bacteria | 1414 |
| 684 | Ga0207690_10345735 | 3300025932 | Bacteria | 1175 |
| 685 | Ga0207706_10000263 | 3300025933 | Bacteria | 57106 |
| 686 | Ga0207706_10120424 | 3300025933 | Bacteria | 2307 |
| 687 | Ga0207706_10134940 | 3300025933 | Bacteria | 2171 |
| 688 | Ga0207706_10235601 | 3300025933 | Bacteria | 1600 |
| 689 | Ga0207686_10003396 | 3300025934 | Bacteria | 8551 |
| 690 | Ga0207686_10027400 | 3300025934 | Bacteria | 3337 |
| 691 | Ga0207686_10310464 | 3300025934 | Bacteria | 1174 |
| 692 | Ga0207709_10004092 | 3300025935 | Bacteria | 8489 |
| 693 | Ga0207709_10009025 | 3300025935 | Bacteria | 5498 |
| 694 | Ga0207709_10036935 | 3300025935 | Bacteria | 2899 |
| 695 | Ga0207709_10437622 | 3300025935 | Bacteria | 1008 |
| 696 | Ga0207670_10003694 | 3300025936 | Bacteria | 8121 |
| 697 | Ga0207670_10004344 | 3300025936 | Bacteria | 7619 |
| 698 | Ga0207670_10147585 | 3300025936 | Bacteria | 1741 |
| 699 | Ga0207670_10217252 | 3300025936 | Bacteria | 1461 |
| 700 | Ga0207669_10001025 | 3300025937 | Bacteria | 11929 |
| 701 | Ga0207669_10001156 | 3300025937 | Bacteria | 11247 |
| 702 | Ga0207669_10138591 | 3300025937 | Bacteria | 1685 |
| 703 | Ga0207669_10263326 | 3300025937 | Bacteria | 1291 |
| 704 | Ga0207669_10335748 | 3300025937 | Bacteria | 1162 |
| 705 | Ga0207704_10085875 | 3300025938 | Bacteria | 2050 |
| 706 | Ga0207704_10274213 | 3300025938 | Bacteria | 1279 |
| 707 | Ga0207704_10397170 | 3300025938 | Bacteria | 1087 |
| 708 | Ga0207665_10000219 | 3300025939 | Bacteria | 38754 |
| 709 | Ga0207665_10001692 | 3300025939 | Bacteria | 14821 |
| 710 | Ga0207665_10010841 | 3300025939 | Bacteria | 5984 |
| 711 | Ga0207665_10041611 | 3300025939 | Bacteria | 3069 |
| 712 | Ga0207691_10002753 | 3300025940 | Bacteria | 17136 |
| 713 | Ga0207691_10008131 | 3300025940 | Bacteria | 10069 |
| 714 | Ga0207691_10064975 | 3300025940 | Bacteria | 3304 |
| 715 | Ga0207691_10159568 | 3300025940 | Bacteria | 1979 |
| 716 | Ga0207711_10008692 | 3300025941 | Bacteria | 8496 |
| 717 | Ga0207711_10037167 | 3300025941 | Bacteria | 4134 |
| 718 | Ga0207711_10040516 | 3300025941 | Bacteria | 3963 |
| 719 | Ga0207711_10089107 | 3300025941 | Bacteria | 2710 |
| 720 | Ga0207711_10567174 | 3300025941 | Bacteria | 1059 |
| 721 | Ga0207689_10001399 | 3300025942 | Bacteria | 23007 |
| 722 | Ga0207689_10010207 | 3300025942 | Bacteria | 8094 |
| 723 | Ga0207689_10013204 | 3300025942 | Bacteria | 7050 |
| 724 | Ga0207689_10073515 | 3300025942 | Bacteria | 2808 |
| 725 | Ga0207689_10076767 | 3300025942 | Bacteria | 2746 |
| 726 | Ga0207689_10236575 | 3300025942 | Bacteria | 1510 |
| 727 | Ga0207689_10668585 | 3300025942 | Bacteria | 875 |
| 728 | Ga0207661_10001264 | 3300025944 | Bacteria | 16911 |
| 729 | Ga0207661_10027285 | 3300025944 | Bacteria | 4361 |
| 730 | Ga0207679_10000064 | 3300025945 | Bacteria | 98118 |
| 731 | Ga0207679_10043430 | 3300025945 | Bacteria | 3236 |
| 732 | Ga0207679_10458704 | 3300025945 | Bacteria | 1131 |
| 733 | Ga0207667_10106805 | 3300025949 | Bacteria | 2888 |
| 734 | Ga0207667_10173810 | 3300025949 | Bacteria | 2213 |
| 735 | Ga0207651_10000420 | 3300025960 | Bacteria | 18070 |
| 736 | Ga0207651_10000820 | 3300025960 | Bacteria | 13434 |
| 737 | Ga0207651_10197490 | 3300025960 | Bacteria | 1609 |
| 738 | Ga0207651_10984408 | 3300025960 | Bacteria | 753 |
| 739 | Ga0207712_10001661 | 3300025961 | Bacteria | 14931 |
| 740 | Ga0207712_10013354 | 3300025961 | Bacteria | 5264 |
| 741 | Ga0207712_10150750 | 3300025961 | Bacteria | 1796 |
| 742 | Ga0207712_10685475 | 3300025961 | Bacteria | 893 |
| 743 | Ga0207668_10000965 | 3300025972 | Bacteria | 17301 |
| 744 | Ga0207668_10025031 | 3300025972 | Bacteria | 3858 |
| 745 | Ga0207668_10047738 | 3300025972 | Bacteria | 2933 |
| 746 | Ga0207668_10102696 | 3300025972 | Bacteria | 2127 |
| 747 | Ga0207668_10257439 | 3300025972 | Bacteria | 1420 |
| 748 | Ga0207668_10542324 | 3300025972 | Bacteria | 1006 |
| 749 | Ga0207640_10001755 | 3300025981 | Bacteria | 11643 |
| 750 | Ga0207640_10039179 | 3300025981 | Bacteria | 2997 |
| 751 | Ga0207640_10819529 | 3300025981 | Bacteria | 808 |
| 752 | Ga0207658_10037471 | 3300025986 | Bacteria | 3485 |
| 753 | Ga0207677_10023844 | 3300026023 | Bacteria | 3788 |
| 754 | Ga0207677_10088811 | 3300026023 | Bacteria | 2242 |
| 755 | Ga0207677_10457550 | 3300026023 | Bacteria | 1095 |
| 756 | Ga0207703_10005045 | 3300026035 | Bacteria | 10699 |
| 757 | Ga0207703_10008946 | 3300026035 | Bacteria | 7887 |
| 758 | Ga0207703_10044466 | 3300026035 | Bacteria | 3569 |
| 759 | Ga0207703_10152745 | 3300026035 | Bacteria | 2015 |
| 760 | Ga0207703_10240532 | 3300026035 | Bacteria | 1627 |
| 761 | Ga0207703_10283672 | 3300026035 | Bacteria | 1505 |
| 762 | Ga0207639_10019760 | 3300026041 | Bacteria | 4810 |
| 763 | Ga0207639_10051164 | 3300026041 | Bacteria | 3141 |
| 764 | Ga0207639_10265540 | 3300026041 | Bacteria | 1503 |
| 765 | Ga0207639_10823749 | 3300026041 | Bacteria | 865 |
| 766 | Ga0207678_10000209 | 3300026067 | Bacteria | 51832 |
| 767 | Ga0207678_10010183 | 3300026067 | Bacteria | 8254 |
| 768 | Ga0207678_10021975 | 3300026067 | Bacteria | 5592 |
| 769 | Ga0207678_10034530 | 3300026067 | Bacteria | 4404 |
| 770 | Ga0207678_10039287 | 3300026067 | Bacteria | 4107 |
| 771 | Ga0207678_10056658 | 3300026067 | Bacteria | 3373 |
| 772 | Ga0207678_10087331 | 3300026067 | Bacteria | 2665 |
| 773 | Ga0207678_10120747 | 3300026067 | Bacteria | 2236 |
| 774 | Ga0207678_10751888 | 3300026067 | Bacteria | 859 |
| 775 | Ga0207708_10000953 | 3300026075 | Bacteria | 21674 |
| 776 | Ga0207708_10002721 | 3300026075 | Bacteria | 12989 |
| 777 | Ga0207708_10020852 | 3300026075 | Bacteria | 4944 |
| 778 | Ga0207708_10193379 | 3300026075 | Bacteria | 1620 |
| 779 | Ga0207702_10003767 | 3300026078 | Bacteria | 13697 |
| 780 | Ga0207702_10007071 | 3300026078 | Bacteria | 9599 |
| 781 | Ga0207702_10044708 | 3300026078 | Bacteria | 3723 |
| 782 | Ga0207641_10007322 | 3300026088 | Bacteria | 9193 |
| 783 | Ga0207641_10034057 | 3300026088 | Bacteria | 4234 |
| 784 | Ga0207641_10200868 | 3300026088 | Bacteria | 1838 |
| 785 | Ga0207641_10235182 | 3300026088 | Bacteria | 1705 |
| 786 | Ga0207641_10802363 | 3300026088 | Bacteria | 931 |
| 787 | Ga0207648_10013547 | 3300026089 | Bacteria | 7581 |
| 788 | Ga0207648_10024588 | 3300026089 | Bacteria | 5374 |
| 789 | Ga0207648_10082742 | 3300026089 | Bacteria | 2799 |
| 790 | Ga0207648_10248865 | 3300026089 | Bacteria | 1584 |
| 791 | Ga0207676_10000079 | 3300026095 | Bacteria | 94811 |
| 792 | Ga0207676_10023198 | 3300026095 | Bacteria | 4573 |
| 793 | Ga0207676_10081013 | 3300026095 | Bacteria | 2636 |
| 794 | Ga0207676_10304493 | 3300026095 | Bacteria | 1456 |
| 795 | Ga0207676_10530292 | 3300026095 | Bacteria | 1122 |
| 796 | Ga0207676_10720567 | 3300026095 | Bacteria | 968 |
| 797 | Ga0207674_10000719 | 3300026116 | Bacteria | 43313 |
| 798 | Ga0207674_10013028 | 3300026116 | Bacteria | 9263 |
| 799 | Ga0207674_10049956 | 3300026116 | Bacteria | 4275 |
| 800 | Ga0207674_10303652 | 3300026116 | Bacteria | 1545 |
| 801 | Ga0207674_10401253 | 3300026116 | Bacteria | 1325 |
| 802 | Ga0207675_100001925 | 3300026118 | Bacteria | 20707 |
| 803 | Ga0207675_100030016 | 3300026118 | Bacteria | 5061 |
| 804 | Ga0207675_100030051 | 3300026118 | Bacteria | 5058 |
| 805 | Ga0207675_100043624 | 3300026118 | Bacteria | 4188 |
| 806 | Ga0207675_100095437 | 3300026118 | Bacteria | 2798 |
| 807 | Ga0207675_100140676 | 3300026118 | Bacteria | 2293 |
| 808 | Ga0207675_100314621 | 3300026118 | Bacteria | 1527 |
| 809 | Ga0207683_10000037 | 3300026121 | Bacteria | 100920 |
| 810 | Ga0207683_10038116 | 3300026121 | Bacteria | 4187 |
| 811 | Ga0207683_10038529 | 3300026121 | Bacteria | 4167 |
| 812 | Ga0207683_10794664 | 3300026121 | Bacteria | 878 |
| 813 | Ga0207698_10725543 | 3300026142 | Bacteria | 991 |
| 814 | Ga0209984_1025295 | 3300027424 | Bacteria | 826 |
| 815 | Ga0210000_1010455 | 3300027462 | Bacteria | 1373 |
| 816 | Ga0209179_1000126 | 3300027512 | Bacteria | 8526 |
| 817 | Ga0210002_1000055 | 3300027617 | Bacteria | 17399 |
| 818 | Ga0209971_1002180 | 3300027682 | Bacteria | 4760 |
| 819 | Ga0209966_1003905 | 3300027695 | Bacteria | 2517 |
| 820 | Ga0209966_1047260 | 3300027695 | Bacteria | 909 |
| 821 | Ga0209998_10001005 | 3300027717 | Bacteria | 7098 |
| 822 | Ga0209998_10012476 | 3300027717 | Bacteria | 1764 |
| 823 | Ga0209974_10003776 | 3300027876 | Bacteria | 5426 |
| 824 | Ga0209974_10006247 | 3300027876 | Bacteria | 4167 |
| 825 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 826 | Ga0207428_10000947 | 3300027907 | Bacteria | 32277 |
| 827 | Ga0207428_10029008 | 3300027907 | Bacteria | 4592 |
| 828 | Ga0207428_10034068 | 3300027907 | Bacteria | 4177 |
| 829 | Ga0207428_10209350 | 3300027907 | Bacteria | 1465 |
| 830 | Ga0268266_10002460 | 3300028379 | Bacteria | 19801 |
| 831 | Ga0268266_10004625 | 3300028379 | Bacteria | 13124 |
| 832 | Ga0268266_10028531 | 3300028379 | Bacteria | 4742 |
| 833 | Ga0268266_10159548 | 3300028379 | Bacteria | 2039 |
| 834 | Ga0268266_10222290 | 3300028379 | Bacteria | 1736 |
| 835 | Ga0268266_10426394 | 3300028379 | Bacteria | 1257 |
| 836 | Ga0268266_10865929 | 3300028379 | Bacteria | 873 |
| 837 | Ga0268265_10001593 | 3300028380 | Bacteria | 18775 |
| 838 | Ga0268265_10033810 | 3300028380 | Bacteria | 3720 |
| 839 | Ga0268265_10078341 | 3300028380 | Bacteria | 2599 |
| 840 | Ga0268265_10170919 | 3300028380 | Bacteria | 1857 |
| 841 | Ga0268265_10220075 | 3300028380 | Bacteria | 1660 |
| 842 | Ga0268265_10251496 | 3300028380 | Bacteria | 1565 |
| 843 | Ga0268265_10424725 | 3300028380 | Bacteria | 1235 |
| 844 | Ga0268264_10002487 | 3300028381 | Bacteria | 16198 |
| 845 | Ga0268264_10071239 | 3300028381 | Bacteria | 2944 |
| 846 | Ga0268264_10279821 | 3300028381 | Bacteria | 1562 |
| 847 | Ga0268264_10769378 | 3300028381 | Bacteria | 960 |
| 848 | Ga0307515_10458819 | 3300028794 | Bacteria | 889 |
| 849 | Ga0265338_10016356 | 3300028800 | Bacteria | 8078 |
| 850 | Ga0265760_10103908 | 3300031090 | Bacteria | 900 |
| 851 | Ga0265330_10078554 | 3300031235 | Bacteria | 1423 |
| 852 | Ga0265332_10001833 | 3300031238 | Bacteria | 11347 |
| 853 | Ga0265332_10078189 | 3300031238 | Bacteria | 1405 |
| 854 | Ga0265325_10000104 | 3300031241 | Bacteria | 59692 |
| 855 | Ga0265325_10108939 | 3300031241 | Bacteria | 1348 |
| 856 | Ga0265325_10139555 | 3300031241 | Bacteria | 1154 |
| 857 | Ga0265325_10151187 | 3300031241 | Bacteria | 1098 |
| 858 | Ga0265329_10084020 | 3300031242 | Bacteria | 1008 |
| 859 | Ga0265340_10000912 | 3300031247 | Bacteria | 16766 |
| 860 | Ga0265340_10023714 | 3300031247 | Bacteria | 3127 |
| 861 | Ga0265340_10035724 | 3300031247 | Bacteria | 2467 |
| 862 | Ga0265340_10066991 | 3300031247 | Bacteria | 1707 |
| 863 | Ga0265339_10001873 | 3300031249 | Bacteria | 15436 |
| 864 | Ga0265339_10040092 | 3300031249 | Bacteria | 2604 |
| 865 | Ga0265339_10394257 | 3300031249 | Bacteria | 647 |
| 866 | Ga0265327_10038056 | 3300031251 | Bacteria | 2628 |
| 867 | Ga0265316_10173377 | 3300031344 | Bacteria | 1608 |
| 868 | Ga0265313_10042774 | 3300031595 | Bacteria | 2222 |
| 869 | Ga0316575_10027893 | 3300031665 | Bacteria | 2198 |
| 870 | Ga0316575_10068149 | 3300031665 | Bacteria | 1427 |
| 871 | Ga0265314_10009907 | 3300031711 | Bacteria | 7994 |
| 872 | Ga0265314_10104897 | 3300031711 | Bacteria | 1809 |
| 873 | Ga0265314_10237494 | 3300031711 | Bacteria | 1053 |
| 874 | Ga0265342_10000011 | 3300031712 | Bacteria | 208435 |
| 875 | Ga0265342_10004591 | 3300031712 | Bacteria | 10776 |
| 876 | Ga0265342_10043958 | 3300031712 | Bacteria | 2694 |
| 877 | Ga0316576_10009892 | 3300031727 | Bacteria | 6173 |
| 878 | Ga0307413_10438084 | 3300031824 | Bacteria | 1034 |
| 879 | Ga0307410_10653654 | 3300031852 | Bacteria | 882 |
| 880 | Ga0307416_101000481 | 3300032002 | Bacteria | 939 |
| 881 | Ga0307411_11102927 | 3300032005 | Bacteria | 715 |
| 882 | Ga0307415_100759077 | 3300032126 | Bacteria | 881 |
| 883 | Ga0316583_10060620 | 3300032133 | Bacteria | 1326 |
| 884 | Ga0307510_10000998 | 3300033180 | Bacteria | 30010 |
| 885 | Ga0307510_10070845 | 3300033180 | Bacteria | 3478 |
| 886 | Ga0373948_0024827 | 3300034817 | Bacteria | 1172 |
| 887 | Ga0373950_0001326 | 3300034818 | Bacteria | 3210 |
| 888 | Ga0373950_0032256 | 3300034818 | Bacteria | 974 |
| 889 | Ga0373958_0001110 | 3300034819 | Bacteria | 3557 |
| 890 | Ga0373958_0024100 | 3300034819 | Bacteria | 1149 |
| 891 | Ga0373959_0037895 | 3300034820 | Bacteria | 1000 |
| 892 | Ga0373938_0011760 | 3300034957 | Bacteria | 1633 |
| 893 | Ga0373926_0038931 | 3300035083 | Bacteria | 1694 |
| 894 | Ga0373928_0000621 | 3300035084 | Bacteria | 6974 |
| 895 | Ga0373929_0035100 | 3300035085 | Bacteria | 1090 |
| 896 | Ga0373929_0043985 | 3300035085 | Bacteria | 1001 |
| 897 | Ga0373934_0026332 | 3300035086 | Bacteria | 2256 |
| 898 | Ga0373934_0156211 | 3300035086 | Bacteria | 935 |
| 899 | Ga0373940_0020800 | 3300035088 | Bacteria | 1670 |
| 900 | Ga0373940_0082408 | 3300035088 | Bacteria | 953 |
| 901 | Ga0373944_0004381 | 3300035089 | Bacteria | 3674 |
| 902 | Ga0373944_0051511 | 3300035089 | Bacteria | 1298 |
| 903 | Ga0373949_0054052 | 3300035090 | Bacteria | 1018 |
| 904 | Ga0373951_0025972 | 3300035091 | Bacteria | 1362 |
| 905 | Ga0373951_0088153 | 3300035091 | Bacteria | 811 |
| 906 | Ga0373952_0001248 | 3300035092 | Bacteria | 4636 |
| 907 | Ga0373952_0001666 | 3300035092 | Bacteria | 4041 |
| 908 | Ga0373923_0095776 | 3300035111 | Bacteria | 1303 |
| 909 | Ga0373932_0003010 | 3300035112 | Bacteria | 4126 |
| 910 | Ga0373936_0027457 | 3300035113 | Bacteria | 2232 |
| 911 | Ga0373936_0092131 | 3300035113 | Bacteria | 1272 |
| 912 | Ga0373936_0226977 | 3300035113 | Bacteria | 830 |
| 913 | Ga0373939_0001456 | 3300035114 | Bacteria | 5728 |
| 914 | Ga0373939_0002110 | 3300035114 | Bacteria | 4738 |
| 915 | Ga0373939_0182499 | 3300035114 | Bacteria | 784 |
| 916 | Ga0373941_0000073 | 3300035115 | Bacteria | 16016 |
| 917 | Ga0373945_0003925 | 3300035116 | Bacteria | 4702 |
| 918 | Ga0373945_0032058 | 3300035116 | Bacteria | 1860 |
| 919 | Ga0373945_0070449 | 3300035116 | Bacteria | 1322 |
| 920 | Ga0373945_0138105 | 3300035116 | Bacteria | 981 |
| 921 | Ga0373954_0011780 | 3300035118 | Bacteria | 3881 |
| 922 | Ga0373954_0019118 | 3300035118 | Bacteria | 3088 |
| 923 | Ga0373954_0047850 | 3300035118 | Bacteria | 2002 |
| 924 | Ga0373956_0142368 | 3300035119 | Bacteria | 1126 |
| 925 | Ga0373956_0267467 | 3300035119 | Bacteria | 813 |
| 926 | Ga0373960_0007900 | 3300035121 | Bacteria | 2533 |
| 927 | Ga0373960_0047852 | 3300035121 | Bacteria | 1260 |
| 928 | Ga0373960_0097727 | 3300035121 | Bacteria | 948 |
| 929 | Ga0373960_0206990 | 3300035121 | Bacteria | 696 |
| 930 | Ga0373943_0147418 | 3300035170 | Bacteria | 1272 |
| 931 | Ga0373946_0011386 | 3300035171 | Bacteria | 3318 |
| 932 | Ga0373946_0058208 | 3300035171 | Bacteria | 1636 |
| 933 | Ga0373946_0100684 | 3300035171 | Bacteria | 1295 |
| 934 | Ga0373946_0161101 | 3300035171 | Bacteria | 1053 |
| 935 | Ga0373955_0000596 | 3300035172 | Bacteria | 15397 |
| 936 | Ga0373955_0008707 | 3300035172 | Bacteria | 4723 |
| 937 | Ga0373955_0286793 | 3300035172 | Bacteria | 991 |
| 938 | Ga0373955_0349460 | 3300035172 | Bacteria | 895 |
| 939 | Ga0373942_0004460 | 3300035207 | Bacteria | 3247 |
| 940 | Ga0373942_0031940 | 3300035207 | Bacteria | 1396 |
| 941 | Ga0373961_0002214 | 3300035241 | Bacteria | 5141 |
| 942 | Ga0373961_0002508 | 3300035241 | Bacteria | 4739 |
| 943 | Ga0373961_0028782 | 3300035241 | Bacteria | 1534 |
| 944 | Ga0373962_0011700 | 3300035242 | Bacteria | 2202 |
| 945 | Ga0373962_0038433 | 3300035242 | Bacteria | 1339 |
| 946 | Ga0373962_0127147 | 3300035242 | Bacteria | 818 |
| 947 | Ga0373924_0133752 | 3300035410 | Bacteria | 1079 |
| 948 | Ga0373931_0007352 | 3300035691 | Bacteria | 5184 |
| 949 | Ga0373931_0041535 | 3300035691 | Bacteria | 2416 |
| 950 | Ga0373931_0094083 | 3300035691 | Bacteria | 1675 |
| 951 | Ga0373931_0136999 | 3300035691 | Bacteria | 1414 |
| 952 | Ga0373931_0163090 | 3300035691 | Bacteria | 1308 |
| 953 | Ga0373931_0188535 | 3300035691 | Bacteria | 1225 |
| 954 | Ga0373931_0402821 | 3300035691 | Bacteria | 867 |
| 955 | Ga0373935_0023521 | 3300035692 | Bacteria | 3786 |
| 956 | Ga0373935_0035954 | 3300035692 | Bacteria | 3094 |
| 957 | Ga0373935_0088837 | 3300035692 | Bacteria | 2020 |
| 958 | Ga0373935_0179385 | 3300035692 | Bacteria | 1453 |
| 959 | Ga0373935_0219916 | 3300035692 | Bacteria | 1319 |
| 960 | Ga0373935_0224761 | 3300035692 | Bacteria | 1305 |
| 961 | Ga0373935_0287333 | 3300035692 | Bacteria | 1159 |
| 962 | Ga0373935_0361731 | 3300035692 | Bacteria | 1036 |
| 963 | Ga0373927_0041206 | 3300035695 | Bacteria | 2995 |
| 964 | Ga0373933_0050540 | 3300035724 | Bacteria | 2482 |
| 965 | Ga0373947_0001465 | 3300035725 | Bacteria | 14517 |
| 966 | Ga0373947_0054777 | 3300035725 | Bacteria | 2407 |
| 967 | Ga0373947_0070451 | 3300035725 | Bacteria | 2142 |
| 968 | Ga0373937_0003886 | 3300036401 | Bacteria | 12639 |
| 969 | Ga0373937_0098200 | 3300036401 | Bacteria | 2716 |
| 970 | Ga0373937_0420970 | 3300036401 | Bacteria | 1268 |
| 971 | Ga0373937_1137856 | 3300036401 | Bacteria | 729 |
| 972 | Ga0316582_0311503 | 3300036647 | Bacteria | 1082 |
| 973 | Ga0316584_0013488 | 3300036712 | Bacteria | 5786 |
| 974 | Ga0373925_0276660 | 3300037068 | Bacteria | 1351 |
| 975 | Ga0373925_0402494 | 3300037068 | Bacteria | 1116 |
| 976 | Ga0373925_0475603 | 3300037068 | Bacteria | 1024 |
| 977 | Ga0373925_0744496 | 3300037068 | Bacteria | 808 |
| 978 | Ga0395899_0013207 | 3300037312 | Bacteria | 6318 |
| 979 | Ga0395899_0072948 | 3300037312 | Bacteria | 2511 |
| 980 | Ga0395899_0181356 | 3300037312 | Bacteria | 1478 |
| 981 | Ga0395900_0003303 | 3300037418 | Bacteria | 17453 |
| 982 | Ga0395900_0005284 | 3300037418 | Bacteria | 13537 |
| 983 | Ga0395900_0018616 | 3300037418 | Bacteria | 7082 |
| 984 | Ga0395900_0083563 | 3300037418 | Bacteria | 3280 |
| 985 | Ga0395900_0242349 | 3300037418 | Bacteria | 1808 |
| 986 | Ga0395900_0279491 | 3300037418 | Bacteria | 1662 |
| 987 | Ga0395900_1154503 | 3300037418 | Bacteria | 691 |
| 988 | Ga0395898_0007949 | 3300037466 | Bacteria | 11250 |
| 989 | Ga0395898_0013960 | 3300037466 | Bacteria | 8254 |
| 990 | Ga0395898_0051498 | 3300037466 | Bacteria | 4026 |
| 991 | Ga0395898_0097387 | 3300037466 | Bacteria | 2825 |
| 992 | Ga0395898_0132734 | 3300037466 | Bacteria | 2384 |
| 993 | Ga0395905_0002720 | 3300037471 | Bacteria | 19373 |
| 994 | Ga0395905_0023923 | 3300037471 | Bacteria | 5767 |
| 995 | Ga0395905_0224049 | 3300037471 | Bacteria | 1759 |
| 996 | Ga0395905_0538647 | 3300037471 | Bacteria | 1068 |
| 997 | Ga0395905_0930992 | 3300037471 | Bacteria | 772 |
| 998 | Ga0436364_1400093 | 3300037853 | Bacteria | 1564 |
| 999 | Ga0395901_0011535 | 3300038443 | Bacteria | 8954 |
| 1000 | Ga0395901_0032978 | 3300038443 | Bacteria | 5343 |
| 1001 | Ga0395901_0126562 | 3300038443 | Bacteria | 2685 |
| 1002 | Ga0395901_0173159 | 3300038443 | Bacteria | 2264 |
| 1003 | Ga0395901_0173764 | 3300038443 | Bacteria | 2260 |
| 1004 | Ga0242420_001294 | 3300038996 | Bacteria | 3291 |
| 1005 | Ga0436365_0222599 | 3300039437 | Bacteria | 829 |
| 1006 | Ga0436361_0008631 | 3300039447 | Bacteria | 2212 |
| 1007 | Ga0436361_0134221 | 3300039447 | Bacteria | 1943 |
| 1008 | Ga0436361_0134613 | 3300039447 | Bacteria | 2505 |
| 1009 | Ga0436363_0373741 | 3300039450 | Bacteria | 1388 |
| 1010 | Ga0439465_0100894 | 3300041413 | Bacteria | 996 |
| 1011 | Ga0439450_032555 | 3300042008 | Bacteria | 1178 |
| 1012 | Ga0439463_005398 | 3300042016 | Bacteria | 3175 |
| 1013 | Ga0439464_0008117 | 3300042439 | Bacteria | 2753 |
| 1014 | Ga0451577_0057746 | 3300042876 | Bacteria | 3459 |
| 1015 | Ga0451577_0320187 | 3300042876 | Bacteria | 1406 |
| 1016 | Ga0453684_0083097 | 3300044712 | Bacteria | 3987 |
| 1017 | Ga0466968_0269607 | 3300044735 | Bacteria | 812 |
| 1018 | Ga0451576_0056877 | 3300045051 | Bacteria | 4089 |
| 1019 | Ga0466967_0970447 | 3300045976 | Bacteria | 846 |
| 1020 | Ga0495617_045430 | 3300046452 | Bacteria | 1464 |
| 1021 | Ga0495592_0019655 | 3300046454 | Bacteria | 5138 |
| 1022 | Ga0495592_0069788 | 3300046454 | Bacteria | 2561 |
| 1023 | Ga0495592_0070753 | 3300046454 | Bacteria | 2540 |
| 1024 | Ga0495603_0007479 | 3300046455 | Bacteria | 6569 |
| 1025 | Ga0495603_0033777 | 3300046455 | Bacteria | 3077 |
| 1026 | Ga0495603_0037649 | 3300046455 | Bacteria | 2902 |
| 1027 | Ga0495603_0056689 | 3300046455 | Bacteria | 2319 |
| 1028 | Ga0495603_0057399 | 3300046455 | Bacteria | 2303 |
| 1029 | Ga0495603_0182940 | 3300046455 | Bacteria | 1212 |
| 1030 | Ga0495603_0273410 | 3300046455 | Bacteria | 971 |
| 1031 | Ga0495590_0251140 | 3300046457 | Bacteria | 658 |
| 1032 | Ga0495629_0001773 | 3300046459 | Bacteria | 16935 |
| 1033 | Ga0495629_0003853 | 3300046459 | Bacteria | 11310 |
| 1034 | Ga0495629_0013360 | 3300046459 | Bacteria | 5924 |
| 1035 | Ga0495629_0036202 | 3300046459 | Bacteria | 3485 |
| 1036 | Ga0495629_0086389 | 3300046459 | Bacteria | 2188 |
| 1037 | Ga0495629_0121691 | 3300046459 | Bacteria | 1818 |
| 1038 | Ga0495638_0010149 | 3300046460 | Bacteria | 6559 |
| 1039 | Ga0495638_0040049 | 3300046460 | Bacteria | 2970 |
| 1040 | Ga0495638_0070326 | 3300046460 | Bacteria | 2143 |
| 1041 | Ga0495638_0152367 | 3300046460 | Bacteria | 1340 |
| 1042 | Ga0495641_0011539 | 3300046461 | Bacteria | 5023 |
| 1043 | Ga0495641_0013912 | 3300046461 | Bacteria | 4386 |
| 1044 | Ga0495641_0017570 | 3300046461 | Bacteria | 3722 |
| 1045 | Ga0495641_0067695 | 3300046461 | Bacteria | 1606 |
| 1046 | Ga0495651_0000921 | 3300046462 | Bacteria | 22808 |
| 1047 | Ga0495651_0067157 | 3300046462 | Bacteria | 2736 |
| 1048 | Ga0495651_0084924 | 3300046462 | Bacteria | 2384 |
| 1049 | Ga0495653_0005157 | 3300046463 | Bacteria | 10610 |
| 1050 | Ga0495653_0288821 | 3300046463 | Bacteria | 1074 |
| 1051 | Ga0495580_0000835 | 3300046472 | Bacteria | 26710 |
| 1052 | Ga0495580_0028360 | 3300046472 | Bacteria | 4068 |
| 1053 | Ga0495580_0084572 | 3300046472 | Bacteria | 2210 |
| 1054 | Ga0495580_0407193 | 3300046472 | Bacteria | 916 |
| 1055 | Ga0495582_0007761 | 3300046473 | Bacteria | 5933 |
| 1056 | Ga0495582_0051422 | 3300046473 | Bacteria | 2271 |
| 1057 | Ga0495582_0069273 | 3300046473 | Bacteria | 1950 |
| 1058 | Ga0495582_0334637 | 3300046473 | Bacteria | 871 |
| 1059 | Ga0495639_0012808 | 3300046475 | Bacteria | 3618 |
| 1060 | Ga0495639_0026424 | 3300046475 | Bacteria | 2566 |
| 1061 | Ga0495639_0032725 | 3300046475 | Bacteria | 2320 |
| 1062 | Ga0495639_0048671 | 3300046475 | Bacteria | 1923 |
| 1063 | Ga0495662_0009375 | 3300046476 | Bacteria | 4803 |
| 1064 | Ga0495662_0129337 | 3300046476 | Bacteria | 1241 |
| 1065 | Ga0495664_0031811 | 3300046477 | Bacteria | 3093 |
| 1066 | Ga0495584_0021018 | 3300046491 | Bacteria | 3315 |
| 1067 | Ga0495584_0187363 | 3300046491 | Bacteria | 1051 |
| 1068 | Ga0495584_0222717 | 3300046491 | Bacteria | 959 |
| 1069 | Ga0495585_0011751 | 3300046492 | Bacteria | 5175 |
| 1070 | Ga0495585_0048246 | 3300046492 | Bacteria | 2368 |
| 1071 | Ga0495594_0020228 | 3300046499 | Bacteria | 3544 |
| 1072 | Ga0495594_0035972 | 3300046499 | Bacteria | 2699 |
| 1073 | Ga0495594_0138431 | 3300046499 | Bacteria | 1380 |
| 1074 | Ga0495594_0242279 | 3300046499 | Bacteria | 1028 |
| 1075 | Ga0495594_0277211 | 3300046499 | Bacteria | 955 |
| 1076 | Ga0495607_0020287 | 3300046501 | Bacteria | 4205 |
| 1077 | Ga0495608_0021603 | 3300046511 | Bacteria | 4417 |
| 1078 | Ga0495610_0087255 | 3300046512 | Bacteria | 1420 |
| 1079 | Ga0495616_0133607 | 3300046513 | Bacteria | 1135 |
| 1080 | Ga0495618_0062799 | 3300046514 | Bacteria | 2357 |
| 1081 | Ga0495618_0175740 | 3300046514 | Bacteria | 1362 |
| 1082 | Ga0495620_0106144 | 3300046515 | Bacteria | 1116 |
| 1083 | Ga0495620_0199018 | 3300046515 | Bacteria | 771 |
| 1084 | Ga0495628_0014081 | 3300046516 | Bacteria | 6713 |
| 1085 | Ga0495630_0014066 | 3300046517 | Bacteria | 5823 |
| 1086 | Ga0495630_0025494 | 3300046517 | Bacteria | 4373 |
| 1087 | Ga0495630_0179847 | 3300046517 | Bacteria | 1612 |
| 1088 | Ga0495632_0078302 | 3300046519 | Bacteria | 1579 |
| 1089 | Ga0495632_0111294 | 3300046519 | Bacteria | 1285 |
| 1090 | Ga0495632_0406252 | 3300046519 | Bacteria | 594 |
| 1091 | Ga0495644_0003443 | 3300046523 | Bacteria | 6261 |
| 1092 | Ga0495644_0134612 | 3300046523 | Bacteria | 942 |
| 1093 | Ga0495648_0167164 | 3300046524 | Bacteria | 1131 |
| 1094 | Ga0495648_0285712 | 3300046524 | Bacteria | 780 |
| 1095 | Ga0495663_0094872 | 3300046525 | Bacteria | 976 |
| 1096 | Ga0495666_0010494 | 3300046526 | Bacteria | 4619 |
| 1097 | Ga0495666_0036764 | 3300046526 | Bacteria | 2384 |
| 1098 | Ga0495666_0116339 | 3300046526 | Bacteria | 1254 |
| 1099 | Ga0495652_0010378 | 3300046529 | Bacteria | 8442 |
| 1100 | Ga0495652_0116472 | 3300046529 | Bacteria | 2139 |
| 1101 | Ga0495652_0222660 | 3300046529 | Bacteria | 1417 |
| 1102 | Ga0495652_0469597 | 3300046529 | Bacteria | 877 |
| 1103 | Ga0495665_0016582 | 3300046531 | Bacteria | 3968 |
| 1104 | Ga0495665_0075432 | 3300046531 | Bacteria | 1775 |
| 1105 | Ga0495665_0145503 | 3300046531 | Bacteria | 1238 |
| 1106 | Ga0495665_0228019 | 3300046531 | Bacteria | 962 |
| 1107 | Ga0495640_0082760 | 3300046533 | Bacteria | 2130 |
| 1108 | Ga0495640_0087133 | 3300046533 | Bacteria | 2066 |
| 1109 | Ga0495640_0311774 | 3300046533 | Bacteria | 976 |
| 1110 | Ga0495586_0077699 | 3300046535 | Bacteria | 1820 |
| 1111 | Ga0495586_0381647 | 3300046535 | Bacteria | 810 |
| 1112 | Ga0495587_0001768 | 3300046536 | Bacteria | 14451 |
| 1113 | Ga0495587_0130519 | 3300046536 | Bacteria | 1436 |
| 1114 | Ga0495598_0001247 | 3300046537 | Bacteria | 4951 |
| 1115 | Ga0495598_0088230 | 3300046537 | Bacteria | 1007 |
| 1116 | Ga0495621_0106772 | 3300046539 | Bacteria | 1070 |
| 1117 | Ga0495645_0127864 | 3300046543 | Bacteria | 1784 |
| 1118 | Ga0495645_0135379 | 3300046543 | Bacteria | 1724 |
| 1119 | Ga0495645_0218645 | 3300046543 | Bacteria | 1282 |
| 1120 | Ga0495622_0000576 | 3300046557 | Bacteria | 22007 |
| 1121 | Ga0495622_0016818 | 3300046557 | Bacteria | 3407 |
| 1122 | Ga0495622_0144157 | 3300046557 | Bacteria | 1080 |
| 1123 | Ga0495633_0015379 | 3300046558 | Bacteria | 3971 |
| 1124 | Ga0495633_0050252 | 3300046558 | Bacteria | 1966 |
| 1125 | Ga0495667_0003339 | 3300046559 | Bacteria | 10747 |
| 1126 | Ga0495667_0003637 | 3300046559 | Bacteria | 10371 |
| 1127 | Ga0495667_0534727 | 3300046559 | Bacteria | 733 |
| 1128 | Ga0495656_0035741 | 3300046615 | Bacteria | 2042 |
| 1129 | Ga0495656_0161462 | 3300046615 | Bacteria | 1089 |
| 1130 | Ga0495668_0126421 | 3300046616 | Bacteria | 1399 |
| 1131 | Ga0495634_0050997 | 3300046642 | Bacteria | 2777 |
| 1132 | Ga0495634_0115116 | 3300046642 | Bacteria | 1726 |
| 1133 | Ga0495634_0297486 | 3300046642 | Bacteria | 976 |
| 1134 | Ga0495611_0052551 | 3300046648 | Bacteria | 1838 |
| 1135 | Ga0495611_0176422 | 3300046648 | Bacteria | 998 |
| 1136 | Ga0495611_0202767 | 3300046648 | Bacteria | 925 |
| 1137 | Ga0495625_0177779 | 3300046660 | Bacteria | 1417 |
| 1138 | Ga0495625_0503512 | 3300046660 | Bacteria | 740 |
| 1139 | Ga0495635_0010530 | 3300046663 | Bacteria | 6472 |
| 1140 | Ga0495635_0029945 | 3300046663 | Bacteria | 3784 |
| 1141 | Ga0495635_0033322 | 3300046663 | Bacteria | 3573 |
| 1142 | Ga0495635_0037535 | 3300046663 | Bacteria | 3354 |
| 1143 | Ga0495635_0105746 | 3300046663 | Bacteria | 1923 |
| 1144 | Ga0495659_0003402 | 3300046664 | Bacteria | 5087 |
| 1145 | Ga0495659_0050049 | 3300046664 | Bacteria | 1519 |
| 1146 | Ga0495661_0076857 | 3300046665 | Bacteria | 1936 |
| 1147 | Ga0495661_0169881 | 3300046665 | Bacteria | 1164 |
| 1148 | Ga0495588_0013011 | 3300046674 | Bacteria | 3953 |
| 1149 | Ga0495588_0086347 | 3300046674 | Bacteria | 1641 |
| 1150 | Ga0495588_0121709 | 3300046674 | Bacteria | 1375 |
| 1151 | Ga0495588_0159101 | 3300046674 | Bacteria | 1194 |
| 1152 | Ga0495657_0039832 | 3300046675 | Bacteria | 3227 |
| 1153 | Ga0495599_0002940 | 3300046678 | Bacteria | 9906 |
| 1154 | Ga0495599_0042206 | 3300046678 | Bacteria | 2862 |
| 1155 | Ga0495623_0029465 | 3300046679 | Bacteria | 3532 |
| 1156 | Ga0495646_0014858 | 3300046680 | Bacteria | 4945 |
| 1157 | Ga0495646_0165214 | 3300046680 | Bacteria | 1223 |
| 1158 | Ga0495647_0001850 | 3300046681 | Bacteria | 6562 |
| 1159 | Ga0495647_0036932 | 3300046681 | Bacteria | 1841 |
| 1160 | Ga0495647_0101203 | 3300046681 | Bacteria | 1193 |
| 1161 | Ga0495658_0000874 | 3300046683 | Bacteria | 16183 |
| 1162 | Ga0495658_0014876 | 3300046683 | Bacteria | 3983 |
| 1163 | Ga0495658_0065055 | 3300046683 | Bacteria | 2102 |
| 1164 | Ga0495658_0168145 | 3300046683 | Bacteria | 1355 |
| 1165 | Ga0495658_0175442 | 3300046683 | Bacteria | 1328 |
| 1166 | Ga0495658_0284388 | 3300046683 | Bacteria | 1044 |
| 1167 | Ga0495613_0001504 | 3300046689 | Bacteria | 17747 |
| 1168 | Ga0495613_0020707 | 3300046689 | Bacteria | 4903 |
| 1169 | Ga0495613_0032939 | 3300046689 | Bacteria | 3850 |
| 1170 | Ga0495613_0185829 | 3300046689 | Bacteria | 1470 |
| 1171 | Ga0495624_0035314 | 3300046690 | Bacteria | 3227 |
| 1172 | Ga0495624_0123376 | 3300046690 | Bacteria | 1590 |
| 1173 | Ga0495624_0364417 | 3300046690 | Bacteria | 869 |
| 1174 | Ga0495670_0003793 | 3300046691 | Bacteria | 7426 |
| 1175 | Ga0495670_0010427 | 3300046691 | Bacteria | 4565 |
| 1176 | Ga0495670_0013237 | 3300046691 | Bacteria | 4057 |
| 1177 | Ga0495671_0110284 | 3300046692 | Bacteria | 1344 |
| 1178 | Ga0495649_0155117 | 3300046694 | Bacteria | 1202 |
| 1179 | Ga0495649_0277895 | 3300046694 | Bacteria | 856 |
| 1180 | Ga0495589_0029954 | 3300046794 | Bacteria | 2743 |
| 1181 | Ga0495589_0060396 | 3300046794 | Bacteria | 1862 |
| 1182 | Ga0495589_0086457 | 3300046794 | Bacteria | 1523 |
| 1183 | Ga0495600_0012176 | 3300046809 | Bacteria | 5372 |
| 1184 | Ga0495600_0092106 | 3300046809 | Bacteria | 1977 |
| 1185 | Ga0495600_0094688 | 3300046809 | Bacteria | 1947 |
| 1186 | Ga0495600_0225776 | 3300046809 | Bacteria | 1197 |
| 1187 | Ga0495600_0598294 | 3300046809 | Bacteria | 670 |
| 1188 | Ga0495581_0007632 | 3300047315 | Bacteria | 6258 |
| 1189 | Ga0495581_0022957 | 3300047315 | Bacteria | 3613 |
| 1190 | Ga0495581_0028023 | 3300047315 | Bacteria | 3265 |
| 1191 | Ga0495581_0392897 | 3300047315 | Bacteria | 809 |
| 1192 | Ga0495604_0217693 | 3300047317 | Bacteria | 1316 |
| 1193 | Ga0495636_0026545 | 3300047318 | Bacteria | 2356 |
| 1194 | Ga0495636_0204644 | 3300047318 | Bacteria | 902 |
| 1195 | Ga0495674_0062320 | 3300047319 | Bacteria | 3248 |
| 1196 | Ga0495674_0073520 | 3300047319 | Bacteria | 2946 |
| 1197 | Ga0495674_0140303 | 3300047319 | Bacteria | 2032 |
| 1198 | Ga0495674_0301131 | 3300047319 | Bacteria | 1309 |
| 1199 | Ga0495676_0030696 | 3300047321 | Bacteria | 4555 |
| 1200 | Ga0495676_0038359 | 3300047321 | Bacteria | 3978 |
| 1201 | Ga0495676_0043807 | 3300047321 | Bacteria | 3658 |
| 1202 | Ga0495676_0092609 | 3300047321 | Bacteria | 2256 |
| 1203 | Ga0495676_0261048 | 3300047321 | Bacteria | 1178 |
| 1204 | Ga0495680_0047510 | 3300047322 | Bacteria | 3376 |
| 1205 | Ga0495680_0071429 | 3300047322 | Bacteria | 2643 |
| 1206 | Ga0495680_0076614 | 3300047322 | Bacteria | 2535 |
| 1207 | Ga0495680_0082709 | 3300047322 | Bacteria | 2422 |
| 1208 | Ga0495680_0112322 | 3300047322 | Bacteria | 2018 |
| 1209 | Ga0495683_0114933 | 3300047323 | Bacteria | 1282 |
| 1210 | Ga0495687_001479 | 3300047443 | Bacteria | 21478 |
| 1211 | Ga0495675_0206297 | 3300047444 | Bacteria | 1194 |
| 1212 | Ga0495677_0038434 | 3300047445 | Bacteria | 1749 |
| 1213 | Ga0495677_0168394 | 3300047445 | Bacteria | 847 |
| 1214 | Ga0495685_096831 | 3300047447 | Bacteria | 975 |
| 1215 | Ga0495673_0108827 | 3300047469 | Bacteria | 1111 |
| 1216 | Ga0495684_0002658 | 3300047471 | Bacteria | 14168 |
| 1217 | Ga0495684_0101159 | 3300047471 | Bacteria | 2179 |
| 1218 | Ga0495684_0334461 | 3300047471 | Bacteria | 1079 |
| 1219 | Ga0495686_0298381 | 3300047472 | Bacteria | 890 |
| 1220 | Ga0495593_0002967 | 3300047673 | Bacteria | 10205 |
| 1221 | Ga0495593_0033479 | 3300047673 | Bacteria | 2798 |
| 1222 | Ga0495593_0139249 | 3300047673 | Bacteria | 1229 |
| 1223 | Ga0495602_0000618 | 3300048088 | Bacteria | 33441 |
| 1224 | Ga0495602_0009515 | 3300048088 | Bacteria | 10102 |
| 1225 | Ga0495602_0118855 | 3300048088 | Bacteria | 2131 |
| 1226 | Ga0495614_0154867 | 3300048089 | Bacteria | 1023 |
| 1227 | Ga0495626_0037215 | 3300048091 | Bacteria | 2314 |
| 1228 | Ga0496100_0001418 | 3300048903 | Bacteria | 11725 |
| 1229 | Ga0496100_0018933 | 3300048903 | Bacteria | 4097 |
| 1230 | Ga0496100_0027178 | 3300048903 | Bacteria | 3516 |
| 1231 | Ga0496100_0058013 | 3300048903 | Bacteria | 2538 |
| 1232 | Ga0496100_0116480 | 3300048903 | Bacteria | 1865 |
| 1233 | Ga0496100_0167121 | 3300048903 | Bacteria | 1581 |
| 1234 | Ga0496100_0459083 | 3300048903 | Bacteria | 977 |
| 1235 | Ga0496101_0007889 | 3300048904 | Bacteria | 6928 |
| 1236 | Ga0496101_0023336 | 3300048904 | Bacteria | 4272 |
| 1237 | Ga0496101_0024749 | 3300048904 | Bacteria | 4159 |
| 1238 | Ga0496101_0220075 | 3300048904 | Bacteria | 1473 |
| 1239 | Ga0496101_0545065 | 3300048904 | Bacteria | 917 |
| 1240 | Ga0496102_0005977 | 3300048905 | Bacteria | 10367 |
| 1241 | Ga0496102_0027192 | 3300048905 | Bacteria | 5109 |
| 1242 | Ga0496102_0052345 | 3300048905 | Bacteria | 3720 |
| 1243 | Ga0496102_0071148 | 3300048905 | Bacteria | 3193 |
| 1244 | Ga0496102_0161964 | 3300048905 | Bacteria | 2104 |
| 1245 | Ga0496102_0172508 | 3300048905 | Bacteria | 2036 |
| 1246 | Ga0496102_0182708 | 3300048905 | Bacteria | 1976 |
| 1247 | Ga0496102_0192167 | 3300048905 | Bacteria | 1924 |
| 1248 | Ga0496102_0375422 | 3300048905 | Bacteria | 1338 |
| 1249 | Ga0496102_0434974 | 3300048905 | Bacteria | 1231 |
| 1250 | Ga0496102_0545390 | 3300048905 | Bacteria | 1082 |
| 1251 | Ga0496102_0686753 | 3300048905 | Bacteria | 947 |
| 1252 | Ga0496103_0001402 | 3300048906 | Bacteria | 16210 |
| 1253 | Ga0496103_0031407 | 3300048906 | Bacteria | 3235 |
| 1254 | Ga0496103_0047272 | 3300048906 | Bacteria | 2659 |
| 1255 | Ga0496103_0052786 | 3300048906 | Bacteria | 2518 |
| 1256 | Ga0496103_0119580 | 3300048906 | Bacteria | 1677 |
| 1257 | Ga0496103_0490539 | 3300048906 | Bacteria | 786 |
| 1258 | Ga0496104_0000196 | 3300048907 | Bacteria | 53901 |
| 1259 | Ga0496104_0004505 | 3300048907 | Bacteria | 12141 |
| 1260 | Ga0496104_0023771 | 3300048907 | Bacteria | 5635 |
| 1261 | Ga0496104_0041962 | 3300048907 | Bacteria | 4290 |
| 1262 | Ga0496104_0066033 | 3300048907 | Bacteria | 3435 |
| 1263 | Ga0496104_0096220 | 3300048907 | Bacteria | 2832 |
| 1264 | Ga0496104_0263190 | 3300048907 | Bacteria | 1637 |
| 1265 | Ga0496104_0367667 | 3300048907 | Bacteria | 1351 |
| 1266 | Ga0496104_0406672 | 3300048907 | Bacteria | 1273 |
| 1267 | Ga0496104_1472259 | 3300048907 | Bacteria | 584 |
| 1268 | Ga0496105_0002714 | 3300048908 | Bacteria | 12911 |
| 1269 | Ga0496105_0002806 | 3300048908 | Bacteria | 12740 |
| 1270 | Ga0496105_0023768 | 3300048908 | Bacteria | 4975 |
| 1271 | Ga0496105_0146095 | 3300048908 | Bacteria | 1945 |
| 1272 | Ga0496105_0466777 | 3300048908 | Bacteria | 995 |
| 1273 | Ga0496106_0048565 | 3300048909 | Bacteria | 3195 |
| 1274 | Ga0496106_0049066 | 3300048909 | Bacteria | 3179 |
| 1275 | Ga0496106_0050298 | 3300048909 | Bacteria | 3141 |
| 1276 | Ga0496106_0074338 | 3300048909 | Bacteria | 2601 |
| 1277 | Ga0496106_0094473 | 3300048909 | Bacteria | 2312 |
| 1278 | Ga0496106_0142856 | 3300048909 | Bacteria | 1884 |
| 1279 | Ga0496107_0001255 | 3300048910 | Bacteria | 15528 |
| 1280 | Ga0496107_0002765 | 3300048910 | Bacteria | 11554 |
| 1281 | Ga0496107_0010054 | 3300048910 | Bacteria | 6563 |
| 1282 | Ga0496107_0015989 | 3300048910 | Bacteria | 5264 |
| 1283 | Ga0496107_0019262 | 3300048910 | Bacteria | 4815 |
| 1284 | Ga0496107_0037460 | 3300048910 | Bacteria | 3480 |
| 1285 | Ga0496107_0041642 | 3300048910 | Bacteria | 3298 |
| 1286 | Ga0496107_0441785 | 3300048910 | Bacteria | 967 |
| 1287 | Ga0496107_0548652 | 3300048910 | Bacteria | 856 |
| 1288 | Ga0496108_0002196 | 3300048911 | Bacteria | 15629 |
| 1289 | Ga0496108_0010961 | 3300048911 | Bacteria | 7362 |
| 1290 | Ga0496108_0013177 | 3300048911 | Bacteria | 6738 |
| 1291 | Ga0496108_0041626 | 3300048911 | Bacteria | 3836 |
| 1292 | Ga0496108_0173597 | 3300048911 | Bacteria | 1865 |
| 1293 | Ga0496108_0177570 | 3300048911 | Bacteria | 1844 |
| 1294 | Ga0496108_0191409 | 3300048911 | Bacteria | 1773 |
| 1295 | Ga0496108_0251862 | 3300048911 | Bacteria | 1536 |
| 1296 | Ga0496109_0001302 | 3300048912 | Bacteria | 20645 |
| 1297 | Ga0496109_0010523 | 3300048912 | Bacteria | 7906 |
| 1298 | Ga0496109_0018777 | 3300048912 | Bacteria | 6081 |
| 1299 | Ga0496109_0043056 | 3300048912 | Bacteria | 4092 |
| 1300 | Ga0496109_0068663 | 3300048912 | Bacteria | 3248 |
| 1301 | Ga0496109_0307001 | 3300048912 | Bacteria | 1496 |
| 1302 | Ga0496109_0547109 | 3300048912 | Bacteria | 1092 |
| 1303 | Ga0496110_0043581 | 3300048913 | Bacteria | 3918 |
| 1304 | Ga0496110_0065153 | 3300048913 | Bacteria | 3221 |
| 1305 | Ga0496110_0072015 | 3300048913 | Bacteria | 3066 |
| 1306 | Ga0496110_0170325 | 3300048913 | Bacteria | 1975 |
| 1307 | Ga0496110_0231374 | 3300048913 | Bacteria | 1681 |
| 1308 | Ga0496110_0276644 | 3300048913 | Bacteria | 1528 |
| 1309 | Ga0496110_0426971 | 3300048913 | Bacteria | 1208 |
| 1310 | Ga0496110_0449951 | 3300048913 | Bacteria | 1174 |
| 1311 | Ga0496111_0002435 | 3300048914 | Bacteria | 11236 |
| 1312 | Ga0496111_0008814 | 3300048914 | Bacteria | 6700 |
| 1313 | Ga0496111_0024822 | 3300048914 | Bacteria | 4227 |
| 1314 | Ga0496111_0064305 | 3300048914 | Bacteria | 2661 |
| 1315 | Ga0496111_0226974 | 3300048914 | Bacteria | 1387 |
| 1316 | Ga0496111_0333231 | 3300048914 | Bacteria | 1123 |
| 1317 | Ga0496112_0004880 | 3300048915 | Bacteria | 11467 |
| 1318 | Ga0496112_0005955 | 3300048915 | Bacteria | 10636 |
| 1319 | Ga0496112_0046232 | 3300048915 | Bacteria | 4268 |
| 1320 | Ga0496112_0055656 | 3300048915 | Bacteria | 3890 |
| 1321 | Ga0496112_0075751 | 3300048915 | Bacteria | 3327 |
| 1322 | Ga0496112_0076321 | 3300048915 | Bacteria | 3314 |
| 1323 | Ga0496112_0092714 | 3300048915 | Bacteria | 2990 |
| 1324 | Ga0496112_0133256 | 3300048915 | Bacteria | 2455 |
| 1325 | Ga0496112_0393785 | 3300048915 | Bacteria | 1325 |
| 1326 | Ga0496112_1236967 | 3300048915 | Bacteria | 663 |
| 1327 | Ga0496113_0000394 | 3300048916 | Bacteria | 21064 |
| 1328 | Ga0496113_0002343 | 3300048916 | Bacteria | 10959 |
| 1329 | Ga0496113_0027510 | 3300048916 | Bacteria | 4078 |
| 1330 | Ga0496113_0031970 | 3300048916 | Bacteria | 3822 |
| 1331 | Ga0496113_0064283 | 3300048916 | Bacteria | 2774 |
| 1332 | Ga0496113_0351528 | 3300048916 | Bacteria | 1182 |
| 1333 | Ga0496114_0004563 | 3300048917 | Bacteria | 10757 |
| 1334 | Ga0496114_0011722 | 3300048917 | Bacteria | 7011 |
| 1335 | Ga0496114_0018298 | 3300048917 | Bacteria | 5664 |
| 1336 | Ga0496114_0035965 | 3300048917 | Bacteria | 4092 |
| 1337 | Ga0496114_0081983 | 3300048917 | Bacteria | 2725 |
| 1338 | Ga0496114_0126945 | 3300048917 | Bacteria | 2199 |
| 1339 | Ga0496114_0678046 | 3300048917 | Bacteria | 905 |
| 1340 | Ga0496114_0787267 | 3300048917 | Bacteria | 829 |
| 1341 | Ga0496114_1064643 | 3300048917 | Bacteria | 693 |
| 1342 | Ga0496115_0004440 | 3300048918 | Bacteria | 10168 |
| 1343 | Ga0496115_0005793 | 3300048918 | Bacteria | 8995 |
| 1344 | Ga0496115_0015657 | 3300048918 | Bacteria | 5757 |
| 1345 | Ga0496115_0187663 | 3300048918 | Unclassified | 1708 |
| 1346 | Ga0496115_0214545 | 3300048918 | Bacteria | 1589 |
| 1347 | Ga0496115_0267824 | 3300048918 | Bacteria | 1404 |
| 1348 | Ga0496115_0396035 | 3300048918 | Bacteria | 1121 |
| 1349 | Ga0496115_0484603 | 3300048918 | Bacteria | 995 |
| 1350 | Ga0496116_0182617 | 3300048919 | Bacteria | 1121 |
| 1351 | Ga0496118_0021970 | 3300048921 | Bacteria | 5595 |
| 1352 | Ga0496119_0046748 | 3300048922 | Bacteria | 2699 |
| 1353 | Ga0496121_0065288 | 3300048924 | Bacteria | 2962 |
| 1354 | Ga0496121_0150220 | 3300048924 | Bacteria | 1715 |
| 1355 | Ga0496121_0201088 | 3300048924 | Bacteria | 1420 |
| 1356 | Ga0496121_0261538 | 3300048924 | Bacteria | 1194 |
| 1357 | Ga0496121_0484065 | 3300048924 | Bacteria | 789 |
| 1358 | Ga0496121_0521610 | 3300048924 | Bacteria | 749 |
| 1359 | Ga0496122_0010630 | 3300048925 | Bacteria | 9454 |
| 1360 | Ga0496123_0000699 | 3300048926 | Bacteria | 55169 |
| 1361 | Ga0496124_0150105 | 3300048927 | Bacteria | 1829 |
| 1362 | Ga0496124_0190898 | 3300048927 | Bacteria | 1568 |
| 1363 | Ga0496125_0109970 | 3300048928 | Bacteria | 2000 |
| 1364 | Ga0496126_0007417 | 3300048929 | Bacteria | 12031 |
| 1365 | Ga0496126_0402706 | 3300048929 | Bacteria | 1109 |
| 1366 | Ga0496126_0534638 | 3300048929 | Bacteria | 932 |
| 1367 | Ga0501032_0065356 | 3300049569 | Bacteria | 2433 |
| 1368 | Ga0501034_0065644 | 3300049571 | Bacteria | 3642 |
| 1369 | Ga0501038_0103883 | 3300049574 | Bacteria | 2362 |
| 1370 | Ga0501040_0024567 | 3300049576 | Bacteria | 4044 |
| 1371 | Ga0501041_0096977 | 3300049577 | Bacteria | 1823 |
| 1372 | Ga0501041_0629797 | 3300049577 | Bacteria | 685 |
| 1373 | Ga0501043_0077627 | 3300049579 | Bacteria | 2609 |
| 1374 | Ga0501047_0004728 | 3300049581 | Bacteria | 12808 |
| 1375 | Ga0501048_0485860 | 3300049582 | Bacteria | 885 |
| 1376 | Ga0501067_0163228 | 3300049583 | Bacteria | 1241 |
| 1377 | Ga0501068_0223224 | 3300049584 | Bacteria | 1198 |
| 1378 | Ga0501068_0375953 | 3300049584 | Bacteria | 915 |
| 1379 | Ga0501070_0025239 | 3300049586 | Bacteria | 4983 |
| 1380 | Ga0501070_0186440 | 3300049586 | Bacteria | 1706 |
| 1381 | Ga0501071_0591937 | 3300049587 | Bacteria | 853 |
| 1382 | Ga0501071_0658462 | 3300049587 | Bacteria | 806 |
| 1383 | Ga0501072_0135586 | 3300049588 | Bacteria | 1963 |
| 1384 | Ga0501073_0001633 | 3300049589 | Bacteria | 16626 |
| 1385 | Ga0501074_0547975 | 3300049590 | Bacteria | 819 |
| 1386 | Ga0501075_0030457 | 3300049591 | Bacteria | 3997 |
| 1387 | Ga0501075_0062556 | 3300049591 | Bacteria | 2805 |
| 1388 | Ga0501076_0109343 | 3300049592 | Bacteria | 2234 |
| 1389 | Ga0501077_0014892 | 3300049593 | Bacteria | 4889 |
| 1390 | Ga0501079_0010682 | 3300049741 | Bacteria | 6991 |
| 1391 | Ga0501080_0163363 | 3300049742 | Bacteria | 2056 |
| 1392 | Ga0501080_0253719 | 3300049742 | Bacteria | 1604 |
| 1393 | Ga0501081_0008617 | 3300049743 | Bacteria | 6627 |
| 1394 | Ga0501083_0093812 | 3300049744 | Bacteria | 1982 |
| 1395 | Ga0501083_0095920 | 3300049744 | Bacteria | 1957 |
| 1396 | Ga0501083_0112649 | 3300049744 | Bacteria | 1788 |
| 1397 | Ga0501083_0126768 | 3300049744 | Bacteria | 1673 |
| 1398 | Ga0501035_0224155 | 3300049822 | Bacteria | 1604 |
| 1399 | Ga0501044_0006753 | 3300049823 | Bacteria | 12649 |
| 1400 | Ga0501044_0037948 | 3300049823 | Bacteria | 5034 |
| 1401 | Ga0501044_0346930 | 3300049823 | Bacteria | 1405 |
| 1402 | Ga0501044_0365650 | 3300049823 | Bacteria | 1360 |
| 1403 | Ga0501045_0701279 | 3300049824 | Bacteria | 747 |
| 1404 | nmdc:mga03683_67278_c1 | 3300050489 | Bacteria | 1525 |
| 1405 | nmdc:mga03n38_473825_c1 | 3300050490 | Bacteria | 699 |
| 1406 | nmdc:mga03n38_57888_c1 | 3300050490 | Bacteria | 1754 |
| 1407 | nmdc:mga03n38_900_c1 | 3300050490 | Bacteria | 8001 |
| 1408 | nmdc:mga00v17_216763_c1 | 3300050491 | Bacteria | 1239 |
| 1409 | nmdc:mga0yw44_149487_c1 | 3300050492 | Bacteria | 1523 |
| 1410 | nmdc:mga0yw44_20390_c1 | 3300050492 | Bacteria | 3678 |
| 1411 | nmdc:mga0yw44_2168_c1 | 3300050492 | Bacteria | 8242 |
| 1412 | nmdc:mga0yw44_239384_c1 | 3300050492 | Bacteria | 1206 |
| 1413 | nmdc:mga0k408_110847_c1 | 3300050493 | Bacteria | 1622 |
| 1414 | nmdc:mga0k408_148432_c1 | 3300050493 | Bacteria | 1396 |
| 1415 | nmdc:mga0k408_216802_c1 | 3300050493 | Bacteria | 1143 |
| 1416 | nmdc:mga0k408_459212_c1 | 3300050493 | Bacteria | 756 |
| 1417 | nmdc:mga0k408_493957_c1 | 3300050493 | Bacteria | 725 |
| 1418 | nmdc:mga06z11_385242_c1 | 3300050494 | Bacteria | 843 |
| 1419 | nmdc:mga04h51_35073_c1 | 3300050495 | Bacteria | 1606 |
| 1420 | nmdc:mga04h51_57703_c1 | 3300050495 | Bacteria | 1321 |
| 1421 | nmdc:mga07m45_83242_c1 | 3300050496 | Bacteria | 1828 |
| 1422 | nmdc:mga05p37_129848_c1 | 3300050507 | Bacteria | 3092 |
| 1423 | nmdc:mga05p37_4032_c1 | 3300050507 | Bacteria | 5627 |
| 1424 | nmdc:mga05p37_465051_c1 | 3300050507 | Bacteria | 1461 |
| 1425 | nmdc:mga05p37_595196_c1 | 3300050507 | Bacteria | 1249 |
| 1426 | nmdc:mga05p37_92337_c1 | 3300050507 | Bacteria | 3730 |
| 1427 | nmdc:mga09592_143025_c1 | 3300050508 | Bacteria | 2062 |
| 1428 | nmdc:mga09592_4710_c1 | 3300050508 | Bacteria | 11047 |
| 1429 | nmdc:mga0qj67_150443_c1 | 3300050509 | Bacteria | 1888 |
| 1430 | nmdc:mga0qj67_552735_c1 | 3300050509 | Bacteria | 923 |
| 1431 | nmdc:mga0qj67_646987_c1 | 3300050509 | Bacteria | 843 |
| 1432 | nmdc:mga0qj67_768_c1 | 3300050509 | Bacteria | 21815 |
| 1433 | nmdc:mga06r32_117900_c1 | 3300050510 | Bacteria | 2617 |
| 1434 | nmdc:mga06r32_427368_c1 | 3300050510 | Bacteria | 1306 |
| 1435 | nmdc:mga08y16_13725_c1 | 3300050511 | Bacteria | 8530 |
| 1436 | nmdc:mga08y16_1880010_c1 | 3300050511 | Bacteria | 550 |
| 1437 | nmdc:mga08y16_2116_c1 | 3300050511 | Bacteria | 20352 |
| 1438 | nmdc:mga08y16_321381_c1 | 3300050511 | Bacteria | 1593 |
| 1439 | nmdc:mga08y16_342219_c1 | 3300050511 | Bacteria | 1537 |
| 1440 | nmdc:mga08y16_67671_c1 | 3300050511 | Bacteria | 3726 |
| 1441 | nmdc:mga08y16_77404_c1 | 3300050511 | Bacteria | 3468 |
| 1442 | nmdc:mga0n895_125016_c1 | 3300050512 | Bacteria | 2596 |
| 1443 | nmdc:mga0n895_167480_c1 | 3300050512 | Bacteria | 2229 |
| 1444 | nmdc:mga0n895_211894_c1 | 3300050512 | Bacteria | 1968 |
| 1445 | nmdc:mga0n895_226459_c1 | 3300050512 | Bacteria | 1898 |
| 1446 | nmdc:mga0n895_408739_c1 | 3300050512 | Bacteria | 1373 |
| 1447 | nmdc:mga0rr50_1039_c1 | 3300050513 | Bacteria | 15047 |
| 1448 | nmdc:mga0rr50_19830_c1 | 3300050513 | Bacteria | 4549 |
| 1449 | nmdc:mga0rr50_379266_c1 | 3300050513 | Bacteria | 1192 |
| 1450 | nmdc:mga0rr50_42391_c1 | 3300050513 | Bacteria | 3323 |
| 1451 | nmdc:mga0rr50_85712_c1 | 3300050513 | Bacteria | 2442 |
| 1452 | nmdc:mga0rr50_989646_c1 | 3300050513 | Bacteria | 717 |
| 1453 | nmdc:mga08x19_114924_c1 | 3300050514 | Bacteria | 1798 |
| 1454 | nmdc:mga08x19_157864_c1 | 3300050514 | Bacteria | 1539 |
| 1455 | nmdc:mga08x19_38172_c1 | 3300050514 | Bacteria | 3050 |
| 1456 | nmdc:mga08x19_50158_c1 | 3300050514 | Bacteria | 2678 |
| 1457 | nmdc:mga0a205_12523_c1 | 3300050515 | Bacteria | 7851 |
| 1458 | nmdc:mga0a205_153815_c1 | 3300050515 | Bacteria | 2199 |
| 1459 | nmdc:mga0a205_293311_c1 | 3300050515 | Bacteria | 1501 |
| 1460 | nmdc:mga0a205_719_c1 | 3300050515 | Bacteria | 26646 |
| 1461 | nmdc:mga0sz30_16211_c1 | 3300050516 | Bacteria | 2955 |
| 1462 | Ga0495601_0040671 | 3300053077 | Bacteria | 2912 |
| 1463 | Ga0495601_0224068 | 3300053077 | Bacteria | 1228 |
| 1464 | Ga0495601_0321479 | 3300053077 | Bacteria | 1007 |
| 1465 | Ga0495612_0000795 | 3300053078 | Bacteria | 12832 |
| 1466 | Ga0495612_0001561 | 3300053078 | Bacteria | 9432 |
| 1467 | Ga0495612_0045685 | 3300053078 | Bacteria | 1793 |
| 1468 | Ga0495612_0088008 | 3300053078 | Bacteria | 1311 |
| 1469 | Ga0495655_0048895 | 3300053083 | Bacteria | 1111 |
| 1470 | Ga0495595_0001780 | 3300053084 | Bacteria | 8401 |
| 1471 | Ga0495595_0009392 | 3300053084 | Bacteria | 4045 |
| 1472 | Ga0495595_0108490 | 3300053084 | Bacteria | 1344 |
| 1473 | Ga0495595_0231695 | 3300053084 | Bacteria | 923 |
| 1474 | Ga0495595_0247532 | 3300053084 | Bacteria | 892 |
| 1475 | Ga0495619_0001605 | 3300053085 | Bacteria | 14871 |
| 1476 | Ga0495619_0002808 | 3300053085 | Bacteria | 11348 |
| 1477 | Ga0495619_0010084 | 3300053085 | Bacteria | 5948 |
| 1478 | Ga0495619_0016499 | 3300053085 | Bacteria | 4676 |
| 1479 | Ga0495619_0017496 | 3300053085 | Bacteria | 4538 |
| 1480 | Ga0495619_0027239 | 3300053085 | Bacteria | 3680 |
| 1481 | Ga0500643_068097 | 3300053087 | Bacteria | 990 |
| 1482 | Ga0500644_0002004 | 3300053088 | Bacteria | 5187 |
| 1483 | Ga0500646_0031443 | 3300053090 | Bacteria | 1461 |
| 1484 | Ga0500583_0085791 | 3300053092 | Bacteria | 1527 |
| 1485 | Ga0500583_0102302 | 3300053092 | Bacteria | 1404 |
| 1486 | Ga0500566_0175753 | 3300053094 | Bacteria | 1103 |
| 1487 | Ga0500566_0332379 | 3300053094 | Bacteria | 703 |
| 1488 | Ga0500641_0002828 | 3300053096 | Bacteria | 6153 |
| 1489 | Ga0500650_0242138 | 3300053098 | Bacteria | 811 |
| 1490 | Ga0500555_093027 | 3300053103 | Bacteria | 773 |
| 1491 | Ga0500593_000274 | 3300053117 | Bacteria | 21119 |
| 1492 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1493 | Ga0500595_001169 | 3300053119 | Bacteria | 14529 |
| 1494 | Ga0500595_008303 | 3300053119 | Bacteria | 4249 |
| 1495 | Ga0500652_019791 | 3300053131 | Bacteria | 2507 |
| 1496 | Ga0500652_094295 | 3300053131 | Bacteria | 1250 |
| 1497 | Ga0500655_011673 | 3300053133 | Bacteria | 1594 |
| 1498 | Ga0500658_0438589 | 3300053134 | Bacteria | 595 |
| 1499 | Ga0500577_0065741 | 3300053142 | Bacteria | 1409 |
| 1500 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1501 | Ga0500616_0169368 | 3300053153 | Bacteria | 993 |
| 1502 | Ga0500645_000410 | 3300053730 | Bacteria | 30009 |
| 1503 | Ga0501084_0119599 | 3300054114 | Bacteria | 2214 |
| 1504 | Ga0501082_0009855 | 3300060353 | Bacteria | 8233 |
| 1505 | Ga0501082_0057803 | 3300060353 | Bacteria | 3341 |
| 1506 | Ga0501082_0359557 | 3300060353 | Bacteria | 1270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_11180439 | Ga0163162_111804391 | 155 |
| 2 | 3300037466 | Ga0395898_0132734 | Ga0395898_0132734_211_936 | 157 |
| 3 | 3300049743 | Ga0501081_0008617 | Ga0501081_0008617_4817_5344 | 157 |
| 4 | 3300005344 | Ga0070661_100894393 | Ga0070661_1008943931 | 159 |
| 5 | 3300005539 | Ga0068853_100285340 | Ga0068853_1002853402 | 159 |
| 6 | 3300025911 | Ga0207654_10165849 | Ga0207654_101658492 | 159 |
| 7 | 3300025920 | Ga0207649_10271214 | Ga0207649_102712142 | 159 |
| 8 | 3300025981 | Ga0207640_10819529 | Ga0207640_108195291 | 159 |
| 9 | 3300026041 | Ga0207639_10823749 | Ga0207639_108237492 | 159 |
| 10 | 3300009176 | Ga0105242_10329538 | Ga0105242_103295382 | 163 |
| 11 | 3300031247 | Ga0265340_10066991 | Ga0265340_100669912 | 164 |
| 12 | 3300005466 | Ga0070685_10551607 | Ga0070685_105516071 | 165 |
| 13 | 3300046674 | Ga0495588_0159101 | Ga0495588_0159101_242_835 | 166 |
| 14 | 3300048903 | Ga0496100_0167121 | Ga0496100_0167121_217_837 | 167 |
| 15 | 3300048917 | Ga0496114_0011722 | Ga0496114_0011722_381_1001 | 167 |
| 16 | 3300049587 | Ga0501071_0658462 | Ga0501071_0658462_122_742 | 167 |
| 17 | 3300005434 | Ga0070709_10775126 | Ga0070709_107751261 | 168 |
| 18 | 3300006163 | Ga0070715_10010881 | Ga0070715_100108813 | 168 |
| 19 | 3300006175 | Ga0070712_100150703 | Ga0070712_1001507032 | 168 |
| 20 | 3300025906 | Ga0207699_10304265 | Ga0207699_103042652 | 168 |
| 21 | 3300035083 | Ga0373926_0038931 | Ga0373926_0038931_339_932 | 168 |
| 22 | 3300035089 | Ga0373944_0051511 | Ga0373944_0051511_469_1062 | 168 |
| 23 | 3300035116 | Ga0373945_0070449 | Ga0373945_0070449_225_818 | 168 |
| 24 | 3300035171 | Ga0373946_0161101 | Ga0373946_0161101_61_654 | 168 |
| 25 | 3300035691 | Ga0373931_0094083 | Ga0373931_0094083_799_1407 | 168 |
| 26 | 3300035692 | Ga0373935_0179385 | Ga0373935_0179385_702_1295 | 168 |
| 27 | 3300037068 | Ga0373925_0402494 | Ga0373925_0402494_307_900 | 168 |
| 28 | 3300046455 | Ga0495603_0037649 | Ga0495603_0037649_1484_2077 | 168 |
| 29 | 3300046459 | Ga0495629_0013360 | Ga0495629_0013360_1867_2460 | 168 |
| 30 | 3300046463 | Ga0495653_0288821 | Ga0495653_0288821_289_882 | 168 |
| 31 | 3300046475 | Ga0495639_0026424 | Ga0495639_0026424_666_1259 | 168 |
| 32 | 3300046477 | Ga0495664_0031811 | Ga0495664_0031811_1467_2060 | 168 |
| 33 | 3300046499 | Ga0495594_0277211 | Ga0495594_0277211_151_744 | 168 |
| 34 | 3300046517 | Ga0495630_0179847 | Ga0495630_0179847_673_1266 | 168 |
| 35 | 3300046526 | Ga0495666_0036764 | Ga0495666_0036764_1766_2359 | 168 |
| 36 | 3300046529 | Ga0495652_0222660 | Ga0495652_0222660_599_1192 | 168 |
| 37 | 3300046531 | Ga0495665_0228019 | Ga0495665_0228019_355_948 | 168 |
| 38 | 3300046533 | Ga0495640_0082760 | Ga0495640_0082760_268_861 | 168 |
| 39 | 3300046642 | Ga0495634_0297486 | Ga0495634_0297486_20_613 | 168 |
| 40 | 3300046683 | Ga0495658_0065055 | Ga0495658_0065055_655_1248 | 168 |
| 41 | 3300046690 | Ga0495624_0123376 | Ga0495624_0123376_218_811 | 168 |
| 42 | 3300047315 | Ga0495581_0392897 | Ga0495581_0392897_132_725 | 168 |
| 43 | 3300047319 | Ga0495674_0073520 | Ga0495674_0073520_1466_2059 | 168 |
| 44 | 3300047321 | Ga0495676_0030696 | Ga0495676_0030696_1401_1994 | 168 |
| 45 | 3300047322 | Ga0495680_0082709 | Ga0495680_0082709_1325_1918 | 168 |
| 46 | 3300047471 | Ga0495684_0101159 | Ga0495684_0101159_562_1155 | 168 |
| 47 | 3300047673 | Ga0495593_0139249 | Ga0495593_0139249_114_707 | 168 |
| 48 | 3300048089 | Ga0495614_0154867 | Ga0495614_0154867_37_630 | 168 |
| 49 | 3300053077 | Ga0495601_0040671 | Ga0495601_0040671_483_1076 | 168 |
| 50 | 3300053078 | Ga0495612_0088008 | Ga0495612_0088008_254_847 | 168 |
| 51 | 3300053085 | Ga0495619_0016499 | Ga0495619_0016499_906_1499 | 168 |
| 52 | 3300037418 | Ga0395900_1154503 | Ga0395900_1154503_74_667 | 169 |
| 53 | 3300045976 | Ga0466967_0970447 | Ga0466967_0970447_204_797 | 169 |
| 54 | 3300009092 | Ga0105250_10327236 | Ga0105250_103272361 | 171 |
| 55 | 3300013297 | Ga0157378_10075985 | Ga0157378_100759852 | 171 |
| 56 | 3300025918 | Ga0207662_10097343 | Ga0207662_100973431 | 171 |
| 57 | 3300026023 | Ga0207677_10457550 | Ga0207677_104575502 | 171 |
| 58 | 3300046519 | Ga0495632_0406252 | Ga0495632_0406252_59_580 | 172 |
| 59 | 3300046559 | Ga0495667_0534727 | Ga0495667_0534727_202_723 | 172 |
| 60 | 3300046616 | Ga0495668_0126421 | Ga0495668_0126421_20_541 | 172 |
| 61 | 3300049571 | Ga0501034_0065644 | Ga0501034_0065644_2830_3414 | 172 |
| 62 | 3300049586 | Ga0501070_0186440 | Ga0501070_0186440_206_790 | 172 |
| 63 | 3300049742 | Ga0501080_0253719 | Ga0501080_0253719_992_1576 | 172 |
| 64 | 3300050511 | nmdc:mga08y16_1880010_c1 | nmdc:mga08y16_1880010_c1_17_538 | 172 |
| 65 | 3300053134 | Ga0500658_0438589 | Ga0500658_0438589_17_538 | 172 |
| 66 | 3300009098 | Ga0105245_10157650 | Ga0105245_101576502 | 173 |
| 67 | 3300014326 | Ga0157380_10449421 | Ga0157380_104494212 | 173 |
| 68 | 3300035692 | Ga0373935_0219916 | Ga0373935_0219916_320_952 | 173 |
| 69 | 3300048907 | Ga0496104_1472259 | Ga0496104_1472259_17_541 | 173 |
| 70 | 3300049824 | Ga0501045_0701279 | Ga0501045_0701279_65_703 | 173 |
| 71 | 3300053094 | Ga0500566_0332379 | Ga0500566_0332379_15_608 | 175 |
| 72 | 3300048913 | Ga0496110_0072015 | Ga0496110_0072015_1635_2255 | 176 |
| 73 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_345731_346315 | 176 |
| 74 | 3300048928 | Ga0496125_0109970 | Ga0496125_0109970_1206_1823 | 177 |
| 75 | 3300053142 | Ga0500577_0065741 | Ga0500577_0065741_142_726 | 177 |
| 76 | 3300006175 | Ga0070712_100519742 | Ga0070712_1005197421 | 178 |
| 77 | 3300025906 | Ga0207699_10052606 | Ga0207699_100526063 | 178 |
| 78 | 3300025939 | Ga0207665_10041611 | Ga0207665_100416113 | 178 |
| 79 | 3300048905 | Ga0496102_0375422 | Ga0496102_0375422_711_1325 | 178 |
| 80 | 3300048907 | Ga0496104_0406672 | Ga0496104_0406672_317_931 | 178 |
| 81 | 3300048909 | Ga0496106_0142856 | Ga0496106_0142856_1125_1739 | 178 |
| 82 | 3300048915 | Ga0496112_0092714 | Ga0496112_0092714_225_839 | 178 |
| 83 | 3300048916 | Ga0496113_0351528 | Ga0496113_0351528_129_743 | 178 |
| 84 | 3300048918 | Ga0496115_0396035 | Ga0496115_0396035_301_915 | 178 |
| 85 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_419564_420148 | 178 |
| 86 | 3300005327 | Ga0070658_10542866 | Ga0070658_105428662 | 179 |
| 87 | 3300005338 | Ga0068868_100511377 | Ga0068868_1005113772 | 179 |
| 88 | 3300013307 | Ga0157372_10405850 | Ga0157372_104058502 | 179 |
| 89 | 3300037471 | Ga0395905_0023923 | Ga0395905_0023923_876_1508 | 179 |
| 90 | 3300048908 | Ga0496105_0146095 | Ga0496105_0146095_807_1439 | 179 |
| 91 | 3300053131 | Ga0500652_019791 | Ga0500652_019791_935_1543 | 179 |
| 92 | 3300037312 | Ga0395899_0072948 | Ga0395899_0072948_1151_1786 | 180 |
| 93 | 3300037418 | Ga0395900_0083563 | Ga0395900_0083563_166_801 | 180 |
| 94 | 3300037466 | Ga0395898_0007949 | Ga0395898_0007949_2724_3359 | 180 |
| 95 | 3300037471 | Ga0395905_0224049 | Ga0395905_0224049_31_666 | 180 |
| 96 | 3300038443 | Ga0395901_0173159 | Ga0395901_0173159_1013_1648 | 180 |
| 97 | 3300005366 | Ga0070659_100306809 | Ga0070659_1003068092 | 181 |
| 98 | 3300048912 | Ga0496109_0043056 | Ga0496109_0043056_2297_2917 | 182 |
| 99 | 3300049569 | Ga0501032_0065356 | Ga0501032_0065356_1606_2190 | 182 |
| 100 | 3300005981 | Ga0081538_10001263 | Ga0081538_1000126313 | 183 |
| 101 | 3300027682 | Ga0209971_1002180 | Ga0209971_10021807 | 183 |
| 102 | 3300049583 | Ga0501067_0163228 | Ga0501067_0163228_501_1085 | 183 |
| 103 | 3300049588 | Ga0501072_0135586 | Ga0501072_0135586_158_742 | 183 |
| 104 | 3300049744 | Ga0501083_0126768 | Ga0501083_0126768_303_887 | 183 |
| 105 | 3300049823 | Ga0501044_0037948 | Ga0501044_0037948_1805_2389 | 183 |
| 106 | 3300060353 | Ga0501082_0057803 | Ga0501082_0057803_456_1040 | 183 |
| 107 | 3300035086 | Ga0373934_0026332 | Ga0373934_0026332_1585_2178 | 184 |
| 108 | 3300035086 | Ga0373934_0156211 | Ga0373934_0156211_122_745 | 184 |
| 109 | 3300035089 | Ga0373944_0004381 | Ga0373944_0004381_180_773 | 184 |
| 110 | 3300035111 | Ga0373923_0095776 | Ga0373923_0095776_348_941 | 184 |
| 111 | 3300035113 | Ga0373936_0027457 | Ga0373936_0027457_543_1136 | 184 |
| 112 | 3300035116 | Ga0373945_0003925 | Ga0373945_0003925_1166_1759 | 184 |
| 113 | 3300035118 | Ga0373954_0019118 | Ga0373954_0019118_2376_2969 | 184 |
| 114 | 3300035119 | Ga0373956_0267467 | Ga0373956_0267467_79_702 | 184 |
| 115 | 3300035170 | Ga0373943_0147418 | Ga0373943_0147418_72_665 | 184 |
| 116 | 3300035171 | Ga0373946_0011386 | Ga0373946_0011386_2477_3070 | 184 |
| 117 | 3300035172 | Ga0373955_0349460 | Ga0373955_0349460_243_836 | 184 |
| 118 | 3300035410 | Ga0373924_0133752 | Ga0373924_0133752_216_809 | 184 |
| 119 | 3300035692 | Ga0373935_0023521 | Ga0373935_0023521_1882_2475 | 184 |
| 120 | 3300035692 | Ga0373935_0224761 | Ga0373935_0224761_489_1112 | 184 |
| 121 | 3300035725 | Ga0373947_0054777 | Ga0373947_0054777_1396_1989 | 184 |
| 122 | 3300036401 | Ga0373937_0003886 | Ga0373937_0003886_2108_2731 | 184 |
| 123 | 3300046452 | Ga0495617_045430 | Ga0495617_045430_155_748 | 184 |
| 124 | 3300046454 | Ga0495592_0019655 | Ga0495592_0019655_3193_3786 | 184 |
| 125 | 3300046455 | Ga0495603_0273410 | Ga0495603_0273410_185_778 | 184 |
| 126 | 3300046459 | Ga0495629_0036202 | Ga0495629_0036202_419_1012 | 184 |
| 127 | 3300046461 | Ga0495641_0017570 | Ga0495641_0017570_1648_2241 | 184 |
| 128 | 3300046462 | Ga0495651_0084924 | Ga0495651_0084924_63_656 | 184 |
| 129 | 3300046463 | Ga0495653_0005157 | Ga0495653_0005157_1334_1927 | 184 |
| 130 | 3300046472 | Ga0495580_0028360 | Ga0495580_0028360_2373_2966 | 184 |
| 131 | 3300046473 | Ga0495582_0334637 | Ga0495582_0334637_185_778 | 184 |
| 132 | 3300046475 | Ga0495639_0012808 | Ga0495639_0012808_2604_3197 | 184 |
| 133 | 3300046476 | Ga0495662_0009375 | Ga0495662_0009375_2424_3017 | 184 |
| 134 | 3300046491 | Ga0495584_0187363 | Ga0495584_0187363_392_985 | 184 |
| 135 | 3300046492 | Ga0495585_0011751 | Ga0495585_0011751_3486_4079 | 184 |
| 136 | 3300046499 | Ga0495594_0020228 | Ga0495594_0020228_1786_2379 | 184 |
| 137 | 3300046501 | Ga0495607_0020287 | Ga0495607_0020287_650_1243 | 184 |
| 138 | 3300046511 | Ga0495608_0021603 | Ga0495608_0021603_2444_3037 | 184 |
| 139 | 3300046514 | Ga0495618_0062799 | Ga0495618_0062799_1347_1940 | 184 |
| 140 | 3300046517 | Ga0495630_0014066 | Ga0495630_0014066_4828_5421 | 184 |
| 141 | 3300046523 | Ga0495644_0003443 | Ga0495644_0003443_15_614 | 184 |
| 142 | 3300046526 | Ga0495666_0010494 | Ga0495666_0010494_2458_3051 | 184 |
| 143 | 3300046529 | Ga0495652_0116472 | Ga0495652_0116472_41_634 | 184 |
| 144 | 3300046531 | Ga0495665_0016582 | Ga0495665_0016582_2255_2848 | 184 |
| 145 | 3300046535 | Ga0495586_0381647 | Ga0495586_0381647_161_754 | 184 |
| 146 | 3300046536 | Ga0495587_0130519 | Ga0495587_0130519_601_1194 | 184 |
| 147 | 3300046543 | Ga0495645_0127864 | Ga0495645_0127864_1165_1758 | 184 |
| 148 | 3300046557 | Ga0495622_0016818 | Ga0495622_0016818_209_802 | 184 |
| 149 | 3300046558 | Ga0495633_0050252 | Ga0495633_0050252_974_1567 | 184 |
| 150 | 3300046559 | Ga0495667_0003339 | Ga0495667_0003339_9709_10302 | 184 |
| 151 | 3300046648 | Ga0495611_0052551 | Ga0495611_0052551_427_1020 | 184 |
| 152 | 3300046663 | Ga0495635_0033322 | Ga0495635_0033322_1882_2475 | 184 |
| 153 | 3300046674 | Ga0495588_0121709 | Ga0495588_0121709_364_957 | 184 |
| 154 | 3300046678 | Ga0495599_0042206 | Ga0495599_0042206_1290_1883 | 184 |
| 155 | 3300046680 | Ga0495646_0014858 | Ga0495646_0014858_4284_4877 | 184 |
| 156 | 3300046681 | Ga0495647_0101203 | Ga0495647_0101203_416_1009 | 184 |
| 157 | 3300046683 | Ga0495658_0168145 | Ga0495658_0168145_722_1315 | 184 |
| 158 | 3300046689 | Ga0495613_0020707 | Ga0495613_0020707_2600_3193 | 184 |
| 159 | 3300046690 | Ga0495624_0035314 | Ga0495624_0035314_2566_3159 | 184 |
| 160 | 3300046691 | Ga0495670_0010427 | Ga0495670_0010427_3595_4188 | 184 |
| 161 | 3300046794 | Ga0495589_0086457 | Ga0495589_0086457_150_743 | 184 |
| 162 | 3300046809 | Ga0495600_0012176 | Ga0495600_0012176_1539_2132 | 184 |
| 163 | 3300047315 | Ga0495581_0022957 | Ga0495581_0022957_324_917 | 184 |
| 164 | 3300047317 | Ga0495604_0217693 | Ga0495604_0217693_318_911 | 184 |
| 165 | 3300047318 | Ga0495636_0204644 | Ga0495636_0204644_112_705 | 184 |
| 166 | 3300047319 | Ga0495674_0301131 | Ga0495674_0301131_243_836 | 184 |
| 167 | 3300047321 | Ga0495676_0038359 | Ga0495676_0038359_1996_2589 | 184 |
| 168 | 3300047322 | Ga0495680_0112322 | Ga0495680_0112322_185_778 | 184 |
| 169 | 3300047471 | Ga0495684_0002658 | Ga0495684_0002658_13244_13837 | 184 |
| 170 | 3300047673 | Ga0495593_0033479 | Ga0495593_0033479_418_1011 | 184 |
| 171 | 3300053078 | Ga0495612_0001561 | Ga0495612_0001561_7447_8040 | 184 |
| 172 | 3300053084 | Ga0495595_0009392 | Ga0495595_0009392_2335_2928 | 184 |
| 173 | 3300053085 | Ga0495619_0010084 | Ga0495619_0010084_3992_4585 | 184 |
| 174 | 3300006852 | Ga0075433_10975308 | Ga0075433_109753081 | 185 |
| 175 | 3300035691 | Ga0373931_0136999 | Ga0373931_0136999_293_877 | 185 |
| 176 | 3300046683 | Ga0495658_0175442 | Ga0495658_0175442_24_584 | 185 |
| 177 | 3300005440 | Ga0070705_100014665 | Ga0070705_1000146656 | 186 |
| 178 | 3300005518 | Ga0070699_100005151 | Ga0070699_1000051513 | 186 |
| 179 | 3300006914 | Ga0075436_100131444 | Ga0075436_1001314443 | 186 |
| 180 | 3300007076 | Ga0075435_100114060 | Ga0075435_1001140602 | 186 |
| 181 | 3300007076 | Ga0075435_100117179 | Ga0075435_1001171791 | 186 |
| 182 | 3300009147 | Ga0114129_10679670 | Ga0114129_106796703 | 186 |
| 183 | 3300025937 | Ga0207669_10335748 | Ga0207669_103357482 | 186 |
| 184 | 3300026118 | Ga0207675_100030016 | Ga0207675_1000300162 | 186 |
| 185 | 3300035113 | Ga0373936_0226977 | Ga0373936_0226977_225_785 | 186 |
| 186 | 3300035692 | Ga0373935_0287333 | Ga0373935_0287333_356_943 | 186 |
| 187 | 3300048905 | Ga0496102_0052345 | Ga0496102_0052345_2967_3620 | 186 |
| 188 | 3300048907 | Ga0496104_0066033 | Ga0496104_0066033_266_919 | 186 |
| 189 | 3300048907 | Ga0496104_0263190 | Ga0496104_0263190_543_1196 | 186 |
| 190 | 3300048908 | Ga0496105_0466777 | Ga0496105_0466777_26_679 | 186 |
| 191 | 3300048911 | Ga0496108_0177570 | Ga0496108_0177570_787_1440 | 186 |
| 192 | 3300048912 | Ga0496109_0547109 | Ga0496109_0547109_37_690 | 186 |
| 193 | 3300048913 | Ga0496110_0426971 | Ga0496110_0426971_362_1015 | 186 |
| 194 | 3300048914 | Ga0496111_0226974 | Ga0496111_0226974_628_1281 | 186 |
| 195 | 3300048915 | Ga0496112_0075751 | Ga0496112_0075751_165_818 | 186 |
| 196 | 3300048917 | Ga0496114_0678046 | Ga0496114_0678046_93_746 | 186 |
| 197 | 3300050507 | nmdc:mga05p37_595196_c1 | nmdc:mga05p37_595196_c1_233_874 | 186 |
| 198 | 3300050513 | nmdc:mga0rr50_989646_c1 | nmdc:mga0rr50_989646_c1_119_706 | 186 |
| 199 | 3300050514 | nmdc:mga08x19_38172_c1 | nmdc:mga08x19_38172_c1_1646_2233 | 186 |
| 200 | 3300005355 | Ga0070671_100484614 | Ga0070671_1004846142 | 187 |
| 201 | 3300005445 | Ga0070708_100301609 | Ga0070708_1003016093 | 187 |
| 202 | 3300005536 | Ga0070697_100180676 | Ga0070697_1001806762 | 187 |
| 203 | 3300006871 | Ga0075434_100326636 | Ga0075434_1003266362 | 187 |
| 204 | 3300009147 | Ga0114129_10207555 | Ga0114129_102075551 | 187 |
| 205 | 3300009176 | Ga0105242_10137941 | Ga0105242_101379412 | 187 |
| 206 | 3300009177 | Ga0105248_10089844 | Ga0105248_100898443 | 187 |
| 207 | 3300025922 | Ga0207646_10168325 | Ga0207646_101683252 | 187 |
| 208 | 3300025934 | Ga0207686_10310464 | Ga0207686_103104642 | 187 |
| 209 | 3300035691 | Ga0373931_0041535 | Ga0373931_0041535_1422_2042 | 187 |
| 210 | 3300036401 | Ga0373937_0420970 | Ga0373937_0420970_137_730 | 187 |
| 211 | 3300039447 | Ga0436361_0008631 | Ga0436361_0008631_1365_2006 | 187 |
| 212 | 3300046664 | Ga0495659_0003402 | Ga0495659_0003402_2573_3166 | 187 |
| 213 | 3300048904 | Ga0496101_0545065 | Ga0496101_0545065_278_898 | 187 |
| 214 | 3300048905 | Ga0496102_0172508 | Ga0496102_0172508_1318_1938 | 187 |
| 215 | 3300048907 | Ga0496104_0004505 | Ga0496104_0004505_10756_11376 | 187 |
| 216 | 3300048909 | Ga0496106_0094473 | Ga0496106_0094473_16_606 | 187 |
| 217 | 3300048911 | Ga0496108_0191409 | Ga0496108_0191409_693_1313 | 187 |
| 218 | 3300049577 | Ga0501041_0629797 | Ga0501041_0629797_12_632 | 187 |
| 219 | 3300049591 | Ga0501075_0030457 | Ga0501075_0030457_1445_2065 | 187 |
| 220 | 3300049592 | Ga0501076_0109343 | Ga0501076_0109343_1395_2015 | 187 |
| 221 | 3300049593 | Ga0501077_0014892 | Ga0501077_0014892_47_667 | 187 |
| 222 | 3300049741 | Ga0501079_0010682 | Ga0501079_0010682_4203_4823 | 187 |
| 223 | 3300050513 | nmdc:mga0rr50_379266_c1 | nmdc:mga0rr50_379266_c1_443_1084 | 187 |
| 224 | 3300054114 | Ga0501084_0119599 | Ga0501084_0119599_149_769 | 187 |
| 225 | 3300060353 | Ga0501082_0009855 | Ga0501082_0009855_2981_3601 | 187 |
| 226 | 3300035114 | Ga0373939_0182499 | Ga0373939_0182499_191_760 | 188 |
| 227 | 3300035242 | Ga0373962_0127147 | Ga0373962_0127147_36_659 | 188 |
| 228 | 3300005844 | Ga0068862_100013206 | Ga0068862_1000132062 | 189 |
| 229 | 3300028380 | Ga0268265_10170919 | Ga0268265_101709192 | 189 |
| 230 | 3300031711 | Ga0265314_10104897 | Ga0265314_101048972 | 189 |
| 231 | 3300046460 | Ga0495638_0010149 | Ga0495638_0010149_4268_4852 | 189 |
| 232 | 3300046460 | Ga0495638_0152367 | Ga0495638_0152367_28_612 | 189 |
| 233 | 3300048906 | Ga0496103_0490539 | Ga0496103_0490539_40_612 | 189 |
| 234 | 3300049574 | Ga0501038_0103883 | Ga0501038_0103883_1324_1932 | 189 |
| 235 | 3300049579 | Ga0501043_0077627 | Ga0501043_0077627_922_1530 | 189 |
| 236 | 3300049581 | Ga0501047_0004728 | Ga0501047_0004728_7402_8010 | 189 |
| 237 | 3300049586 | Ga0501070_0025239 | Ga0501070_0025239_4226_4834 | 189 |
| 238 | 3300049742 | Ga0501080_0163363 | Ga0501080_0163363_13_621 | 189 |
| 239 | 3300049822 | Ga0501035_0224155 | Ga0501035_0224155_918_1526 | 189 |
| 240 | 3300049823 | Ga0501044_0006753 | Ga0501044_0006753_7834_8442 | 189 |
| 241 | iso_pu_bacteria | 3003665799 | 3003672326 | 189 |
| 242 | 3300046809 | Ga0495600_0092106 | Ga0495600_0092106_237_821 | 190 |
| 243 | 3300047322 | Ga0495680_0071429 | Ga0495680_0071429_1568_2152 | 190 |
| 244 | 3300053730 | Ga0500645_000410 | Ga0500645_000410_8652_9260 | 190 |
| 245 | 3300005329 | Ga0070683_100776329 | Ga0070683_1007763291 | 191 |
| 246 | 3300005334 | Ga0068869_100079064 | Ga0068869_1000790642 | 191 |
| 247 | 3300005334 | Ga0068869_100464313 | Ga0068869_1004643131 | 191 |
| 248 | 3300005340 | Ga0070689_100549246 | Ga0070689_1005492462 | 191 |
| 249 | 3300005353 | Ga0070669_101043520 | Ga0070669_1010435201 | 191 |
| 250 | 3300005355 | Ga0070671_100619743 | Ga0070671_1006197431 | 191 |
| 251 | 3300005356 | Ga0070674_101064527 | Ga0070674_1010645271 | 191 |
| 252 | 3300005365 | Ga0070688_100152339 | Ga0070688_1001523392 | 191 |
| 253 | 3300005365 | Ga0070688_100559243 | Ga0070688_1005592431 | 191 |
| 254 | 3300005367 | Ga0070667_100183834 | Ga0070667_1001838342 | 191 |
| 255 | 3300005367 | Ga0070667_100365985 | Ga0070667_1003659852 | 191 |
| 256 | 3300005444 | Ga0070694_100258671 | Ga0070694_1002586711 | 191 |
| 257 | 3300005455 | Ga0070663_100544340 | Ga0070663_1005443402 | 191 |
| 258 | 3300005456 | Ga0070678_100547881 | Ga0070678_1005478812 | 191 |
| 259 | 3300005546 | Ga0070696_100180766 | Ga0070696_1001807662 | 191 |
| 260 | 3300005548 | Ga0070665_100012968 | Ga0070665_1000129683 | 191 |
| 261 | 3300005577 | Ga0068857_100288465 | Ga0068857_1002884651 | 191 |
| 262 | 3300005615 | Ga0070702_100125969 | Ga0070702_1001259692 | 191 |
| 263 | 3300005719 | Ga0068861_100142225 | Ga0068861_1001422252 | 191 |
| 264 | 3300005719 | Ga0068861_100456140 | Ga0068861_1004561402 | 191 |
| 265 | 3300005719 | Ga0068861_100579863 | Ga0068861_1005798632 | 191 |
| 266 | 3300005719 | Ga0068861_100596011 | Ga0068861_1005960112 | 191 |
| 267 | 3300005840 | Ga0068870_10078105 | Ga0068870_100781052 | 191 |
| 268 | 3300005841 | Ga0068863_100118460 | Ga0068863_1001184602 | 191 |
| 269 | 3300005842 | Ga0068858_100103118 | Ga0068858_1001031182 | 191 |
| 270 | 3300005843 | Ga0068860_100146466 | Ga0068860_1001464663 | 191 |
| 271 | 3300006178 | Ga0075367_10161551 | Ga0075367_101615511 | 191 |
| 272 | 3300006195 | Ga0075366_10346061 | Ga0075366_103460611 | 191 |
| 273 | 3300006844 | Ga0075428_100914195 | Ga0075428_1009141952 | 191 |
| 274 | 3300006871 | Ga0075434_100453414 | Ga0075434_1004534142 | 191 |
| 275 | 3300006881 | Ga0068865_100448001 | Ga0068865_1004480011 | 191 |
| 276 | 3300009101 | Ga0105247_10007741 | Ga0105247_100077418 | 191 |
| 277 | 3300009101 | Ga0105247_10775489 | Ga0105247_107754891 | 191 |
| 278 | 3300013306 | Ga0163162_10206364 | Ga0163162_102063641 | 191 |
| 279 | 3300013306 | Ga0163162_10661123 | Ga0163162_106611231 | 191 |
| 280 | 3300014325 | Ga0163163_10227523 | Ga0163163_102275232 | 191 |
| 281 | 3300014968 | Ga0157379_10097828 | Ga0157379_100978282 | 191 |
| 282 | 3300025900 | Ga0207710_10027741 | Ga0207710_100277413 | 191 |
| 283 | 3300025900 | Ga0207710_10314770 | Ga0207710_103147701 | 191 |
| 284 | 3300025907 | Ga0207645_10197517 | Ga0207645_101975172 | 191 |
| 285 | 3300025908 | Ga0207643_10103051 | Ga0207643_101030512 | 191 |
| 286 | 3300025910 | Ga0207684_10167323 | Ga0207684_101673232 | 191 |
| 287 | 3300025919 | Ga0207657_10243994 | Ga0207657_102439941 | 191 |
| 288 | 3300025923 | Ga0207681_10100954 | Ga0207681_101009542 | 191 |
| 289 | 3300025932 | Ga0207690_10345735 | Ga0207690_103457351 | 191 |
| 290 | 3300025937 | Ga0207669_10138591 | Ga0207669_101385912 | 191 |
| 291 | 3300025938 | Ga0207704_10274213 | Ga0207704_102742132 | 191 |
| 292 | 3300025942 | Ga0207689_10076767 | Ga0207689_100767672 | 191 |
| 293 | 3300025942 | Ga0207689_10236575 | Ga0207689_102365752 | 191 |
| 294 | 3300025960 | Ga0207651_10984408 | Ga0207651_109844081 | 191 |
| 295 | 3300025961 | Ga0207712_10685475 | Ga0207712_106854752 | 191 |
| 296 | 3300025972 | Ga0207668_10025031 | Ga0207668_100250312 | 191 |
| 297 | 3300025972 | Ga0207668_10257439 | Ga0207668_102574391 | 191 |
| 298 | 3300026035 | Ga0207703_10008946 | Ga0207703_100089462 | 191 |
| 299 | 3300026067 | Ga0207678_10056658 | Ga0207678_100566583 | 191 |
| 300 | 3300026118 | Ga0207675_100043624 | Ga0207675_1000436243 | 191 |
| 301 | 3300026118 | Ga0207675_100314621 | Ga0207675_1003146212 | 191 |
| 302 | 3300028379 | Ga0268266_10004625 | Ga0268266_100046257 | 191 |
| 303 | 3300028379 | Ga0268266_10028531 | Ga0268266_100285314 | 191 |
| 304 | 3300028379 | Ga0268266_10865929 | Ga0268266_108659291 | 191 |
| 305 | 3300028380 | Ga0268265_10220075 | Ga0268265_102200751 | 191 |
| 306 | 3300028381 | Ga0268264_10279821 | Ga0268264_102798212 | 191 |
| 307 | 3300028381 | Ga0268264_10769378 | Ga0268264_107693782 | 191 |
| 308 | 3300031852 | Ga0307410_10653654 | Ga0307410_106536541 | 191 |
| 309 | 3300032002 | Ga0307416_101000481 | Ga0307416_1010004811 | 191 |
| 310 | 3300032005 | Ga0307411_11102927 | Ga0307411_111029271 | 191 |
| 311 | 3300032126 | Ga0307415_100759077 | Ga0307415_1007590772 | 191 |
| 312 | 3300035113 | Ga0373936_0092131 | Ga0373936_0092131_210_797 | 191 |
| 313 | 3300035691 | Ga0373931_0402821 | Ga0373931_0402821_219_842 | 191 |
| 314 | 3300037068 | Ga0373925_0744496 | Ga0373925_0744496_100_687 | 191 |
| 315 | 3300046455 | Ga0495603_0056689 | Ga0495603_0056689_1234_1821 | 191 |
| 316 | 3300046455 | Ga0495603_0057399 | Ga0495603_0057399_849_1436 | 191 |
| 317 | 3300046459 | Ga0495629_0121691 | Ga0495629_0121691_869_1456 | 191 |
| 318 | 3300046460 | Ga0495638_0040049 | Ga0495638_0040049_1633_2220 | 191 |
| 319 | 3300046492 | Ga0495585_0048246 | Ga0495585_0048246_1386_1973 | 191 |
| 320 | 3300046512 | Ga0495610_0087255 | Ga0495610_0087255_651_1238 | 191 |
| 321 | 3300046515 | Ga0495620_0106144 | Ga0495620_0106144_150_737 | 191 |
| 322 | 3300046519 | Ga0495632_0078302 | Ga0495632_0078302_404_991 | 191 |
| 323 | 3300046519 | Ga0495632_0111294 | Ga0495632_0111294_564_1151 | 191 |
| 324 | 3300046523 | Ga0495644_0134612 | Ga0495644_0134612_255_842 | 191 |
| 325 | 3300046524 | Ga0495648_0167164 | Ga0495648_0167164_374_961 | 191 |
| 326 | 3300046525 | Ga0495663_0094872 | Ga0495663_0094872_279_866 | 191 |
| 327 | 3300046526 | Ga0495666_0116339 | Ga0495666_0116339_606_1193 | 191 |
| 328 | 3300046537 | Ga0495598_0088230 | Ga0495598_0088230_269_856 | 191 |
| 329 | 3300046539 | Ga0495621_0106772 | Ga0495621_0106772_57_644 | 191 |
| 330 | 3300046615 | Ga0495656_0035741 | Ga0495656_0035741_375_962 | 191 |
| 331 | 3300046615 | Ga0495656_0161462 | Ga0495656_0161462_122_709 | 191 |
| 332 | 3300046648 | Ga0495611_0176422 | Ga0495611_0176422_83_670 | 191 |
| 333 | 3300046660 | Ga0495625_0177779 | Ga0495625_0177779_604_1191 | 191 |
| 334 | 3300046660 | Ga0495625_0503512 | Ga0495625_0503512_133_720 | 191 |
| 335 | 3300046663 | Ga0495635_0105746 | Ga0495635_0105746_96_683 | 191 |
| 336 | 3300046664 | Ga0495659_0050049 | Ga0495659_0050049_840_1427 | 191 |
| 337 | 3300046665 | Ga0495661_0169881 | Ga0495661_0169881_518_1105 | 191 |
| 338 | 3300046681 | Ga0495647_0036932 | Ga0495647_0036932_644_1231 | 191 |
| 339 | 3300046691 | Ga0495670_0013237 | Ga0495670_0013237_2791_3378 | 191 |
| 340 | 3300046694 | Ga0495649_0277895 | Ga0495649_0277895_247_834 | 191 |
| 341 | 3300047318 | Ga0495636_0026545 | Ga0495636_0026545_423_1010 | 191 |
| 342 | 3300047447 | Ga0495685_096831 | Ga0495685_096831_15_602 | 191 |
| 343 | 3300048907 | Ga0496104_0367667 | Ga0496104_0367667_272_859 | 191 |
| 344 | 3300048910 | Ga0496107_0441785 | Ga0496107_0441785_370_957 | 191 |
| 345 | 3300048913 | Ga0496110_0231374 | Ga0496110_0231374_897_1484 | 191 |
| 346 | 3300048918 | Ga0496115_0187663 | Ga0496115_0187663_996_1598 | 191 |
| 347 | 3300048924 | Ga0496121_0150220 | Ga0496121_0150220_978_1565 | 191 |
| 348 | 3300048924 | Ga0496121_0201088 | Ga0496121_0201088_811_1398 | 191 |
| 349 | 3300048924 | Ga0496121_0261538 | Ga0496121_0261538_568_1155 | 191 |
| 350 | 3300048924 | Ga0496121_0521610 | Ga0496121_0521610_11_598 | 191 |
| 351 | 3300048927 | Ga0496124_0150105 | Ga0496124_0150105_825_1412 | 191 |
| 352 | 3300048929 | Ga0496126_0007417 | Ga0496126_0007417_61_648 | 191 |
| 353 | 3300048929 | Ga0496126_0534638 | Ga0496126_0534638_321_908 | 191 |
| 354 | 3300050492 | nmdc:mga0yw44_239384_c1 | nmdc:mga0yw44_239384_c1_118_705 | 191 |
| 355 | 3300050493 | nmdc:mga0k408_459212_c1 | nmdc:mga0k408_459212_c1_129_716 | 191 |
| 356 | 3300053087 | Ga0500643_068097 | Ga0500643_068097_203_790 | 191 |
| 357 | 3300053090 | Ga0500646_0031443 | Ga0500646_0031443_595_1182 | 191 |
| 358 | 3300053092 | Ga0500583_0085791 | Ga0500583_0085791_533_1120 | 191 |
| 359 | 3300053092 | Ga0500583_0102302 | Ga0500583_0102302_108_695 | 191 |
| 360 | 3300053119 | Ga0500595_001169 | Ga0500595_001169_3052_3639 | 191 |
| 361 | 3300053133 | Ga0500655_011673 | Ga0500655_011673_988_1575 | 191 |
| 362 | iso_pu_bacteria | 2773857925 | 2774868500 | 191 |
| 363 | iso_pu_bacteria | 2876808645 | 2876813191 | 191 |
| 364 | iso_pu_bacteria | 2879110137 | 2879110355 | 191 |
| 365 | iso_pu_bacteria | 2882456835 | 2882460511 | 191 |
| 366 | iso_pu_bacteria | 2922386360 | 2922392233 | 191 |
| 367 | iso_pu_bacteria | 8006984368 | 8006990550 | 191 |
| 368 | 3300005330 | Ga0070690_100375674 | Ga0070690_1003756742 | 192 |
| 369 | 3300005334 | Ga0068869_100023059 | Ga0068869_1000230595 | 192 |
| 370 | 3300005338 | Ga0068868_100053941 | Ga0068868_1000539412 | 192 |
| 371 | 3300005345 | Ga0070692_10083630 | Ga0070692_100836301 | 192 |
| 372 | 3300005355 | Ga0070671_101024128 | Ga0070671_1010241281 | 192 |
| 373 | 3300005437 | Ga0070710_10010865 | Ga0070710_100108653 | 192 |
| 374 | 3300005439 | Ga0070711_100140869 | Ga0070711_1001408692 | 192 |
| 375 | 3300005455 | Ga0070663_100020947 | Ga0070663_1000209472 | 192 |
| 376 | 3300005456 | Ga0070678_100051447 | Ga0070678_1000514474 | 192 |
| 377 | 3300005467 | Ga0070706_100409282 | Ga0070706_1004092821 | 192 |
| 378 | 3300005547 | Ga0070693_100193224 | Ga0070693_1001932242 | 192 |
| 379 | 3300005548 | Ga0070665_100015770 | Ga0070665_1000157707 | 192 |
| 380 | 3300005548 | Ga0070665_100031231 | Ga0070665_1000312318 | 192 |
| 381 | 3300005563 | Ga0068855_100065612 | Ga0068855_1000656124 | 192 |
| 382 | 3300005564 | Ga0070664_100234239 | Ga0070664_1002342392 | 192 |
| 383 | 3300005614 | Ga0068856_100059691 | Ga0068856_1000596913 | 192 |
| 384 | 3300005616 | Ga0068852_100191180 | Ga0068852_1001911802 | 192 |
| 385 | 3300005834 | Ga0068851_10244094 | Ga0068851_102440942 | 192 |
| 386 | 3300005937 | Ga0081455_10006075 | Ga0081455_100060754 | 192 |
| 387 | 3300005937 | Ga0081455_10034040 | Ga0081455_100340402 | 192 |
| 388 | 3300005983 | Ga0081540_1005549 | Ga0081540_10055492 | 192 |
| 389 | 3300005983 | Ga0081540_1008834 | Ga0081540_10088347 | 192 |
| 390 | 3300005983 | Ga0081540_1059689 | Ga0081540_10596892 | 192 |
| 391 | 3300006038 | Ga0075365_10049225 | Ga0075365_100492253 | 192 |
| 392 | 3300006038 | Ga0075365_10063140 | Ga0075365_100631403 | 192 |
| 393 | 3300006042 | Ga0075368_10062213 | Ga0075368_100622132 | 192 |
| 394 | 3300006048 | Ga0075363_100002157 | Ga0075363_1000021572 | 192 |
| 395 | 3300006048 | Ga0075363_100038988 | Ga0075363_1000389882 | 192 |
| 396 | 3300006051 | Ga0075364_10176770 | Ga0075364_101767702 | 192 |
| 397 | 3300006051 | Ga0075364_10281845 | Ga0075364_102818451 | 192 |
| 398 | 3300006058 | Ga0075432_10050851 | Ga0075432_100508511 | 192 |
| 399 | 3300006175 | Ga0070712_100012714 | Ga0070712_1000127142 | 192 |
| 400 | 3300006177 | Ga0075362_10059913 | Ga0075362_100599132 | 192 |
| 401 | 3300006186 | Ga0075369_10009009 | Ga0075369_100090093 | 192 |
| 402 | 3300006195 | Ga0075366_10095588 | Ga0075366_100955882 | 192 |
| 403 | 3300006237 | Ga0097621_100451891 | Ga0097621_1004518912 | 192 |
| 404 | 3300006353 | Ga0075370_10405111 | Ga0075370_104051111 | 192 |
| 405 | 3300006844 | Ga0075428_100093645 | Ga0075428_1000936452 | 192 |
| 406 | 3300009093 | Ga0105240_11715710 | Ga0105240_117157101 | 192 |
| 407 | 3300009147 | Ga0114129_10141666 | Ga0114129_101416663 | 192 |
| 408 | 3300009174 | Ga0105241_10344256 | Ga0105241_103442562 | 192 |
| 409 | 3300009545 | Ga0105237_10338448 | Ga0105237_103384482 | 192 |
| 410 | 3300011119 | Ga0105246_10030840 | Ga0105246_100308402 | 192 |
| 411 | 3300013100 | Ga0157373_10619101 | Ga0157373_106191011 | 192 |
| 412 | 3300013104 | Ga0157370_10014874 | Ga0157370_100148749 | 192 |
| 413 | 3300014325 | Ga0163163_10096909 | Ga0163163_100969093 | 192 |
| 414 | 3300014325 | Ga0163163_10176164 | Ga0163163_101761642 | 192 |
| 415 | 3300025297 | Ga0209758_1016560 | Ga0209758_10165602 | 192 |
| 416 | 3300025915 | Ga0207693_10003911 | Ga0207693_100039113 | 192 |
| 417 | 3300025916 | Ga0207663_10160475 | Ga0207663_101604752 | 192 |
| 418 | 3300025920 | Ga0207649_10274574 | Ga0207649_102745742 | 192 |
| 419 | 3300025924 | Ga0207694_10166927 | Ga0207694_101669272 | 192 |
| 420 | 3300025931 | Ga0207644_10668146 | Ga0207644_106681462 | 192 |
| 421 | 3300025942 | Ga0207689_10013204 | Ga0207689_100132049 | 192 |
| 422 | 3300025945 | Ga0207679_10043430 | Ga0207679_100434302 | 192 |
| 423 | 3300025949 | Ga0207667_10106805 | Ga0207667_101068052 | 192 |
| 424 | 3300025972 | Ga0207668_10102696 | Ga0207668_101026962 | 192 |
| 425 | 3300026035 | Ga0207703_10283672 | Ga0207703_102836722 | 192 |
| 426 | 3300026067 | Ga0207678_10021975 | Ga0207678_100219752 | 192 |
| 427 | 3300026067 | Ga0207678_10751888 | Ga0207678_107518882 | 192 |
| 428 | 3300026078 | Ga0207702_10044708 | Ga0207702_100447083 | 192 |
| 429 | 3300026088 | Ga0207641_10235182 | Ga0207641_102351822 | 192 |
| 430 | 3300026095 | Ga0207676_10304493 | Ga0207676_103044932 | 192 |
| 431 | 3300026116 | Ga0207674_10401253 | Ga0207674_104012532 | 192 |
| 432 | 3300026121 | Ga0207683_10794664 | Ga0207683_107946642 | 192 |
| 433 | 3300028379 | Ga0268266_10002460 | Ga0268266_1000246024 | 192 |
| 434 | 3300028379 | Ga0268266_10426394 | Ga0268266_104263942 | 192 |
| 435 | 3300028380 | Ga0268265_10078341 | Ga0268265_100783412 | 192 |
| 436 | 3300028794 | Ga0307515_10458819 | Ga0307515_104588192 | 192 |
| 437 | 3300031665 | Ga0316575_10068149 | Ga0316575_100681492 | 192 |
| 438 | 3300031824 | Ga0307413_10438084 | Ga0307413_104380842 | 192 |
| 439 | 3300032133 | Ga0316583_10060620 | Ga0316583_100606202 | 192 |
| 440 | 3300033180 | Ga0307510_10000998 | Ga0307510_1000099824 | 192 |
| 441 | 3300035121 | Ga0373960_0097727 | Ga0373960_0097727_176_766 | 192 |
| 442 | 3300036401 | Ga0373937_1137856 | Ga0373937_1137856_70_657 | 192 |
| 443 | 3300037471 | Ga0395905_0538647 | Ga0395905_0538647_222_866 | 192 |
| 444 | 3300039437 | Ga0436365_0222599 | Ga0436365_0222599_27_629 | 192 |
| 445 | 3300039450 | Ga0436363_0373741 | Ga0436363_0373741_68_700 | 192 |
| 446 | 3300041413 | Ga0439465_0100894 | Ga0439465_0100894_319_909 | 192 |
| 447 | 3300044735 | Ga0466968_0269607 | Ga0466968_0269607_124_723 | 192 |
| 448 | 3300046455 | Ga0495603_0182940 | Ga0495603_0182940_90_680 | 192 |
| 449 | 3300046472 | Ga0495580_0084572 | Ga0495580_0084572_1254_1877 | 192 |
| 450 | 3300046524 | Ga0495648_0285712 | Ga0495648_0285712_57_647 | 192 |
| 451 | 3300046531 | Ga0495665_0145503 | Ga0495665_0145503_58_648 | 192 |
| 452 | 3300046557 | Ga0495622_0144157 | Ga0495622_0144157_442_1050 | 192 |
| 453 | 3300047445 | Ga0495677_0168394 | Ga0495677_0168394_58_648 | 192 |
| 454 | 3300047469 | Ga0495673_0108827 | Ga0495673_0108827_29_619 | 192 |
| 455 | 3300047472 | Ga0495686_0298381 | Ga0495686_0298381_73_663 | 192 |
| 456 | 3300048903 | Ga0496100_0116480 | Ga0496100_0116480_908_1498 | 192 |
| 457 | 3300048905 | Ga0496102_0182708 | Ga0496102_0182708_895_1485 | 192 |
| 458 | 3300048905 | Ga0496102_0686753 | Ga0496102_0686753_37_627 | 192 |
| 459 | 3300048909 | Ga0496106_0050298 | Ga0496106_0050298_1480_2070 | 192 |
| 460 | 3300048910 | Ga0496107_0548652 | Ga0496107_0548652_55_645 | 192 |
| 461 | 3300048911 | Ga0496108_0251862 | Ga0496108_0251862_349_939 | 192 |
| 462 | 3300048917 | Ga0496114_1064643 | Ga0496114_1064643_32_622 | 192 |
| 463 | 3300048918 | Ga0496115_0267824 | Ga0496115_0267824_308_898 | 192 |
| 464 | 3300048924 | Ga0496121_0065288 | Ga0496121_0065288_86_676 | 192 |
| 465 | 3300048925 | Ga0496122_0010630 | Ga0496122_0010630_8596_9201 | 192 |
| 466 | 3300048926 | Ga0496123_0000699 | Ga0496123_0000699_47780_48385 | 192 |
| 467 | 3300048927 | Ga0496124_0190898 | Ga0496124_0190898_77_667 | 192 |
| 468 | 3300049584 | Ga0501068_0375953 | Ga0501068_0375953_101_691 | 192 |
| 469 | 3300049589 | Ga0501073_0001633 | Ga0501073_0001633_9469_10086 | 192 |
| 470 | 3300049744 | Ga0501083_0093812 | Ga0501083_0093812_1372_1971 | 192 |
| 471 | 3300049823 | Ga0501044_0346930 | Ga0501044_0346930_650_1243 | 192 |
| 472 | 3300050489 | nmdc:mga03683_67278_c1 | nmdc:mga03683_67278_c1_69_659 | 192 |
| 473 | 3300050490 | nmdc:mga03n38_473825_c1 | nmdc:mga03n38_473825_c1_27_641 | 192 |
| 474 | 3300050490 | nmdc:mga03n38_57888_c1 | nmdc:mga03n38_57888_c1_675_1265 | 192 |
| 475 | 3300050490 | nmdc:mga03n38_900_c1 | nmdc:mga03n38_900_c1_858_1448 | 192 |
| 476 | 3300050491 | nmdc:mga00v17_216763_c1 | nmdc:mga00v17_216763_c1_173_763 | 192 |
| 477 | 3300050492 | nmdc:mga0yw44_20390_c1 | nmdc:mga0yw44_20390_c1_43_633 | 192 |
| 478 | 3300050492 | nmdc:mga0yw44_2168_c1 | nmdc:mga0yw44_2168_c1_7607_8197 | 192 |
| 479 | 3300050493 | nmdc:mga0k408_110847_c1 | nmdc:mga0k408_110847_c1_531_1121 | 192 |
| 480 | 3300050493 | nmdc:mga0k408_148432_c1 | nmdc:mga0k408_148432_c1_72_662 | 192 |
| 481 | 3300050493 | nmdc:mga0k408_216802_c1 | nmdc:mga0k408_216802_c1_357_947 | 192 |
| 482 | 3300050494 | nmdc:mga06z11_385242_c1 | nmdc:mga06z11_385242_c1_208_798 | 192 |
| 483 | 3300050495 | nmdc:mga04h51_35073_c1 | nmdc:mga04h51_35073_c1_523_1113 | 192 |
| 484 | 3300050507 | nmdc:mga05p37_92337_c1 | nmdc:mga05p37_92337_c1_1207_1797 | 192 |
| 485 | 3300050509 | nmdc:mga0qj67_646987_c1 | nmdc:mga0qj67_646987_c1_240_830 | 192 |
| 486 | 3300050516 | nmdc:mga0sz30_16211_c1 | nmdc:mga0sz30_16211_c1_90_680 | 192 |
| 487 | 3300053078 | Ga0495612_0045685 | Ga0495612_0045685_661_1248 | 192 |
| 488 | 3300053084 | Ga0495595_0247532 | Ga0495595_0247532_15_602 | 192 |
| 489 | 3300053103 | Ga0500555_093027 | Ga0500555_093027_128_718 | 192 |
| 490 | iso_pu_bacteria | 2721755755 | 2723845924 | 192 |
| 491 | iso_pu_bacteria | 2765235802 | 2765465450 | 192 |
| 492 | iso_pu_bacteria | 2767802442 | 2770197687 | 192 |
| 493 | iso_pu_bacteria | 2775506902 | 2776271712 | 192 |
| 494 | iso_pu_bacteria | 2775506904 | 2776279775 | 192 |
| 495 | iso_pu_bacteria | 2839993093 | 2839995691 | 192 |
| 496 | iso_pu_bacteria | 2840764183 | 2840769965 | 192 |
| 497 | iso_pu_bacteria | 2842871566 | 2842872802 | 192 |
| 498 | iso_pu_bacteria | 2874604998 | 2874609423 | 192 |
| 499 | iso_pu_bacteria | 2894652903 | 2894654623 | 192 |
| 500 | iso_pu_bacteria | 2904578770 | 2904581592 | 192 |
| 501 | iso_pu_bacteria | 2919119836 | 2919122826 | 192 |
| 502 | iso_pu_bacteria | 8006994254 | 8006996307 | 192 |
| 503 | 3300002075 | JGI24738J21930_10011716 | JGI24738J21930_100117161 | 193 |
| 504 | 3300002077 | JGI24744J21845_10013759 | JGI24744J21845_100137591 | 193 |
| 505 | 3300003578 | Ga0006562J51391_1072694 | Ga0006562J51391_10726943 | 193 |
| 506 | 3300005295 | Ga0065707_10519568 | Ga0065707_105195681 | 193 |
| 507 | 3300005327 | Ga0070658_10304524 | Ga0070658_103045242 | 193 |
| 508 | 3300005328 | Ga0070676_10048243 | Ga0070676_100482434 | 193 |
| 509 | 3300005329 | Ga0070683_100025517 | Ga0070683_1000255173 | 193 |
| 510 | 3300005330 | Ga0070690_100000533 | Ga0070690_1000005334 | 193 |
| 511 | 3300005331 | Ga0070670_100001563 | Ga0070670_1000015633 | 193 |
| 512 | 3300005334 | Ga0068869_100014062 | Ga0068869_1000140624 | 193 |
| 513 | 3300005335 | Ga0070666_10000893 | Ga0070666_100008932 | 193 |
| 514 | 3300005336 | Ga0070680_100016082 | Ga0070680_1000160822 | 193 |
| 515 | 3300005337 | Ga0070682_100000573 | Ga0070682_10000057322 | 193 |
| 516 | 3300005338 | Ga0068868_100002842 | Ga0068868_10000284211 | 193 |
| 517 | 3300005339 | Ga0070660_100003177 | Ga0070660_1000031774 | 193 |
| 518 | 3300005340 | Ga0070689_100000136 | Ga0070689_10000013613 | 193 |
| 519 | 3300005341 | Ga0070691_10000418 | Ga0070691_100004183 | 193 |
| 520 | 3300005343 | Ga0070687_100002615 | Ga0070687_1000026153 | 193 |
| 521 | 3300005344 | Ga0070661_100002616 | Ga0070661_1000026164 | 193 |
| 522 | 3300005345 | Ga0070692_10002091 | Ga0070692_100020911 | 193 |
| 523 | 3300005347 | Ga0070668_100000188 | Ga0070668_10000018815 | 193 |
| 524 | 3300005353 | Ga0070669_100001556 | Ga0070669_10000155610 | 193 |
| 525 | 3300005354 | Ga0070675_100045291 | Ga0070675_1000452914 | 193 |
| 526 | 3300005355 | Ga0070671_100008445 | Ga0070671_1000084453 | 193 |
| 527 | 3300005356 | Ga0070674_100032220 | Ga0070674_1000322203 | 193 |
| 528 | 3300005364 | Ga0070673_100003390 | Ga0070673_1000033906 | 193 |
| 529 | 3300005365 | Ga0070688_100000981 | Ga0070688_1000009814 | 193 |
| 530 | 3300005366 | Ga0070659_100041455 | Ga0070659_1000414552 | 193 |
| 531 | 3300005367 | Ga0070667_100001681 | Ga0070667_1000016814 | 193 |
| 532 | 3300005434 | Ga0070709_10004792 | Ga0070709_100047923 | 193 |
| 533 | 3300005435 | Ga0070714_100009986 | Ga0070714_1000099865 | 193 |
| 534 | 3300005438 | Ga0070701_10001284 | Ga0070701_100012844 | 193 |
| 535 | 3300005439 | Ga0070711_100000961 | Ga0070711_10000096116 | 193 |
| 536 | 3300005440 | Ga0070705_100009498 | Ga0070705_1000094981 | 193 |
| 537 | 3300005441 | Ga0070700_100004996 | Ga0070700_1000049962 | 193 |
| 538 | 3300005444 | Ga0070694_100000659 | Ga0070694_10000065917 | 193 |
| 539 | 3300005445 | Ga0070708_100541419 | Ga0070708_1005414192 | 193 |
| 540 | 3300005455 | Ga0070663_100001220 | Ga0070663_10000122016 | 193 |
| 541 | 3300005456 | Ga0070678_100000682 | Ga0070678_10000068218 | 193 |
| 542 | 3300005456 | Ga0070678_100684868 | Ga0070678_1006848682 | 193 |
| 543 | 3300005457 | Ga0070662_100000339 | Ga0070662_1000003393 | 193 |
| 544 | 3300005458 | Ga0070681_10024612 | Ga0070681_100246123 | 193 |
| 545 | 3300005459 | Ga0068867_100005776 | Ga0068867_10000577610 | 193 |
| 546 | 3300005466 | Ga0070685_10047091 | Ga0070685_100470911 | 193 |
| 547 | 3300005518 | Ga0070699_100243455 | Ga0070699_1002434552 | 193 |
| 548 | 3300005530 | Ga0070679_100363214 | Ga0070679_1003632142 | 193 |
| 549 | 3300005535 | Ga0070684_100023896 | Ga0070684_1000238962 | 193 |
| 550 | 3300005539 | Ga0068853_100002127 | Ga0068853_10000212713 | 193 |
| 551 | 3300005543 | Ga0070672_100008180 | Ga0070672_1000081804 | 193 |
| 552 | 3300005544 | Ga0070686_100000707 | Ga0070686_1000007073 | 193 |
| 553 | 3300005545 | Ga0070695_100000995 | Ga0070695_1000009953 | 193 |
| 554 | 3300005546 | Ga0070696_100000743 | Ga0070696_1000007434 | 193 |
| 555 | 3300005547 | Ga0070693_100000993 | Ga0070693_10000099310 | 193 |
| 556 | 3300005548 | Ga0070665_100011802 | Ga0070665_1000118022 | 193 |
| 557 | 3300005549 | Ga0070704_100000607 | Ga0070704_10000060714 | 193 |
| 558 | 3300005563 | Ga0068855_100003471 | Ga0068855_10000347116 | 193 |
| 559 | 3300005564 | Ga0070664_100044843 | Ga0070664_1000448433 | 193 |
| 560 | 3300005578 | Ga0068854_100005622 | Ga0068854_1000056224 | 193 |
| 561 | 3300005614 | Ga0068856_100004777 | Ga0068856_1000047777 | 193 |
| 562 | 3300005615 | Ga0070702_100000022 | Ga0070702_10000002224 | 193 |
| 563 | 3300005616 | Ga0068852_100006412 | Ga0068852_1000064124 | 193 |
| 564 | 3300005617 | Ga0068859_100043181 | Ga0068859_1000431814 | 193 |
| 565 | 3300005618 | Ga0068864_100004252 | Ga0068864_1000042523 | 193 |
| 566 | 3300005718 | Ga0068866_10010382 | Ga0068866_100103824 | 193 |
| 567 | 3300005719 | Ga0068861_100001574 | Ga0068861_1000015748 | 193 |
| 568 | 3300005834 | Ga0068851_10012493 | Ga0068851_100124934 | 193 |
| 569 | 3300005841 | Ga0068863_100001307 | Ga0068863_10000130722 | 193 |
| 570 | 3300005842 | Ga0068858_100001450 | Ga0068858_10000145016 | 193 |
| 571 | 3300005843 | Ga0068860_100067009 | Ga0068860_1000670094 | 193 |
| 572 | 3300005983 | Ga0081540_1007633 | Ga0081540_10076334 | 193 |
| 573 | 3300006051 | Ga0075364_10362623 | Ga0075364_103626232 | 193 |
| 574 | 3300006058 | Ga0075432_10009083 | Ga0075432_100090832 | 193 |
| 575 | 3300006163 | Ga0070715_10001884 | Ga0070715_100018844 | 193 |
| 576 | 3300006173 | Ga0070716_100001144 | Ga0070716_1000011444 | 193 |
| 577 | 3300006175 | Ga0070712_100006971 | Ga0070712_1000069714 | 193 |
| 578 | 3300006237 | Ga0097621_100130845 | Ga0097621_1001308453 | 193 |
| 579 | 3300006358 | Ga0068871_100116665 | Ga0068871_1001166652 | 193 |
| 580 | 3300006844 | Ga0075428_100697545 | Ga0075428_1006975452 | 193 |
| 581 | 3300006847 | Ga0075431_100025139 | Ga0075431_1000251393 | 193 |
| 582 | 3300006852 | Ga0075433_10156830 | Ga0075433_101568302 | 193 |
| 583 | 3300006871 | Ga0075434_100103418 | Ga0075434_1001034183 | 193 |
| 584 | 3300006880 | Ga0075429_100178387 | Ga0075429_1001783874 | 193 |
| 585 | 3300006914 | Ga0075436_100027016 | Ga0075436_1000270164 | 193 |
| 586 | 3300006931 | Ga0097620_100043182 | Ga0097620_1000431824 | 193 |
| 587 | 3300007076 | Ga0075435_100020401 | Ga0075435_1000204014 | 193 |
| 588 | 3300009092 | Ga0105250_10026850 | Ga0105250_100268503 | 193 |
| 589 | 3300009093 | Ga0105240_10031786 | Ga0105240_100317862 | 193 |
| 590 | 3300009094 | Ga0111539_10391019 | Ga0111539_103910192 | 193 |
| 591 | 3300009098 | Ga0105245_10002367 | Ga0105245_100023676 | 193 |
| 592 | 3300009101 | Ga0105247_10001141 | Ga0105247_100011417 | 193 |
| 593 | 3300009148 | Ga0105243_10000417 | Ga0105243_1000041731 | 193 |
| 594 | 3300009174 | Ga0105241_10000456 | Ga0105241_1000045611 | 193 |
| 595 | 3300009176 | Ga0105242_10002247 | Ga0105242_1000224712 | 193 |
| 596 | 3300009177 | Ga0105248_10000293 | Ga0105248_1000029317 | 193 |
| 597 | 3300009545 | Ga0105237_10000712 | Ga0105237_1000071212 | 193 |
| 598 | 3300009551 | Ga0105238_10008146 | Ga0105238_100081465 | 193 |
| 599 | 3300009553 | Ga0105249_10049172 | Ga0105249_100491724 | 193 |
| 600 | 3300010375 | Ga0105239_10024373 | Ga0105239_100243734 | 193 |
| 601 | 3300011119 | Ga0105246_10000118 | Ga0105246_1000011821 | 193 |
| 602 | 3300013102 | Ga0157371_10005561 | Ga0157371_100055612 | 193 |
| 603 | 3300013105 | Ga0157369_10034660 | Ga0157369_100346604 | 193 |
| 604 | 3300013296 | Ga0157374_10004169 | Ga0157374_100041693 | 193 |
| 605 | 3300013297 | Ga0157378_10000643 | Ga0157378_1000064325 | 193 |
| 606 | 3300013306 | Ga0163162_10009748 | Ga0163162_100097486 | 193 |
| 607 | 3300013307 | Ga0157372_10001248 | Ga0157372_1000124823 | 193 |
| 608 | 3300013308 | Ga0157375_10124184 | Ga0157375_101241841 | 193 |
| 609 | 3300014325 | Ga0163163_10005028 | Ga0163163_100050285 | 193 |
| 610 | 3300014325 | Ga0163163_10471930 | Ga0163163_104719302 | 193 |
| 611 | 3300014326 | Ga0157380_10001138 | Ga0157380_1000113822 | 193 |
| 612 | 3300014745 | Ga0157377_10000982 | Ga0157377_100009829 | 193 |
| 613 | 3300014968 | Ga0157379_10000933 | Ga0157379_1000093321 | 193 |
| 614 | 3300014969 | Ga0157376_10001069 | Ga0157376_100010695 | 193 |
| 615 | 3300014969 | Ga0157376_10714668 | Ga0157376_107146682 | 193 |
| 616 | 3300025253 | Ga0209677_100646 | Ga0209677_10064611 | 193 |
| 617 | 3300025315 | Ga0207697_10012377 | Ga0207697_100123774 | 193 |
| 618 | 3300025321 | Ga0207656_10063337 | Ga0207656_100633372 | 193 |
| 619 | 3300025901 | Ga0207688_10000764 | Ga0207688_100007642 | 193 |
| 620 | 3300025903 | Ga0207680_10240928 | Ga0207680_102409282 | 193 |
| 621 | 3300025904 | Ga0207647_10001565 | Ga0207647_1000156519 | 193 |
| 622 | 3300025906 | Ga0207699_10029787 | Ga0207699_100297873 | 193 |
| 623 | 3300025907 | Ga0207645_10035619 | Ga0207645_100356194 | 193 |
| 624 | 3300025909 | Ga0207705_10396043 | Ga0207705_103960432 | 193 |
| 625 | 3300025911 | Ga0207654_10053975 | Ga0207654_100539752 | 193 |
| 626 | 3300025912 | Ga0207707_10051812 | Ga0207707_100518123 | 193 |
| 627 | 3300025915 | Ga0207693_10000703 | Ga0207693_1000070312 | 193 |
| 628 | 3300025916 | Ga0207663_10001248 | Ga0207663_1000124811 | 193 |
| 629 | 3300025917 | Ga0207660_10028108 | Ga0207660_100281083 | 193 |
| 630 | 3300025918 | Ga0207662_10002213 | Ga0207662_100022133 | 193 |
| 631 | 3300025919 | Ga0207657_10000304 | Ga0207657_1000030439 | 193 |
| 632 | 3300025920 | Ga0207649_10002403 | Ga0207649_100024034 | 193 |
| 633 | 3300025921 | Ga0207652_10043155 | Ga0207652_100431552 | 193 |
| 634 | 3300025923 | Ga0207681_10044828 | Ga0207681_100448281 | 193 |
| 635 | 3300025924 | Ga0207694_10009066 | Ga0207694_100090664 | 193 |
| 636 | 3300025925 | Ga0207650_10069957 | Ga0207650_100699572 | 193 |
| 637 | 3300025927 | Ga0207687_10001882 | Ga0207687_1000188214 | 193 |
| 638 | 3300025929 | Ga0207664_10232042 | Ga0207664_102320421 | 193 |
| 639 | 3300025931 | Ga0207644_10001431 | Ga0207644_1000143115 | 193 |
| 640 | 3300025932 | Ga0207690_10003254 | Ga0207690_100032544 | 193 |
| 641 | 3300025933 | Ga0207706_10000263 | Ga0207706_1000026338 | 193 |
| 642 | 3300025934 | Ga0207686_10027400 | Ga0207686_100274004 | 193 |
| 643 | 3300025935 | Ga0207709_10004092 | Ga0207709_100040924 | 193 |
| 644 | 3300025936 | Ga0207670_10004344 | Ga0207670_100043444 | 193 |
| 645 | 3300025937 | Ga0207669_10001156 | Ga0207669_100011566 | 193 |
| 646 | 3300025939 | Ga0207665_10000219 | Ga0207665_1000021910 | 193 |
| 647 | 3300025940 | Ga0207691_10002753 | Ga0207691_1000275314 | 193 |
| 648 | 3300025941 | Ga0207711_10008692 | Ga0207711_100086924 | 193 |
| 649 | 3300025942 | Ga0207689_10010207 | Ga0207689_100102074 | 193 |
| 650 | 3300025944 | Ga0207661_10027285 | Ga0207661_100272854 | 193 |
| 651 | 3300025960 | Ga0207651_10000820 | Ga0207651_1000082011 | 193 |
| 652 | 3300025961 | Ga0207712_10013354 | Ga0207712_100133544 | 193 |
| 653 | 3300025972 | Ga0207668_10047738 | Ga0207668_100477383 | 193 |
| 654 | 3300025981 | Ga0207640_10039179 | Ga0207640_100391794 | 193 |
| 655 | 3300025986 | Ga0207658_10037471 | Ga0207658_100374713 | 193 |
| 656 | 3300026035 | Ga0207703_10005045 | Ga0207703_100050453 | 193 |
| 657 | 3300026041 | Ga0207639_10051164 | Ga0207639_100511643 | 193 |
| 658 | 3300026067 | Ga0207678_10000209 | Ga0207678_1000020917 | 193 |
| 659 | 3300026075 | Ga0207708_10000953 | Ga0207708_1000095321 | 193 |
| 660 | 3300026078 | Ga0207702_10007071 | Ga0207702_100070718 | 193 |
| 661 | 3300026088 | Ga0207641_10007322 | Ga0207641_100073223 | 193 |
| 662 | 3300026089 | Ga0207648_10013547 | Ga0207648_100135477 | 193 |
| 663 | 3300026095 | Ga0207676_10081013 | Ga0207676_100810133 | 193 |
| 664 | 3300026116 | Ga0207674_10000719 | Ga0207674_1000071924 | 193 |
| 665 | 3300026118 | Ga0207675_100001925 | Ga0207675_10000192524 | 193 |
| 666 | 3300027907 | Ga0207428_10029008 | Ga0207428_100290082 | 193 |
| 667 | 3300028380 | Ga0268265_10033810 | Ga0268265_100338103 | 193 |
| 668 | 3300031247 | Ga0265340_10023714 | Ga0265340_100237143 | 193 |
| 669 | 3300031711 | Ga0265314_10009907 | Ga0265314_100099073 | 193 |
| 670 | 3300031727 | Ga0316576_10009892 | Ga0316576_100098922 | 193 |
| 671 | 3300034817 | Ga0373948_0024827 | Ga0373948_0024827_317_931 | 193 |
| 672 | 3300035116 | Ga0373945_0138105 | Ga0373945_0138105_53_670 | 193 |
| 673 | 3300035171 | Ga0373946_0058208 | Ga0373946_0058208_631_1245 | 193 |
| 674 | 3300035691 | Ga0373931_0007352 | Ga0373931_0007352_2268_2882 | 193 |
| 675 | 3300035691 | Ga0373931_0163090 | Ga0373931_0163090_52_690 | 193 |
| 676 | 3300035692 | Ga0373935_0361731 | Ga0373935_0361731_281_898 | 193 |
| 677 | 3300035695 | Ga0373927_0041206 | Ga0373927_0041206_512_1126 | 193 |
| 678 | 3300035725 | Ga0373947_0001465 | Ga0373947_0001465_390_1004 | 193 |
| 679 | 3300036647 | Ga0316582_0311503 | Ga0316582_0311503_315_923 | 193 |
| 680 | 3300036712 | Ga0316584_0013488 | Ga0316584_0013488_584_1192 | 193 |
| 681 | 3300037068 | Ga0373925_0475603 | Ga0373925_0475603_237_851 | 193 |
| 682 | 3300037418 | Ga0395900_0018616 | Ga0395900_0018616_4786_5400 | 193 |
| 683 | 3300037466 | Ga0395898_0051498 | Ga0395898_0051498_101_715 | 193 |
| 684 | 3300037471 | Ga0395905_0002720 | Ga0395905_0002720_2382_2996 | 193 |
| 685 | 3300037471 | Ga0395905_0930992 | Ga0395905_0930992_107_724 | 193 |
| 686 | 3300037853 | Ga0436364_1400093 | Ga0436364_1400093_429_1016 | 193 |
| 687 | 3300038443 | Ga0395901_0126562 | Ga0395901_0126562_1197_1811 | 193 |
| 688 | 3300042876 | Ga0451577_0320187 | Ga0451577_0320187_159_776 | 193 |
| 689 | 3300044712 | Ga0453684_0083097 | Ga0453684_0083097_1032_1649 | 193 |
| 690 | 3300045051 | Ga0451576_0056877 | Ga0451576_0056877_1972_2586 | 193 |
| 691 | 3300046455 | Ga0495603_0007479 | Ga0495603_0007479_1268_1882 | 193 |
| 692 | 3300046459 | Ga0495629_0003853 | Ga0495629_0003853_687_1301 | 193 |
| 693 | 3300046461 | Ga0495641_0011539 | Ga0495641_0011539_1321_1935 | 193 |
| 694 | 3300046472 | Ga0495580_0000835 | Ga0495580_0000835_16203_16817 | 193 |
| 695 | 3300046473 | Ga0495582_0007761 | Ga0495582_0007761_1165_1779 | 193 |
| 696 | 3300046475 | Ga0495639_0032725 | Ga0495639_0032725_518_1132 | 193 |
| 697 | 3300046476 | Ga0495662_0129337 | Ga0495662_0129337_448_1074 | 193 |
| 698 | 3300046499 | Ga0495594_0035972 | Ga0495594_0035972_763_1377 | 193 |
| 699 | 3300046531 | Ga0495665_0075432 | Ga0495665_0075432_955_1569 | 193 |
| 700 | 3300046533 | Ga0495640_0311774 | Ga0495640_0311774_248_865 | 193 |
| 701 | 3300046535 | Ga0495586_0077699 | Ga0495586_0077699_193_819 | 193 |
| 702 | 3300046557 | Ga0495622_0000576 | Ga0495622_0000576_6334_6948 | 193 |
| 703 | 3300046642 | Ga0495634_0050997 | Ga0495634_0050997_1648_2262 | 193 |
| 704 | 3300046663 | Ga0495635_0037535 | Ga0495635_0037535_1754_2368 | 193 |
| 705 | 3300046674 | Ga0495588_0013011 | Ga0495588_0013011_1159_1773 | 193 |
| 706 | 3300046681 | Ga0495647_0001850 | Ga0495647_0001850_155_769 | 193 |
| 707 | 3300046683 | Ga0495658_0014876 | Ga0495658_0014876_985_1599 | 193 |
| 708 | 3300046689 | Ga0495613_0001504 | Ga0495613_0001504_16384_16998 | 193 |
| 709 | 3300047315 | Ga0495581_0007632 | Ga0495581_0007632_891_1505 | 193 |
| 710 | 3300047319 | Ga0495674_0140303 | Ga0495674_0140303_569_1195 | 193 |
| 711 | 3300047321 | Ga0495676_0043807 | Ga0495676_0043807_2646_3260 | 193 |
| 712 | 3300047673 | Ga0495593_0002967 | Ga0495593_0002967_751_1365 | 193 |
| 713 | 3300048903 | Ga0496100_0018933 | Ga0496100_0018933_2412_3026 | 193 |
| 714 | 3300048903 | Ga0496100_0459083 | Ga0496100_0459083_11_625 | 193 |
| 715 | 3300048904 | Ga0496101_0007889 | Ga0496101_0007889_2748_3362 | 193 |
| 716 | 3300048905 | Ga0496102_0434974 | Ga0496102_0434974_469_1083 | 193 |
| 717 | 3300048910 | Ga0496107_0010054 | Ga0496107_0010054_4878_5492 | 193 |
| 718 | 3300048912 | Ga0496109_0018777 | Ga0496109_0018777_5127_5741 | 193 |
| 719 | 3300048914 | Ga0496111_0333231 | Ga0496111_0333231_41_655 | 193 |
| 720 | 3300048915 | Ga0496112_0055656 | Ga0496112_0055656_2333_2947 | 193 |
| 721 | 3300048917 | Ga0496114_0126945 | Ga0496114_0126945_149_763 | 193 |
| 722 | 3300048918 | Ga0496115_0005793 | Ga0496115_0005793_469_1083 | 193 |
| 723 | 3300048919 | Ga0496116_0182617 | Ga0496116_0182617_256_852 | 193 |
| 724 | 3300048921 | Ga0496118_0021970 | Ga0496118_0021970_2620_3216 | 193 |
| 725 | 3300048922 | Ga0496119_0046748 | Ga0496119_0046748_1998_2594 | 193 |
| 726 | 3300048924 | Ga0496121_0484065 | Ga0496121_0484065_94_690 | 193 |
| 727 | 3300048929 | Ga0496126_0402706 | Ga0496126_0402706_395_997 | 193 |
| 728 | 3300050508 | nmdc:mga09592_143025_c1 | nmdc:mga09592_143025_c1_1357_1971 | 193 |
| 729 | 3300050509 | nmdc:mga0qj67_552735_c1 | nmdc:mga0qj67_552735_c1_268_882 | 193 |
| 730 | 3300050510 | nmdc:mga06r32_427368_c1 | nmdc:mga06r32_427368_c1_551_1165 | 193 |
| 731 | 3300050511 | nmdc:mga08y16_67671_c1 | nmdc:mga08y16_67671_c1_1437_2051 | 193 |
| 732 | 3300050513 | nmdc:mga0rr50_85712_c1 | nmdc:mga0rr50_85712_c1_1086_1700 | 193 |
| 733 | 3300050514 | nmdc:mga08x19_50158_c1 | nmdc:mga08x19_50158_c1_625_1239 | 193 |
| 734 | 3300050515 | nmdc:mga0a205_293311_c1 | nmdc:mga0a205_293311_c1_337_951 | 193 |
| 735 | 3300053084 | Ga0495595_0108490 | Ga0495595_0108490_28_645 | 193 |
| 736 | 3300053085 | Ga0495619_0002808 | Ga0495619_0002808_9728_10345 | 193 |
| 737 | 3300053088 | Ga0500644_0002004 | Ga0500644_0002004_2265_2849 | 193 |
| 738 | 3300053094 | Ga0500566_0175753 | Ga0500566_0175753_103_717 | 193 |
| 739 | 3300053119 | Ga0500595_008303 | Ga0500595_008303_2946_3530 | 193 |
| 740 | 3300053153 | Ga0500616_0169368 | Ga0500616_0169368_98_682 | 193 |
| 741 | iso_pu_bacteria | 2643221547 | 2643756579 | 193 |
| 742 | iso_pu_bacteria | 2828305725 | 2828305786 | 193 |
| 743 | iso_pu_bacteria | 8056689827 | 8056695786 | 193 |
| 744 | 3300005365 | Ga0070688_100141008 | Ga0070688_1001410081 | 194 |
| 745 | 3300005434 | Ga0070709_10029345 | Ga0070709_100293453 | 194 |
| 746 | 3300005435 | Ga0070714_100009596 | Ga0070714_1000095963 | 194 |
| 747 | 3300005436 | Ga0070713_100010983 | Ga0070713_1000109834 | 194 |
| 748 | 3300005437 | Ga0070710_10024828 | Ga0070710_100248283 | 194 |
| 749 | 3300005459 | Ga0068867_100119450 | Ga0068867_1001194502 | 194 |
| 750 | 3300005518 | Ga0070699_100003740 | Ga0070699_1000037401 | 194 |
| 751 | 3300005546 | Ga0070696_100551444 | Ga0070696_1005514441 | 194 |
| 752 | 3300005548 | Ga0070665_100223967 | Ga0070665_1002239672 | 194 |
| 753 | 3300006173 | Ga0070716_100003890 | Ga0070716_1000038909 | 194 |
| 754 | 3300006852 | Ga0075433_10464983 | Ga0075433_104649832 | 194 |
| 755 | 3300006871 | Ga0075434_100465532 | Ga0075434_1004655322 | 194 |
| 756 | 3300009094 | Ga0111539_11144462 | Ga0111539_111444621 | 194 |
| 757 | 3300009101 | Ga0105247_10028441 | Ga0105247_100284414 | 194 |
| 758 | 3300009176 | Ga0105242_10816779 | Ga0105242_108167792 | 194 |
| 759 | 3300009177 | Ga0105248_10064060 | Ga0105248_100640605 | 194 |
| 760 | 3300009551 | Ga0105238_10757331 | Ga0105238_107573312 | 194 |
| 761 | 3300012515 | Ga0157338_1011623 | Ga0157338_10116231 | 194 |
| 762 | 3300013297 | Ga0157378_10369456 | Ga0157378_103694562 | 194 |
| 763 | 3300013308 | Ga0157375_10002635 | Ga0157375_1000263520 | 194 |
| 764 | 3300014326 | Ga0157380_10492797 | Ga0157380_104927971 | 194 |
| 765 | 3300014968 | Ga0157379_10173780 | Ga0157379_101737802 | 194 |
| 766 | 3300014969 | Ga0157376_10067815 | Ga0157376_100678156 | 194 |
| 767 | 3300025900 | Ga0207710_10011822 | Ga0207710_100118224 | 194 |
| 768 | 3300025905 | Ga0207685_10008128 | Ga0207685_100081283 | 194 |
| 769 | 3300025924 | Ga0207694_10517013 | Ga0207694_105170132 | 194 |
| 770 | 3300025928 | Ga0207700_10456861 | Ga0207700_104568612 | 194 |
| 771 | 3300025929 | Ga0207664_10259026 | Ga0207664_102590263 | 194 |
| 772 | 3300025939 | Ga0207665_10001692 | Ga0207665_100016925 | 194 |
| 773 | 3300026035 | Ga0207703_10152745 | Ga0207703_101527451 | 194 |
| 774 | 3300026041 | Ga0207639_10019760 | Ga0207639_100197606 | 194 |
| 775 | 3300026095 | Ga0207676_10530292 | Ga0207676_105302921 | 194 |
| 776 | 3300031090 | Ga0265760_10103908 | Ga0265760_101039081 | 194 |
| 777 | 3300048903 | Ga0496100_0027178 | Ga0496100_0027178_2533_3162 | 194 |
| 778 | 3300048904 | Ga0496101_0024749 | Ga0496101_0024749_2660_3289 | 194 |
| 779 | 3300048904 | Ga0496101_0220075 | Ga0496101_0220075_580_1221 | 194 |
| 780 | 3300048905 | Ga0496102_0027192 | Ga0496102_0027192_3394_4023 | 194 |
| 781 | 3300048905 | Ga0496102_0192167 | Ga0496102_0192167_805_1446 | 194 |
| 782 | 3300048906 | Ga0496103_0052786 | Ga0496103_0052786_1103_1732 | 194 |
| 783 | 3300048907 | Ga0496104_0023771 | Ga0496104_0023771_1144_1773 | 194 |
| 784 | 3300048908 | Ga0496105_0023768 | Ga0496105_0023768_1652_2281 | 194 |
| 785 | 3300048909 | Ga0496106_0049066 | Ga0496106_0049066_145_774 | 194 |
| 786 | 3300048910 | Ga0496107_0041642 | Ga0496107_0041642_151_780 | 194 |
| 787 | 3300048911 | Ga0496108_0041626 | Ga0496108_0041626_1973_2602 | 194 |
| 788 | 3300048912 | Ga0496109_0010523 | Ga0496109_0010523_245_874 | 194 |
| 789 | 3300048913 | Ga0496110_0449951 | Ga0496110_0449951_431_1072 | 194 |
| 790 | 3300048915 | Ga0496112_0076321 | Ga0496112_0076321_2184_2813 | 194 |
| 791 | 3300048916 | Ga0496113_0064283 | Ga0496113_0064283_1291_1920 | 194 |
| 792 | 3300048917 | Ga0496114_0035965 | Ga0496114_0035965_992_1621 | 194 |
| 793 | 3300048918 | Ga0496115_0484603 | Ga0496115_0484603_214_843 | 194 |
| 794 | 3300049744 | Ga0501083_0112649 | Ga0501083_0112649_530_1138 | 194 |
| 795 | 3300050512 | nmdc:mga0n895_226459_c1 | nmdc:mga0n895_226459_c1_115_756 | 194 |
| 796 | 3300053098 | Ga0500650_0242138 | Ga0500650_0242138_24_656 | 194 |
| 797 | 3300053117 | Ga0500593_000274 | Ga0500593_000274_6210_6842 | 194 |
| 798 | 3300007788 | Ga0099795_10000155 | Ga0099795_100001555 | 195 |
| 799 | 3300010159 | Ga0099796_10000545 | Ga0099796_100005455 | 195 |
| 800 | 3300027512 | Ga0209179_1000126 | Ga0209179_10001263 | 195 |
| 801 | 3300031251 | Ga0265327_10038056 | Ga0265327_100380562 | 195 |
| 802 | 3300031665 | Ga0316575_10027893 | Ga0316575_100278932 | 195 |
| 803 | 3300049823 | Ga0501044_0365650 | Ga0501044_0365650_478_1077 | 195 |
| 804 | 3300053096 | Ga0500641_0002828 | Ga0500641_0002828_4338_4967 | 195 |
| 805 | 3300005331 | Ga0070670_100018981 | Ga0070670_1000189812 | 196 |
| 806 | 3300005334 | Ga0068869_100081008 | Ga0068869_1000810081 | 196 |
| 807 | 3300005334 | Ga0068869_100956081 | Ga0068869_1009560811 | 196 |
| 808 | 3300005336 | Ga0070680_100359363 | Ga0070680_1003593632 | 196 |
| 809 | 3300005336 | Ga0070680_100650272 | Ga0070680_1006502721 | 196 |
| 810 | 3300005337 | Ga0070682_100044961 | Ga0070682_1000449611 | 196 |
| 811 | 3300005338 | Ga0068868_100078297 | Ga0068868_1000782971 | 196 |
| 812 | 3300005340 | Ga0070689_100018095 | Ga0070689_1000180951 | 196 |
| 813 | 3300005341 | Ga0070691_10323580 | Ga0070691_103235801 | 196 |
| 814 | 3300005347 | Ga0070668_100303584 | Ga0070668_1003035841 | 196 |
| 815 | 3300005354 | Ga0070675_100038119 | Ga0070675_1000381193 | 196 |
| 816 | 3300005356 | Ga0070674_100044252 | Ga0070674_1000442523 | 196 |
| 817 | 3300005365 | Ga0070688_100113882 | Ga0070688_1001138821 | 196 |
| 818 | 3300005367 | Ga0070667_100062837 | Ga0070667_1000628374 | 196 |
| 819 | 3300005438 | Ga0070701_10046339 | Ga0070701_100463393 | 196 |
| 820 | 3300005440 | Ga0070705_100149248 | Ga0070705_1001492482 | 196 |
| 821 | 3300005441 | Ga0070700_100046465 | Ga0070700_1000464653 | 196 |
| 822 | 3300005444 | Ga0070694_100168255 | Ga0070694_1001682552 | 196 |
| 823 | 3300005455 | Ga0070663_100084716 | Ga0070663_1000847163 | 196 |
| 824 | 3300005457 | Ga0070662_100049937 | Ga0070662_1000499373 | 196 |
| 825 | 3300005459 | Ga0068867_100066847 | Ga0068867_1000668473 | 196 |
| 826 | 3300005466 | Ga0070685_10116531 | Ga0070685_101165312 | 196 |
| 827 | 3300005468 | Ga0070707_100247698 | Ga0070707_1002476982 | 196 |
| 828 | 3300005539 | Ga0068853_100363022 | Ga0068853_1003630221 | 196 |
| 829 | 3300005543 | Ga0070672_100129901 | Ga0070672_1001299011 | 196 |
| 830 | 3300005544 | Ga0070686_100026881 | Ga0070686_1000268813 | 196 |
| 831 | 3300005564 | Ga0070664_100163030 | Ga0070664_1001630302 | 196 |
| 832 | 3300005578 | Ga0068854_100444423 | Ga0068854_1004444231 | 196 |
| 833 | 3300005614 | Ga0068856_100071204 | Ga0068856_1000712042 | 196 |
| 834 | 3300005615 | Ga0070702_100002122 | Ga0070702_1000021228 | 196 |
| 835 | 3300005617 | Ga0068859_100038396 | Ga0068859_1000383963 | 196 |
| 836 | 3300005718 | Ga0068866_10002715 | Ga0068866_100027153 | 196 |
| 837 | 3300005719 | Ga0068861_100145140 | Ga0068861_1001451402 | 196 |
| 838 | 3300005840 | Ga0068870_10103020 | Ga0068870_101030202 | 196 |
| 839 | 3300005841 | Ga0068863_100050785 | Ga0068863_1000507853 | 196 |
| 840 | 3300005842 | Ga0068858_100055131 | Ga0068858_1000551314 | 196 |
| 841 | 3300005843 | Ga0068860_100011366 | Ga0068860_10001136613 | 196 |
| 842 | 3300005937 | Ga0081455_10039510 | Ga0081455_100395102 | 196 |
| 843 | 3300005937 | Ga0081455_10072301 | Ga0081455_100723012 | 196 |
| 844 | 3300005983 | Ga0081540_1015330 | Ga0081540_10153302 | 196 |
| 845 | 3300006028 | Ga0070717_10150544 | Ga0070717_101505441 | 196 |
| 846 | 3300006038 | Ga0075365_10034820 | Ga0075365_100348202 | 196 |
| 847 | 3300006038 | Ga0075365_10086232 | Ga0075365_100862323 | 196 |
| 848 | 3300006038 | Ga0075365_10393029 | Ga0075365_103930291 | 196 |
| 849 | 3300006194 | Ga0075427_10000933 | Ga0075427_100009332 | 196 |
| 850 | 3300006358 | Ga0068871_100045370 | Ga0068871_1000453701 | 196 |
| 851 | 3300006844 | Ga0075428_100009524 | Ga0075428_10000952410 | 196 |
| 852 | 3300006844 | Ga0075428_100319812 | Ga0075428_1003198122 | 196 |
| 853 | 3300006846 | Ga0075430_100053356 | Ga0075430_1000533562 | 196 |
| 854 | 3300006846 | Ga0075430_100077845 | Ga0075430_1000778452 | 196 |
| 855 | 3300006847 | Ga0075431_100004032 | Ga0075431_10000403213 | 196 |
| 856 | 3300006847 | Ga0075431_100312229 | Ga0075431_1003122292 | 196 |
| 857 | 3300006852 | Ga0075433_10000876 | Ga0075433_1000087611 | 196 |
| 858 | 3300006852 | Ga0075433_10327623 | Ga0075433_103276231 | 196 |
| 859 | 3300006871 | Ga0075434_100003784 | Ga0075434_1000037843 | 196 |
| 860 | 3300006871 | Ga0075434_100056876 | Ga0075434_1000568764 | 196 |
| 861 | 3300006871 | Ga0075434_100237368 | Ga0075434_1002373682 | 196 |
| 862 | 3300006880 | Ga0075429_100207320 | Ga0075429_1002073202 | 196 |
| 863 | 3300006881 | Ga0068865_100039979 | Ga0068865_1000399792 | 196 |
| 864 | 3300006931 | Ga0097620_100038394 | Ga0097620_1000383943 | 196 |
| 865 | 3300007076 | Ga0075435_100024050 | Ga0075435_1000240503 | 196 |
| 866 | 3300007076 | Ga0075435_100032996 | Ga0075435_1000329962 | 196 |
| 867 | 3300009094 | Ga0111539_10042647 | Ga0111539_100426477 | 196 |
| 868 | 3300009094 | Ga0111539_10174268 | Ga0111539_101742682 | 196 |
| 869 | 3300009101 | Ga0105247_10018808 | Ga0105247_100188084 | 196 |
| 870 | 3300009147 | Ga0114129_10018611 | Ga0114129_100186116 | 196 |
| 871 | 3300009147 | Ga0114129_10058921 | Ga0114129_100589212 | 196 |
| 872 | 3300009176 | Ga0105242_10600087 | Ga0105242_106000872 | 196 |
| 873 | 3300009177 | Ga0105248_10083940 | Ga0105248_100839402 | 196 |
| 874 | 3300009177 | Ga0105248_10955660 | Ga0105248_109556602 | 196 |
| 875 | 3300009545 | Ga0105237_10464690 | Ga0105237_104646901 | 196 |
| 876 | 3300009553 | Ga0105249_10137387 | Ga0105249_101373872 | 196 |
| 877 | 3300011119 | Ga0105246_10237213 | Ga0105246_102372132 | 196 |
| 878 | 3300013105 | Ga0157369_10524924 | Ga0157369_105249242 | 196 |
| 879 | 3300013296 | Ga0157374_10068417 | Ga0157374_100684172 | 196 |
| 880 | 3300013306 | Ga0163162_10181804 | Ga0163162_101818042 | 196 |
| 881 | 3300013306 | Ga0163162_10285414 | Ga0163162_102854143 | 196 |
| 882 | 3300013306 | Ga0163162_10622692 | Ga0163162_106226921 | 196 |
| 883 | 3300013308 | Ga0157375_10063052 | Ga0157375_100630523 | 196 |
| 884 | 3300014325 | Ga0163163_10047249 | Ga0163163_100472495 | 196 |
| 885 | 3300014745 | Ga0157377_10024270 | Ga0157377_100242703 | 196 |
| 886 | 3300014968 | Ga0157379_10162654 | Ga0157379_101626542 | 196 |
| 887 | 3300014969 | Ga0157376_10225758 | Ga0157376_102257582 | 196 |
| 888 | 3300017792 | Ga0163161_10115761 | Ga0163161_101157612 | 196 |
| 889 | 3300024227 | Ga0228598_1003451 | Ga0228598_10034512 | 196 |
| 890 | 3300025900 | Ga0207710_10048741 | Ga0207710_100487412 | 196 |
| 891 | 3300025901 | Ga0207688_10008788 | Ga0207688_100087883 | 196 |
| 892 | 3300025908 | Ga0207643_10013330 | Ga0207643_100133302 | 196 |
| 893 | 3300025915 | Ga0207693_10010627 | Ga0207693_100106278 | 196 |
| 894 | 3300025916 | Ga0207663_10292068 | Ga0207663_102920682 | 196 |
| 895 | 3300025918 | Ga0207662_10020777 | Ga0207662_100207773 | 196 |
| 896 | 3300025919 | Ga0207657_10349052 | Ga0207657_103490521 | 196 |
| 897 | 3300025920 | Ga0207649_10085151 | Ga0207649_100851512 | 196 |
| 898 | 3300025925 | Ga0207650_10095801 | Ga0207650_100958012 | 196 |
| 899 | 3300025925 | Ga0207650_10156525 | Ga0207650_101565252 | 196 |
| 900 | 3300025928 | Ga0207700_10103473 | Ga0207700_101034732 | 196 |
| 901 | 3300025933 | Ga0207706_10120424 | Ga0207706_101204242 | 196 |
| 902 | 3300025940 | Ga0207691_10159568 | Ga0207691_101595683 | 196 |
| 903 | 3300025941 | Ga0207711_10040516 | Ga0207711_100405163 | 196 |
| 904 | 3300025941 | Ga0207711_10089107 | Ga0207711_100891072 | 196 |
| 905 | 3300025942 | Ga0207689_10073515 | Ga0207689_100735151 | 196 |
| 906 | 3300025960 | Ga0207651_10197490 | Ga0207651_101974903 | 196 |
| 907 | 3300025961 | Ga0207712_10150750 | Ga0207712_101507502 | 196 |
| 908 | 3300026023 | Ga0207677_10088811 | Ga0207677_100888112 | 196 |
| 909 | 3300026067 | Ga0207678_10034530 | Ga0207678_100345304 | 196 |
| 910 | 3300026067 | Ga0207678_10087331 | Ga0207678_100873312 | 196 |
| 911 | 3300026075 | Ga0207708_10002721 | Ga0207708_1000272112 | 196 |
| 912 | 3300026089 | Ga0207648_10024588 | Ga0207648_100245883 | 196 |
| 913 | 3300026095 | Ga0207676_10023198 | Ga0207676_100231983 | 196 |
| 914 | 3300026116 | Ga0207674_10049956 | Ga0207674_100499563 | 196 |
| 915 | 3300026118 | Ga0207675_100030051 | Ga0207675_1000300514 | 196 |
| 916 | 3300026121 | Ga0207683_10038116 | Ga0207683_100381163 | 196 |
| 917 | 3300027907 | Ga0207428_10000216 | Ga0207428_1000021618 | 196 |
| 918 | 3300028379 | Ga0268266_10159548 | Ga0268266_101595481 | 196 |
| 919 | 3300028380 | Ga0268265_10424725 | Ga0268265_104247251 | 196 |
| 920 | 3300028800 | Ga0265338_10016356 | Ga0265338_1001635610 | 196 |
| 921 | 3300031235 | Ga0265330_10078554 | Ga0265330_100785542 | 196 |
| 922 | 3300031238 | Ga0265332_10001833 | Ga0265332_100018334 | 196 |
| 923 | 3300031238 | Ga0265332_10078189 | Ga0265332_100781892 | 196 |
| 924 | 3300031241 | Ga0265325_10108939 | Ga0265325_101089392 | 196 |
| 925 | 3300031241 | Ga0265325_10151187 | Ga0265325_101511872 | 196 |
| 926 | 3300031242 | Ga0265329_10084020 | Ga0265329_100840202 | 196 |
| 927 | 3300031247 | Ga0265340_10000912 | Ga0265340_100009124 | 196 |
| 928 | 3300031247 | Ga0265340_10035724 | Ga0265340_100357244 | 196 |
| 929 | 3300031249 | Ga0265339_10001873 | Ga0265339_100018734 | 196 |
| 930 | 3300031249 | Ga0265339_10040092 | Ga0265339_100400922 | 196 |
| 931 | 3300031249 | Ga0265339_10394257 | Ga0265339_103942571 | 196 |
| 932 | 3300031344 | Ga0265316_10173377 | Ga0265316_101733771 | 196 |
| 933 | 3300031595 | Ga0265313_10042774 | Ga0265313_100427743 | 196 |
| 934 | 3300031711 | Ga0265314_10237494 | Ga0265314_102374942 | 196 |
| 935 | 3300031712 | Ga0265342_10000011 | Ga0265342_10000011120 | 196 |
| 936 | 3300031712 | Ga0265342_10004591 | Ga0265342_100045913 | 196 |
| 937 | 3300031712 | Ga0265342_10043958 | Ga0265342_100439584 | 196 |
| 938 | 3300035091 | Ga0373951_0088153 | Ga0373951_0088153_53_700 | 196 |
| 939 | 3300035121 | Ga0373960_0206990 | Ga0373960_0206990_29_676 | 196 |
| 940 | 3300035172 | Ga0373955_0286793 | Ga0373955_0286793_259_906 | 196 |
| 941 | 3300035692 | Ga0373935_0088837 | Ga0373935_0088837_740_1387 | 196 |
| 942 | 3300037312 | Ga0395899_0013207 | Ga0395899_0013207_3689_4282 | 196 |
| 943 | 3300037312 | Ga0395899_0181356 | Ga0395899_0181356_804_1397 | 196 |
| 944 | 3300037418 | Ga0395900_0003303 | Ga0395900_0003303_5218_5811 | 196 |
| 945 | 3300037418 | Ga0395900_0005284 | Ga0395900_0005284_5179_5772 | 196 |
| 946 | 3300037418 | Ga0395900_0242349 | Ga0395900_0242349_181_774 | 196 |
| 947 | 3300037418 | Ga0395900_0279491 | Ga0395900_0279491_478_1071 | 196 |
| 948 | 3300037466 | Ga0395898_0013960 | Ga0395898_0013960_7428_8021 | 196 |
| 949 | 3300037466 | Ga0395898_0097387 | Ga0395898_0097387_660_1253 | 196 |
| 950 | 3300038443 | Ga0395901_0011535 | Ga0395901_0011535_7641_8234 | 196 |
| 951 | 3300038443 | Ga0395901_0032978 | Ga0395901_0032978_2009_2602 | 196 |
| 952 | 3300038443 | Ga0395901_0173764 | Ga0395901_0173764_146_739 | 196 |
| 953 | 3300039447 | Ga0436361_0134221 | Ga0436361_0134221_202_831 | 196 |
| 954 | 3300046459 | Ga0495629_0086389 | Ga0495629_0086389_452_1099 | 196 |
| 955 | 3300046460 | Ga0495638_0070326 | Ga0495638_0070326_1443_2090 | 196 |
| 956 | 3300046461 | Ga0495641_0067695 | Ga0495641_0067695_326_973 | 196 |
| 957 | 3300046473 | Ga0495582_0051422 | Ga0495582_0051422_1558_2205 | 196 |
| 958 | 3300046475 | Ga0495639_0048671 | Ga0495639_0048671_832_1479 | 196 |
| 959 | 3300046491 | Ga0495584_0021018 | Ga0495584_0021018_1693_2340 | 196 |
| 960 | 3300046491 | Ga0495584_0222717 | Ga0495584_0222717_54_701 | 196 |
| 961 | 3300046499 | Ga0495594_0138431 | Ga0495594_0138431_342_989 | 196 |
| 962 | 3300046513 | Ga0495616_0133607 | Ga0495616_0133607_238_885 | 196 |
| 963 | 3300046514 | Ga0495618_0175740 | Ga0495618_0175740_93_740 | 196 |
| 964 | 3300046515 | Ga0495620_0199018 | Ga0495620_0199018_50_697 | 196 |
| 965 | 3300046529 | Ga0495652_0469597 | Ga0495652_0469597_106_738 | 196 |
| 966 | 3300046537 | Ga0495598_0001247 | Ga0495598_0001247_1722_2369 | 196 |
| 967 | 3300046543 | Ga0495645_0135379 | Ga0495645_0135379_349_981 | 196 |
| 968 | 3300046558 | Ga0495633_0015379 | Ga0495633_0015379_335_982 | 196 |
| 969 | 3300046648 | Ga0495611_0202767 | Ga0495611_0202767_194_841 | 196 |
| 970 | 3300046665 | Ga0495661_0076857 | Ga0495661_0076857_431_1078 | 196 |
| 971 | 3300046674 | Ga0495588_0086347 | Ga0495588_0086347_337_984 | 196 |
| 972 | 3300046683 | Ga0495658_0284388 | Ga0495658_0284388_162_809 | 196 |
| 973 | 3300046689 | Ga0495613_0185829 | Ga0495613_0185829_227_874 | 196 |
| 974 | 3300046690 | Ga0495624_0364417 | Ga0495624_0364417_135_782 | 196 |
| 975 | 3300046691 | Ga0495670_0003793 | Ga0495670_0003793_2528_3175 | 196 |
| 976 | 3300046692 | Ga0495671_0110284 | Ga0495671_0110284_589_1236 | 196 |
| 977 | 3300046694 | Ga0495649_0155117 | Ga0495649_0155117_460_1107 | 196 |
| 978 | 3300046794 | Ga0495589_0029954 | Ga0495589_0029954_1725_2372 | 196 |
| 979 | 3300046794 | Ga0495589_0060396 | Ga0495589_0060396_972_1619 | 196 |
| 980 | 3300046809 | Ga0495600_0225776 | Ga0495600_0225776_435_1082 | 196 |
| 981 | 3300047315 | Ga0495581_0028023 | Ga0495581_0028023_88_735 | 196 |
| 982 | 3300047321 | Ga0495676_0261048 | Ga0495676_0261048_417_1064 | 196 |
| 983 | 3300047323 | Ga0495683_0114933 | Ga0495683_0114933_435_1082 | 196 |
| 984 | 3300047445 | Ga0495677_0038434 | Ga0495677_0038434_604_1251 | 196 |
| 985 | 3300048088 | Ga0495602_0118855 | Ga0495602_0118855_679_1326 | 196 |
| 986 | 3300048091 | Ga0495626_0037215 | Ga0495626_0037215_96_743 | 196 |
| 987 | 3300048905 | Ga0496102_0005977 | Ga0496102_0005977_3723_4370 | 196 |
| 988 | 3300048905 | Ga0496102_0161964 | Ga0496102_0161964_785_1432 | 196 |
| 989 | 3300048906 | Ga0496103_0047272 | Ga0496103_0047272_527_1177 | 196 |
| 990 | 3300048906 | Ga0496103_0119580 | Ga0496103_0119580_226_873 | 196 |
| 991 | 3300048907 | Ga0496104_0041962 | Ga0496104_0041962_2259_2906 | 196 |
| 992 | 3300048907 | Ga0496104_0096220 | Ga0496104_0096220_2156_2803 | 196 |
| 993 | 3300048908 | Ga0496105_0002806 | Ga0496105_0002806_2595_3242 | 196 |
| 994 | 3300048909 | Ga0496106_0074338 | Ga0496106_0074338_456_1103 | 196 |
| 995 | 3300048910 | Ga0496107_0001255 | Ga0496107_0001255_10900_11547 | 196 |
| 996 | 3300048910 | Ga0496107_0037460 | Ga0496107_0037460_2558_3205 | 196 |
| 997 | 3300048911 | Ga0496108_0013177 | Ga0496108_0013177_1720_2367 | 196 |
| 998 | 3300048911 | Ga0496108_0173597 | Ga0496108_0173597_934_1581 | 196 |
| 999 | 3300048912 | Ga0496109_0001302 | Ga0496109_0001302_6672_7319 | 196 |
| 1000 | 3300048912 | Ga0496109_0307001 | Ga0496109_0307001_76_723 | 196 |
| 1001 | 3300048913 | Ga0496110_0170325 | Ga0496110_0170325_458_1105 | 196 |
| 1002 | 3300048914 | Ga0496111_0002435 | Ga0496111_0002435_931_1578 | 196 |
| 1003 | 3300048914 | Ga0496111_0008814 | Ga0496111_0008814_3384_4034 | 196 |
| 1004 | 3300048915 | Ga0496112_0004880 | Ga0496112_0004880_5194_5844 | 196 |
| 1005 | 3300048915 | Ga0496112_0005955 | Ga0496112_0005955_3753_4400 | 196 |
| 1006 | 3300048916 | Ga0496113_0000394 | Ga0496113_0000394_2289_2936 | 196 |
| 1007 | 3300048917 | Ga0496114_0018298 | Ga0496114_0018298_3467_4114 | 196 |
| 1008 | 3300048917 | Ga0496114_0787267 | Ga0496114_0787267_122_769 | 196 |
| 1009 | 3300048918 | Ga0496115_0004440 | Ga0496115_0004440_3442_4089 | 196 |
| 1010 | 3300048918 | Ga0496115_0015657 | Ga0496115_0015657_61_708 | 196 |
| 1011 | 3300049576 | Ga0501040_0024567 | Ga0501040_0024567_3303_3950 | 196 |
| 1012 | 3300049577 | Ga0501041_0096977 | Ga0501041_0096977_920_1567 | 196 |
| 1013 | 3300049582 | Ga0501048_0485860 | Ga0501048_0485860_29_676 | 196 |
| 1014 | 3300049584 | Ga0501068_0223224 | Ga0501068_0223224_233_880 | 196 |
| 1015 | 3300049590 | Ga0501074_0547975 | Ga0501074_0547975_159_752 | 196 |
| 1016 | 3300049591 | Ga0501075_0062556 | Ga0501075_0062556_2110_2757 | 196 |
| 1017 | 3300049744 | Ga0501083_0095920 | Ga0501083_0095920_1311_1937 | 196 |
| 1018 | 3300050492 | nmdc:mga0yw44_149487_c1 | nmdc:mga0yw44_149487_c1_694_1341 | 196 |
| 1019 | 3300050493 | nmdc:mga0k408_493957_c1 | nmdc:mga0k408_493957_c1_16_663 | 196 |
| 1020 | 3300050495 | nmdc:mga04h51_57703_c1 | nmdc:mga04h51_57703_c1_633_1280 | 196 |
| 1021 | 3300050507 | nmdc:mga05p37_129848_c1 | nmdc:mga05p37_129848_c1_430_1077 | 196 |
| 1022 | 3300050507 | nmdc:mga05p37_4032_c1 | nmdc:mga05p37_4032_c1_4559_5149 | 196 |
| 1023 | 3300050507 | nmdc:mga05p37_465051_c1 | nmdc:mga05p37_465051_c1_639_1229 | 196 |
| 1024 | 3300050508 | nmdc:mga09592_4710_c1 | nmdc:mga09592_4710_c1_5899_6489 | 196 |
| 1025 | 3300050509 | nmdc:mga0qj67_150443_c1 | nmdc:mga0qj67_150443_c1_1188_1838 | 196 |
| 1026 | 3300050509 | nmdc:mga0qj67_768_c1 | nmdc:mga0qj67_768_c1_16423_17013 | 196 |
| 1027 | 3300050510 | nmdc:mga06r32_117900_c1 | nmdc:mga06r32_117900_c1_2013_2603 | 196 |
| 1028 | 3300050511 | nmdc:mga08y16_2116_c1 | nmdc:mga08y16_2116_c1_8626_9216 | 196 |
| 1029 | 3300050511 | nmdc:mga08y16_321381_c1 | nmdc:mga08y16_321381_c1_526_1173 | 196 |
| 1030 | 3300050511 | nmdc:mga08y16_342219_c1 | nmdc:mga08y16_342219_c1_160_807 | 196 |
| 1031 | 3300050512 | nmdc:mga0n895_125016_c1 | nmdc:mga0n895_125016_c1_605_1195 | 196 |
| 1032 | 3300050512 | nmdc:mga0n895_167480_c1 | nmdc:mga0n895_167480_c1_867_1514 | 196 |
| 1033 | 3300050513 | nmdc:mga0rr50_1039_c1 | nmdc:mga0rr50_1039_c1_3533_4123 | 196 |
| 1034 | 3300050513 | nmdc:mga0rr50_42391_c1 | nmdc:mga0rr50_42391_c1_460_1050 | 196 |
| 1035 | 3300050514 | nmdc:mga08x19_114924_c1 | nmdc:mga08x19_114924_c1_434_1024 | 196 |
| 1036 | 3300050515 | nmdc:mga0a205_153815_c1 | nmdc:mga0a205_153815_c1_62_652 | 196 |
| 1037 | 3300050515 | nmdc:mga0a205_719_c1 | nmdc:mga0a205_719_c1_16747_17337 | 196 |
| 1038 | 3300053077 | Ga0495601_0321479 | Ga0495601_0321479_126_758 | 196 |
| 1039 | 3300053083 | Ga0495655_0048895 | Ga0495655_0048895_47_694 | 196 |
| 1040 | 3300053085 | Ga0495619_0027239 | Ga0495619_0027239_2308_2955 | 196 |
| 1041 | 2209111006 | 2214856315 | 2213902568 | 197 |
| 1042 | 3300000041 | ARcpr5oldR_c000202 | ARcpr5oldR_0002025 | 197 |
| 1043 | 3300000042 | ARSoilYngRDRAFT_c00201 | ARSoilYngRDRAFT_002015 | 197 |
| 1044 | 3300000043 | ARcpr5yngRDRAFT_c000176 | ARcpr5yngRDRAFT_0001765 | 197 |
| 1045 | 3300000044 | ARSoilOldRDRAFT_c000187 | ARSoilOldRDRAFT_0001875 | 197 |
| 1046 | 3300000045 | ARCol0oldRDRAFT_c02347 | ARCol0oldRDRAFT_023472 | 197 |
| 1047 | 3300000652 | ARCol0yngRDRAFT_1000204 | ARCol0yngRDRAFT_10002045 | 197 |
| 1048 | 3300001430 | JGI24032J14994_100577 | JGI24032J14994_1005772 | 197 |
| 1049 | 3300001976 | JGI24752J21851_1004412 | JGI24752J21851_10044122 | 197 |
| 1050 | 3300001977 | JGI24746J21847_1002942 | JGI24746J21847_10029424 | 197 |
| 1051 | 3300001989 | JGI24739J22299_10012807 | JGI24739J22299_100128072 | 197 |
| 1052 | 3300001990 | JGI24737J22298_10003419 | JGI24737J22298_100034192 | 197 |
| 1053 | 3300001990 | JGI24737J22298_10031013 | JGI24737J22298_100310132 | 197 |
| 1054 | 3300001991 | JGI24743J22301_10004649 | JGI24743J22301_100046492 | 197 |
| 1055 | 3300002070 | JGI24750J21931_1002092 | JGI24750J21931_10020921 | 197 |
| 1056 | 3300002074 | JGI24748J21848_1003313 | JGI24748J21848_10033132 | 197 |
| 1057 | 3300002075 | JGI24738J21930_10002133 | JGI24738J21930_100021333 | 197 |
| 1058 | 3300002075 | JGI24738J21930_10002848 | JGI24738J21930_100028487 | 197 |
| 1059 | 3300002155 | JGI24033J26618_1002523 | JGI24033J26618_10025232 | 197 |
| 1060 | 3300002239 | JGI24034J26672_10001569 | JGI24034J26672_100015694 | 197 |
| 1061 | 3300002239 | JGI24034J26672_10004883 | JGI24034J26672_100048832 | 197 |
| 1062 | 3300002244 | JGI24742J22300_10006556 | JGI24742J22300_100065562 | 197 |
| 1063 | 3300002244 | JGI24742J22300_10007189 | JGI24742J22300_100071892 | 197 |
| 1064 | 3300005277 | Ga0065716_1002368 | Ga0065716_10023681 | 197 |
| 1065 | 3300005289 | Ga0065704_10005364 | Ga0065704_100053644 | 197 |
| 1066 | 3300005290 | Ga0065712_10002565 | Ga0065712_100025657 | 197 |
| 1067 | 3300005293 | Ga0065715_10000602 | Ga0065715_100006023 | 197 |
| 1068 | 3300005293 | Ga0065715_10000779 | Ga0065715_100007794 | 197 |
| 1069 | 3300005295 | Ga0065707_10119681 | Ga0065707_101196812 | 197 |
| 1070 | 3300005328 | Ga0070676_10000170 | Ga0070676_1000017012 | 197 |
| 1071 | 3300005328 | Ga0070676_10055775 | Ga0070676_100557752 | 197 |
| 1072 | 3300005329 | Ga0070683_100007194 | Ga0070683_1000071946 | 197 |
| 1073 | 3300005329 | Ga0070683_100267388 | Ga0070683_1002673881 | 197 |
| 1074 | 3300005330 | Ga0070690_100007785 | Ga0070690_1000077852 | 197 |
| 1075 | 3300005330 | Ga0070690_100037856 | Ga0070690_1000378562 | 197 |
| 1076 | 3300005331 | Ga0070670_100007710 | Ga0070670_1000077107 | 197 |
| 1077 | 3300005331 | Ga0070670_100183906 | Ga0070670_1001839062 | 197 |
| 1078 | 3300005333 | Ga0070677_10000320 | Ga0070677_100003203 | 197 |
| 1079 | 3300005334 | Ga0068869_100000181 | Ga0068869_1000001815 | 197 |
| 1080 | 3300005334 | Ga0068869_100555443 | Ga0068869_1005554431 | 197 |
| 1081 | 3300005334 | Ga0068869_100580816 | Ga0068869_1005808162 | 197 |
| 1082 | 3300005335 | Ga0070666_10021002 | Ga0070666_100210023 | 197 |
| 1083 | 3300005335 | Ga0070666_10109278 | Ga0070666_101092782 | 197 |
| 1084 | 3300005335 | Ga0070666_10336369 | Ga0070666_103363692 | 197 |
| 1085 | 3300005336 | Ga0070680_100203803 | Ga0070680_1002038031 | 197 |
| 1086 | 3300005336 | Ga0070680_100397581 | Ga0070680_1003975812 | 197 |
| 1087 | 3300005337 | Ga0070682_100000903 | Ga0070682_1000009032 | 197 |
| 1088 | 3300005337 | Ga0070682_100016960 | Ga0070682_1000169605 | 197 |
| 1089 | 3300005337 | Ga0070682_100171307 | Ga0070682_1001713072 | 197 |
| 1090 | 3300005338 | Ga0068868_100000287 | Ga0068868_10000028734 | 197 |
| 1091 | 3300005338 | Ga0068868_100143378 | Ga0068868_1001433782 | 197 |
| 1092 | 3300005339 | Ga0070660_100023149 | Ga0070660_1000231492 | 197 |
| 1093 | 3300005339 | Ga0070660_100379450 | Ga0070660_1003794502 | 197 |
| 1094 | 3300005340 | Ga0070689_100001256 | Ga0070689_10000125618 | 197 |
| 1095 | 3300005341 | Ga0070691_10000085 | Ga0070691_1000008524 | 197 |
| 1096 | 3300005343 | Ga0070687_100011861 | Ga0070687_1000118612 | 197 |
| 1097 | 3300005343 | Ga0070687_100219702 | Ga0070687_1002197022 | 197 |
| 1098 | 3300005344 | Ga0070661_100520801 | Ga0070661_1005208012 | 197 |
| 1099 | 3300005344 | Ga0070661_100705230 | Ga0070661_1007052301 | 197 |
| 1100 | 3300005345 | Ga0070692_10010746 | Ga0070692_100107463 | 197 |
| 1101 | 3300005347 | Ga0070668_100001169 | Ga0070668_10000116912 | 197 |
| 1102 | 3300005347 | Ga0070668_100639276 | Ga0070668_1006392762 | 197 |
| 1103 | 3300005353 | Ga0070669_100019772 | Ga0070669_1000197726 | 197 |
| 1104 | 3300005353 | Ga0070669_100023221 | Ga0070669_1000232213 | 197 |
| 1105 | 3300005354 | Ga0070675_100049831 | Ga0070675_1000498312 | 197 |
| 1106 | 3300005355 | Ga0070671_100005621 | Ga0070671_1000056212 | 197 |
| 1107 | 3300005355 | Ga0070671_100085669 | Ga0070671_1000856692 | 197 |
| 1108 | 3300005356 | Ga0070674_100039583 | Ga0070674_1000395832 | 197 |
| 1109 | 3300005356 | Ga0070674_100216926 | Ga0070674_1002169262 | 197 |
| 1110 | 3300005364 | Ga0070673_100000191 | Ga0070673_10000019123 | 197 |
| 1111 | 3300005365 | Ga0070688_100009109 | Ga0070688_1000091092 | 197 |
| 1112 | 3300005365 | Ga0070688_100067111 | Ga0070688_1000671113 | 197 |
| 1113 | 3300005365 | Ga0070688_100214272 | Ga0070688_1002142722 | 197 |
| 1114 | 3300005366 | Ga0070659_100001504 | Ga0070659_10000150421 | 197 |
| 1115 | 3300005367 | Ga0070667_100032349 | Ga0070667_1000323494 | 197 |
| 1116 | 3300005367 | Ga0070667_100168830 | Ga0070667_1001688302 | 197 |
| 1117 | 3300005367 | Ga0070667_100236644 | Ga0070667_1002366442 | 197 |
| 1118 | 3300005406 | Ga0070703_10014931 | Ga0070703_100149312 | 197 |
| 1119 | 3300005434 | Ga0070709_10015140 | Ga0070709_100151403 | 197 |
| 1120 | 3300005434 | Ga0070709_10204030 | Ga0070709_102040302 | 197 |
| 1121 | 3300005436 | Ga0070713_100296138 | Ga0070713_1002961381 | 197 |
| 1122 | 3300005437 | Ga0070710_10005069 | Ga0070710_100050695 | 197 |
| 1123 | 3300005437 | Ga0070710_10401382 | Ga0070710_104013821 | 197 |
| 1124 | 3300005438 | Ga0070701_10000454 | Ga0070701_1000045413 | 197 |
| 1125 | 3300005439 | Ga0070711_100034363 | Ga0070711_1000343634 | 197 |
| 1126 | 3300005439 | Ga0070711_100099922 | Ga0070711_1000999222 | 197 |
| 1127 | 3300005440 | Ga0070705_100006964 | Ga0070705_1000069644 | 197 |
| 1128 | 3300005440 | Ga0070705_100364976 | Ga0070705_1003649761 | 197 |
| 1129 | 3300005441 | Ga0070700_100001181 | Ga0070700_10000118115 | 197 |
| 1130 | 3300005441 | Ga0070700_100026485 | Ga0070700_1000264852 | 197 |
| 1131 | 3300005444 | Ga0070694_100005471 | Ga0070694_1000054713 | 197 |
| 1132 | 3300005444 | Ga0070694_100026966 | Ga0070694_1000269664 | 197 |
| 1133 | 3300005445 | Ga0070708_100012815 | Ga0070708_1000128156 | 197 |
| 1134 | 3300005445 | Ga0070708_100217296 | Ga0070708_1002172962 | 197 |
| 1135 | 3300005455 | Ga0070663_100001277 | Ga0070663_1000012775 | 197 |
| 1136 | 3300005455 | Ga0070663_100026167 | Ga0070663_1000261672 | 197 |
| 1137 | 3300005455 | Ga0070663_100256998 | Ga0070663_1002569981 | 197 |
| 1138 | 3300005456 | Ga0070678_100098678 | Ga0070678_1000986782 | 197 |
| 1139 | 3300005457 | Ga0070662_100009258 | Ga0070662_1000092583 | 197 |
| 1140 | 3300005457 | Ga0070662_100025609 | Ga0070662_1000256096 | 197 |
| 1141 | 3300005458 | Ga0070681_10002441 | Ga0070681_1000244122 | 197 |
| 1142 | 3300005458 | Ga0070681_10045062 | Ga0070681_100450624 | 197 |
| 1143 | 3300005459 | Ga0068867_100003651 | Ga0068867_1000036512 | 197 |
| 1144 | 3300005466 | Ga0070685_10001020 | Ga0070685_1000102013 | 197 |
| 1145 | 3300005466 | Ga0070685_10356442 | Ga0070685_103564422 | 197 |
| 1146 | 3300005471 | Ga0070698_100520643 | Ga0070698_1005206432 | 197 |
| 1147 | 3300005518 | Ga0070699_100265772 | Ga0070699_1002657722 | 197 |
| 1148 | 3300005530 | Ga0070679_100002397 | Ga0070679_1000023973 | 197 |
| 1149 | 3300005530 | Ga0070679_100205962 | Ga0070679_1002059622 | 197 |
| 1150 | 3300005535 | Ga0070684_100129882 | Ga0070684_1001298822 | 197 |
| 1151 | 3300005536 | Ga0070697_100180051 | Ga0070697_1001800512 | 197 |
| 1152 | 3300005543 | Ga0070672_100104924 | Ga0070672_1001049242 | 197 |
| 1153 | 3300005544 | Ga0070686_100001852 | Ga0070686_1000018524 | 197 |
| 1154 | 3300005544 | Ga0070686_100010885 | Ga0070686_1000108854 | 197 |
| 1155 | 3300005544 | Ga0070686_100043297 | Ga0070686_1000432975 | 197 |
| 1156 | 3300005545 | Ga0070695_100017667 | Ga0070695_1000176674 | 197 |
| 1157 | 3300005545 | Ga0070695_100029096 | Ga0070695_1000290962 | 197 |
| 1158 | 3300005546 | Ga0070696_100030172 | Ga0070696_1000301723 | 197 |
| 1159 | 3300005546 | Ga0070696_100059761 | Ga0070696_1000597612 | 197 |
| 1160 | 3300005546 | Ga0070696_100196382 | Ga0070696_1001963822 | 197 |
| 1161 | 3300005547 | Ga0070693_100003405 | Ga0070693_1000034054 | 197 |
| 1162 | 3300005548 | Ga0070665_100172863 | Ga0070665_1001728632 | 197 |
| 1163 | 3300005549 | Ga0070704_100129790 | Ga0070704_1001297902 | 197 |
| 1164 | 3300005549 | Ga0070704_100179847 | Ga0070704_1001798471 | 197 |
| 1165 | 3300005563 | Ga0068855_100012458 | Ga0068855_1000124583 | 197 |
| 1166 | 3300005564 | Ga0070664_100144557 | Ga0070664_1001445572 | 197 |
| 1167 | 3300005564 | Ga0070664_100485787 | Ga0070664_1004857872 | 197 |
| 1168 | 3300005577 | Ga0068857_100007472 | Ga0068857_1000074724 | 197 |
| 1169 | 3300005578 | Ga0068854_100007745 | Ga0068854_1000077455 | 197 |
| 1170 | 3300005578 | Ga0068854_100112874 | Ga0068854_1001128743 | 197 |
| 1171 | 3300005615 | Ga0070702_100046887 | Ga0070702_1000468872 | 197 |
| 1172 | 3300005615 | Ga0070702_100141601 | Ga0070702_1001416012 | 197 |
| 1173 | 3300005616 | Ga0068852_100073978 | Ga0068852_1000739782 | 197 |
| 1174 | 3300005617 | Ga0068859_100002296 | Ga0068859_10000229619 | 197 |
| 1175 | 3300005617 | Ga0068859_100451919 | Ga0068859_1004519192 | 197 |
| 1176 | 3300005618 | Ga0068864_100002090 | Ga0068864_10000209025 | 197 |
| 1177 | 3300005618 | Ga0068864_100030933 | Ga0068864_1000309336 | 197 |
| 1178 | 3300005718 | Ga0068866_10066835 | Ga0068866_100668352 | 197 |
| 1179 | 3300005719 | Ga0068861_100001910 | Ga0068861_1000019104 | 197 |
| 1180 | 3300005840 | Ga0068870_10000133 | Ga0068870_1000013311 | 197 |
| 1181 | 3300005841 | Ga0068863_100010858 | Ga0068863_1000108582 | 197 |
| 1182 | 3300005841 | Ga0068863_100156523 | Ga0068863_1001565232 | 197 |
| 1183 | 3300005842 | Ga0068858_100029162 | Ga0068858_1000291623 | 197 |
| 1184 | 3300005842 | Ga0068858_100047364 | Ga0068858_1000473642 | 197 |
| 1185 | 3300005843 | Ga0068860_100003358 | Ga0068860_10000335824 | 197 |
| 1186 | 3300005843 | Ga0068860_100040861 | Ga0068860_1000408614 | 197 |
| 1187 | 3300005843 | Ga0068860_100119726 | Ga0068860_1001197262 | 197 |
| 1188 | 3300005844 | Ga0068862_100006524 | Ga0068862_1000065243 | 197 |
| 1189 | 3300005844 | Ga0068862_100188553 | Ga0068862_1001885532 | 197 |
| 1190 | 3300005937 | Ga0081455_10000009 | Ga0081455_10000009236 | 197 |
| 1191 | 3300006028 | Ga0070717_10012313 | Ga0070717_100123139 | 197 |
| 1192 | 3300006163 | Ga0070715_10001233 | Ga0070715_100012333 | 197 |
| 1193 | 3300006173 | Ga0070716_100225011 | Ga0070716_1002250111 | 197 |
| 1194 | 3300006175 | Ga0070712_100083832 | Ga0070712_1000838322 | 197 |
| 1195 | 3300006175 | Ga0070712_100158544 | Ga0070712_1001585442 | 197 |
| 1196 | 3300006178 | Ga0075367_10017457 | Ga0075367_100174574 | 197 |
| 1197 | 3300006237 | Ga0097621_100000616 | Ga0097621_10000061624 | 197 |
| 1198 | 3300006237 | Ga0097621_100067560 | Ga0097621_1000675602 | 197 |
| 1199 | 3300006353 | Ga0075370_10051098 | Ga0075370_100510982 | 197 |
| 1200 | 3300006358 | Ga0068871_100016286 | Ga0068871_1000162864 | 197 |
| 1201 | 3300006358 | Ga0068871_100031874 | Ga0068871_1000318746 | 197 |
| 1202 | 3300006852 | Ga0075433_10061884 | Ga0075433_100618842 | 197 |
| 1203 | 3300006871 | Ga0075434_100026789 | Ga0075434_1000267892 | 197 |
| 1204 | 3300006881 | Ga0068865_100001101 | Ga0068865_1000011014 | 197 |
| 1205 | 3300006881 | Ga0068865_100053184 | Ga0068865_1000531842 | 197 |
| 1206 | 3300006914 | Ga0075436_100254770 | Ga0075436_1002547702 | 197 |
| 1207 | 3300006914 | Ga0075436_100272646 | Ga0075436_1002726462 | 197 |
| 1208 | 3300006931 | Ga0097620_100002296 | Ga0097620_10000229619 | 197 |
| 1209 | 3300006931 | Ga0097620_100451932 | Ga0097620_1004519322 | 197 |
| 1210 | 3300007076 | Ga0075435_100041844 | Ga0075435_1000418442 | 197 |
| 1211 | 3300007076 | Ga0075435_100063268 | Ga0075435_1000632682 | 197 |
| 1212 | 3300009011 | Ga0105251_10037175 | Ga0105251_100371751 | 197 |
| 1213 | 3300009011 | Ga0105251_10051478 | Ga0105251_100514781 | 197 |
| 1214 | 3300009036 | Ga0105244_10061434 | Ga0105244_100614342 | 197 |
| 1215 | 3300009092 | Ga0105250_10137392 | Ga0105250_101373921 | 197 |
| 1216 | 3300009093 | Ga0105240_10011690 | Ga0105240_1001169012 | 197 |
| 1217 | 3300009094 | Ga0111539_10003401 | Ga0111539_1000340113 | 197 |
| 1218 | 3300009094 | Ga0111539_10035433 | Ga0111539_100354336 | 197 |
| 1219 | 3300009094 | Ga0111539_10171638 | Ga0111539_101716381 | 197 |
| 1220 | 3300009094 | Ga0111539_12097479 | Ga0111539_120974791 | 197 |
| 1221 | 3300009098 | Ga0105245_10056051 | Ga0105245_100560513 | 197 |
| 1222 | 3300009098 | Ga0105245_10601755 | Ga0105245_106017552 | 197 |
| 1223 | 3300009101 | Ga0105247_10008319 | Ga0105247_1000831912 | 197 |
| 1224 | 3300009101 | Ga0105247_10011047 | Ga0105247_100110471 | 197 |
| 1225 | 3300009148 | Ga0105243_10002317 | Ga0105243_100023173 | 197 |
| 1226 | 3300009148 | Ga0105243_10015545 | Ga0105243_100155455 | 197 |
| 1227 | 3300009174 | Ga0105241_10003767 | Ga0105241_100037672 | 197 |
| 1228 | 3300009174 | Ga0105241_10072284 | Ga0105241_100722844 | 197 |
| 1229 | 3300009174 | Ga0105241_10205607 | Ga0105241_102056072 | 197 |
| 1230 | 3300009176 | Ga0105242_10000990 | Ga0105242_1000099015 | 197 |
| 1231 | 3300009177 | Ga0105248_10013733 | Ga0105248_1001373312 | 197 |
| 1232 | 3300009177 | Ga0105248_10047103 | Ga0105248_100471036 | 197 |
| 1233 | 3300009177 | Ga0105248_10067752 | Ga0105248_100677526 | 197 |
| 1234 | 3300009177 | Ga0105248_10198164 | Ga0105248_101981642 | 197 |
| 1235 | 3300009545 | Ga0105237_10024092 | Ga0105237_100240925 | 197 |
| 1236 | 3300009551 | Ga0105238_10088824 | Ga0105238_100888244 | 197 |
| 1237 | 3300009553 | Ga0105249_10001033 | Ga0105249_1000103321 | 197 |
| 1238 | 3300009553 | Ga0105249_10025232 | Ga0105249_100252323 | 197 |
| 1239 | 3300010375 | Ga0105239_10121234 | Ga0105239_101212342 | 197 |
| 1240 | 3300010375 | Ga0105239_10135993 | Ga0105239_101359933 | 197 |
| 1241 | 3300010375 | Ga0105239_10402983 | Ga0105239_104029832 | 197 |
| 1242 | 3300011119 | Ga0105246_10001800 | Ga0105246_1000180015 | 197 |
| 1243 | 3300011119 | Ga0105246_10466612 | Ga0105246_104666121 | 197 |
| 1244 | 3300012476 | Ga0157344_1000799 | Ga0157344_10007992 | 197 |
| 1245 | 3300012480 | Ga0157346_1002141 | Ga0157346_10021411 | 197 |
| 1246 | 3300012492 | Ga0157335_1002311 | Ga0157335_10023112 | 197 |
| 1247 | 3300012494 | Ga0157341_1006083 | Ga0157341_10060832 | 197 |
| 1248 | 3300012503 | Ga0157313_1001600 | Ga0157313_10016002 | 197 |
| 1249 | 3300012510 | Ga0157316_1003972 | Ga0157316_10039722 | 197 |
| 1250 | 3300013100 | Ga0157373_10027665 | Ga0157373_100276653 | 197 |
| 1251 | 3300013102 | Ga0157371_10164975 | Ga0157371_101649752 | 197 |
| 1252 | 3300013296 | Ga0157374_10067658 | Ga0157374_100676581 | 197 |
| 1253 | 3300013296 | Ga0157374_10775036 | Ga0157374_107750361 | 197 |
| 1254 | 3300013297 | Ga0157378_10047383 | Ga0157378_100473836 | 197 |
| 1255 | 3300013306 | Ga0163162_10003401 | Ga0163162_1000340113 | 197 |
| 1256 | 3300013306 | Ga0163162_10009782 | Ga0163162_1000978212 | 197 |
| 1257 | 3300013307 | Ga0157372_10014509 | Ga0157372_100145097 | 197 |
| 1258 | 3300013307 | Ga0157372_10116252 | Ga0157372_101162523 | 197 |
| 1259 | 3300013308 | Ga0157375_10039024 | Ga0157375_100390243 | 197 |
| 1260 | 3300013308 | Ga0157375_10419068 | Ga0157375_104190682 | 197 |
| 1261 | 3300013308 | Ga0157375_10461012 | Ga0157375_104610122 | 197 |
| 1262 | 3300014325 | Ga0163163_10005155 | Ga0163163_100051552 | 197 |
| 1263 | 3300014325 | Ga0163163_10196977 | Ga0163163_101969772 | 197 |
| 1264 | 3300014326 | Ga0157380_10001301 | Ga0157380_1000130121 | 197 |
| 1265 | 3300014326 | Ga0157380_10554899 | Ga0157380_105548992 | 197 |
| 1266 | 3300014745 | Ga0157377_10001682 | Ga0157377_100016822 | 197 |
| 1267 | 3300014745 | Ga0157377_10117432 | Ga0157377_101174322 | 197 |
| 1268 | 3300014745 | Ga0157377_10321503 | Ga0157377_103215031 | 197 |
| 1269 | 3300014968 | Ga0157379_10000275 | Ga0157379_1000027539 | 197 |
| 1270 | 3300014968 | Ga0157379_10010341 | Ga0157379_100103413 | 197 |
| 1271 | 3300014968 | Ga0157379_10018203 | Ga0157379_1001820313 | 197 |
| 1272 | 3300014969 | Ga0157376_10001767 | Ga0157376_100017672 | 197 |
| 1273 | 3300014969 | Ga0157376_10033668 | Ga0157376_100336686 | 197 |
| 1274 | 3300014969 | Ga0157376_10910733 | Ga0157376_109107332 | 197 |
| 1275 | 3300017792 | Ga0163161_10044631 | Ga0163161_100446311 | 197 |
| 1276 | 3300017792 | Ga0163161_10138728 | Ga0163161_101387282 | 197 |
| 1277 | 3300025271 | Ga0207666_1000149 | Ga0207666_10001496 | 197 |
| 1278 | 3300025290 | Ga0207673_1000068 | Ga0207673_100006811 | 197 |
| 1279 | 3300025315 | Ga0207697_10012080 | Ga0207697_100120804 | 197 |
| 1280 | 3300025315 | Ga0207697_10028933 | Ga0207697_100289332 | 197 |
| 1281 | 3300025315 | Ga0207697_10167940 | Ga0207697_101679402 | 197 |
| 1282 | 3300025885 | Ga0207653_10003139 | Ga0207653_100031394 | 197 |
| 1283 | 3300025893 | Ga0207682_10000695 | Ga0207682_100006954 | 197 |
| 1284 | 3300025898 | Ga0207692_10087236 | Ga0207692_100872362 | 197 |
| 1285 | 3300025899 | Ga0207642_10000453 | Ga0207642_100004533 | 197 |
| 1286 | 3300025900 | Ga0207710_10044901 | Ga0207710_100449012 | 197 |
| 1287 | 3300025901 | Ga0207688_10064883 | Ga0207688_100648832 | 197 |
| 1288 | 3300025903 | Ga0207680_10044492 | Ga0207680_100444922 | 197 |
| 1289 | 3300025903 | Ga0207680_10056057 | Ga0207680_100560571 | 197 |
| 1290 | 3300025903 | Ga0207680_10137513 | Ga0207680_101375132 | 197 |
| 1291 | 3300025903 | Ga0207680_10431973 | Ga0207680_104319732 | 197 |
| 1292 | 3300025904 | Ga0207647_10022486 | Ga0207647_100224862 | 197 |
| 1293 | 3300025904 | Ga0207647_10030550 | Ga0207647_100305503 | 197 |
| 1294 | 3300025905 | Ga0207685_10055588 | Ga0207685_100555881 | 197 |
| 1295 | 3300025907 | Ga0207645_10019429 | Ga0207645_100194292 | 197 |
| 1296 | 3300025907 | Ga0207645_10131127 | Ga0207645_101311272 | 197 |
| 1297 | 3300025908 | Ga0207643_10000523 | Ga0207643_100005232 | 197 |
| 1298 | 3300025911 | Ga0207654_10001610 | Ga0207654_100016106 | 197 |
| 1299 | 3300025911 | Ga0207654_10123326 | Ga0207654_101233262 | 197 |
| 1300 | 3300025912 | Ga0207707_10001147 | Ga0207707_1000114713 | 197 |
| 1301 | 3300025912 | Ga0207707_10338101 | Ga0207707_103381012 | 197 |
| 1302 | 3300025913 | Ga0207695_10136425 | Ga0207695_101364252 | 197 |
| 1303 | 3300025914 | Ga0207671_10130803 | Ga0207671_101308032 | 197 |
| 1304 | 3300025915 | Ga0207693_10041415 | Ga0207693_100414154 | 197 |
| 1305 | 3300025916 | Ga0207663_10185141 | Ga0207663_101851412 | 197 |
| 1306 | 3300025917 | Ga0207660_10102335 | Ga0207660_101023352 | 197 |
| 1307 | 3300025917 | Ga0207660_10590809 | Ga0207660_105908092 | 197 |
| 1308 | 3300025918 | Ga0207662_10083908 | Ga0207662_100839082 | 197 |
| 1309 | 3300025918 | Ga0207662_10128515 | Ga0207662_101285151 | 197 |
| 1310 | 3300025919 | Ga0207657_10056806 | Ga0207657_100568063 | 197 |
| 1311 | 3300025919 | Ga0207657_10076719 | Ga0207657_100767193 | 197 |
| 1312 | 3300025920 | Ga0207649_10000142 | Ga0207649_1000014259 | 197 |
| 1313 | 3300025921 | Ga0207652_10002021 | Ga0207652_100020214 | 197 |
| 1314 | 3300025921 | Ga0207652_10092880 | Ga0207652_100928802 | 197 |
| 1315 | 3300025923 | Ga0207681_10020796 | Ga0207681_100207962 | 197 |
| 1316 | 3300025923 | Ga0207681_10090654 | Ga0207681_100906542 | 197 |
| 1317 | 3300025925 | Ga0207650_10002366 | Ga0207650_1000236612 | 197 |
| 1318 | 3300025926 | Ga0207659_10000078 | Ga0207659_100000782 | 197 |
| 1319 | 3300025927 | Ga0207687_10002377 | Ga0207687_100023775 | 197 |
| 1320 | 3300025928 | Ga0207700_10048631 | Ga0207700_100486313 | 197 |
| 1321 | 3300025931 | Ga0207644_10026921 | Ga0207644_100269214 | 197 |
| 1322 | 3300025932 | Ga0207690_10002633 | Ga0207690_1000263312 | 197 |
| 1323 | 3300025932 | Ga0207690_10233063 | Ga0207690_102330632 | 197 |
| 1324 | 3300025933 | Ga0207706_10134940 | Ga0207706_101349402 | 197 |
| 1325 | 3300025933 | Ga0207706_10235601 | Ga0207706_102356011 | 197 |
| 1326 | 3300025934 | Ga0207686_10003396 | Ga0207686_100033962 | 197 |
| 1327 | 3300025935 | Ga0207709_10009025 | Ga0207709_100090254 | 197 |
| 1328 | 3300025935 | Ga0207709_10036935 | Ga0207709_100369351 | 197 |
| 1329 | 3300025935 | Ga0207709_10437622 | Ga0207709_104376222 | 197 |
| 1330 | 3300025936 | Ga0207670_10003694 | Ga0207670_100036942 | 197 |
| 1331 | 3300025936 | Ga0207670_10147585 | Ga0207670_101475851 | 197 |
| 1332 | 3300025936 | Ga0207670_10217252 | Ga0207670_102172522 | 197 |
| 1333 | 3300025937 | Ga0207669_10001025 | Ga0207669_100010252 | 197 |
| 1334 | 3300025937 | Ga0207669_10263326 | Ga0207669_102633261 | 197 |
| 1335 | 3300025938 | Ga0207704_10085875 | Ga0207704_100858753 | 197 |
| 1336 | 3300025938 | Ga0207704_10397170 | Ga0207704_103971702 | 197 |
| 1337 | 3300025939 | Ga0207665_10010841 | Ga0207665_100108413 | 197 |
| 1338 | 3300025940 | Ga0207691_10008131 | Ga0207691_100081312 | 197 |
| 1339 | 3300025940 | Ga0207691_10064975 | Ga0207691_100649752 | 197 |
| 1340 | 3300025941 | Ga0207711_10037167 | Ga0207711_100371675 | 197 |
| 1341 | 3300025941 | Ga0207711_10567174 | Ga0207711_105671742 | 197 |
| 1342 | 3300025942 | Ga0207689_10001399 | Ga0207689_100013992 | 197 |
| 1343 | 3300025942 | Ga0207689_10668585 | Ga0207689_106685851 | 197 |
| 1344 | 3300025944 | Ga0207661_10001264 | Ga0207661_100012642 | 197 |
| 1345 | 3300025945 | Ga0207679_10000064 | Ga0207679_10000064104 | 197 |
| 1346 | 3300025945 | Ga0207679_10458704 | Ga0207679_104587042 | 197 |
| 1347 | 3300025949 | Ga0207667_10173810 | Ga0207667_101738102 | 197 |
| 1348 | 3300025960 | Ga0207651_10000420 | Ga0207651_1000042021 | 197 |
| 1349 | 3300025961 | Ga0207712_10001661 | Ga0207712_1000166117 | 197 |
| 1350 | 3300025972 | Ga0207668_10000965 | Ga0207668_1000096515 | 197 |
| 1351 | 3300025972 | Ga0207668_10542324 | Ga0207668_105423241 | 197 |
| 1352 | 3300025981 | Ga0207640_10001755 | Ga0207640_1000175514 | 197 |
| 1353 | 3300026023 | Ga0207677_10023844 | Ga0207677_100238443 | 197 |
| 1354 | 3300026035 | Ga0207703_10044466 | Ga0207703_100444664 | 197 |
| 1355 | 3300026035 | Ga0207703_10240532 | Ga0207703_102405322 | 197 |
| 1356 | 3300026041 | Ga0207639_10265540 | Ga0207639_102655402 | 197 |
| 1357 | 3300026067 | Ga0207678_10010183 | Ga0207678_100101839 | 197 |
| 1358 | 3300026067 | Ga0207678_10039287 | Ga0207678_100392873 | 197 |
| 1359 | 3300026067 | Ga0207678_10120747 | Ga0207678_101207472 | 197 |
| 1360 | 3300026075 | Ga0207708_10020852 | Ga0207708_100208524 | 197 |
| 1361 | 3300026075 | Ga0207708_10193379 | Ga0207708_101933791 | 197 |
| 1362 | 3300026078 | Ga0207702_10003767 | Ga0207702_100037673 | 197 |
| 1363 | 3300026088 | Ga0207641_10034057 | Ga0207641_100340572 | 197 |
| 1364 | 3300026088 | Ga0207641_10200868 | Ga0207641_102008682 | 197 |
| 1365 | 3300026088 | Ga0207641_10802363 | Ga0207641_108023631 | 197 |
| 1366 | 3300026089 | Ga0207648_10082742 | Ga0207648_100827422 | 197 |
| 1367 | 3300026089 | Ga0207648_10248865 | Ga0207648_102488652 | 197 |
| 1368 | 3300026095 | Ga0207676_10000079 | Ga0207676_1000007998 | 197 |
| 1369 | 3300026095 | Ga0207676_10720567 | Ga0207676_107205672 | 197 |
| 1370 | 3300026116 | Ga0207674_10013028 | Ga0207674_100130282 | 197 |
| 1371 | 3300026116 | Ga0207674_10303652 | Ga0207674_103036522 | 197 |
| 1372 | 3300026118 | Ga0207675_100095437 | Ga0207675_1000954373 | 197 |
| 1373 | 3300026118 | Ga0207675_100140676 | Ga0207675_1001406761 | 197 |
| 1374 | 3300026121 | Ga0207683_10000037 | Ga0207683_100000372 | 197 |
| 1375 | 3300026121 | Ga0207683_10038529 | Ga0207683_100385291 | 197 |
| 1376 | 3300026142 | Ga0207698_10725543 | Ga0207698_107255432 | 197 |
| 1377 | 3300027424 | Ga0209984_1025295 | Ga0209984_10252952 | 197 |
| 1378 | 3300027462 | Ga0210000_1010455 | Ga0210000_10104552 | 197 |
| 1379 | 3300027617 | Ga0210002_1000055 | Ga0210002_100005516 | 197 |
| 1380 | 3300027695 | Ga0209966_1003905 | Ga0209966_10039052 | 197 |
| 1381 | 3300027695 | Ga0209966_1047260 | Ga0209966_10472601 | 197 |
| 1382 | 3300027717 | Ga0209998_10001005 | Ga0209998_100010053 | 197 |
| 1383 | 3300027717 | Ga0209998_10012476 | Ga0209998_100124762 | 197 |
| 1384 | 3300027876 | Ga0209974_10003776 | Ga0209974_100037763 | 197 |
| 1385 | 3300027876 | Ga0209974_10006247 | Ga0209974_100062473 | 197 |
| 1386 | 3300027907 | Ga0207428_10000947 | Ga0207428_1000094716 | 197 |
| 1387 | 3300027907 | Ga0207428_10034068 | Ga0207428_100340681 | 197 |
| 1388 | 3300027907 | Ga0207428_10209350 | Ga0207428_102093502 | 197 |
| 1389 | 3300028379 | Ga0268266_10222290 | Ga0268266_102222901 | 197 |
| 1390 | 3300028380 | Ga0268265_10001593 | Ga0268265_100015932 | 197 |
| 1391 | 3300028380 | Ga0268265_10251496 | Ga0268265_102514962 | 197 |
| 1392 | 3300028381 | Ga0268264_10002487 | Ga0268264_100024872 | 197 |
| 1393 | 3300028381 | Ga0268264_10071239 | Ga0268264_100712391 | 197 |
| 1394 | 3300031241 | Ga0265325_10000104 | Ga0265325_1000010416 | 197 |
| 1395 | 3300031241 | Ga0265325_10139555 | Ga0265325_101395552 | 197 |
| 1396 | 3300033180 | Ga0307510_10070845 | Ga0307510_100708452 | 197 |
| 1397 | 3300034818 | Ga0373950_0001326 | Ga0373950_0001326_2321_2914 | 197 |
| 1398 | 3300034818 | Ga0373950_0032256 | Ga0373950_0032256_79_675 | 197 |
| 1399 | 3300034819 | Ga0373958_0001110 | Ga0373958_0001110_2906_3499 | 197 |
| 1400 | 3300034819 | Ga0373958_0024100 | Ga0373958_0024100_92_685 | 197 |
| 1401 | 3300034820 | Ga0373959_0037895 | Ga0373959_0037895_257_850 | 197 |
| 1402 | 3300034957 | Ga0373938_0011760 | Ga0373938_0011760_81_674 | 197 |
| 1403 | 3300035084 | Ga0373928_0000621 | Ga0373928_0000621_3897_4490 | 197 |
| 1404 | 3300035085 | Ga0373929_0035100 | Ga0373929_0035100_155_748 | 197 |
| 1405 | 3300035085 | Ga0373929_0043985 | Ga0373929_0043985_387_983 | 197 |
| 1406 | 3300035088 | Ga0373940_0020800 | Ga0373940_0020800_166_759 | 197 |
| 1407 | 3300035088 | Ga0373940_0082408 | Ga0373940_0082408_295_891 | 197 |
| 1408 | 3300035090 | Ga0373949_0054052 | Ga0373949_0054052_183_776 | 197 |
| 1409 | 3300035091 | Ga0373951_0025972 | Ga0373951_0025972_82_675 | 197 |
| 1410 | 3300035092 | Ga0373952_0001248 | Ga0373952_0001248_3826_4419 | 197 |
| 1411 | 3300035092 | Ga0373952_0001666 | Ga0373952_0001666_2602_3195 | 197 |
| 1412 | 3300035112 | Ga0373932_0003010 | Ga0373932_0003010_1208_1801 | 197 |
| 1413 | 3300035114 | Ga0373939_0001456 | Ga0373939_0001456_2585_3178 | 197 |
| 1414 | 3300035114 | Ga0373939_0002110 | Ga0373939_0002110_1367_1960 | 197 |
| 1415 | 3300035115 | Ga0373941_0000073 | Ga0373941_0000073_10655_11248 | 197 |
| 1416 | 3300035116 | Ga0373945_0032058 | Ga0373945_0032058_48_644 | 197 |
| 1417 | 3300035118 | Ga0373954_0011780 | Ga0373954_0011780_2136_2729 | 197 |
| 1418 | 3300035118 | Ga0373954_0047850 | Ga0373954_0047850_116_709 | 197 |
| 1419 | 3300035119 | Ga0373956_0142368 | Ga0373956_0142368_359_952 | 197 |
| 1420 | 3300035121 | Ga0373960_0007900 | Ga0373960_0007900_1778_2371 | 197 |
| 1421 | 3300035121 | Ga0373960_0047852 | Ga0373960_0047852_397_993 | 197 |
| 1422 | 3300035171 | Ga0373946_0100684 | Ga0373946_0100684_678_1274 | 197 |
| 1423 | 3300035172 | Ga0373955_0000596 | Ga0373955_0000596_622_1218 | 197 |
| 1424 | 3300035172 | Ga0373955_0008707 | Ga0373955_0008707_2080_2673 | 197 |
| 1425 | 3300035207 | Ga0373942_0004460 | Ga0373942_0004460_2414_3007 | 197 |
| 1426 | 3300035207 | Ga0373942_0031940 | Ga0373942_0031940_706_1314 | 197 |
| 1427 | 3300035241 | Ga0373961_0002214 | Ga0373961_0002214_315_908 | 197 |
| 1428 | 3300035241 | Ga0373961_0002508 | Ga0373961_0002508_4080_4673 | 197 |
| 1429 | 3300035241 | Ga0373961_0028782 | Ga0373961_0028782_353_949 | 197 |
| 1430 | 3300035242 | Ga0373962_0011700 | Ga0373962_0011700_179_775 | 197 |
| 1431 | 3300035242 | Ga0373962_0038433 | Ga0373962_0038433_234_827 | 197 |
| 1432 | 3300035691 | Ga0373931_0188535 | Ga0373931_0188535_558_1151 | 197 |
| 1433 | 3300035692 | Ga0373935_0035954 | Ga0373935_0035954_28_624 | 197 |
| 1434 | 3300035724 | Ga0373933_0050540 | Ga0373933_0050540_559_1152 | 197 |
| 1435 | 3300035725 | Ga0373947_0070451 | Ga0373947_0070451_174_770 | 197 |
| 1436 | 3300036401 | Ga0373937_0098200 | Ga0373937_0098200_19_612 | 197 |
| 1437 | 3300037068 | Ga0373925_0276660 | Ga0373925_0276660_520_1113 | 197 |
| 1438 | 3300038996 | Ga0242420_001294 | Ga0242420_001294_1424_2017 | 197 |
| 1439 | 3300039447 | Ga0436361_0134613 | Ga0436361_0134613_190_843 | 197 |
| 1440 | 3300042008 | Ga0439450_032555 | Ga0439450_032555_369_962 | 197 |
| 1441 | 3300042016 | Ga0439463_005398 | Ga0439463_005398_573_1166 | 197 |
| 1442 | 3300042439 | Ga0439464_0008117 | Ga0439464_0008117_1031_1624 | 197 |
| 1443 | 3300042876 | Ga0451577_0057746 | Ga0451577_0057746_315_908 | 197 |
| 1444 | 3300046454 | Ga0495592_0069788 | Ga0495592_0069788_1846_2442 | 197 |
| 1445 | 3300046454 | Ga0495592_0070753 | Ga0495592_0070753_523_1116 | 197 |
| 1446 | 3300046455 | Ga0495603_0033777 | Ga0495603_0033777_1814_2410 | 197 |
| 1447 | 3300046457 | Ga0495590_0251140 | Ga0495590_0251140_24_617 | 197 |
| 1448 | 3300046459 | Ga0495629_0001773 | Ga0495629_0001773_15854_16450 | 197 |
| 1449 | 3300046461 | Ga0495641_0013912 | Ga0495641_0013912_2276_2872 | 197 |
| 1450 | 3300046462 | Ga0495651_0000921 | Ga0495651_0000921_20271_20867 | 197 |
| 1451 | 3300046462 | Ga0495651_0067157 | Ga0495651_0067157_670_1263 | 197 |
| 1452 | 3300046472 | Ga0495580_0407193 | Ga0495580_0407193_244_840 | 197 |
| 1453 | 3300046473 | Ga0495582_0069273 | Ga0495582_0069273_527_1123 | 197 |
| 1454 | 3300046499 | Ga0495594_0242279 | Ga0495594_0242279_285_881 | 197 |
| 1455 | 3300046516 | Ga0495628_0014081 | Ga0495628_0014081_5095_5688 | 197 |
| 1456 | 3300046517 | Ga0495630_0025494 | Ga0495630_0025494_3612_4208 | 197 |
| 1457 | 3300046529 | Ga0495652_0010378 | Ga0495652_0010378_5411_6004 | 197 |
| 1458 | 3300046533 | Ga0495640_0087133 | Ga0495640_0087133_1406_1999 | 197 |
| 1459 | 3300046536 | Ga0495587_0001768 | Ga0495587_0001768_13281_13877 | 197 |
| 1460 | 3300046543 | Ga0495645_0218645 | Ga0495645_0218645_30_623 | 197 |
| 1461 | 3300046559 | Ga0495667_0003637 | Ga0495667_0003637_569_1162 | 197 |
| 1462 | 3300046642 | Ga0495634_0115116 | Ga0495634_0115116_800_1396 | 197 |
| 1463 | 3300046663 | Ga0495635_0010530 | Ga0495635_0010530_1519_2115 | 197 |
| 1464 | 3300046663 | Ga0495635_0029945 | Ga0495635_0029945_732_1325 | 197 |
| 1465 | 3300046675 | Ga0495657_0039832 | Ga0495657_0039832_1748_2341 | 197 |
| 1466 | 3300046678 | Ga0495599_0002940 | Ga0495599_0002940_3025_3618 | 197 |
| 1467 | 3300046679 | Ga0495623_0029465 | Ga0495623_0029465_1281_1874 | 197 |
| 1468 | 3300046680 | Ga0495646_0165214 | Ga0495646_0165214_567_1160 | 197 |
| 1469 | 3300046683 | Ga0495658_0000874 | Ga0495658_0000874_9384_9980 | 197 |
| 1470 | 3300046689 | Ga0495613_0032939 | Ga0495613_0032939_3170_3766 | 197 |
| 1471 | 3300046809 | Ga0495600_0094688 | Ga0495600_0094688_856_1449 | 197 |
| 1472 | 3300046809 | Ga0495600_0598294 | Ga0495600_0598294_51_647 | 197 |
| 1473 | 3300047319 | Ga0495674_0062320 | Ga0495674_0062320_2464_3057 | 197 |
| 1474 | 3300047321 | Ga0495676_0092609 | Ga0495676_0092609_1577_2173 | 197 |
| 1475 | 3300047322 | Ga0495680_0047510 | Ga0495680_0047510_2758_3351 | 197 |
| 1476 | 3300047322 | Ga0495680_0076614 | Ga0495680_0076614_41_637 | 197 |
| 1477 | 3300047443 | Ga0495687_001479 | Ga0495687_001479_721_1398 | 197 |
| 1478 | 3300047444 | Ga0495675_0206297 | Ga0495675_0206297_493_1086 | 197 |
| 1479 | 3300047471 | Ga0495684_0334461 | Ga0495684_0334461_297_893 | 197 |
| 1480 | 3300048088 | Ga0495602_0000618 | Ga0495602_0000618_31323_31919 | 197 |
| 1481 | 3300048088 | Ga0495602_0009515 | Ga0495602_0009515_2483_3076 | 197 |
| 1482 | 3300048903 | Ga0496100_0001418 | Ga0496100_0001418_426_1019 | 197 |
| 1483 | 3300048903 | Ga0496100_0058013 | Ga0496100_0058013_452_1048 | 197 |
| 1484 | 3300048904 | Ga0496101_0023336 | Ga0496101_0023336_2545_3138 | 197 |
| 1485 | 3300048905 | Ga0496102_0071148 | Ga0496102_0071148_56_649 | 197 |
| 1486 | 3300048905 | Ga0496102_0545390 | Ga0496102_0545390_392_985 | 197 |
| 1487 | 3300048906 | Ga0496103_0001402 | Ga0496103_0001402_14839_15432 | 197 |
| 1488 | 3300048906 | Ga0496103_0031407 | Ga0496103_0031407_1016_1612 | 197 |
| 1489 | 3300048907 | Ga0496104_0000196 | Ga0496104_0000196_9519_10112 | 197 |
| 1490 | 3300048908 | Ga0496105_0002714 | Ga0496105_0002714_4574_5167 | 197 |
| 1491 | 3300048909 | Ga0496106_0048565 | Ga0496106_0048565_2184_2777 | 197 |
| 1492 | 3300048910 | Ga0496107_0002765 | Ga0496107_0002765_56_649 | 197 |
| 1493 | 3300048910 | Ga0496107_0015989 | Ga0496107_0015989_2766_3362 | 197 |
| 1494 | 3300048910 | Ga0496107_0019262 | Ga0496107_0019262_1807_2400 | 197 |
| 1495 | 3300048911 | Ga0496108_0002196 | Ga0496108_0002196_7667_8260 | 197 |
| 1496 | 3300048911 | Ga0496108_0010961 | Ga0496108_0010961_39_632 | 197 |
| 1497 | 3300048912 | Ga0496109_0068663 | Ga0496109_0068663_432_1025 | 197 |
| 1498 | 3300048913 | Ga0496110_0043581 | Ga0496110_0043581_3270_3863 | 197 |
| 1499 | 3300048913 | Ga0496110_0065153 | Ga0496110_0065153_709_1302 | 197 |
| 1500 | 3300048913 | Ga0496110_0276644 | Ga0496110_0276644_473_1069 | 197 |
| 1501 | 3300048914 | Ga0496111_0024822 | Ga0496111_0024822_456_1052 | 197 |
| 1502 | 3300048914 | Ga0496111_0064305 | Ga0496111_0064305_29_622 | 197 |
| 1503 | 3300048915 | Ga0496112_0046232 | Ga0496112_0046232_2361_2954 | 197 |
| 1504 | 3300048915 | Ga0496112_0133256 | Ga0496112_0133256_42_638 | 197 |
| 1505 | 3300048915 | Ga0496112_0393785 | Ga0496112_0393785_30_626 | 197 |
| 1506 | 3300048915 | Ga0496112_1236967 | Ga0496112_1236967_24_617 | 197 |
| 1507 | 3300048916 | Ga0496113_0002343 | Ga0496113_0002343_4878_5471 | 197 |
| 1508 | 3300048916 | Ga0496113_0027510 | Ga0496113_0027510_1125_1718 | 197 |
| 1509 | 3300048916 | Ga0496113_0031970 | Ga0496113_0031970_1052_1648 | 197 |
| 1510 | 3300048917 | Ga0496114_0004563 | Ga0496114_0004563_9479_10072 | 197 |
| 1511 | 3300048917 | Ga0496114_0081983 | Ga0496114_0081983_312_908 | 197 |
| 1512 | 3300048918 | Ga0496115_0214545 | Ga0496115_0214545_147_740 | 197 |
| 1513 | 3300049587 | Ga0501071_0591937 | Ga0501071_0591937_214_807 | 197 |
| 1514 | 3300050496 | nmdc:mga07m45_83242_c1 | nmdc:mga07m45_83242_c1_956_1549 | 197 |
| 1515 | 3300050511 | nmdc:mga08y16_13725_c1 | nmdc:mga08y16_13725_c1_4052_4645 | 197 |
| 1516 | 3300050511 | nmdc:mga08y16_77404_c1 | nmdc:mga08y16_77404_c1_1587_2180 | 197 |
| 1517 | 3300050512 | nmdc:mga0n895_211894_c1 | nmdc:mga0n895_211894_c1_1189_1782 | 197 |
| 1518 | 3300050512 | nmdc:mga0n895_408739_c1 | nmdc:mga0n895_408739_c1_503_1099 | 197 |
| 1519 | 3300050513 | nmdc:mga0rr50_19830_c1 | nmdc:mga0rr50_19830_c1_1560_2153 | 197 |
| 1520 | 3300050514 | nmdc:mga08x19_157864_c1 | nmdc:mga08x19_157864_c1_430_1026 | 197 |
| 1521 | 3300050515 | nmdc:mga0a205_12523_c1 | nmdc:mga0a205_12523_c1_4593_5186 | 197 |
| 1522 | 3300053077 | Ga0495601_0224068 | Ga0495601_0224068_355_1014 | 197 |
| 1523 | 3300053078 | Ga0495612_0000795 | Ga0495612_0000795_10670_11263 | 197 |
| 1524 | 3300053084 | Ga0495595_0001780 | Ga0495595_0001780_5167_5760 | 197 |
| 1525 | 3300053084 | Ga0495595_0231695 | Ga0495595_0231695_264_860 | 197 |
| 1526 | 3300053085 | Ga0495619_0001605 | Ga0495619_0001605_1447_2040 | 197 |
| 1527 | 3300053085 | Ga0495619_0017496 | Ga0495619_0017496_920_1516 | 197 |
| 1528 | 3300053131 | Ga0500652_094295 | Ga0500652_094295_405_1079 | 197 |
| 1529 | 3300060353 | Ga0501082_0359557 | Ga0501082_0359557_518_1141 | 197 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xj8-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form | 0.9282 | 1 | 190 |
| 5xj5-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form | 0.9277 | 3 | 192 |
| 5xj5-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form | 0.892 | 3 | 192 |
| 5xj8-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form | 0.8919 | 1 | 190 |
| 8e0m-assembly1.cif.gz_B | homotrimeric variant of tctrp9, bgl15 | 0.364 | 41 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYS6_9_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.9234 | 10 | 180 | 1.10.1760.20 |
| af_P60782_11_184_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.901 | 10 | 180 | 1.10.1760.20 |
| af_P60782_11_184_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8816 | 10 | 180 | 1.10.1760.20 |
| af_Q2FYS6_9_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.861 | 10 | 180 | 1.10.1760.20 |
| af_Q2FVK0_1_153_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3647 | 62 | 183 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E3H611-F1-model_v4 | Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) | 0.9734 | 2 | 194 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A6N8T7P6-F1-model_v4 | Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) | 0.9717 | 2 | 193 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A6B8KE78-F1-model_v4 | Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) | 0.9707 | 2 | 193 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A530APE1-F1-model_v4 | Glycerol-3-phosphate 1-O-acyltransferase PlsY (EC 2.3.1.15) | 0.9693 | 1 | 165 |
GO:0004366
GO:0005886 GO:0008654 GO:0043772 |
| AF-A0A3C0ME81-F1-model_v4 | Acyl-phosphate glycerol 3-phosphate acyltransferase | 0.9688 | 2 | 180 |
GO:0005886
GO:0008654 GO:0043772 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar