F494551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1523 | 612 | 1409 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0000702|Ga0453684_0000702_22925_24145 |
| Length | 406 |
| Sequence | MLGRLADAAANGNLAHGAQVAKVGYLFLHSYTKILYQIGQIGMAIESARRILPQEKNSRYWKGQAVIIDIHGHYTTAPKALEEWRKRQIEGIKQPALMPKVSELKISDDELRESIETNQLKKMKERGSDLTIFSPRASFMAHHIGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAMLPQSPGVDPATCVPELEKAVKQYGFVGINLNPDPSGGHWKEPPLTSRHWYPIYEKMVEYGIPAMIHVSTSCNECFHTTGAHYINADTTAFMQLIQGDLFKDFPDMKFVIPHGGGAAPYHWGRYRGLAQELKKPLLDEHLLNNVFFDTCVYHQPGIDLLTRVIPLKNVLFASEMIGAVKGIDPQTGHNFDDTKRYIEGADLTADERHMIYEGNARRVYPRLDAALKQKGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 4 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 5 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 6 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 7 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 8 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 9 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 10 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 11 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 12 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 13 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 14 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 15 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 16 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 17 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 18 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 19 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 20 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 21 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 22 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 23 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 24 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 25 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 26 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 27 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 28 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 29 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 30 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 31 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 32 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 33 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 34 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 35 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 36 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 37 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 38 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 39 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 40 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 41 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 42 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 43 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 44 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 45 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 46 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 47 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 48 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 49 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 50 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 51 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 52 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 53 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 54 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 55 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 56 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 57 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 58 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 59 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 60 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 61 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 62 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 63 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 64 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 65 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 66 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 67 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 68 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 69 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 70 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 71 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 72 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 73 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 74 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 75 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 76 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 77 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 78 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 79 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 80 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 81 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 82 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 83 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 84 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 85 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 86 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 87 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 88 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 89 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 90 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 91 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 92 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 93 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 94 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 95 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 96 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 97 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 98 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 99 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 100 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 101 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 102 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 103 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 104 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 105 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 106 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 107 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 108 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 109 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 110 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 111 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 112 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 113 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 114 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 115 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 116 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 118 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 119 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 120 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 121 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 122 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 123 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 124 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 125 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 126 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 127 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 128 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 129 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 130 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 132 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 134 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 137 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 138 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 141 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 143 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 145 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 147 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 148 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 157 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 166 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 171 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 172 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 173 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 174 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 175 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 176 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 178 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 179 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 181 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 187 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 189 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 190 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 191 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 193 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 194 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 195 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 196 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 197 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 198 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 199 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 200 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 201 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 202 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 203 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 204 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 205 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 206 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 208 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 209 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 210 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 212 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 213 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 214 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 215 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 217 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 218 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 219 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 220 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 221 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 222 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 223 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 225 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 240 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 255 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 256 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 257 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 258 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 259 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 261 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 262 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 263 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 270 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 272 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 285 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 353 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 357 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 361 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 362 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 363 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 364 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 365 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 366 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 367 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 368 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 369 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 370 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 371 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 372 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 373 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 374 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 375 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 376 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 377 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 378 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 379 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 380 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 381 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 382 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 383 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 384 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 385 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 386 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 387 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 388 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 389 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 390 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 391 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 392 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 393 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 394 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 395 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 396 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 397 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 398 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 399 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 400 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 401 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 402 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 403 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 404 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 405 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 406 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 407 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 408 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 409 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 410 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 411 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 412 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 413 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 414 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 415 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 416 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 417 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 418 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 419 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 420 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 421 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 422 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 423 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 424 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 425 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 426 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 427 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 428 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 429 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 430 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 431 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 432 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 433 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 434 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 435 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 436 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 437 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 438 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 439 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 440 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 441 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 442 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 443 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 444 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 445 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 446 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 447 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 448 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 449 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 525 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 526 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 527 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 528 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 529 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 530 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 531 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 532 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 533 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 534 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 535 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 536 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 537 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 538 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 539 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 540 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 541 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 542 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 543 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 544 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 545 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 546 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 547 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 548 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 549 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 552 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 557 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 560 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 562 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 563 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 564 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 570 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 573 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 574 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 575 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 580 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 584 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 585 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 586 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 587 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 588 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 589 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 590 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 591 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 592 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 594 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 595 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 596 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 597 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 598 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 599 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 600 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 601 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 602 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 603 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 604 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 605 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 606 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 607 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 608 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 609 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 610 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 611 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 612 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.45 |
| Metatranscriptomes | 0.07 |
| Isolates | 7.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.98 |
| Nodule | 0.53 |
| Rhizoplane | 4.4 |
| Rhizosphere | 75.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10000797 | 3300001991 | Bacteria | 3963 |
| 2 | JGI24745J21846_1009742 | 3300002073 | Bacteria | 1091 |
| 3 | JGI24742J22300_10009999 | 3300002244 | Bacteria | 1567 |
| 4 | JGI25152J39213_1004123 | 3300002773 | Bacteria | 4692 |
| 5 | JGI25159J45721_1007113 | 3300002987 | Bacteria | 3252 |
| 6 | JGI25151J46595_10000545 | 3300003187 | Bacteria | 34695 |
| 7 | JGI25151J46595_10003021 | 3300003187 | Bacteria | 9562 |
| 8 | JGI25406J46586_10000250 | 3300003203 | Bacteria | 23917 |
| 9 | JGI25406J46586_10004727 | 3300003203 | Bacteria | 6337 |
| 10 | JGI25406J46586_10007846 | 3300003203 | Bacteria | 4856 |
| 11 | JGI25153J46596_10000540 | 3300003215 | Bacteria | 23618 |
| 12 | JGI25153J46596_10002993 | 3300003215 | Bacteria | 9562 |
| 13 | JGI25160J50197_1020348 | 3300003354 | Bacteria | 2005 |
| 14 | Ga0055538_1000010 | 3300003751 | Bacteria | 376599 |
| 15 | Ga0055539_1000015 | 3300003752 | Bacteria | 376599 |
| 16 | Ga0055533_1000018 | 3300003756 | Bacteria | 376599 |
| 17 | Ga0055525_1000020 | 3300003759 | Bacteria | 376599 |
| 18 | Ga0055526_1000336 | 3300003771 | Bacteria | 38625 |
| 19 | Ga0055526_1004371 | 3300003771 | Bacteria | 8524 |
| 20 | Ga0055526_1005207 | 3300003771 | Bacteria | 7552 |
| 21 | Ga0055537_1000060 | 3300003773 | Bacteria | 79376 |
| 22 | Ga0055537_1001197 | 3300003773 | Bacteria | 11019 |
| 23 | Ga0055524_1000157 | 3300003775 | Bacteria | 79002 |
| 24 | Ga0055524_1001147 | 3300003775 | Bacteria | 15953 |
| 25 | Ga0055524_1001729 | 3300003775 | Bacteria | 12127 |
| 26 | Ga0055524_1005063 | 3300003775 | Bacteria | 5960 |
| 27 | Ga0055536_1003357 | 3300003781 | Bacteria | 8644 |
| 28 | Ga0055536_1004808 | 3300003781 | Bacteria | 6764 |
| 29 | Ga0055534_1000009 | 3300003784 | Bacteria | 210256 |
| 30 | Ga0055534_1000341 | 3300003784 | Bacteria | 30179 |
| 31 | Ga0055534_1000777 | 3300003784 | Bacteria | 14972 |
| 32 | Ga0055534_1000858 | 3300003784 | Bacteria | 13928 |
| 33 | Ga0055534_1001653 | 3300003784 | Bacteria | 8599 |
| 34 | Ga0055528_1000012 | 3300003790 | Bacteria | 182704 |
| 35 | Ga0055530_10000311 | 3300003791 | Bacteria | 44214 |
| 36 | Ga0055530_10003376 | 3300003791 | Bacteria | 9129 |
| 37 | Ga0055540_1000016 | 3300003792 | Bacteria | 232942 |
| 38 | Ga0055540_1001497 | 3300003792 | Bacteria | 13893 |
| 39 | Ga0055540_1001826 | 3300003792 | Bacteria | 12052 |
| 40 | Ga0055540_1005932 | 3300003792 | Bacteria | 4975 |
| 41 | Ga0055540_1025950 | 3300003792 | Bacteria | 1425 |
| 42 | Ga0055531_10000103 | 3300003794 | Bacteria | 92298 |
| 43 | Ga0055531_10001224 | 3300003794 | Bacteria | 19583 |
| 44 | Ga0055531_10001302 | 3300003794 | Bacteria | 18802 |
| 45 | Ga0055531_10001335 | 3300003794 | Bacteria | 18427 |
| 46 | Ga0055531_10002563 | 3300003794 | Bacteria | 12070 |
| 47 | Ga0055541_1000011 | 3300003841 | Bacteria | 376599 |
| 48 | Ga0065165_1000834 | 3300005262 | Bacteria | 40482 |
| 49 | Ga0065165_1002832 | 3300005262 | Bacteria | 13534 |
| 50 | Ga0065714_10092228 | 3300005288 | Bacteria | 1878 |
| 51 | Ga0065712_10080409 | 3300005290 | Bacteria | 3108 |
| 52 | Ga0065712_10106004 | 3300005290 | Bacteria | 1927 |
| 53 | Ga0065715_10118502 | 3300005293 | Bacteria | 2310 |
| 54 | Ga0065707_10084750 | 3300005295 | Bacteria | 6818 |
| 55 | Ga0070658_10000534 | 3300005327 | Bacteria | 33047 |
| 56 | Ga0070658_10229495 | 3300005327 | Bacteria | 1571 |
| 57 | Ga0070676_10002014 | 3300005328 | Bacteria | 10326 |
| 58 | Ga0070676_10012319 | 3300005328 | Bacteria | 4663 |
| 59 | Ga0070676_10026321 | 3300005328 | Bacteria | 3293 |
| 60 | Ga0070683_100024091 | 3300005329 | Bacteria | 5447 |
| 61 | Ga0070683_100024988 | 3300005329 | Bacteria | 5358 |
| 62 | Ga0070683_100049447 | 3300005329 | Bacteria | 3889 |
| 63 | Ga0070683_100065312 | 3300005329 | Bacteria | 3388 |
| 64 | Ga0070683_100246277 | 3300005329 | Bacteria | 1700 |
| 65 | Ga0070690_100007036 | 3300005330 | Bacteria | 6415 |
| 66 | Ga0070690_100009057 | 3300005330 | Bacteria | 5755 |
| 67 | Ga0070690_100016117 | 3300005330 | Bacteria | 4471 |
| 68 | Ga0070690_100029571 | 3300005330 | Bacteria | 3399 |
| 69 | Ga0070690_100069749 | 3300005330 | Bacteria | 2281 |
| 70 | Ga0070670_100000863 | 3300005331 | Bacteria | 23798 |
| 71 | Ga0070670_100001673 | 3300005331 | Bacteria | 17995 |
| 72 | Ga0070670_100017556 | 3300005331 | Bacteria | 6140 |
| 73 | Ga0070670_100018340 | 3300005331 | Bacteria | 6004 |
| 74 | Ga0070670_100070670 | 3300005331 | Bacteria | 2997 |
| 75 | Ga0070677_10002127 | 3300005333 | Bacteria | 6322 |
| 76 | Ga0068869_100004158 | 3300005334 | Bacteria | 8979 |
| 77 | Ga0068869_100038646 | 3300005334 | Bacteria | 3404 |
| 78 | Ga0068869_100053280 | 3300005334 | Bacteria | 2940 |
| 79 | Ga0068869_100099685 | 3300005334 | Bacteria | 2196 |
| 80 | Ga0068869_100168305 | 3300005334 | Bacteria | 1710 |
| 81 | Ga0070666_10001432 | 3300005335 | Bacteria | 14445 |
| 82 | Ga0070666_10006463 | 3300005335 | Bacteria | 7206 |
| 83 | Ga0070666_10204678 | 3300005335 | Bacteria | 1389 |
| 84 | Ga0070680_100011410 | 3300005336 | Bacteria | 6872 |
| 85 | Ga0070682_100000252 | 3300005337 | Bacteria | 38842 |
| 86 | Ga0068868_100007971 | 3300005338 | Bacteria | 7568 |
| 87 | Ga0068868_100012306 | 3300005338 | Bacteria | 6251 |
| 88 | Ga0068868_100018460 | 3300005338 | Bacteria | 5215 |
| 89 | Ga0068868_100045303 | 3300005338 | Bacteria | 3441 |
| 90 | Ga0068868_100140159 | 3300005338 | Bacteria | 1984 |
| 91 | Ga0068868_100172909 | 3300005338 | Bacteria | 1789 |
| 92 | Ga0068868_100206984 | 3300005338 | Bacteria | 1638 |
| 93 | Ga0068868_100237010 | 3300005338 | Bacteria | 1532 |
| 94 | Ga0070660_100004251 | 3300005339 | Bacteria | 9883 |
| 95 | Ga0070660_100148018 | 3300005339 | Bacteria | 1887 |
| 96 | Ga0070660_100236251 | 3300005339 | Bacteria | 1488 |
| 97 | Ga0070689_100002998 | 3300005340 | Bacteria | 11106 |
| 98 | Ga0070689_100008431 | 3300005340 | Bacteria | 7259 |
| 99 | Ga0070689_100010538 | 3300005340 | Bacteria | 6588 |
| 100 | Ga0070689_100019686 | 3300005340 | Bacteria | 4993 |
| 101 | Ga0070689_100027445 | 3300005340 | Bacteria | 4292 |
| 102 | Ga0070689_100405937 | 3300005340 | Bacteria | 1152 |
| 103 | Ga0070687_100100407 | 3300005343 | Bacteria | 1619 |
| 104 | Ga0070687_100126658 | 3300005343 | Bacteria | 1469 |
| 105 | Ga0070661_100035765 | 3300005344 | Bacteria | 3609 |
| 106 | Ga0070661_100064928 | 3300005344 | Bacteria | 2682 |
| 107 | Ga0070661_100091323 | 3300005344 | Bacteria | 2255 |
| 108 | Ga0070661_100181651 | 3300005344 | Bacteria | 1601 |
| 109 | Ga0070692_10017952 | 3300005345 | Bacteria | 3392 |
| 110 | Ga0070692_10034767 | 3300005345 | Bacteria | 2548 |
| 111 | Ga0070692_10071600 | 3300005345 | Bacteria | 1848 |
| 112 | Ga0070668_100005618 | 3300005347 | Bacteria | 9297 |
| 113 | Ga0070668_100085408 | 3300005347 | Bacteria | 2480 |
| 114 | Ga0070669_100003725 | 3300005353 | Bacteria | 11006 |
| 115 | Ga0070669_100049967 | 3300005353 | Bacteria | 3054 |
| 116 | Ga0070669_100111702 | 3300005353 | Bacteria | 2075 |
| 117 | Ga0070669_100192789 | 3300005353 | Bacteria | 1599 |
| 118 | Ga0070675_100000605 | 3300005354 | Bacteria | 24695 |
| 119 | Ga0070675_100011272 | 3300005354 | Bacteria | 6998 |
| 120 | Ga0070675_100041359 | 3300005354 | Bacteria | 3765 |
| 121 | Ga0070675_100049771 | 3300005354 | Bacteria | 3440 |
| 122 | Ga0070675_100060864 | 3300005354 | Bacteria | 3117 |
| 123 | Ga0070675_100091225 | 3300005354 | Bacteria | 2552 |
| 124 | Ga0070675_100098724 | 3300005354 | Bacteria | 2457 |
| 125 | Ga0070675_100250598 | 3300005354 | Bacteria | 1550 |
| 126 | Ga0070671_100010636 | 3300005355 | Bacteria | 7384 |
| 127 | Ga0070671_100033086 | 3300005355 | Bacteria | 4274 |
| 128 | Ga0070671_100043588 | 3300005355 | Bacteria | 3728 |
| 129 | Ga0070671_100064323 | 3300005355 | Bacteria | 3055 |
| 130 | Ga0070671_100216519 | 3300005355 | Bacteria | 1625 |
| 131 | Ga0070671_100223975 | 3300005355 | Bacteria | 1596 |
| 132 | Ga0070674_100005518 | 3300005356 | Bacteria | 7313 |
| 133 | Ga0070674_100008774 | 3300005356 | Bacteria | 6032 |
| 134 | Ga0070674_100011027 | 3300005356 | Bacteria | 5483 |
| 135 | Ga0070674_100012896 | 3300005356 | Bacteria | 5147 |
| 136 | Ga0070674_100088011 | 3300005356 | Bacteria | 2234 |
| 137 | Ga0070673_100000416 | 3300005364 | Bacteria | 22479 |
| 138 | Ga0070673_100004008 | 3300005364 | Bacteria | 9269 |
| 139 | Ga0070673_100027949 | 3300005364 | Bacteria | 4189 |
| 140 | Ga0070673_100031352 | 3300005364 | Bacteria | 3988 |
| 141 | Ga0070673_100037138 | 3300005364 | Bacteria | 3709 |
| 142 | Ga0070673_100048421 | 3300005364 | Bacteria | 3314 |
| 143 | Ga0070673_100086512 | 3300005364 | Bacteria | 2554 |
| 144 | Ga0070673_100106692 | 3300005364 | Bacteria | 2316 |
| 145 | Ga0070673_100130251 | 3300005364 | Bacteria | 2109 |
| 146 | Ga0070688_100004155 | 3300005365 | Bacteria | 7512 |
| 147 | Ga0070688_100004763 | 3300005365 | Bacteria | 7090 |
| 148 | Ga0070659_100007556 | 3300005366 | Bacteria | 7899 |
| 149 | Ga0070659_100261485 | 3300005366 | Bacteria | 1436 |
| 150 | Ga0070667_100004143 | 3300005367 | Bacteria | 12254 |
| 151 | Ga0070667_100006265 | 3300005367 | Bacteria | 9890 |
| 152 | Ga0070667_100017248 | 3300005367 | Bacteria | 5981 |
| 153 | Ga0070667_100038773 | 3300005367 | Bacteria | 3995 |
| 154 | Ga0070667_100039343 | 3300005367 | Bacteria | 3963 |
| 155 | Ga0070667_100062521 | 3300005367 | Bacteria | 3154 |
| 156 | Ga0070667_100067596 | 3300005367 | Bacteria | 3038 |
| 157 | Ga0070667_100291399 | 3300005367 | Bacteria | 1468 |
| 158 | Ga0070709_10000424 | 3300005434 | Bacteria | 25604 |
| 159 | Ga0070709_10003057 | 3300005434 | Bacteria | 8983 |
| 160 | Ga0070714_100003678 | 3300005435 | Bacteria | 11483 |
| 161 | Ga0070714_100005399 | 3300005435 | Bacteria | 9753 |
| 162 | Ga0070714_100058748 | 3300005435 | Bacteria | 3296 |
| 163 | Ga0070713_100000019 | 3300005436 | Bacteria | 110100 |
| 164 | Ga0070713_100015895 | 3300005436 | Bacteria | 5643 |
| 165 | Ga0070713_100048177 | 3300005436 | Bacteria | 3507 |
| 166 | Ga0070713_100062064 | 3300005436 | Bacteria | 3129 |
| 167 | Ga0070713_100519499 | 3300005436 | Bacteria | 1125 |
| 168 | Ga0070710_10001915 | 3300005437 | Bacteria | 9853 |
| 169 | Ga0070710_10055704 | 3300005437 | Bacteria | 2235 |
| 170 | Ga0070710_10087640 | 3300005437 | Bacteria | 1830 |
| 171 | Ga0070701_10004081 | 3300005438 | Bacteria | 5860 |
| 172 | Ga0070701_10009235 | 3300005438 | Bacteria | 4311 |
| 173 | Ga0070711_100001539 | 3300005439 | Bacteria | 12700 |
| 174 | Ga0070711_100002750 | 3300005439 | Bacteria | 10085 |
| 175 | Ga0070711_100120904 | 3300005439 | Bacteria | 1937 |
| 176 | Ga0070711_100256708 | 3300005439 | Bacteria | 1373 |
| 177 | Ga0070711_100256866 | 3300005439 | Bacteria | 1373 |
| 178 | Ga0070700_100004241 | 3300005441 | Bacteria | 7486 |
| 179 | Ga0070700_100122036 | 3300005441 | Bacteria | 1747 |
| 180 | Ga0070708_100000889 | 3300005445 | Bacteria | 22619 |
| 181 | Ga0070663_100008820 | 3300005455 | Bacteria | 6222 |
| 182 | Ga0070663_100052002 | 3300005455 | Bacteria | 2920 |
| 183 | Ga0070663_100137140 | 3300005455 | Bacteria | 1864 |
| 184 | Ga0070663_100148612 | 3300005455 | Bacteria | 1795 |
| 185 | Ga0070678_100002173 | 3300005456 | Bacteria | 10652 |
| 186 | Ga0070678_100007462 | 3300005456 | Bacteria | 6493 |
| 187 | Ga0070678_100104983 | 3300005456 | Bacteria | 2198 |
| 188 | Ga0070678_100106303 | 3300005456 | Bacteria | 2187 |
| 189 | Ga0070678_100109558 | 3300005456 | Bacteria | 2158 |
| 190 | Ga0070678_100153245 | 3300005456 | Bacteria | 1859 |
| 191 | Ga0070662_100000546 | 3300005457 | Bacteria | 22896 |
| 192 | Ga0070662_100016857 | 3300005457 | Bacteria | 4911 |
| 193 | Ga0070662_100109421 | 3300005457 | Bacteria | 2103 |
| 194 | Ga0070681_10002422 | 3300005458 | Bacteria | 17060 |
| 195 | Ga0070681_10007525 | 3300005458 | Bacteria | 10643 |
| 196 | Ga0070681_10156558 | 3300005458 | Bacteria | 2203 |
| 197 | Ga0068867_100000041 | 3300005459 | Bacteria | 78472 |
| 198 | Ga0068867_100001563 | 3300005459 | Bacteria | 15894 |
| 199 | Ga0068867_100001878 | 3300005459 | Bacteria | 14605 |
| 200 | Ga0068867_100005891 | 3300005459 | Bacteria | 8697 |
| 201 | Ga0068867_100007968 | 3300005459 | Bacteria | 7484 |
| 202 | Ga0068867_100044748 | 3300005459 | Bacteria | 3244 |
| 203 | Ga0068867_100129629 | 3300005459 | Bacteria | 1958 |
| 204 | Ga0068867_100158557 | 3300005459 | Bacteria | 1783 |
| 205 | Ga0068867_100212036 | 3300005459 | Bacteria | 1556 |
| 206 | Ga0070685_10013969 | 3300005466 | Bacteria | 4248 |
| 207 | Ga0070685_10016951 | 3300005466 | Bacteria | 3890 |
| 208 | Ga0070685_10024895 | 3300005466 | Bacteria | 3292 |
| 209 | Ga0070685_10084117 | 3300005466 | Bacteria | 1913 |
| 210 | Ga0070706_100003229 | 3300005467 | Bacteria | 16104 |
| 211 | Ga0070706_100270019 | 3300005467 | Bacteria | 1587 |
| 212 | Ga0070707_100023650 | 3300005468 | Bacteria | 5812 |
| 213 | Ga0070707_100243072 | 3300005468 | Bacteria | 1752 |
| 214 | Ga0070698_100081425 | 3300005471 | Bacteria | 3232 |
| 215 | Ga0070698_100269772 | 3300005471 | Bacteria | 1633 |
| 216 | Ga0070699_100200393 | 3300005518 | Bacteria | 1775 |
| 217 | Ga0070679_100000180 | 3300005530 | Bacteria | 50879 |
| 218 | Ga0070679_100079119 | 3300005530 | Bacteria | 3277 |
| 219 | Ga0070679_100217475 | 3300005530 | Bacteria | 1873 |
| 220 | Ga0070679_100220439 | 3300005530 | Bacteria | 1858 |
| 221 | Ga0070684_100000578 | 3300005535 | Bacteria | 25373 |
| 222 | Ga0070684_100004669 | 3300005535 | Bacteria | 10461 |
| 223 | Ga0070684_100020163 | 3300005535 | Bacteria | 5531 |
| 224 | Ga0070684_100077838 | 3300005535 | Bacteria | 2929 |
| 225 | Ga0070697_100025578 | 3300005536 | Bacteria | 4708 |
| 226 | Ga0070697_100235223 | 3300005536 | Bacteria | 1563 |
| 227 | Ga0068853_100005895 | 3300005539 | Bacteria | 9666 |
| 228 | Ga0068853_100021596 | 3300005539 | Bacteria | 5370 |
| 229 | Ga0068853_100034801 | 3300005539 | Bacteria | 4277 |
| 230 | Ga0068853_100061464 | 3300005539 | Bacteria | 3249 |
| 231 | Ga0068853_100104878 | 3300005539 | Bacteria | 2503 |
| 232 | Ga0068853_100108685 | 3300005539 | Bacteria | 2461 |
| 233 | Ga0068853_100123705 | 3300005539 | Bacteria | 2310 |
| 234 | Ga0068853_100145864 | 3300005539 | Bacteria | 2127 |
| 235 | Ga0070672_100000414 | 3300005543 | Bacteria | 24728 |
| 236 | Ga0070672_100008479 | 3300005543 | Bacteria | 7034 |
| 237 | Ga0070672_100008902 | 3300005543 | Bacteria | 6896 |
| 238 | Ga0070672_100011272 | 3300005543 | Bacteria | 6234 |
| 239 | Ga0070672_100014528 | 3300005543 | Bacteria | 5582 |
| 240 | Ga0070672_100045698 | 3300005543 | Bacteria | 3389 |
| 241 | Ga0070672_100071345 | 3300005543 | Bacteria | 2763 |
| 242 | Ga0070672_100109350 | 3300005543 | Bacteria | 2251 |
| 243 | Ga0070672_100148133 | 3300005543 | Bacteria | 1940 |
| 244 | Ga0070672_100255976 | 3300005543 | Bacteria | 1475 |
| 245 | Ga0070672_100262709 | 3300005543 | Bacteria | 1456 |
| 246 | Ga0070672_100451935 | 3300005543 | Bacteria | 1107 |
| 247 | Ga0070686_100009212 | 3300005544 | Bacteria | 5541 |
| 248 | Ga0070686_100017437 | 3300005544 | Bacteria | 4196 |
| 249 | Ga0070693_100070874 | 3300005547 | Bacteria | 2052 |
| 250 | Ga0070665_100002566 | 3300005548 | Bacteria | 19913 |
| 251 | Ga0070665_100010851 | 3300005548 | Bacteria | 9213 |
| 252 | Ga0070665_100017168 | 3300005548 | Bacteria | 7262 |
| 253 | Ga0070665_100080934 | 3300005548 | Bacteria | 3253 |
| 254 | Ga0070665_100093316 | 3300005548 | Bacteria | 3015 |
| 255 | Ga0070665_100094448 | 3300005548 | Bacteria | 2995 |
| 256 | Ga0070665_100174660 | 3300005548 | Bacteria | 2149 |
| 257 | Ga0070665_100218435 | 3300005548 | Bacteria | 1907 |
| 258 | Ga0070704_100050726 | 3300005549 | Bacteria | 2918 |
| 259 | Ga0070704_100085978 | 3300005549 | Bacteria | 2329 |
| 260 | Ga0068855_100001533 | 3300005563 | Bacteria | 29006 |
| 261 | Ga0068855_100008719 | 3300005563 | Bacteria | 12260 |
| 262 | Ga0068855_100016734 | 3300005563 | Bacteria | 8819 |
| 263 | Ga0068855_100051277 | 3300005563 | Bacteria | 4860 |
| 264 | Ga0068855_100132479 | 3300005563 | Bacteria | 2846 |
| 265 | Ga0068855_100332842 | 3300005563 | Bacteria | 1676 |
| 266 | Ga0068855_100462796 | 3300005563 | Bacteria | 1383 |
| 267 | Ga0070664_100001978 | 3300005564 | Bacteria | 16414 |
| 268 | Ga0070664_100021313 | 3300005564 | Bacteria | 5340 |
| 269 | Ga0070664_100057585 | 3300005564 | Bacteria | 3303 |
| 270 | Ga0070664_100111346 | 3300005564 | Bacteria | 2390 |
| 271 | Ga0070664_100343365 | 3300005564 | Bacteria | 1357 |
| 272 | Ga0070664_100440653 | 3300005564 | Bacteria | 1195 |
| 273 | Ga0068857_100005085 | 3300005577 | Bacteria | 11181 |
| 274 | Ga0068857_100012412 | 3300005577 | Bacteria | 7417 |
| 275 | Ga0068857_100020815 | 3300005577 | Bacteria | 5770 |
| 276 | Ga0068857_100029733 | 3300005577 | Bacteria | 4821 |
| 277 | Ga0068857_100233400 | 3300005577 | Bacteria | 1683 |
| 278 | Ga0068854_100036656 | 3300005578 | Bacteria | 3439 |
| 279 | Ga0068854_100051600 | 3300005578 | Bacteria | 2947 |
| 280 | Ga0068856_100000409 | 3300005614 | Bacteria | 47269 |
| 281 | Ga0068856_100000762 | 3300005614 | Bacteria | 34958 |
| 282 | Ga0068856_100026700 | 3300005614 | Bacteria | 5631 |
| 283 | Ga0068856_100093824 | 3300005614 | Bacteria | 2987 |
| 284 | Ga0068856_100150706 | 3300005614 | Bacteria | 2335 |
| 285 | Ga0068856_100501402 | 3300005614 | Bacteria | 1235 |
| 286 | Ga0070702_100058566 | 3300005615 | Bacteria | 2232 |
| 287 | Ga0068852_100003141 | 3300005616 | Bacteria | 11513 |
| 288 | Ga0068852_100069880 | 3300005616 | Bacteria | 3079 |
| 289 | Ga0068852_100070212 | 3300005616 | Bacteria | 3072 |
| 290 | Ga0068852_100169402 | 3300005616 | Bacteria | 2046 |
| 291 | Ga0068859_100001521 | 3300005617 | Bacteria | 23669 |
| 292 | Ga0068859_100005041 | 3300005617 | Bacteria | 13404 |
| 293 | Ga0068859_100023535 | 3300005617 | Bacteria | 6181 |
| 294 | Ga0068859_100027160 | 3300005617 | Bacteria | 5743 |
| 295 | Ga0068859_100033265 | 3300005617 | Bacteria | 5178 |
| 296 | Ga0068859_100126907 | 3300005617 | Bacteria | 2621 |
| 297 | Ga0068859_100128172 | 3300005617 | Bacteria | 2608 |
| 298 | Ga0068864_100000365 | 3300005618 | Bacteria | 39562 |
| 299 | Ga0068864_100005574 | 3300005618 | Bacteria | 10321 |
| 300 | Ga0068864_100033367 | 3300005618 | Bacteria | 4376 |
| 301 | Ga0068864_100034309 | 3300005618 | Bacteria | 4315 |
| 302 | Ga0068866_10018183 | 3300005718 | Bacteria | 3174 |
| 303 | Ga0068866_10160338 | 3300005718 | Bacteria | 1311 |
| 304 | Ga0068861_100000654 | 3300005719 | Bacteria | 20566 |
| 305 | Ga0068861_100004095 | 3300005719 | Bacteria | 9773 |
| 306 | Ga0068861_100072427 | 3300005719 | Bacteria | 2673 |
| 307 | Ga0068861_100109272 | 3300005719 | Bacteria | 2213 |
| 308 | Ga0068861_100180278 | 3300005719 | Bacteria | 1758 |
| 309 | Ga0068851_10001795 | 3300005834 | Bacteria | 9394 |
| 310 | Ga0068851_10017743 | 3300005834 | Bacteria | 3423 |
| 311 | Ga0068870_10009255 | 3300005840 | Bacteria | 4473 |
| 312 | Ga0068863_100011694 | 3300005841 | Bacteria | 8487 |
| 313 | Ga0068863_100014739 | 3300005841 | Bacteria | 7521 |
| 314 | Ga0068863_100027447 | 3300005841 | Bacteria | 5430 |
| 315 | Ga0068863_100037388 | 3300005841 | Bacteria | 4622 |
| 316 | Ga0068863_100047519 | 3300005841 | Bacteria | 4070 |
| 317 | Ga0068863_100206010 | 3300005841 | Bacteria | 1893 |
| 318 | Ga0068858_100000738 | 3300005842 | Bacteria | 34250 |
| 319 | Ga0068858_100016017 | 3300005842 | Bacteria | 7041 |
| 320 | Ga0068858_100038510 | 3300005842 | Bacteria | 4435 |
| 321 | Ga0068858_100038617 | 3300005842 | Bacteria | 4429 |
| 322 | Ga0068858_100042577 | 3300005842 | Bacteria | 4210 |
| 323 | Ga0068858_100110531 | 3300005842 | Bacteria | 2566 |
| 324 | Ga0068858_100135674 | 3300005842 | Bacteria | 2309 |
| 325 | Ga0068858_100212532 | 3300005842 | Bacteria | 1831 |
| 326 | Ga0068858_100269925 | 3300005842 | Bacteria | 1619 |
| 327 | Ga0068860_100000101 | 3300005843 | Bacteria | 142856 |
| 328 | Ga0068860_100000602 | 3300005843 | Bacteria | 42928 |
| 329 | Ga0068860_100018313 | 3300005843 | Bacteria | 6814 |
| 330 | Ga0068860_100071506 | 3300005843 | Bacteria | 3297 |
| 331 | Ga0068860_100105526 | 3300005843 | Bacteria | 2691 |
| 332 | Ga0068860_100169807 | 3300005843 | Bacteria | 2106 |
| 333 | Ga0068860_100275266 | 3300005843 | Bacteria | 1644 |
| 334 | Ga0068862_100004504 | 3300005844 | Bacteria | 11751 |
| 335 | Ga0068862_100021693 | 3300005844 | Bacteria | 5371 |
| 336 | Ga0068862_100028032 | 3300005844 | Bacteria | 4743 |
| 337 | Ga0068862_100032137 | 3300005844 | Bacteria | 4434 |
| 338 | Ga0068862_100057123 | 3300005844 | Bacteria | 3345 |
| 339 | Ga0068862_100110564 | 3300005844 | Bacteria | 2411 |
| 340 | Ga0081455_10008730 | 3300005937 | Bacteria | 10495 |
| 341 | Ga0081455_10027965 | 3300005937 | Bacteria | 5158 |
| 342 | Ga0081540_1003649 | 3300005983 | Bacteria | 12076 |
| 343 | Ga0081540_1008233 | 3300005983 | Bacteria | 7307 |
| 344 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 345 | Ga0081539_10001407 | 3300005985 | Bacteria | 41418 |
| 346 | Ga0081539_10006668 | 3300005985 | Bacteria | 10929 |
| 347 | Ga0081539_10045408 | 3300005985 | Bacteria | 2527 |
| 348 | Ga0070717_10090988 | 3300006028 | Bacteria | 2575 |
| 349 | Ga0075368_10039532 | 3300006042 | Bacteria | 1849 |
| 350 | Ga0070715_10034825 | 3300006163 | Bacteria | 2067 |
| 351 | Ga0070716_100008627 | 3300006173 | Bacteria | 5065 |
| 352 | Ga0070716_100039217 | 3300006173 | Bacteria | 2628 |
| 353 | Ga0070712_100012323 | 3300006175 | Bacteria | 5433 |
| 354 | Ga0070712_100044445 | 3300006175 | Bacteria | 3063 |
| 355 | Ga0075362_10016232 | 3300006177 | Bacteria | 3046 |
| 356 | Ga0075367_10020407 | 3300006178 | Bacteria | 3689 |
| 357 | Ga0075369_10034115 | 3300006186 | Bacteria | 2159 |
| 358 | Ga0075366_10002354 | 3300006195 | Bacteria | 9680 |
| 359 | Ga0075366_10020394 | 3300006195 | Bacteria | 3846 |
| 360 | Ga0075366_10045457 | 3300006195 | Bacteria | 2602 |
| 361 | Ga0075366_10056364 | 3300006195 | Bacteria | 2334 |
| 362 | Ga0075366_10060174 | 3300006195 | Bacteria | 2256 |
| 363 | Ga0075366_10071982 | 3300006195 | Bacteria | 2060 |
| 364 | Ga0075366_10079395 | 3300006195 | Bacteria | 1959 |
| 365 | Ga0075366_10085256 | 3300006195 | Bacteria | 1889 |
| 366 | Ga0097621_100001636 | 3300006237 | Bacteria | 15349 |
| 367 | Ga0097621_100022241 | 3300006237 | Bacteria | 4920 |
| 368 | Ga0097621_100025888 | 3300006237 | Bacteria | 4595 |
| 369 | Ga0097621_100039233 | 3300006237 | Bacteria | 3803 |
| 370 | Ga0097621_100083635 | 3300006237 | Bacteria | 2660 |
| 371 | Ga0097621_100221579 | 3300006237 | Bacteria | 1648 |
| 372 | Ga0097621_100276649 | 3300006237 | Bacteria | 1477 |
| 373 | Ga0097621_100290580 | 3300006237 | Bacteria | 1441 |
| 374 | Ga0075370_10003026 | 3300006353 | Bacteria | 7925 |
| 375 | Ga0075370_10022952 | 3300006353 | Bacteria | 3432 |
| 376 | Ga0075370_10041483 | 3300006353 | Bacteria | 2598 |
| 377 | Ga0068871_100019604 | 3300006358 | Bacteria | 5167 |
| 378 | Ga0068871_100047818 | 3300006358 | Bacteria | 3451 |
| 379 | Ga0068871_100051822 | 3300006358 | Bacteria | 3323 |
| 380 | Ga0068871_100061257 | 3300006358 | Bacteria | 3072 |
| 381 | Ga0068871_100067090 | 3300006358 | Bacteria | 2942 |
| 382 | Ga0068871_100161611 | 3300006358 | Bacteria | 1916 |
| 383 | Ga0075428_100195429 | 3300006844 | Bacteria | 2188 |
| 384 | Ga0075430_100017933 | 3300006846 | Bacteria | 6024 |
| 385 | Ga0075431_100422198 | 3300006847 | Bacteria | 1333 |
| 386 | Ga0075434_100014097 | 3300006871 | Bacteria | 7633 |
| 387 | Ga0075434_100183202 | 3300006871 | Bacteria | 2115 |
| 388 | Ga0075434_100422475 | 3300006871 | Bacteria | 1354 |
| 389 | Ga0068865_100002296 | 3300006881 | Bacteria | 11265 |
| 390 | Ga0068865_100118490 | 3300006881 | Bacteria | 1964 |
| 391 | Ga0068865_100130634 | 3300006881 | Bacteria | 1881 |
| 392 | Ga0097620_100001521 | 3300006931 | Bacteria | 23669 |
| 393 | Ga0097620_100005041 | 3300006931 | Bacteria | 13404 |
| 394 | Ga0097620_100023534 | 3300006931 | Bacteria | 6181 |
| 395 | Ga0097620_100027159 | 3300006931 | Bacteria | 5743 |
| 396 | Ga0097620_100033265 | 3300006931 | Bacteria | 5178 |
| 397 | Ga0097620_100126910 | 3300006931 | Bacteria | 2621 |
| 398 | Ga0097620_100128181 | 3300006931 | Bacteria | 2608 |
| 399 | Ga0079104_1000724 | 3300006946 | Bacteria | 29488 |
| 400 | Ga0105250_10014017 | 3300009092 | Bacteria | 3300 |
| 401 | Ga0105250_10024702 | 3300009092 | Bacteria | 2420 |
| 402 | Ga0105240_10000369 | 3300009093 | Bacteria | 84513 |
| 403 | Ga0105240_10001549 | 3300009093 | Bacteria | 39012 |
| 404 | Ga0105240_10003856 | 3300009093 | Bacteria | 23162 |
| 405 | Ga0105240_10017113 | 3300009093 | Bacteria | 9788 |
| 406 | Ga0105240_10028585 | 3300009093 | Bacteria | 7279 |
| 407 | Ga0105240_10205200 | 3300009093 | Bacteria | 2307 |
| 408 | Ga0105240_10274468 | 3300009093 | Bacteria | 1940 |
| 409 | Ga0105245_10000304 | 3300009098 | Bacteria | 47231 |
| 410 | Ga0105245_10007246 | 3300009098 | Bacteria | 9713 |
| 411 | Ga0105247_10012839 | 3300009101 | Bacteria | 5027 |
| 412 | Ga0105247_10014160 | 3300009101 | Bacteria | 4784 |
| 413 | Ga0105247_10136194 | 3300009101 | Bacteria | 1605 |
| 414 | Ga0114129_10008622 | 3300009147 | Bacteria | 14537 |
| 415 | Ga0114129_10693764 | 3300009147 | Bacteria | 1309 |
| 416 | Ga0105243_10001818 | 3300009148 | Bacteria | 18256 |
| 417 | Ga0105243_10004635 | 3300009148 | Bacteria | 10832 |
| 418 | Ga0105243_10015365 | 3300009148 | Bacteria | 5791 |
| 419 | Ga0105241_10213251 | 3300009174 | Bacteria | 1619 |
| 420 | Ga0105241_10273242 | 3300009174 | Bacteria | 1441 |
| 421 | Ga0105242_10014388 | 3300009176 | Bacteria | 6130 |
| 422 | Ga0105248_10003092 | 3300009177 | Bacteria | 18448 |
| 423 | Ga0105248_10016194 | 3300009177 | Bacteria | 8205 |
| 424 | Ga0105248_10020577 | 3300009177 | Bacteria | 7312 |
| 425 | Ga0105248_10126259 | 3300009177 | Bacteria | 2886 |
| 426 | Ga0105248_10217614 | 3300009177 | Bacteria | 2151 |
| 427 | Ga0105237_10000102 | 3300009545 | Bacteria | 118684 |
| 428 | Ga0105237_10003670 | 3300009545 | Bacteria | 18091 |
| 429 | Ga0105237_10003738 | 3300009545 | Bacteria | 17928 |
| 430 | Ga0105237_10006549 | 3300009545 | Bacteria | 12884 |
| 431 | Ga0105237_10082720 | 3300009545 | Bacteria | 3201 |
| 432 | Ga0105237_10122526 | 3300009545 | Bacteria | 2594 |
| 433 | Ga0105238_10004877 | 3300009551 | Bacteria | 13269 |
| 434 | Ga0105238_10005947 | 3300009551 | Bacteria | 12095 |
| 435 | Ga0105238_10008650 | 3300009551 | Bacteria | 10187 |
| 436 | Ga0105238_10017238 | 3300009551 | Bacteria | 7338 |
| 437 | Ga0105238_10071110 | 3300009551 | Bacteria | 3476 |
| 438 | Ga0105238_10209044 | 3300009551 | Bacteria | 1927 |
| 439 | Ga0105238_10224467 | 3300009551 | Bacteria | 1855 |
| 440 | Ga0105249_10079548 | 3300009553 | Bacteria | 3043 |
| 441 | Ga0105249_10340160 | 3300009553 | Bacteria | 1517 |
| 442 | Ga0105249_10508969 | 3300009553 | Bacteria | 1250 |
| 443 | Ga0105239_10004222 | 3300010375 | Bacteria | 17259 |
| 444 | Ga0105239_10005317 | 3300010375 | Bacteria | 15112 |
| 445 | Ga0105239_10023690 | 3300010375 | Bacteria | 6758 |
| 446 | Ga0105239_10060721 | 3300010375 | Bacteria | 4149 |
| 447 | Ga0105239_10072813 | 3300010375 | Bacteria | 3778 |
| 448 | Ga0105239_10233481 | 3300010375 | Bacteria | 2064 |
| 449 | Ga0105239_10243732 | 3300010375 | Bacteria | 2018 |
| 450 | Ga0105239_10345655 | 3300010375 | Bacteria | 1679 |
| 451 | Ga0105246_10128394 | 3300011119 | Bacteria | 1890 |
| 452 | Ga0105246_10149026 | 3300011119 | Bacteria | 1769 |
| 453 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 454 | Ga0157373_10038570 | 3300013100 | Bacteria | 3424 |
| 455 | Ga0157373_10046395 | 3300013100 | Bacteria | 3100 |
| 456 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 457 | Ga0157371_10001396 | 3300013102 | Bacteria | 25235 |
| 458 | Ga0157370_10003812 | 3300013104 | Bacteria | 17590 |
| 459 | Ga0157370_10077047 | 3300013104 | Bacteria | 3141 |
| 460 | Ga0157370_10077682 | 3300013104 | Bacteria | 3127 |
| 461 | Ga0157370_10102792 | 3300013104 | Bacteria | 2675 |
| 462 | Ga0157370_10133981 | 3300013104 | Bacteria | 2310 |
| 463 | Ga0157370_10205156 | 3300013104 | Bacteria | 1828 |
| 464 | Ga0157369_10015817 | 3300013105 | Bacteria | 8498 |
| 465 | Ga0157369_10062589 | 3300013105 | Bacteria | 4009 |
| 466 | Ga0157369_10120918 | 3300013105 | Bacteria | 2779 |
| 467 | Ga0157374_10030166 | 3300013296 | Bacteria | 4920 |
| 468 | Ga0157374_10037518 | 3300013296 | Bacteria | 4448 |
| 469 | Ga0157374_10214331 | 3300013296 | Bacteria | 1889 |
| 470 | Ga0157374_10281971 | 3300013296 | Bacteria | 1641 |
| 471 | Ga0157374_10370200 | 3300013296 | Bacteria | 1426 |
| 472 | Ga0157374_10456079 | 3300013296 | Bacteria | 1280 |
| 473 | Ga0157378_10001074 | 3300013297 | Bacteria | 24973 |
| 474 | Ga0157378_10005793 | 3300013297 | Bacteria | 10829 |
| 475 | Ga0157378_10039983 | 3300013297 | Bacteria | 4160 |
| 476 | Ga0157378_10232360 | 3300013297 | Bacteria | 1758 |
| 477 | Ga0163162_10000673 | 3300013306 | Bacteria | 31751 |
| 478 | Ga0163162_10027327 | 3300013306 | Bacteria | 5642 |
| 479 | Ga0163162_10028459 | 3300013306 | Bacteria | 5530 |
| 480 | Ga0163162_10166561 | 3300013306 | Bacteria | 2328 |
| 481 | Ga0163162_10403665 | 3300013306 | Bacteria | 1499 |
| 482 | Ga0157372_10002169 | 3300013307 | Bacteria | 21364 |
| 483 | Ga0157372_10003163 | 3300013307 | Bacteria | 17748 |
| 484 | Ga0157372_10065457 | 3300013307 | Bacteria | 4081 |
| 485 | Ga0157372_10073975 | 3300013307 | Bacteria | 3841 |
| 486 | Ga0157372_10110633 | 3300013307 | Bacteria | 3147 |
| 487 | Ga0157372_10195141 | 3300013307 | Bacteria | 2345 |
| 488 | Ga0157372_10238262 | 3300013307 | Bacteria | 2111 |
| 489 | Ga0157372_10299267 | 3300013307 | Bacteria | 1871 |
| 490 | Ga0157372_10604190 | 3300013307 | Bacteria | 1278 |
| 491 | Ga0157375_10000903 | 3300013308 | Bacteria | 25828 |
| 492 | Ga0157375_10025478 | 3300013308 | Bacteria | 5497 |
| 493 | Ga0157375_10034886 | 3300013308 | Bacteria | 4796 |
| 494 | Ga0157375_10058213 | 3300013308 | Bacteria | 3823 |
| 495 | Ga0157375_10064446 | 3300013308 | Bacteria | 3648 |
| 496 | Ga0157375_10109092 | 3300013308 | Bacteria | 2864 |
| 497 | Ga0157375_10136678 | 3300013308 | Bacteria | 2576 |
| 498 | Ga0157375_10247396 | 3300013308 | Bacteria | 1943 |
| 499 | Ga0163163_10021170 | 3300014325 | Bacteria | 6133 |
| 500 | Ga0163163_10112854 | 3300014325 | Bacteria | 2747 |
| 501 | Ga0163163_10194059 | 3300014325 | Bacteria | 2078 |
| 502 | Ga0163163_10230312 | 3300014325 | Bacteria | 1902 |
| 503 | Ga0157380_10028852 | 3300014326 | Bacteria | 4236 |
| 504 | Ga0157380_10184998 | 3300014326 | Bacteria | 1834 |
| 505 | Ga0157380_10188195 | 3300014326 | Bacteria | 1820 |
| 506 | Ga0157377_10000020 | 3300014745 | Bacteria | 151620 |
| 507 | Ga0157377_10001422 | 3300014745 | Bacteria | 10332 |
| 508 | Ga0157377_10169970 | 3300014745 | Bacteria | 1363 |
| 509 | Ga0157379_10001219 | 3300014968 | Bacteria | 20902 |
| 510 | Ga0157379_10010297 | 3300014968 | Bacteria | 8141 |
| 511 | Ga0157379_10020285 | 3300014968 | Bacteria | 5876 |
| 512 | Ga0157379_10029133 | 3300014968 | Bacteria | 4911 |
| 513 | Ga0157379_10066515 | 3300014968 | Bacteria | 3222 |
| 514 | Ga0157379_10314292 | 3300014968 | Bacteria | 1429 |
| 515 | Ga0157379_10355302 | 3300014968 | Bacteria | 1342 |
| 516 | Ga0157376_10015296 | 3300014969 | Bacteria | 5792 |
| 517 | Ga0157376_10016372 | 3300014969 | Bacteria | 5628 |
| 518 | Ga0157376_10027198 | 3300014969 | Bacteria | 4531 |
| 519 | Ga0157376_10047085 | 3300014969 | Bacteria | 3559 |
| 520 | Ga0182006_1000802 | 3300015261 | Bacteria | 21095 |
| 521 | Ga0182007_10005892 | 3300015262 | Bacteria | 5323 |
| 522 | Ga0182005_1004230 | 3300015265 | Bacteria | 4684 |
| 523 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 524 | Ga0183361_10005 | 3300016635 | Bacteria | 413599 |
| 525 | Ga0163161_10029083 | 3300017792 | Bacteria | 3927 |
| 526 | Ga0163161_10070546 | 3300017792 | Bacteria | 2554 |
| 527 | Ga0163161_10088500 | 3300017792 | Bacteria | 2289 |
| 528 | Ga0213872_10000547 | 3300021361 | Bacteria | 29250 |
| 529 | Ga0213872_10007605 | 3300021361 | Bacteria | 5314 |
| 530 | Ga0213872_10036381 | 3300021361 | Bacteria | 2250 |
| 531 | Ga0213876_10001330 | 3300021384 | Bacteria | 15523 |
| 532 | Ga0213876_10003361 | 3300021384 | Bacteria | 9159 |
| 533 | Ga0213876_10003916 | 3300021384 | Bacteria | 8411 |
| 534 | Ga0213875_10007526 | 3300021388 | Bacteria | 5615 |
| 535 | Ga0209784_100025 | 3300025224 | Bacteria | 376681 |
| 536 | Ga0209566_100025 | 3300025225 | Bacteria | 376681 |
| 537 | Ga0209674_100042 | 3300025226 | Bacteria | 376681 |
| 538 | Ga0209672_106442 | 3300025228 | Bacteria | 1905 |
| 539 | Ga0209563_100046 | 3300025230 | Bacteria | 376681 |
| 540 | Ga0209258_102632 | 3300025242 | Bacteria | 4459 |
| 541 | Ga0207425_1001488 | 3300025245 | Bacteria | 9731 |
| 542 | Ga0209677_100027 | 3300025253 | Bacteria | 376681 |
| 543 | Ga0209677_100280 | 3300025253 | Bacteria | 34034 |
| 544 | Ga0209129_1002187 | 3300025258 | Bacteria | 9834 |
| 545 | Ga0209129_1015638 | 3300025258 | Bacteria | 1554 |
| 546 | Ga0209233_1002090 | 3300025261 | Bacteria | 7536 |
| 547 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 548 | Ga0209565_1000086 | 3300025263 | Bacteria | 152204 |
| 549 | Ga0209565_1007495 | 3300025263 | Bacteria | 2937 |
| 550 | Ga0209455_1000337 | 3300025272 | Bacteria | 44758 |
| 551 | Ga0209455_1001166 | 3300025272 | Bacteria | 12650 |
| 552 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 553 | Ga0209130_1001292 | 3300025284 | Bacteria | 17284 |
| 554 | Ga0209130_1002441 | 3300025284 | Bacteria | 9309 |
| 555 | Ga0207673_1003069 | 3300025290 | Bacteria | 1940 |
| 556 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 557 | Ga0209675_1000510 | 3300025291 | Bacteria | 28831 |
| 558 | Ga0209675_1001661 | 3300025291 | Bacteria | 12382 |
| 559 | Ga0209675_1001682 | 3300025291 | Bacteria | 12287 |
| 560 | Ga0209675_1001762 | 3300025291 | Bacteria | 11860 |
| 561 | Ga0209675_1002042 | 3300025291 | Bacteria | 10779 |
| 562 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 563 | Ga0209676_1000026 | 3300025292 | Bacteria | 574599 |
| 564 | Ga0209676_1000172 | 3300025292 | Bacteria | 153664 |
| 565 | Ga0209676_1010011 | 3300025292 | Bacteria | 4010 |
| 566 | Ga0209025_1000059 | 3300025294 | Bacteria | 305480 |
| 567 | Ga0209025_1000380 | 3300025294 | Bacteria | 92360 |
| 568 | Ga0209025_1000550 | 3300025294 | Bacteria | 70073 |
| 569 | Ga0209025_1005956 | 3300025294 | Bacteria | 9704 |
| 570 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 571 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 572 | Ga0209564_1000814 | 3300025295 | Bacteria | 42501 |
| 573 | Ga0209564_1001766 | 3300025295 | Bacteria | 20140 |
| 574 | Ga0209564_1002095 | 3300025295 | Bacteria | 17070 |
| 575 | Ga0209758_1000122 | 3300025297 | Bacteria | 190970 |
| 576 | Ga0209758_1004631 | 3300025297 | Bacteria | 11269 |
| 577 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 578 | Ga0209050_1000082 | 3300025298 | Bacteria | 266864 |
| 579 | Ga0209050_1000509 | 3300025298 | Bacteria | 65792 |
| 580 | Ga0209050_1004407 | 3300025298 | Bacteria | 9528 |
| 581 | Ga0209050_1005094 | 3300025298 | Bacteria | 8472 |
| 582 | Ga0209050_1019763 | 3300025298 | Bacteria | 2542 |
| 583 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 584 | Ga0209256_1000086 | 3300025299 | Bacteria | 218837 |
| 585 | Ga0209256_1000177 | 3300025299 | Bacteria | 125603 |
| 586 | Ga0209256_1000314 | 3300025299 | Bacteria | 84164 |
| 587 | Ga0209256_1003909 | 3300025299 | Bacteria | 9850 |
| 588 | Ga0207426_1000264 | 3300025302 | Bacteria | 110747 |
| 589 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 590 | Ga0209051_1000029 | 3300025303 | Bacteria | 403675 |
| 591 | Ga0209051_1000055 | 3300025303 | Bacteria | 277194 |
| 592 | Ga0209051_1000074 | 3300025303 | Bacteria | 208667 |
| 593 | Ga0209051_1000096 | 3300025303 | Bacteria | 167399 |
| 594 | Ga0209051_1007768 | 3300025303 | Bacteria | 5803 |
| 595 | Ga0209051_1027528 | 3300025303 | Bacteria | 2263 |
| 596 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 597 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 598 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 599 | Ga0209257_1000101 | 3300025304 | Bacteria | 251553 |
| 600 | Ga0209257_1000131 | 3300025304 | Bacteria | 211464 |
| 601 | Ga0209257_1000347 | 3300025304 | Bacteria | 95122 |
| 602 | Ga0209257_1008032 | 3300025304 | Bacteria | 6148 |
| 603 | Ga0207697_10003899 | 3300025315 | Bacteria | 7274 |
| 604 | Ga0207656_10008913 | 3300025321 | Bacteria | 3716 |
| 605 | Ga0207656_10013605 | 3300025321 | Bacteria | 3115 |
| 606 | Ga0207656_10063702 | 3300025321 | Bacteria | 1623 |
| 607 | Ga0207696_1016362 | 3300025711 | Bacteria | 2482 |
| 608 | Ga0207682_10000076 | 3300025893 | Bacteria | 43305 |
| 609 | Ga0207682_10041995 | 3300025893 | Bacteria | 1867 |
| 610 | Ga0207692_10000738 | 3300025898 | Bacteria | 11534 |
| 611 | Ga0207688_10019333 | 3300025901 | Bacteria | 3709 |
| 612 | Ga0207688_10022933 | 3300025901 | Bacteria | 3416 |
| 613 | Ga0207680_10041485 | 3300025903 | Bacteria | 2685 |
| 614 | Ga0207680_10067513 | 3300025903 | Bacteria | 2203 |
| 615 | Ga0207680_10181731 | 3300025903 | Bacteria | 1423 |
| 616 | Ga0207647_10068431 | 3300025904 | Bacteria | 2149 |
| 617 | Ga0207647_10085467 | 3300025904 | Bacteria | 1887 |
| 618 | Ga0207685_10025834 | 3300025905 | Bacteria | 2033 |
| 619 | Ga0207699_10000465 | 3300025906 | Bacteria | 20602 |
| 620 | Ga0207699_10020690 | 3300025906 | Bacteria | 3532 |
| 621 | Ga0207645_10001421 | 3300025907 | Bacteria | 19600 |
| 622 | Ga0207645_10003433 | 3300025907 | Bacteria | 12042 |
| 623 | Ga0207645_10011482 | 3300025907 | Bacteria | 6045 |
| 624 | Ga0207645_10028308 | 3300025907 | Bacteria | 3618 |
| 625 | Ga0207645_10179074 | 3300025907 | Bacteria | 1390 |
| 626 | Ga0207645_10218132 | 3300025907 | Bacteria | 1257 |
| 627 | Ga0207643_10000904 | 3300025908 | Bacteria | 17745 |
| 628 | Ga0207643_10021409 | 3300025908 | Bacteria | 3552 |
| 629 | Ga0207643_10141620 | 3300025908 | Bacteria | 1436 |
| 630 | Ga0207705_10026384 | 3300025909 | Bacteria | 4143 |
| 631 | Ga0207684_10043697 | 3300025910 | Bacteria | 3799 |
| 632 | Ga0207684_10086433 | 3300025910 | Bacteria | 2671 |
| 633 | Ga0207707_10002364 | 3300025912 | Bacteria | 17002 |
| 634 | Ga0207707_10006120 | 3300025912 | Bacteria | 10516 |
| 635 | Ga0207707_10223708 | 3300025912 | Bacteria | 1638 |
| 636 | Ga0207707_10381337 | 3300025912 | Bacteria | 1212 |
| 637 | Ga0207695_10000923 | 3300025913 | Bacteria | 52620 |
| 638 | Ga0207695_10019147 | 3300025913 | Bacteria | 7888 |
| 639 | Ga0207695_10037106 | 3300025913 | Bacteria | 5260 |
| 640 | Ga0207695_10328926 | 3300025913 | Bacteria | 1417 |
| 641 | Ga0207671_10000201 | 3300025914 | Bacteria | 91167 |
| 642 | Ga0207671_10006455 | 3300025914 | Bacteria | 10440 |
| 643 | Ga0207671_10021491 | 3300025914 | Bacteria | 4895 |
| 644 | Ga0207693_10001447 | 3300025915 | Bacteria | 21016 |
| 645 | Ga0207693_10002285 | 3300025915 | Bacteria | 16669 |
| 646 | Ga0207693_10003980 | 3300025915 | Bacteria | 12554 |
| 647 | Ga0207693_10016361 | 3300025915 | Bacteria | 5929 |
| 648 | Ga0207663_10004872 | 3300025916 | Bacteria | 6718 |
| 649 | Ga0207663_10014014 | 3300025916 | Bacteria | 4377 |
| 650 | Ga0207663_10096804 | 3300025916 | Bacteria | 1972 |
| 651 | Ga0207663_10137224 | 3300025916 | Bacteria | 1699 |
| 652 | Ga0207663_10154064 | 3300025916 | Bacteria | 1615 |
| 653 | Ga0207662_10000340 | 3300025918 | Bacteria | 21083 |
| 654 | Ga0207662_10076027 | 3300025918 | Bacteria | 2040 |
| 655 | Ga0207657_10001161 | 3300025919 | Bacteria | 28036 |
| 656 | Ga0207657_10001611 | 3300025919 | Bacteria | 24269 |
| 657 | Ga0207649_10019565 | 3300025920 | Bacteria | 3871 |
| 658 | Ga0207649_10028161 | 3300025920 | Bacteria | 3306 |
| 659 | Ga0207652_10009390 | 3300025921 | Bacteria | 7865 |
| 660 | Ga0207652_10032624 | 3300025921 | Bacteria | 4380 |
| 661 | Ga0207652_10043028 | 3300025921 | Bacteria | 3845 |
| 662 | Ga0207652_10226530 | 3300025921 | Bacteria | 1685 |
| 663 | Ga0207652_10294907 | 3300025921 | Bacteria | 1463 |
| 664 | Ga0207646_10046772 | 3300025922 | Bacteria | 3882 |
| 665 | Ga0207681_10002291 | 3300025923 | Bacteria | 12161 |
| 666 | Ga0207681_10039259 | 3300025923 | Bacteria | 3142 |
| 667 | Ga0207681_10082670 | 3300025923 | Bacteria | 2271 |
| 668 | Ga0207681_10083909 | 3300025923 | Bacteria | 2256 |
| 669 | Ga0207694_10003707 | 3300025924 | Bacteria | 12098 |
| 670 | Ga0207694_10004641 | 3300025924 | Bacteria | 10694 |
| 671 | Ga0207694_10041991 | 3300025924 | Bacteria | 3526 |
| 672 | Ga0207694_10091014 | 3300025924 | Bacteria | 2407 |
| 673 | Ga0207694_10187123 | 3300025924 | Bacteria | 1681 |
| 674 | Ga0207694_10378800 | 3300025924 | Bacteria | 1174 |
| 675 | Ga0207650_10000326 | 3300025925 | Bacteria | 46321 |
| 676 | Ga0207650_10022991 | 3300025925 | Bacteria | 4417 |
| 677 | Ga0207650_10024020 | 3300025925 | Bacteria | 4328 |
| 678 | Ga0207650_10051006 | 3300025925 | Bacteria | 3061 |
| 679 | Ga0207650_10056708 | 3300025925 | Bacteria | 2912 |
| 680 | Ga0207650_10096005 | 3300025925 | Bacteria | 2273 |
| 681 | Ga0207659_10000299 | 3300025926 | Bacteria | 29997 |
| 682 | Ga0207659_10002670 | 3300025926 | Bacteria | 10630 |
| 683 | Ga0207659_10025069 | 3300025926 | Bacteria | 4003 |
| 684 | Ga0207659_10029291 | 3300025926 | Bacteria | 3751 |
| 685 | Ga0207659_10116489 | 3300025926 | Bacteria | 2040 |
| 686 | Ga0207659_10195984 | 3300025926 | Bacteria | 1610 |
| 687 | Ga0207659_10216757 | 3300025926 | Bacteria | 1537 |
| 688 | Ga0207687_10000963 | 3300025927 | Bacteria | 19570 |
| 689 | Ga0207687_10006397 | 3300025927 | Bacteria | 7785 |
| 690 | Ga0207700_10000035 | 3300025928 | Bacteria | 119648 |
| 691 | Ga0207700_10299117 | 3300025928 | Bacteria | 1389 |
| 692 | Ga0207700_10458174 | 3300025928 | Bacteria | 1125 |
| 693 | Ga0207664_10027742 | 3300025929 | Bacteria | 4297 |
| 694 | Ga0207664_10156051 | 3300025929 | Bacteria | 1943 |
| 695 | Ga0207644_10001354 | 3300025931 | Bacteria | 15752 |
| 696 | Ga0207644_10013170 | 3300025931 | Bacteria | 5508 |
| 697 | Ga0207644_10013287 | 3300025931 | Bacteria | 5485 |
| 698 | Ga0207644_10018325 | 3300025931 | Bacteria | 4734 |
| 699 | Ga0207644_10127407 | 3300025931 | Bacteria | 1945 |
| 700 | Ga0207644_10233436 | 3300025931 | Bacteria | 1462 |
| 701 | Ga0207644_10254365 | 3300025931 | Bacteria | 1402 |
| 702 | Ga0207690_10000957 | 3300025932 | Bacteria | 18474 |
| 703 | Ga0207690_10013743 | 3300025932 | Bacteria | 4874 |
| 704 | Ga0207690_10015013 | 3300025932 | Bacteria | 4688 |
| 705 | Ga0207706_10000267 | 3300025933 | Bacteria | 56832 |
| 706 | Ga0207706_10052609 | 3300025933 | Bacteria | 3595 |
| 707 | Ga0207706_10091118 | 3300025933 | Bacteria | 2681 |
| 708 | Ga0207706_10139430 | 3300025933 | Bacteria | 2133 |
| 709 | Ga0207706_10188407 | 3300025933 | Bacteria | 1811 |
| 710 | Ga0207706_10296846 | 3300025933 | Bacteria | 1408 |
| 711 | Ga0207686_10050543 | 3300025934 | Bacteria | 2585 |
| 712 | Ga0207686_10245493 | 3300025934 | Bacteria | 1305 |
| 713 | Ga0207709_10000172 | 3300025935 | Bacteria | 86654 |
| 714 | Ga0207709_10003347 | 3300025935 | Bacteria | 9594 |
| 715 | Ga0207709_10085856 | 3300025935 | Bacteria | 2041 |
| 716 | Ga0207709_10089506 | 3300025935 | Bacteria | 2007 |
| 717 | Ga0207670_10000064 | 3300025936 | Bacteria | 75795 |
| 718 | Ga0207670_10005667 | 3300025936 | Bacteria | 6874 |
| 719 | Ga0207670_10007685 | 3300025936 | Bacteria | 6039 |
| 720 | Ga0207670_10021513 | 3300025936 | Bacteria | 3981 |
| 721 | Ga0207670_10029379 | 3300025936 | Bacteria | 3501 |
| 722 | Ga0207669_10013588 | 3300025937 | Bacteria | 4050 |
| 723 | Ga0207669_10021010 | 3300025937 | Bacteria | 3436 |
| 724 | Ga0207669_10060872 | 3300025937 | Bacteria | 2317 |
| 725 | Ga0207669_10063459 | 3300025937 | Bacteria | 2280 |
| 726 | Ga0207669_10076252 | 3300025937 | Bacteria | 2128 |
| 727 | Ga0207704_10008488 | 3300025938 | Bacteria | 4918 |
| 728 | Ga0207704_10155721 | 3300025938 | Bacteria | 1619 |
| 729 | Ga0207665_10002891 | 3300025939 | Bacteria | 11523 |
| 730 | Ga0207665_10025629 | 3300025939 | Bacteria | 3891 |
| 731 | Ga0207665_10096410 | 3300025939 | Bacteria | 2057 |
| 732 | Ga0207691_10000049 | 3300025940 | Bacteria | 94813 |
| 733 | Ga0207691_10004263 | 3300025940 | Bacteria | 13884 |
| 734 | Ga0207691_10005602 | 3300025940 | Bacteria | 12139 |
| 735 | Ga0207691_10007985 | 3300025940 | Bacteria | 10177 |
| 736 | Ga0207691_10010067 | 3300025940 | Bacteria | 9075 |
| 737 | Ga0207691_10012884 | 3300025940 | Bacteria | 8006 |
| 738 | Ga0207691_10017331 | 3300025940 | Bacteria | 6832 |
| 739 | Ga0207691_10020338 | 3300025940 | Bacteria | 6275 |
| 740 | Ga0207691_10027190 | 3300025940 | Bacteria | 5366 |
| 741 | Ga0207691_10028712 | 3300025940 | Bacteria | 5206 |
| 742 | Ga0207691_10050504 | 3300025940 | Bacteria | 3807 |
| 743 | Ga0207691_10190681 | 3300025940 | Bacteria | 1788 |
| 744 | Ga0207691_10201265 | 3300025940 | Bacteria | 1733 |
| 745 | Ga0207711_10001803 | 3300025941 | Bacteria | 19580 |
| 746 | Ga0207711_10016290 | 3300025941 | Bacteria | 6174 |
| 747 | Ga0207711_10026718 | 3300025941 | Bacteria | 4846 |
| 748 | Ga0207711_10034266 | 3300025941 | Bacteria | 4301 |
| 749 | Ga0207711_10094747 | 3300025941 | Bacteria | 2632 |
| 750 | Ga0207711_10221904 | 3300025941 | Bacteria | 1729 |
| 751 | Ga0207711_10234553 | 3300025941 | Bacteria | 1681 |
| 752 | Ga0207689_10004241 | 3300025942 | Bacteria | 13040 |
| 753 | Ga0207689_10007394 | 3300025942 | Bacteria | 9632 |
| 754 | Ga0207689_10007729 | 3300025942 | Bacteria | 9409 |
| 755 | Ga0207689_10016503 | 3300025942 | Bacteria | 6251 |
| 756 | Ga0207689_10070339 | 3300025942 | Bacteria | 2875 |
| 757 | Ga0207689_10075235 | 3300025942 | Bacteria | 2776 |
| 758 | Ga0207661_10000444 | 3300025944 | Bacteria | 26690 |
| 759 | Ga0207661_10003085 | 3300025944 | Bacteria | 11542 |
| 760 | Ga0207661_10213112 | 3300025944 | Bacteria | 1703 |
| 761 | Ga0207679_10007980 | 3300025945 | Bacteria | 6731 |
| 762 | Ga0207679_10050694 | 3300025945 | Bacteria | 3035 |
| 763 | Ga0207679_10120783 | 3300025945 | Bacteria | 2085 |
| 764 | Ga0207679_10234570 | 3300025945 | Bacteria | 1551 |
| 765 | Ga0207667_10003714 | 3300025949 | Bacteria | 18825 |
| 766 | Ga0207667_10009983 | 3300025949 | Bacteria | 11135 |
| 767 | Ga0207667_10032865 | 3300025949 | Bacteria | 5584 |
| 768 | Ga0207667_10066981 | 3300025949 | Bacteria | 3741 |
| 769 | Ga0207667_10218116 | 3300025949 | Bacteria | 1955 |
| 770 | Ga0207667_10308933 | 3300025949 | Bacteria | 1615 |
| 771 | Ga0207667_10514076 | 3300025949 | Bacteria | 1213 |
| 772 | Ga0207651_10000587 | 3300025960 | Bacteria | 15314 |
| 773 | Ga0207651_10000834 | 3300025960 | Bacteria | 13379 |
| 774 | Ga0207651_10012045 | 3300025960 | Bacteria | 4872 |
| 775 | Ga0207651_10015130 | 3300025960 | Bacteria | 4474 |
| 776 | Ga0207651_10021090 | 3300025960 | Bacteria | 3950 |
| 777 | Ga0207651_10030616 | 3300025960 | Bacteria | 3429 |
| 778 | Ga0207651_10032496 | 3300025960 | Bacteria | 3352 |
| 779 | Ga0207651_10033171 | 3300025960 | Bacteria | 3327 |
| 780 | Ga0207651_10080125 | 3300025960 | Bacteria | 2349 |
| 781 | Ga0207651_10101855 | 3300025960 | Bacteria | 2133 |
| 782 | Ga0207651_10268474 | 3300025960 | Bacteria | 1404 |
| 783 | Ga0207712_10020569 | 3300025961 | Bacteria | 4324 |
| 784 | Ga0207668_10025834 | 3300025972 | Bacteria | 3806 |
| 785 | Ga0207668_10034750 | 3300025972 | Bacteria | 3350 |
| 786 | Ga0207668_10080871 | 3300025972 | Bacteria | 2355 |
| 787 | Ga0207668_10202939 | 3300025972 | Bacteria | 1580 |
| 788 | Ga0207640_10022288 | 3300025981 | Bacteria | 3788 |
| 789 | Ga0207640_10059297 | 3300025981 | Bacteria | 2525 |
| 790 | Ga0207658_10006530 | 3300025986 | Bacteria | 7958 |
| 791 | Ga0207658_10019879 | 3300025986 | Bacteria | 4647 |
| 792 | Ga0207658_10038169 | 3300025986 | Bacteria | 3458 |
| 793 | Ga0207658_10096999 | 3300025986 | Bacteria | 2300 |
| 794 | Ga0207658_10107171 | 3300025986 | Bacteria | 2201 |
| 795 | Ga0207658_10347280 | 3300025986 | Bacteria | 1291 |
| 796 | Ga0207677_10001996 | 3300026023 | Bacteria | 10780 |
| 797 | Ga0207677_10040842 | 3300026023 | Bacteria | 3062 |
| 798 | Ga0207677_10053078 | 3300026023 | Bacteria | 2757 |
| 799 | Ga0207677_10109729 | 3300026023 | Bacteria | 2052 |
| 800 | Ga0207703_10002691 | 3300026035 | Bacteria | 15245 |
| 801 | Ga0207703_10003961 | 3300026035 | Bacteria | 12275 |
| 802 | Ga0207703_10010840 | 3300026035 | Bacteria | 7110 |
| 803 | Ga0207703_10115956 | 3300026035 | Bacteria | 2292 |
| 804 | Ga0207703_10165759 | 3300026035 | Bacteria | 1939 |
| 805 | Ga0207703_10314255 | 3300026035 | Bacteria | 1433 |
| 806 | Ga0207639_10082656 | 3300026041 | Bacteria | 2547 |
| 807 | Ga0207639_10107994 | 3300026041 | Bacteria | 2262 |
| 808 | Ga0207639_10135950 | 3300026041 | Bacteria | 2041 |
| 809 | Ga0207639_10137019 | 3300026041 | Bacteria | 2035 |
| 810 | Ga0207639_10161416 | 3300026041 | Bacteria | 1889 |
| 811 | Ga0207639_10313384 | 3300026041 | Bacteria | 1391 |
| 812 | Ga0207678_10001480 | 3300026067 | Bacteria | 21540 |
| 813 | Ga0207678_10009973 | 3300026067 | Bacteria | 8335 |
| 814 | Ga0207678_10351679 | 3300026067 | Bacteria | 1271 |
| 815 | Ga0207708_10002639 | 3300026075 | Bacteria | 13194 |
| 816 | Ga0207708_10110506 | 3300026075 | Bacteria | 2133 |
| 817 | Ga0207708_10245971 | 3300026075 | Bacteria | 1440 |
| 818 | Ga0207702_10021218 | 3300026078 | Bacteria | 5376 |
| 819 | Ga0207702_10062188 | 3300026078 | Bacteria | 3187 |
| 820 | Ga0207702_10101639 | 3300026078 | Bacteria | 2539 |
| 821 | Ga0207702_10183129 | 3300026078 | Bacteria | 1930 |
| 822 | Ga0207702_10266940 | 3300026078 | Bacteria | 1613 |
| 823 | Ga0207702_10275424 | 3300026078 | Bacteria | 1589 |
| 824 | Ga0207641_10002409 | 3300026088 | Bacteria | 17271 |
| 825 | Ga0207641_10011015 | 3300026088 | Bacteria | 7416 |
| 826 | Ga0207641_10112533 | 3300026088 | Bacteria | 2415 |
| 827 | Ga0207641_10166073 | 3300026088 | Bacteria | 2010 |
| 828 | Ga0207641_10363514 | 3300026088 | Bacteria | 1382 |
| 829 | Ga0207648_10000026 | 3300026089 | Bacteria | 131314 |
| 830 | Ga0207648_10000582 | 3300026089 | Bacteria | 40973 |
| 831 | Ga0207648_10000984 | 3300026089 | Bacteria | 32138 |
| 832 | Ga0207648_10002748 | 3300026089 | Bacteria | 18702 |
| 833 | Ga0207648_10006618 | 3300026089 | Bacteria | 11511 |
| 834 | Ga0207648_10022764 | 3300026089 | Bacteria | 5623 |
| 835 | Ga0207648_10109504 | 3300026089 | Bacteria | 2425 |
| 836 | Ga0207648_10114654 | 3300026089 | Bacteria | 2368 |
| 837 | Ga0207676_10003531 | 3300026095 | Bacteria | 11065 |
| 838 | Ga0207676_10006625 | 3300026095 | Bacteria | 8188 |
| 839 | Ga0207676_10032058 | 3300026095 | Bacteria | 3957 |
| 840 | Ga0207676_10042277 | 3300026095 | Bacteria | 3504 |
| 841 | Ga0207674_10002404 | 3300026116 | Bacteria | 23612 |
| 842 | Ga0207674_10002741 | 3300026116 | Bacteria | 21969 |
| 843 | Ga0207674_10010615 | 3300026116 | Bacteria | 10420 |
| 844 | Ga0207674_10017659 | 3300026116 | Bacteria | 7778 |
| 845 | Ga0207674_10024563 | 3300026116 | Bacteria | 6436 |
| 846 | Ga0207675_100000601 | 3300026118 | Bacteria | 35110 |
| 847 | Ga0207675_100001389 | 3300026118 | Bacteria | 24286 |
| 848 | Ga0207675_100023734 | 3300026118 | Bacteria | 5706 |
| 849 | Ga0207675_100035627 | 3300026118 | Bacteria | 4642 |
| 850 | Ga0207675_100043728 | 3300026118 | Bacteria | 4184 |
| 851 | Ga0207675_100078131 | 3300026118 | Bacteria | 3101 |
| 852 | Ga0207675_100087055 | 3300026118 | Bacteria | 2934 |
| 853 | Ga0207683_10001689 | 3300026121 | Bacteria | 19754 |
| 854 | Ga0207683_10006288 | 3300026121 | Bacteria | 10178 |
| 855 | Ga0207683_10007344 | 3300026121 | Bacteria | 9446 |
| 856 | Ga0207683_10016814 | 3300026121 | Bacteria | 6225 |
| 857 | Ga0207683_10044697 | 3300026121 | Bacteria | 3872 |
| 858 | Ga0207683_10071593 | 3300026121 | Bacteria | 3065 |
| 859 | Ga0207683_10109066 | 3300026121 | Bacteria | 2477 |
| 860 | Ga0207683_10319470 | 3300026121 | Bacteria | 1422 |
| 861 | Ga0207698_10010328 | 3300026142 | Bacteria | 5990 |
| 862 | Ga0207698_10112555 | 3300026142 | Bacteria | 2285 |
| 863 | Ga0207698_10164339 | 3300026142 | Bacteria | 1946 |
| 864 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 865 | Ga0209982_1004484 | 3300027552 | Bacteria | 2000 |
| 866 | Ga0209970_1003020 | 3300027614 | Bacteria | 2837 |
| 867 | Ga0209974_10021098 | 3300027876 | Bacteria | 2158 |
| 868 | Ga0209974_10033674 | 3300027876 | Bacteria | 1700 |
| 869 | Ga0207428_10016435 | 3300027907 | Bacteria | 6367 |
| 870 | Ga0268266_10007672 | 3300028379 | Bacteria | 9692 |
| 871 | Ga0268266_10013258 | 3300028379 | Bacteria | 7105 |
| 872 | Ga0268266_10018457 | 3300028379 | Bacteria | 5944 |
| 873 | Ga0268266_10077105 | 3300028379 | Bacteria | 2897 |
| 874 | Ga0268266_10216977 | 3300028379 | Bacteria | 1757 |
| 875 | Ga0268266_10329639 | 3300028379 | Bacteria | 1430 |
| 876 | Ga0268265_10003246 | 3300028380 | Bacteria | 11804 |
| 877 | Ga0268265_10052060 | 3300028380 | Bacteria | 3094 |
| 878 | Ga0268265_10075457 | 3300028380 | Bacteria | 2641 |
| 879 | Ga0268265_10210613 | 3300028380 | Bacteria | 1693 |
| 880 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 881 | Ga0268264_10001438 | 3300028381 | Bacteria | 22260 |
| 882 | Ga0268264_10003226 | 3300028381 | Bacteria | 14120 |
| 883 | Ga0268264_10012760 | 3300028381 | Bacteria | 6914 |
| 884 | Ga0268264_10031545 | 3300028381 | Bacteria | 4343 |
| 885 | Ga0268264_10059458 | 3300028381 | Bacteria | 3202 |
| 886 | Ga0268264_10476689 | 3300028381 | Bacteria | 1213 |
| 887 | Ga0265337_1001439 | 3300028556 | Bacteria | 11715 |
| 888 | Ga0265326_10001380 | 3300028558 | Bacteria | 8553 |
| 889 | Ga0265319_1002798 | 3300028563 | Bacteria | 9365 |
| 890 | Ga0265334_10005260 | 3300028573 | Bacteria | 5665 |
| 891 | Ga0265318_10003474 | 3300028577 | Bacteria | 7906 |
| 892 | Ga0265323_10000992 | 3300028653 | Bacteria | 14760 |
| 893 | Ga0265322_10002589 | 3300028654 | Bacteria | 5560 |
| 894 | Ga0265336_10000003 | 3300028666 | Bacteria | 423158 |
| 895 | Ga0265336_10000063 | 3300028666 | Bacteria | 98413 |
| 896 | Ga0307517_10001421 | 3300028786 | Bacteria | 40285 |
| 897 | Ga0307517_10055873 | 3300028786 | Bacteria | 3865 |
| 898 | Ga0307517_10095068 | 3300028786 | Bacteria | 2401 |
| 899 | Ga0307515_10000160 | 3300028794 | Bacteria | 164789 |
| 900 | Ga0307515_10000737 | 3300028794 | Bacteria | 75687 |
| 901 | Ga0307515_10028520 | 3300028794 | Bacteria | 9485 |
| 902 | Ga0307515_10049556 | 3300028794 | Bacteria | 6314 |
| 903 | Ga0307515_10060791 | 3300028794 | Bacteria | 5378 |
| 904 | Ga0307515_10082200 | 3300028794 | Bacteria | 4171 |
| 905 | Ga0265338_10000087 | 3300028800 | Bacteria | 174926 |
| 906 | Ga0265338_10000154 | 3300028800 | Bacteria | 125708 |
| 907 | Ga0265338_10003118 | 3300028800 | Bacteria | 23705 |
| 908 | Ga0265324_10001590 | 3300029957 | Bacteria | 12642 |
| 909 | Ga0265324_10003293 | 3300029957 | Bacteria | 7760 |
| 910 | Ga0307511_10076742 | 3300030521 | Bacteria | 2385 |
| 911 | Ga0307512_10026765 | 3300030522 | Bacteria | 5088 |
| 912 | Ga0265330_10099631 | 3300031235 | Bacteria | 1244 |
| 913 | Ga0265332_10000083 | 3300031238 | Bacteria | 83040 |
| 914 | Ga0265332_10007298 | 3300031238 | Bacteria | 4999 |
| 915 | Ga0265325_10002402 | 3300031241 | Bacteria | 12664 |
| 916 | Ga0265340_10005895 | 3300031247 | Bacteria | 6775 |
| 917 | Ga0265340_10032584 | 3300031247 | Bacteria | 2601 |
| 918 | Ga0265339_10001335 | 3300031249 | Bacteria | 18436 |
| 919 | Ga0265339_10112241 | 3300031249 | Bacteria | 1409 |
| 920 | Ga0265327_10001335 | 3300031251 | Bacteria | 31984 |
| 921 | Ga0265327_10005550 | 3300031251 | Bacteria | 10474 |
| 922 | Ga0265316_10069195 | 3300031344 | Bacteria | 2724 |
| 923 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 924 | Ga0307513_10009007 | 3300031456 | Bacteria | 12663 |
| 925 | Ga0307513_10015012 | 3300031456 | Bacteria | 9403 |
| 926 | Ga0307513_10306852 | 3300031456 | Bacteria | 1351 |
| 927 | Ga0307509_10008423 | 3300031507 | Bacteria | 13161 |
| 928 | Ga0307509_10009946 | 3300031507 | Bacteria | 11750 |
| 929 | Ga0307509_10062217 | 3300031507 | Bacteria | 3936 |
| 930 | Ga0307509_10071416 | 3300031507 | Bacteria | 3622 |
| 931 | Ga0307509_10239462 | 3300031507 | Bacteria | 1608 |
| 932 | Ga0307408_100036322 | 3300031548 | Bacteria | 3463 |
| 933 | Ga0265313_10004883 | 3300031595 | Bacteria | 10056 |
| 934 | Ga0265313_10122378 | 3300031595 | Bacteria | 1134 |
| 935 | Ga0307508_10000282 | 3300031616 | Bacteria | 62510 |
| 936 | Ga0307508_10004767 | 3300031616 | Bacteria | 13094 |
| 937 | Ga0307508_10011607 | 3300031616 | Bacteria | 8050 |
| 938 | Ga0307508_10014131 | 3300031616 | Bacteria | 7284 |
| 939 | Ga0307508_10039482 | 3300031616 | Bacteria | 4240 |
| 940 | Ga0307514_10000408 | 3300031649 | Bacteria | 95961 |
| 941 | Ga0307514_10017292 | 3300031649 | Bacteria | 5937 |
| 942 | Ga0316575_10048438 | 3300031665 | Bacteria | 1690 |
| 943 | Ga0265342_10023680 | 3300031712 | Bacteria | 3882 |
| 944 | Ga0307516_10001367 | 3300031730 | Bacteria | 33805 |
| 945 | Ga0307516_10002101 | 3300031730 | Bacteria | 27049 |
| 946 | Ga0307516_10039313 | 3300031730 | Bacteria | 4716 |
| 947 | Ga0307516_10052275 | 3300031730 | Bacteria | 3999 |
| 948 | Ga0307516_10065805 | 3300031730 | Bacteria | 3499 |
| 949 | Ga0307516_10083114 | 3300031730 | Bacteria | 3044 |
| 950 | Ga0307516_10176584 | 3300031730 | Bacteria | 1872 |
| 951 | Ga0307516_10204155 | 3300031730 | Bacteria | 1694 |
| 952 | Ga0307516_10206691 | 3300031730 | Bacteria | 1680 |
| 953 | Ga0307405_10062112 | 3300031731 | Bacteria | 2364 |
| 954 | Ga0307405_10276730 | 3300031731 | Bacteria | 1261 |
| 955 | Ga0307413_10002484 | 3300031824 | Bacteria | 7508 |
| 956 | Ga0307518_10038656 | 3300031838 | Bacteria | 3469 |
| 957 | Ga0307406_10073164 | 3300031901 | Bacteria | 2252 |
| 958 | Ga0307412_10035132 | 3300031911 | Bacteria | 3200 |
| 959 | Ga0307416_100023883 | 3300032002 | Bacteria | 4448 |
| 960 | Ga0316583_10002590 | 3300032133 | Bacteria | 6300 |
| 961 | Ga0307507_10044588 | 3300033179 | Bacteria | 4380 |
| 962 | Ga0307510_10025998 | 3300033180 | Bacteria | 6740 |
| 963 | Ga0307510_10034714 | 3300033180 | Bacteria | 5641 |
| 964 | Ga0307510_10052888 | 3300033180 | Bacteria | 4274 |
| 965 | Ga0307510_10066040 | 3300033180 | Bacteria | 3656 |
| 966 | Ga0373949_0000342 | 3300035090 | Bacteria | 16550 |
| 967 | Ga0373923_0008265 | 3300035111 | Bacteria | 3703 |
| 968 | Ga0373923_0058329 | 3300035111 | Bacteria | 1634 |
| 969 | Ga0373939_0000469 | 3300035114 | Bacteria | 10203 |
| 970 | Ga0373953_0000542 | 3300035117 | Bacteria | 10471 |
| 971 | Ga0373953_0052078 | 3300035117 | Bacteria | 1656 |
| 972 | Ga0373954_0000323 | 3300035118 | Bacteria | 17518 |
| 973 | Ga0373954_0003173 | 3300035118 | Bacteria | 6946 |
| 974 | Ga0373954_0041561 | 3300035118 | Bacteria | 2144 |
| 975 | Ga0373956_0003655 | 3300035119 | Bacteria | 6213 |
| 976 | Ga0373956_0009107 | 3300035119 | Bacteria | 4026 |
| 977 | Ga0373946_0043163 | 3300035171 | Bacteria | 1857 |
| 978 | Ga0373955_0003057 | 3300035172 | Bacteria | 7328 |
| 979 | Ga0373924_0004824 | 3300035410 | Bacteria | 4741 |
| 980 | Ga0373924_0014735 | 3300035410 | Bacteria | 2958 |
| 981 | Ga0373931_0047358 | 3300035691 | Bacteria | 2275 |
| 982 | Ga0373935_0046730 | 3300035692 | Bacteria | 2735 |
| 983 | Ga0373935_0097648 | 3300035692 | Bacteria | 1932 |
| 984 | Ga0373935_0106598 | 3300035692 | Bacteria | 1855 |
| 985 | Ga0373927_0088386 | 3300035695 | Bacteria | 2012 |
| 986 | Ga0373933_0001324 | 3300035724 | Bacteria | 14581 |
| 987 | Ga0373933_0034647 | 3300035724 | Bacteria | 2943 |
| 988 | Ga0373947_0008307 | 3300035725 | Bacteria | 5980 |
| 989 | Ga0373947_0018126 | 3300035725 | Bacteria | 4051 |
| 990 | Ga0373947_0030133 | 3300035725 | Bacteria | 3187 |
| 991 | Ga0373937_0000847 | 3300036401 | Bacteria | 26243 |
| 992 | Ga0373937_0004472 | 3300036401 | Bacteria | 11874 |
| 993 | Ga0373937_0007329 | 3300036401 | Bacteria | 9549 |
| 994 | Ga0373937_0069648 | 3300036401 | Bacteria | 3243 |
| 995 | Ga0373937_0158162 | 3300036401 | Bacteria | 2124 |
| 996 | Ga0373937_0323570 | 3300036401 | Bacteria | 1459 |
| 997 | Ga0316584_0002088 | 3300036712 | Bacteria | 12512 |
| 998 | Ga0373925_0004343 | 3300037068 | Bacteria | 10729 |
| 999 | Ga0373925_0056541 | 3300037068 | Bacteria | 2939 |
| 1000 | Ga0373925_0087711 | 3300037068 | Bacteria | 2375 |
| 1001 | Ga0373925_0113055 | 3300037068 | Bacteria | 2099 |
| 1002 | Ga0373925_0124132 | 3300037068 | Bacteria | 2007 |
| 1003 | Ga0395899_0130710 | 3300037312 | Bacteria | 1793 |
| 1004 | Ga0395900_0016357 | 3300037418 | Bacteria | 7561 |
| 1005 | Ga0395900_0083912 | 3300037418 | Bacteria | 3273 |
| 1006 | Ga0395900_0193333 | 3300037418 | Bacteria | 2063 |
| 1007 | Ga0395898_0042436 | 3300037466 | Bacteria | 4487 |
| 1008 | Ga0395898_0051091 | 3300037466 | Bacteria | 4043 |
| 1009 | Ga0395898_0070969 | 3300037466 | Bacteria | 3366 |
| 1010 | Ga0395898_0323056 | 3300037466 | Bacteria | 1472 |
| 1011 | Ga0395905_0002007 | 3300037471 | Bacteria | 23235 |
| 1012 | Ga0395905_0009530 | 3300037471 | Bacteria | 9485 |
| 1013 | Ga0395905_0012101 | 3300037471 | Bacteria | 8312 |
| 1014 | Ga0395905_0013595 | 3300037471 | Bacteria | 7797 |
| 1015 | Ga0395905_0021316 | 3300037471 | Bacteria | 6130 |
| 1016 | Ga0395905_0045282 | 3300037471 | Bacteria | 4126 |
| 1017 | Ga0395905_0118549 | 3300037471 | Bacteria | 2488 |
| 1018 | Ga0395905_0180684 | 3300037471 | Bacteria | 1981 |
| 1019 | Ga0395905_0205964 | 3300037471 | Bacteria | 1843 |
| 1020 | Ga0436364_0513795 | 3300037853 | Bacteria | 7231 |
| 1021 | Ga0395901_0093209 | 3300038443 | Bacteria | 3153 |
| 1022 | Ga0400490_26120 | 3300038726 | Bacteria | 2446 |
| 1023 | Ga0400490_31337 | 3300038726 | Bacteria | 30266 |
| 1024 | Ga0400490_35285 | 3300038726 | Bacteria | 7917 |
| 1025 | Ga0400490_43165 | 3300038726 | Bacteria | 39854 |
| 1026 | Ga0400490_43931 | 3300038726 | Bacteria | 87826 |
| 1027 | Ga0400491_00605 | 3300038727 | Bacteria | 1521 |
| 1028 | Ga0400488_09907 | 3300038741 | Bacteria | 2709 |
| 1029 | Ga0400488_41347 | 3300038741 | Bacteria | 2130 |
| 1030 | Ga0400488_53493 | 3300038741 | Bacteria | 5647 |
| 1031 | Ga0400487_23984 | 3300039110 | Bacteria | 13649 |
| 1032 | Ga0400487_34028 | 3300039110 | Bacteria | 26819 |
| 1033 | Ga0400487_37419 | 3300039110 | Bacteria | 2729 |
| 1034 | Ga0400487_42799 | 3300039110 | Bacteria | 62577 |
| 1035 | Ga0400487_44343 | 3300039110 | Bacteria | 4179 |
| 1036 | Ga0436365_0082862 | 3300039437 | Bacteria | 1721 |
| 1037 | Ga0436365_0894540 | 3300039437 | Bacteria | 57738 |
| 1038 | Ga0436365_1221318 | 3300039437 | Bacteria | 1255 |
| 1039 | Ga0436365_1549030 | 3300039437 | Bacteria | 8562 |
| 1040 | Ga0436360_0275638 | 3300039438 | Bacteria | 1157 |
| 1041 | Ga0436361_0193139 | 3300039447 | Bacteria | 16854 |
| 1042 | Ga0436361_0527730 | 3300039447 | Bacteria | 33218 |
| 1043 | Ga0436361_0632584 | 3300039447 | Bacteria | 6423 |
| 1044 | Ga0436361_0761768 | 3300039447 | Bacteria | 9080 |
| 1045 | Ga0436362_0663798 | 3300039453 | Bacteria | 2630 |
| 1046 | Ga0451837_1009537 | 3300041494 | Bacteria | 1513 |
| 1047 | Ga0439431_0009589 | 3300041997 | Bacteria | 2187 |
| 1048 | Ga0439441_000337 | 3300042001 | Bacteria | 4786 |
| 1049 | Ga0439449_0005387 | 3300042007 | Bacteria | 4903 |
| 1050 | Ga0450890_001687 | 3300042127 | Bacteria | 3146 |
| 1051 | Ga0450891_000178 | 3300042129 | Bacteria | 6142 |
| 1052 | Ga0450892_001312 | 3300042130 | Bacteria | 2505 |
| 1053 | Ga0439435_0000689 | 3300042436 | Bacteria | 5627 |
| 1054 | Ga0439460_0027648 | 3300042461 | Bacteria | 1594 |
| 1055 | Ga0450893_0001010 | 3300042532 | Bacteria | 4212 |
| 1056 | Ga0451577_0000271 | 3300042876 | Bacteria | 101284 |
| 1057 | Ga0451577_0106470 | 3300042876 | Bacteria | 2507 |
| 1058 | Ga0466966_0009768 | 3300044684 | Bacteria | 6359 |
| 1059 | Ga0466963_0000320 | 3300044694 | Bacteria | 21684 |
| 1060 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 1061 | Ga0453684_0000583 | 3300044712 | Bacteria | 135940 |
| 1062 | Ga0453684_0000702 | 3300044712 | Bacteria | 118936 |
| 1063 | Ga0453684_0000906 | 3300044712 | Bacteria | 98768 |
| 1064 | Ga0453684_0006332 | 3300044712 | Bacteria | 22593 |
| 1065 | Ga0453684_0152269 | 3300044712 | Bacteria | 2746 |
| 1066 | Ga0466968_0002656 | 3300044735 | Bacteria | 6584 |
| 1067 | Ga0466957_0036330 | 3300044842 | Bacteria | 2961 |
| 1068 | Ga0466959_0066363 | 3300045049 | Bacteria | 2618 |
| 1069 | Ga0451576_0000137 | 3300045051 | Bacteria | 185212 |
| 1070 | Ga0451576_0000259 | 3300045051 | Bacteria | 129591 |
| 1071 | Ga0451576_0118222 | 3300045051 | Bacteria | 2759 |
| 1072 | Ga0466967_0236995 | 3300045976 | Bacteria | 1739 |
| 1073 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 1074 | Ga0495592_0000519 | 3300046454 | Bacteria | 27856 |
| 1075 | Ga0495590_0000008 | 3300046457 | Bacteria | 330520 |
| 1076 | Ga0495591_000043 | 3300046458 | Bacteria | 148885 |
| 1077 | Ga0495629_0098817 | 3300046459 | Bacteria | 2037 |
| 1078 | Ga0495651_0014174 | 3300046462 | Bacteria | 6161 |
| 1079 | Ga0495651_0203056 | 3300046462 | Bacteria | 1386 |
| 1080 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 1081 | Ga0495653_0012104 | 3300046463 | Bacteria | 7039 |
| 1082 | Ga0495650_0001530 | 3300046471 | Bacteria | 21964 |
| 1083 | Ga0495650_0001834 | 3300046471 | Bacteria | 19019 |
| 1084 | Ga0495650_0015649 | 3300046471 | Bacteria | 3880 |
| 1085 | Ga0495582_0003052 | 3300046473 | Bacteria | 9380 |
| 1086 | Ga0495605_0008667 | 3300046474 | Bacteria | 5745 |
| 1087 | Ga0495584_0000025 | 3300046491 | Bacteria | 116731 |
| 1088 | Ga0495584_0000173 | 3300046491 | Bacteria | 45316 |
| 1089 | Ga0495585_0004296 | 3300046492 | Bacteria | 9275 |
| 1090 | Ga0495585_0015337 | 3300046492 | Bacteria | 4453 |
| 1091 | Ga0495585_0055384 | 3300046492 | Bacteria | 2191 |
| 1092 | Ga0495594_0038315 | 3300046499 | Bacteria | 2617 |
| 1093 | Ga0495596_0000604 | 3300046500 | Bacteria | 22532 |
| 1094 | Ga0495596_0004602 | 3300046500 | Bacteria | 6687 |
| 1095 | Ga0495596_0017045 | 3300046500 | Bacteria | 3013 |
| 1096 | Ga0495596_0019695 | 3300046500 | Bacteria | 2768 |
| 1097 | Ga0495607_0014372 | 3300046501 | Bacteria | 5157 |
| 1098 | Ga0495583_0000011 | 3300046506 | Bacteria | 350215 |
| 1099 | Ga0495583_0000306 | 3300046506 | Bacteria | 77699 |
| 1100 | Ga0495583_0000512 | 3300046506 | Bacteria | 55428 |
| 1101 | Ga0495583_0036138 | 3300046506 | Bacteria | 2352 |
| 1102 | Ga0495608_0012098 | 3300046511 | Bacteria | 5998 |
| 1103 | Ga0495610_0002865 | 3300046512 | Bacteria | 14003 |
| 1104 | Ga0495610_0006324 | 3300046512 | Bacteria | 8192 |
| 1105 | Ga0495610_0012368 | 3300046512 | Bacteria | 5144 |
| 1106 | Ga0495616_0000643 | 3300046513 | Bacteria | 26050 |
| 1107 | Ga0495616_0034632 | 3300046513 | Bacteria | 2620 |
| 1108 | Ga0495628_0005737 | 3300046516 | Bacteria | 10875 |
| 1109 | Ga0495631_0000337 | 3300046518 | Bacteria | 32281 |
| 1110 | Ga0495631_0018893 | 3300046518 | Bacteria | 3238 |
| 1111 | Ga0495631_0023463 | 3300046518 | Bacteria | 2858 |
| 1112 | Ga0495632_0017507 | 3300046519 | Bacteria | 3953 |
| 1113 | Ga0495637_0000009 | 3300046520 | Bacteria | 402028 |
| 1114 | Ga0495643_0000028 | 3300046522 | Bacteria | 262886 |
| 1115 | Ga0495643_0092054 | 3300046522 | Bacteria | 1563 |
| 1116 | Ga0495644_0000119 | 3300046523 | Bacteria | 37559 |
| 1117 | Ga0495644_0007875 | 3300046523 | Bacteria | 4103 |
| 1118 | Ga0495644_0023099 | 3300046523 | Bacteria | 2368 |
| 1119 | Ga0495644_0074202 | 3300046523 | Bacteria | 1279 |
| 1120 | Ga0495648_0001735 | 3300046524 | Bacteria | 21077 |
| 1121 | Ga0495648_0003308 | 3300046524 | Bacteria | 14229 |
| 1122 | Ga0495648_0062334 | 3300046524 | Bacteria | 2208 |
| 1123 | Ga0495642_0011402 | 3300046528 | Bacteria | 3415 |
| 1124 | Ga0495652_0022690 | 3300046529 | Bacteria | 5569 |
| 1125 | Ga0495652_0033439 | 3300046529 | Bacteria | 4489 |
| 1126 | Ga0495654_0001482 | 3300046530 | Bacteria | 16073 |
| 1127 | Ga0495654_0110646 | 3300046530 | Bacteria | 1254 |
| 1128 | Ga0495586_0002965 | 3300046535 | Bacteria | 9148 |
| 1129 | Ga0495586_0045669 | 3300046535 | Bacteria | 2361 |
| 1130 | Ga0495587_0005573 | 3300046536 | Bacteria | 8216 |
| 1131 | Ga0495598_0067512 | 3300046537 | Bacteria | 1118 |
| 1132 | Ga0495609_0000647 | 3300046538 | Bacteria | 27112 |
| 1133 | Ga0495609_0019622 | 3300046538 | Bacteria | 3126 |
| 1134 | Ga0495621_0000113 | 3300046539 | Bacteria | 16978 |
| 1135 | Ga0495621_0001756 | 3300046539 | Bacteria | 5685 |
| 1136 | Ga0495597_0000762 | 3300046542 | Bacteria | 25455 |
| 1137 | Ga0495597_0000911 | 3300046542 | Bacteria | 22921 |
| 1138 | Ga0495597_0021496 | 3300046542 | Bacteria | 2999 |
| 1139 | Ga0495645_0095615 | 3300046543 | Bacteria | 2118 |
| 1140 | Ga0495645_0117138 | 3300046543 | Bacteria | 1880 |
| 1141 | Ga0495622_0000092 | 3300046557 | Bacteria | 80637 |
| 1142 | Ga0495633_0000181 | 3300046558 | Bacteria | 82164 |
| 1143 | Ga0495633_0000742 | 3300046558 | Bacteria | 29473 |
| 1144 | Ga0495633_0004718 | 3300046558 | Bacteria | 8568 |
| 1145 | Ga0495633_0064321 | 3300046558 | Bacteria | 1715 |
| 1146 | Ga0495667_0058675 | 3300046559 | Bacteria | 2527 |
| 1147 | Ga0495656_0000383 | 3300046615 | Bacteria | 14729 |
| 1148 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 1149 | Ga0495668_0000028 | 3300046616 | Bacteria | 286629 |
| 1150 | Ga0495668_0042735 | 3300046616 | Bacteria | 2522 |
| 1151 | Ga0495611_0000361 | 3300046648 | Bacteria | 29629 |
| 1152 | Ga0495611_0001188 | 3300046648 | Bacteria | 13508 |
| 1153 | Ga0495611_0006888 | 3300046648 | Bacteria | 4831 |
| 1154 | Ga0495611_0013006 | 3300046648 | Bacteria | 3539 |
| 1155 | Ga0495625_0001300 | 3300046660 | Bacteria | 31240 |
| 1156 | Ga0495625_0005155 | 3300046660 | Bacteria | 12056 |
| 1157 | Ga0495625_0029787 | 3300046660 | Bacteria | 4079 |
| 1158 | Ga0495625_0077111 | 3300046660 | Bacteria | 2329 |
| 1159 | Ga0495635_0006348 | 3300046663 | Bacteria | 8242 |
| 1160 | Ga0495635_0212429 | 3300046663 | Bacteria | 1310 |
| 1161 | Ga0495661_0003126 | 3300046665 | Bacteria | 12410 |
| 1162 | Ga0495661_0007978 | 3300046665 | Bacteria | 7351 |
| 1163 | Ga0495661_0019488 | 3300046665 | Bacteria | 4445 |
| 1164 | Ga0495661_0034022 | 3300046665 | Bacteria | 3210 |
| 1165 | Ga0495661_0178883 | 3300046665 | Bacteria | 1125 |
| 1166 | Ga0495657_0015234 | 3300046675 | Bacteria | 5628 |
| 1167 | Ga0495599_0004863 | 3300046678 | Bacteria | 7993 |
| 1168 | Ga0495623_0002882 | 3300046679 | Bacteria | 11335 |
| 1169 | Ga0495623_0005974 | 3300046679 | Bacteria | 7930 |
| 1170 | Ga0495623_0139277 | 3300046679 | Bacteria | 1445 |
| 1171 | Ga0495646_0008308 | 3300046680 | Bacteria | 6600 |
| 1172 | Ga0495647_0001791 | 3300046681 | Bacteria | 6639 |
| 1173 | Ga0495669_0007195 | 3300046684 | Bacteria | 4664 |
| 1174 | Ga0495670_0000053 | 3300046691 | Bacteria | 60401 |
| 1175 | Ga0495670_0012551 | 3300046691 | Bacteria | 4167 |
| 1176 | Ga0495671_0038435 | 3300046692 | Bacteria | 2419 |
| 1177 | Ga0495649_0000028 | 3300046694 | Bacteria | 163229 |
| 1178 | Ga0495649_0032021 | 3300046694 | Bacteria | 2899 |
| 1179 | Ga0495589_0018666 | 3300046794 | Bacteria | 3556 |
| 1180 | Ga0495600_0058069 | 3300046809 | Bacteria | 2527 |
| 1181 | Ga0495660_0020740 | 3300046810 | Bacteria | 3767 |
| 1182 | Ga0495660_0085207 | 3300046810 | Bacteria | 1651 |
| 1183 | Ga0495604_0000893 | 3300047317 | Bacteria | 24849 |
| 1184 | Ga0495604_0082744 | 3300047317 | Bacteria | 2399 |
| 1185 | Ga0495604_0131342 | 3300047317 | Bacteria | 1800 |
| 1186 | Ga0495636_0003446 | 3300047318 | Bacteria | 6139 |
| 1187 | Ga0495636_0004208 | 3300047318 | Bacteria | 5652 |
| 1188 | Ga0495674_0073493 | 3300047319 | Bacteria | 2947 |
| 1189 | Ga0495672_0000055 | 3300047320 | Bacteria | 229428 |
| 1190 | Ga0495672_0003194 | 3300047320 | Bacteria | 14247 |
| 1191 | Ga0495672_0019403 | 3300047320 | Bacteria | 4484 |
| 1192 | Ga0495680_0036120 | 3300047322 | Bacteria | 3971 |
| 1193 | Ga0495680_0117364 | 3300047322 | Bacteria | 1967 |
| 1194 | Ga0495683_0000047 | 3300047323 | Bacteria | 126770 |
| 1195 | Ga0495683_0032671 | 3300047323 | Bacteria | 2650 |
| 1196 | Ga0495687_001812 | 3300047443 | Bacteria | 18792 |
| 1197 | Ga0495687_003723 | 3300047443 | Bacteria | 10818 |
| 1198 | Ga0495687_010481 | 3300047443 | Bacteria | 5081 |
| 1199 | Ga0495687_011218 | 3300047443 | Bacteria | 4835 |
| 1200 | Ga0495675_0003845 | 3300047444 | Bacteria | 9091 |
| 1201 | Ga0495675_0020051 | 3300047444 | Bacteria | 4248 |
| 1202 | Ga0495677_0000986 | 3300047445 | Bacteria | 11456 |
| 1203 | Ga0495677_0007612 | 3300047445 | Bacteria | 4041 |
| 1204 | Ga0495677_0011525 | 3300047445 | Bacteria | 3233 |
| 1205 | Ga0495677_0025374 | 3300047445 | Bacteria | 2150 |
| 1206 | Ga0495679_010120 | 3300047446 | Bacteria | 3724 |
| 1207 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 1208 | Ga0495681_0006008 | 3300047470 | Bacteria | 8041 |
| 1209 | Ga0495681_0009513 | 3300047470 | Bacteria | 5979 |
| 1210 | Ga0495681_0011106 | 3300047470 | Bacteria | 5397 |
| 1211 | Ga0495681_0045847 | 3300047470 | Bacteria | 2089 |
| 1212 | Ga0495684_0005498 | 3300047471 | Bacteria | 9863 |
| 1213 | Ga0495686_0000603 | 3300047472 | Bacteria | 49764 |
| 1214 | Ga0495686_0030707 | 3300047472 | Bacteria | 3488 |
| 1215 | Ga0495602_0001190 | 3300048088 | Bacteria | 25555 |
| 1216 | Ga0495602_0021398 | 3300048088 | Bacteria | 6367 |
| 1217 | Ga0495602_0023541 | 3300048088 | Bacteria | 5998 |
| 1218 | Ga0495602_0307882 | 3300048088 | Bacteria | 1157 |
| 1219 | Ga0495614_0003366 | 3300048089 | Bacteria | 7147 |
| 1220 | Ga0495614_0070629 | 3300048089 | Bacteria | 1505 |
| 1221 | Ga0495615_0033952 | 3300048090 | Bacteria | 1239 |
| 1222 | Ga0495626_0007108 | 3300048091 | Bacteria | 6269 |
| 1223 | Ga0495626_0007741 | 3300048091 | Bacteria | 5953 |
| 1224 | Ga0495626_0030425 | 3300048091 | Bacteria | 2604 |
| 1225 | Ga0495626_0045637 | 3300048091 | Bacteria | 2044 |
| 1226 | Ga0496100_0000929 | 3300048903 | Bacteria | 13991 |
| 1227 | Ga0496100_0069821 | 3300048903 | Bacteria | 2341 |
| 1228 | Ga0496101_0005022 | 3300048904 | Bacteria | 8409 |
| 1229 | Ga0496101_0077873 | 3300048904 | Bacteria | 2444 |
| 1230 | Ga0496101_0080354 | 3300048904 | Bacteria | 2408 |
| 1231 | Ga0496101_0114617 | 3300048904 | Bacteria | 2032 |
| 1232 | Ga0496101_0149669 | 3300048904 | Bacteria | 1785 |
| 1233 | Ga0496101_0213994 | 3300048904 | Bacteria | 1494 |
| 1234 | Ga0496102_0014718 | 3300048905 | Bacteria | 6800 |
| 1235 | Ga0496102_0154653 | 3300048905 | Bacteria | 2156 |
| 1236 | Ga0496102_0199474 | 3300048905 | Bacteria | 1886 |
| 1237 | Ga0496103_0013140 | 3300048906 | Bacteria | 4910 |
| 1238 | Ga0496103_0016204 | 3300048906 | Bacteria | 4447 |
| 1239 | Ga0496104_0002648 | 3300048907 | Bacteria | 15407 |
| 1240 | Ga0496104_0008496 | 3300048907 | Bacteria | 9134 |
| 1241 | Ga0496104_0011778 | 3300048907 | Bacteria | 7847 |
| 1242 | Ga0496104_0049145 | 3300048907 | Bacteria | 3977 |
| 1243 | Ga0496104_0092955 | 3300048907 | Bacteria | 2884 |
| 1244 | Ga0496104_0150125 | 3300048907 | Bacteria | 2237 |
| 1245 | Ga0496104_0240711 | 3300048907 | Bacteria | 1722 |
| 1246 | Ga0496104_0315020 | 3300048907 | Bacteria | 1477 |
| 1247 | Ga0496105_0000572 | 3300048908 | Bacteria | 24357 |
| 1248 | Ga0496105_0002416 | 3300048908 | Bacteria | 13531 |
| 1249 | Ga0496105_0015520 | 3300048908 | Bacteria | 6072 |
| 1250 | Ga0496105_0105424 | 3300048908 | Bacteria | 2327 |
| 1251 | Ga0496106_0000002 | 3300048909 | Bacteria | 377020 |
| 1252 | Ga0496106_0004513 | 3300048909 | Bacteria | 10312 |
| 1253 | Ga0496106_0004659 | 3300048909 | Bacteria | 10166 |
| 1254 | Ga0496106_0005567 | 3300048909 | Bacteria | 9323 |
| 1255 | Ga0496106_0033439 | 3300048909 | Bacteria | 3836 |
| 1256 | Ga0496106_0175493 | 3300048909 | Bacteria | 1700 |
| 1257 | Ga0496106_0297618 | 3300048909 | Bacteria | 1294 |
| 1258 | Ga0496107_0003143 | 3300048910 | Bacteria | 10982 |
| 1259 | Ga0496107_0005458 | 3300048910 | Bacteria | 8701 |
| 1260 | Ga0496107_0025568 | 3300048910 | Bacteria | 4180 |
| 1261 | Ga0496107_0049325 | 3300048910 | Bacteria | 3034 |
| 1262 | Ga0496108_0005344 | 3300048911 | Bacteria | 10382 |
| 1263 | Ga0496108_0008379 | 3300048911 | Bacteria | 8388 |
| 1264 | Ga0496108_0077250 | 3300048911 | Bacteria | 2816 |
| 1265 | Ga0496109_0004278 | 3300048912 | Bacteria | 11925 |
| 1266 | Ga0496109_0022002 | 3300048912 | Bacteria | 5644 |
| 1267 | Ga0496109_0276868 | 3300048912 | Bacteria | 1581 |
| 1268 | Ga0496110_0000729 | 3300048913 | Bacteria | 22689 |
| 1269 | Ga0496110_0008923 | 3300048913 | Bacteria | 8082 |
| 1270 | Ga0496110_0020100 | 3300048913 | Bacteria | 5633 |
| 1271 | Ga0496110_0520382 | 3300048913 | Bacteria | 1082 |
| 1272 | Ga0496111_0004705 | 3300048914 | Bacteria | 8655 |
| 1273 | Ga0496111_0069535 | 3300048914 | Bacteria | 2560 |
| 1274 | Ga0496112_0005808 | 3300048915 | Bacteria | 10736 |
| 1275 | Ga0496112_0017735 | 3300048915 | Bacteria | 6700 |
| 1276 | Ga0496113_0016931 | 3300048916 | Bacteria | 5046 |
| 1277 | Ga0496113_0042675 | 3300048916 | Bacteria | 3352 |
| 1278 | Ga0496113_0122522 | 3300048916 | Bacteria | 2034 |
| 1279 | Ga0496113_0202699 | 3300048916 | Bacteria | 1577 |
| 1280 | Ga0496114_0000501 | 3300048917 | Bacteria | 28631 |
| 1281 | Ga0496114_0007334 | 3300048917 | Bacteria | 8706 |
| 1282 | Ga0496114_0016064 | 3300048917 | Bacteria | 6024 |
| 1283 | Ga0496114_0027394 | 3300048917 | Bacteria | 4667 |
| 1284 | Ga0496114_0028792 | 3300048917 | Bacteria | 4561 |
| 1285 | Ga0496114_0198475 | 3300048917 | Bacteria | 1757 |
| 1286 | Ga0496115_0007693 | 3300048918 | Bacteria | 7944 |
| 1287 | Ga0496115_0018095 | 3300048918 | Bacteria | 5401 |
| 1288 | Ga0496115_0041449 | 3300048918 | Bacteria | 3665 |
| 1289 | Ga0496115_0053225 | 3300048918 | Bacteria | 3248 |
| 1290 | Ga0496116_0005353 | 3300048919 | Bacteria | 11950 |
| 1291 | Ga0496116_0064205 | 3300048919 | Bacteria | 2361 |
| 1292 | Ga0496117_0022285 | 3300048920 | Bacteria | 5085 |
| 1293 | Ga0496118_0004640 | 3300048921 | Bacteria | 16123 |
| 1294 | Ga0496119_0000213 | 3300048922 | Bacteria | 82822 |
| 1295 | Ga0496121_0000089 | 3300048924 | Bacteria | 219007 |
| 1296 | Ga0496121_0001937 | 3300048924 | Bacteria | 33021 |
| 1297 | Ga0496121_0029822 | 3300048924 | Bacteria | 5028 |
| 1298 | Ga0496121_0050156 | 3300048924 | Bacteria | 3529 |
| 1299 | Ga0496121_0055079 | 3300048924 | Bacteria | 3316 |
| 1300 | Ga0496122_0001063 | 3300048925 | Bacteria | 47771 |
| 1301 | Ga0496123_0000246 | 3300048926 | Bacteria | 109397 |
| 1302 | Ga0496123_0062416 | 3300048926 | Bacteria | 2388 |
| 1303 | Ga0496125_0018144 | 3300048928 | Bacteria | 6688 |
| 1304 | Ga0496126_0003551 | 3300048929 | Bacteria | 19610 |
| 1305 | Ga0495678_000060 | 3300049459 | Bacteria | 142851 |
| 1306 | Ga0495678_000266 | 3300049459 | Bacteria | 57869 |
| 1307 | Ga0495678_039730 | 3300049459 | Bacteria | 1896 |
| 1308 | Ga0495678_039877 | 3300049459 | Bacteria | 1891 |
| 1309 | Ga0495682_0000035 | 3300049460 | Bacteria | 126349 |
| 1310 | Ga0501300_004779 | 3300049523 | Bacteria | 2003 |
| 1311 | Ga0501031_0001824 | 3300049568 | Bacteria | 13399 |
| 1312 | Ga0501031_0239964 | 3300049568 | Bacteria | 1178 |
| 1313 | Ga0501034_0020044 | 3300049571 | Bacteria | 6830 |
| 1314 | Ga0501034_0056570 | 3300049571 | Bacteria | 3946 |
| 1315 | Ga0501034_0064115 | 3300049571 | Bacteria | 3688 |
| 1316 | Ga0501034_0274409 | 3300049571 | Bacteria | 1626 |
| 1317 | Ga0501036_0005963 | 3300049572 | Bacteria | 9878 |
| 1318 | Ga0501036_0105368 | 3300049572 | Bacteria | 2385 |
| 1319 | Ga0501037_0164638 | 3300049573 | Bacteria | 1579 |
| 1320 | Ga0501038_0012969 | 3300049574 | Bacteria | 7603 |
| 1321 | Ga0501038_0023790 | 3300049574 | Bacteria | 5473 |
| 1322 | Ga0501039_0010395 | 3300049575 | Bacteria | 7094 |
| 1323 | Ga0501041_0021938 | 3300049577 | Bacteria | 3824 |
| 1324 | Ga0501042_0056056 | 3300049578 | Bacteria | 2812 |
| 1325 | Ga0501043_0000058 | 3300049579 | Bacteria | 102030 |
| 1326 | Ga0501043_0000643 | 3300049579 | Bacteria | 30832 |
| 1327 | Ga0501043_0021150 | 3300049579 | Bacteria | 5100 |
| 1328 | Ga0501043_0292325 | 3300049579 | Bacteria | 1247 |
| 1329 | Ga0501046_0000051 | 3300049580 | Bacteria | 133545 |
| 1330 | Ga0501046_0002679 | 3300049580 | Bacteria | 16603 |
| 1331 | Ga0501046_0094302 | 3300049580 | Bacteria | 2300 |
| 1332 | Ga0501046_0182877 | 3300049580 | Bacteria | 1566 |
| 1333 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 1334 | Ga0501047_0004563 | 3300049581 | Bacteria | 13023 |
| 1335 | Ga0501047_0005052 | 3300049581 | Bacteria | 12383 |
| 1336 | Ga0501047_0101760 | 3300049581 | Bacteria | 2752 |
| 1337 | Ga0501047_0229176 | 3300049581 | Bacteria | 1712 |
| 1338 | Ga0501048_0008908 | 3300049582 | Bacteria | 7554 |
| 1339 | Ga0501048_0010868 | 3300049582 | Bacteria | 6788 |
| 1340 | Ga0501048_0042759 | 3300049582 | Bacteria | 3243 |
| 1341 | Ga0501067_0014886 | 3300049583 | Bacteria | 4305 |
| 1342 | Ga0501070_0006327 | 3300049586 | Bacteria | 10076 |
| 1343 | Ga0501071_0035366 | 3300049587 | Bacteria | 3558 |
| 1344 | Ga0501072_0005493 | 3300049588 | Bacteria | 9652 |
| 1345 | Ga0501072_0076284 | 3300049588 | Bacteria | 2652 |
| 1346 | Ga0501073_0003296 | 3300049589 | Bacteria | 12128 |
| 1347 | Ga0501073_0032616 | 3300049589 | Bacteria | 3713 |
| 1348 | Ga0501075_0000410 | 3300049591 | Bacteria | 24998 |
| 1349 | Ga0501076_0001765 | 3300049592 | Bacteria | 14630 |
| 1350 | Ga0501076_0157259 | 3300049592 | Bacteria | 1851 |
| 1351 | Ga0501077_0013599 | 3300049593 | Bacteria | 5102 |
| 1352 | Ga0501223_021408 | 3300049663 | Bacteria | 1264 |
| 1353 | Ga0501225_0008344 | 3300049705 | Bacteria | 2974 |
| 1354 | Ga0501229_000131 | 3300049706 | Bacteria | 7802 |
| 1355 | Ga0501079_0193788 | 3300049741 | Bacteria | 1586 |
| 1356 | Ga0501080_0012936 | 3300049742 | Bacteria | 7660 |
| 1357 | Ga0501081_0005625 | 3300049743 | Bacteria | 8100 |
| 1358 | Ga0501083_0048123 | 3300049744 | Bacteria | 2879 |
| 1359 | Ga0501262_000404 | 3300049759 | Bacteria | 5207 |
| 1360 | Ga0501035_0002048 | 3300049822 | Bacteria | 20096 |
| 1361 | Ga0501035_0024668 | 3300049822 | Bacteria | 5513 |
| 1362 | Ga0501035_0124667 | 3300049822 | Bacteria | 2249 |
| 1363 | Ga0501044_0000515 | 3300049823 | Bacteria | 47051 |
| 1364 | Ga0501044_0007899 | 3300049823 | Bacteria | 11699 |
| 1365 | Ga0501044_0011617 | 3300049823 | Bacteria | 9542 |
| 1366 | Ga0501044_0046836 | 3300049823 | Bacteria | 4475 |
| 1367 | Ga0501044_0047853 | 3300049823 | Bacteria | 4422 |
| 1368 | Ga0501044_0049233 | 3300049823 | Bacteria | 4350 |
| 1369 | Ga0501044_0538433 | 3300049823 | Bacteria | 1066 |
| 1370 | Ga0501045_0001820 | 3300049824 | Bacteria | 14399 |
| 1371 | Ga0501045_0007439 | 3300049824 | Bacteria | 7607 |
| 1372 | Ga0501045_0037446 | 3300049824 | Bacteria | 3526 |
| 1373 | nmdc:mga03683_94541_c1 | 3300050489 | Bacteria | 1307 |
| 1374 | nmdc:mga0k408_15138_c1 | 3300050493 | Bacteria | 4263 |
| 1375 | nmdc:mga0k408_206_c1 | 3300050493 | Bacteria | 31456 |
| 1376 | nmdc:mga0k408_221_c1 | 3300050493 | Bacteria | 30239 |
| 1377 | nmdc:mga0k408_54843_c1 | 3300050493 | Bacteria | 2310 |
| 1378 | nmdc:mga0k408_5529_c1 | 3300050493 | Bacteria | 6728 |
| 1379 | nmdc:mga0k408_62462_c1 | 3300050493 | Bacteria | 2166 |
| 1380 | nmdc:mga0k408_641_c2 | 3300050493 | Bacteria | 18568 |
| 1381 | nmdc:mga06z11_3267_c1 | 3300050494 | Bacteria | 6268 |
| 1382 | nmdc:mga07m45_138909_c1 | 3300050496 | Bacteria | 1407 |
| 1383 | nmdc:mga07m45_18057_c2 | 3300050496 | Bacteria | 3141 |
| 1384 | nmdc:mga07m45_19775_c1 | 3300050496 | Bacteria | 3651 |
| 1385 | nmdc:mga05p37_52613_c1 | 3300050507 | Bacteria | 5006 |
| 1386 | nmdc:mga0qj67_18883_c1 | 3300050509 | Bacteria | 5260 |
| 1387 | nmdc:mga08y16_181892_c1 | 3300050511 | Bacteria | 2183 |
| 1388 | nmdc:mga0n895_200805_c1 | 3300050512 | Bacteria | 2025 |
| 1389 | nmdc:mga0rr50_419562_c1 | 3300050513 | Bacteria | 1132 |
| 1390 | Ga0495612_0083098 | 3300053078 | Bacteria | 1347 |
| 1391 | Ga0500643_007434 | 3300053087 | Bacteria | 4419 |
| 1392 | Ga0500651_0000087 | 3300053093 | Bacteria | 59423 |
| 1393 | Ga0500651_0164338 | 3300053093 | Bacteria | 1326 |
| 1394 | Ga0500571_000055 | 3300053110 | Bacteria | 35434 |
| 1395 | Ga0500593_000250 | 3300053117 | Bacteria | 22072 |
| 1396 | Ga0500595_011037 | 3300053119 | Bacteria | 3558 |
| 1397 | Ga0500652_000452 | 3300053131 | Bacteria | 14586 |
| 1398 | Ga0500568_0001338 | 3300053139 | Bacteria | 16133 |
| 1399 | Ga0500568_0009819 | 3300053139 | Bacteria | 4521 |
| 1400 | Ga0500586_000197 | 3300053145 | Bacteria | 11679 |
| 1401 | Ga0500622_0001145 | 3300053156 | Bacteria | 22070 |
| 1402 | Ga0500622_0036726 | 3300053156 | Bacteria | 2560 |
| 1403 | Ga0500634_0001009 | 3300053161 | Bacteria | 10269 |
| 1404 | Ga0500645_054278 | 3300053730 | Bacteria | 1166 |
| 1405 | Ga0501084_0115626 | 3300054114 | Bacteria | 2255 |
| 1406 | Ga0587077_015555 | 3300059493 | Bacteria | 1268 |
| 1407 | Ga0501082_0004526 | 3300060353 | Bacteria | 12138 |
| 1408 | Ga0501082_0169444 | 3300060353 | Bacteria | 1898 |
| 1409 | Ga0530510_0007623 | 3300061734 | Bacteria | 7537 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049593 | Ga0501077_0013599 | Ga0501077_0013599_16_930 | 301 |
| 2 | 3300009093 | Ga0105240_10003856 | Ga0105240_100038568 | 320 |
| 3 | 3300048924 | Ga0496121_0001937 | Ga0496121_0001937_28631_29668 | 320 |
| 4 | 3300041494 | Ga0451837_1009537 | Ga0451837_1009537_348_1376 | 326 |
| 5 | 3300006847 | Ga0075431_100422198 | Ga0075431_1004221981 | 328 |
| 6 | 3300048909 | Ga0496106_0000002 | Ga0496106_0000002_69639_70700 | 329 |
| 7 | 3300048924 | Ga0496121_0050156 | Ga0496121_0050156_712_1773 | 329 |
| 8 | 3300013308 | Ga0157375_10247396 | Ga0157375_102473962 | 330 |
| 9 | 3300053139 | Ga0500568_0001338 | Ga0500568_0001338_10981_11976 | 330 |
| 10 | iso_pu_bacteria | 2919051321 | 2919054995 | 335 |
| 11 | 3300005437 | Ga0070710_10087640 | Ga0070710_100876401 | 336 |
| 12 | 3300045049 | Ga0466959_0066363 | Ga0466959_0066363_803_1816 | 336 |
| 13 | 3300046459 | Ga0495629_0098817 | Ga0495629_0098817_13_1026 | 336 |
| 14 | iso_pu_bacteria | 2511231003 | 2511248354 | 336 |
| 15 | iso_pu_bacteria | 2511231026 | 2511383472 | 336 |
| 16 | iso_pu_bacteria | 2513237165 | 2514042723 | 336 |
| 17 | iso_pu_bacteria | 2574179768 | 2574433010 | 336 |
| 18 | iso_pu_bacteria | 2643221631 | 2644179092 | 336 |
| 19 | iso_pu_bacteria | 2765235838 | 2765568378 | 336 |
| 20 | iso_pu_bacteria | 2784132148 | 2784585781 | 336 |
| 21 | iso_pu_bacteria | 2808606384 | 2808968877 | 336 |
| 22 | iso_pu_bacteria | 2808606390 | 2809003708 | 336 |
| 23 | iso_pu_bacteria | 2808606391 | 2809010985 | 336 |
| 24 | iso_pu_bacteria | 2808606448 | 2809229270 | 336 |
| 25 | iso_pu_bacteria | 2811994917 | 2812479647 | 336 |
| 26 | iso_pu_bacteria | 2838074704 | 2838079085 | 336 |
| 27 | iso_pu_bacteria | 2857564685 | 2857567035 | 336 |
| 28 | iso_pu_bacteria | 2885270888 | 2885277846 | 336 |
| 29 | iso_pu_bacteria | 2896384573 | 2896385781 | 336 |
| 30 | iso_pu_bacteria | 2904541872 | 2904546023 | 336 |
| 31 | iso_pu_bacteria | 2905926851 | 2905929602 | 336 |
| 32 | iso_pu_bacteria | 2920760137 | 2920766452 | 336 |
| 33 | iso_pu_bacteria | 2929160207 | 2929161225 | 336 |
| 34 | iso_pu_bacteria | 2954691527 | 2954692632 | 336 |
| 35 | iso_pu_bacteria | 2954701450 | 2954707705 | 336 |
| 36 | iso_pu_bacteria | 2954711539 | 2954712291 | 336 |
| 37 | iso_pu_bacteria | 2954721474 | 2954722237 | 336 |
| 38 | iso_pu_bacteria | 2954731030 | 2954739613 | 336 |
| 39 | iso_pu_bacteria | 2954740390 | 2954741125 | 336 |
| 40 | iso_pu_bacteria | 2954749733 | 2954758439 | 336 |
| 41 | iso_pu_bacteria | 2954759201 | 2954760136 | 336 |
| 42 | iso_pu_bacteria | 2966598605 | 2966599288 | 336 |
| 43 | iso_pu_bacteria | 2974302888 | 2974305400 | 336 |
| 44 | iso_pu_bacteria | 639633007 | 639787697 | 336 |
| 45 | iso_pu_bacteria | 8003314358 | 8003317753 | 336 |
| 46 | iso_pu_bacteria | 8048127548 | 8048136899 | 336 |
| 47 | 3300005329 | Ga0070683_100049447 | Ga0070683_1000494473 | 337 |
| 48 | 3300005364 | Ga0070673_100130251 | Ga0070673_1001302512 | 337 |
| 49 | 3300005457 | Ga0070662_100016857 | Ga0070662_1000168574 | 337 |
| 50 | 3300005471 | Ga0070698_100081425 | Ga0070698_1000814252 | 337 |
| 51 | 3300005518 | Ga0070699_100200393 | Ga0070699_1002003932 | 337 |
| 52 | 3300005539 | Ga0068853_100104878 | Ga0068853_1001048783 | 337 |
| 53 | 3300005564 | Ga0070664_100057585 | Ga0070664_1000575854 | 337 |
| 54 | 3300005842 | Ga0068858_100212532 | Ga0068858_1002125322 | 337 |
| 55 | 3300025933 | Ga0207706_10296846 | Ga0207706_102968462 | 337 |
| 56 | 3300025934 | Ga0207686_10245493 | Ga0207686_102454931 | 337 |
| 57 | 3300025941 | Ga0207711_10016290 | Ga0207711_100162907 | 337 |
| 58 | 3300025960 | Ga0207651_10080125 | Ga0207651_100801252 | 337 |
| 59 | 3300026035 | Ga0207703_10314255 | Ga0207703_103142552 | 337 |
| 60 | 3300026078 | Ga0207702_10183129 | Ga0207702_101831292 | 337 |
| 61 | 3300035692 | Ga0373935_0097648 | Ga0373935_0097648_497_1513 | 337 |
| 62 | 3300046473 | Ga0495582_0003052 | Ga0495582_0003052_346_1362 | 337 |
| 63 | 3300046535 | Ga0495586_0002965 | Ga0495586_0002965_7870_8886 | 337 |
| 64 | 3300046535 | Ga0495586_0045669 | Ga0495586_0045669_1264_2280 | 337 |
| 65 | iso_pu_bacteria | 2501025502 | 2501080491 | 337 |
| 66 | iso_pu_bacteria | 2510917013 | 2511092624 | 337 |
| 67 | iso_pu_bacteria | 2511231002 | 2511243186 | 337 |
| 68 | iso_pu_bacteria | 2511231003 | 2511249744 | 337 |
| 69 | iso_pu_bacteria | 2515154122 | 2515682116 | 337 |
| 70 | iso_pu_bacteria | 2515154189 | 2516021416 | 337 |
| 71 | iso_pu_bacteria | 2562617112 | 2563064037 | 337 |
| 72 | iso_pu_bacteria | 2599185214 | 2599624803 | 337 |
| 73 | iso_pu_bacteria | 2599185226 | 2599672815 | 337 |
| 74 | iso_pu_bacteria | 2599185227 | 2599682735 | 337 |
| 75 | iso_pu_bacteria | 2599185229 | 2599694424 | 337 |
| 76 | iso_pu_bacteria | 2643221544 | 2643746370 | 337 |
| 77 | iso_pu_bacteria | 2643221639 | 2644222256 | 337 |
| 78 | iso_pu_bacteria | 2643221646 | 2644258141 | 337 |
| 79 | iso_pu_bacteria | 2643221658 | 2644329137 | 337 |
| 80 | iso_pu_bacteria | 2711768613 | 2713472311 | 337 |
| 81 | iso_pu_bacteria | 2721755523 | 2722883080 | 337 |
| 82 | iso_pu_bacteria | 2738541277 | 2738721062 | 337 |
| 83 | iso_pu_bacteria | 2738541296 | 2738821398 | 337 |
| 84 | iso_pu_bacteria | 2738541298 | 2738833881 | 337 |
| 85 | iso_pu_bacteria | 2738541306 | 2738875084 | 337 |
| 86 | iso_pu_bacteria | 2738541307 | 2738885748 | 337 |
| 87 | iso_pu_bacteria | 2738541337 | 2739053718 | 337 |
| 88 | iso_pu_bacteria | 2738543002 | 2739187038 | 337 |
| 89 | iso_pu_bacteria | 2738543008 | 2739221682 | 337 |
| 90 | iso_pu_bacteria | 2738543013 | 2739249156 | 337 |
| 91 | iso_pu_bacteria | 2738543019 | 2739280261 | 337 |
| 92 | iso_pu_bacteria | 2744054900 | 2746091603 | 337 |
| 93 | iso_pu_bacteria | 2744054901 | 2746099242 | 337 |
| 94 | iso_pu_bacteria | 2791355137 | 2792840869 | 337 |
| 95 | iso_pu_bacteria | 2831265667 | 2831265862 | 337 |
| 96 | iso_pu_bacteria | 2831864461 | 2831867798 | 337 |
| 97 | iso_pu_bacteria | 2842718218 | 2842719403 | 337 |
| 98 | iso_pu_bacteria | 2881101125 | 2881105151 | 337 |
| 99 | iso_pu_bacteria | 2883087390 | 2883095792 | 337 |
| 100 | iso_pu_bacteria | 2884811622 | 2884812427 | 337 |
| 101 | iso_pu_bacteria | 2884836552 | 2884840384 | 337 |
| 102 | iso_pu_bacteria | 2884852848 | 2884855640 | 337 |
| 103 | iso_pu_bacteria | 2885198086 | 2885203513 | 337 |
| 104 | iso_pu_bacteria | 2885211737 | 2885217137 | 337 |
| 105 | iso_pu_bacteria | 2885270888 | 2885274406 | 337 |
| 106 | iso_pu_bacteria | 2886848708 | 2886849060 | 337 |
| 107 | iso_pu_bacteria | 2886848708 | 2886850892 | 337 |
| 108 | iso_pu_bacteria | 2894023352 | 2894026830 | 337 |
| 109 | iso_pu_bacteria | 2896154374 | 2896157434 | 337 |
| 110 | iso_pu_bacteria | 2902682994 | 2902685527 | 337 |
| 111 | iso_pu_bacteria | 2904479285 | 2904482827 | 337 |
| 112 | iso_pu_bacteria | 2928070936 | 2928074844 | 337 |
| 113 | iso_pu_bacteria | 2928084124 | 2928088992 | 337 |
| 114 | iso_pu_bacteria | 2939631187 | 2939632355 | 337 |
| 115 | iso_pu_bacteria | 2945945610 | 2945948455 | 337 |
| 116 | iso_pu_bacteria | 642555112 | 642595002 | 337 |
| 117 | iso_pu_bacteria | 8006926726 | 8006930741 | 337 |
| 118 | 3300005435 | Ga0070714_100058748 | Ga0070714_1000587484 | 338 |
| 119 | 3300005436 | Ga0070713_100062064 | Ga0070713_1000620644 | 338 |
| 120 | 3300005437 | Ga0070710_10055704 | Ga0070710_100557042 | 338 |
| 121 | 3300005439 | Ga0070711_100256708 | Ga0070711_1002567082 | 338 |
| 122 | 3300005458 | Ga0070681_10007525 | Ga0070681_1000752510 | 338 |
| 123 | 3300005536 | Ga0070697_100025578 | Ga0070697_1000255784 | 338 |
| 124 | 3300005536 | Ga0070697_100235223 | Ga0070697_1002352232 | 338 |
| 125 | 3300005985 | Ga0081539_10006668 | Ga0081539_100066685 | 338 |
| 126 | 3300006028 | Ga0070717_10090988 | Ga0070717_100909881 | 338 |
| 127 | 3300006173 | Ga0070716_100039217 | Ga0070716_1000392172 | 338 |
| 128 | 3300025912 | Ga0207707_10006120 | Ga0207707_1000612010 | 338 |
| 129 | 3300025915 | Ga0207693_10002285 | Ga0207693_100022858 | 338 |
| 130 | 3300025928 | Ga0207700_10299117 | Ga0207700_102991172 | 338 |
| 131 | 3300025929 | Ga0207664_10156051 | Ga0207664_101560512 | 338 |
| 132 | 3300025939 | Ga0207665_10096410 | Ga0207665_100964102 | 338 |
| 133 | 3300046492 | Ga0495585_0015337 | Ga0495585_0015337_1697_2731 | 338 |
| 134 | 3300046523 | Ga0495644_0007875 | Ga0495644_0007875_2709_3728 | 338 |
| 135 | 3300046530 | Ga0495654_0110646 | Ga0495654_0110646_173_1192 | 338 |
| 136 | 3300046538 | Ga0495609_0019622 | Ga0495609_0019622_1104_2138 | 338 |
| 137 | 3300046539 | Ga0495621_0000113 | Ga0495621_0000113_13064_14083 | 338 |
| 138 | 3300046542 | Ga0495597_0021496 | Ga0495597_0021496_526_1560 | 338 |
| 139 | 3300046558 | Ga0495633_0064321 | Ga0495633_0064321_406_1425 | 338 |
| 140 | 3300046692 | Ga0495671_0038435 | Ga0495671_0038435_669_1688 | 338 |
| 141 | 3300047470 | Ga0495681_0009513 | Ga0495681_0009513_4585_5604 | 338 |
| 142 | 3300047470 | Ga0495681_0045847 | Ga0495681_0045847_192_1226 | 338 |
| 143 | 3300048090 | Ga0495615_0033952 | Ga0495615_0033952_43_1062 | 338 |
| 144 | 3300048091 | Ga0495626_0045637 | Ga0495626_0045637_35_1069 | 338 |
| 145 | 3300048918 | Ga0496115_0018095 | Ga0496115_0018095_1804_2838 | 338 |
| 146 | 3300054114 | Ga0501084_0115626 | Ga0501084_0115626_591_1610 | 338 |
| 147 | 3300003203 | JGI25406J46586_10000250 | JGI25406J46586_1000025020 | 339 |
| 148 | 3300005985 | Ga0081539_10001407 | Ga0081539_1000140741 | 339 |
| 149 | 3300006042 | Ga0075368_10039532 | Ga0075368_100395321 | 339 |
| 150 | 3300006178 | Ga0075367_10020407 | Ga0075367_100204073 | 339 |
| 151 | 3300006186 | Ga0075369_10034115 | Ga0075369_100341151 | 339 |
| 152 | 3300006195 | Ga0075366_10071982 | Ga0075366_100719822 | 339 |
| 153 | 3300013102 | Ga0157371_10000013 | Ga0157371_10000013315 | 339 |
| 154 | 3300013297 | Ga0157378_10232360 | Ga0157378_102323602 | 339 |
| 155 | 3300025904 | Ga0207647_10085467 | Ga0207647_100854673 | 339 |
| 156 | 3300026078 | Ga0207702_10101639 | Ga0207702_101016391 | 339 |
| 157 | 3300028794 | Ga0307515_10049556 | Ga0307515_100495562 | 339 |
| 158 | 3300037466 | Ga0395898_0051091 | Ga0395898_0051091_1539_2576 | 339 |
| 159 | 3300042001 | Ga0439441_000337 | Ga0439441_000337_927_1955 | 339 |
| 160 | 3300042436 | Ga0439435_0000689 | Ga0439435_0000689_757_1785 | 339 |
| 161 | 3300042461 | Ga0439460_0027648 | Ga0439460_0027648_224_1252 | 339 |
| 162 | 3300048904 | Ga0496101_0213994 | Ga0496101_0213994_378_1403 | 339 |
| 163 | 3300048909 | Ga0496106_0033439 | Ga0496106_0033439_2367_3392 | 339 |
| 164 | 3300048910 | Ga0496107_0003143 | Ga0496107_0003143_1706_2731 | 339 |
| 165 | 3300048915 | Ga0496112_0017735 | Ga0496112_0017735_42_1091 | 339 |
| 166 | 3300048916 | Ga0496113_0122522 | Ga0496113_0122522_70_1119 | 339 |
| 167 | 3300048916 | Ga0496113_0202699 | Ga0496113_0202699_232_1257 | 339 |
| 168 | 3300048917 | Ga0496114_0028792 | Ga0496114_0028792_2195_3220 | 339 |
| 169 | 3300049571 | Ga0501034_0056570 | Ga0501034_0056570_1653_2678 | 339 |
| 170 | 3300049574 | Ga0501038_0012969 | Ga0501038_0012969_6100_7125 | 339 |
| 171 | 3300049575 | Ga0501039_0010395 | Ga0501039_0010395_4187_5215 | 339 |
| 172 | 3300049577 | Ga0501041_0021938 | Ga0501041_0021938_2438_3466 | 339 |
| 173 | 3300049582 | Ga0501048_0010868 | Ga0501048_0010868_14_1042 | 339 |
| 174 | 3300049587 | Ga0501071_0035366 | Ga0501071_0035366_1255_2283 | 339 |
| 175 | 3300049588 | Ga0501072_0005493 | Ga0501072_0005493_5419_6447 | 339 |
| 176 | 3300049588 | Ga0501072_0076284 | Ga0501072_0076284_120_1151 | 339 |
| 177 | 3300049591 | Ga0501075_0000410 | Ga0501075_0000410_7616_8644 | 339 |
| 178 | 3300049592 | Ga0501076_0001765 | Ga0501076_0001765_5174_6202 | 339 |
| 179 | 3300049592 | Ga0501076_0157259 | Ga0501076_0157259_702_1730 | 339 |
| 180 | 3300049741 | Ga0501079_0193788 | Ga0501079_0193788_222_1250 | 339 |
| 181 | 3300049743 | Ga0501081_0005625 | Ga0501081_0005625_3981_5009 | 339 |
| 182 | 3300049822 | Ga0501035_0124667 | Ga0501035_0124667_273_1298 | 339 |
| 183 | 3300049824 | Ga0501045_0007439 | Ga0501045_0007439_4863_5891 | 339 |
| 184 | 3300050489 | nmdc:mga03683_94541_c1 | nmdc:mga03683_94541_c1_17_1093 | 339 |
| 185 | 3300050493 | nmdc:mga0k408_54843_c1 | nmdc:mga0k408_54843_c1_399_1475 | 339 |
| 186 | 3300050494 | nmdc:mga06z11_3267_c1 | nmdc:mga06z11_3267_c1_5175_6251 | 339 |
| 187 | 3300053119 | Ga0500595_011037 | Ga0500595_011037_553_1590 | 339 |
| 188 | 3300053131 | Ga0500652_000452 | Ga0500652_000452_10377_11414 | 339 |
| 189 | 3300053730 | Ga0500645_054278 | Ga0500645_054278_22_1098 | 339 |
| 190 | 3300060353 | Ga0501082_0004526 | Ga0501082_0004526_678_1706 | 339 |
| 191 | 3300060353 | Ga0501082_0169444 | Ga0501082_0169444_263_1291 | 339 |
| 192 | 3300061734 | Ga0530510_0007623 | Ga0530510_0007623_1498_2526 | 339 |
| 193 | iso_pu_bacteria | 2547132374 | 2548500321 | 339 |
| 194 | iso_pu_bacteria | 2643221570 | 2643864643 | 339 |
| 195 | iso_pu_bacteria | 2643221596 | 2643992742 | 339 |
| 196 | iso_pu_bacteria | 2643221609 | 2644058343 | 339 |
| 197 | iso_pu_bacteria | 2643221611 | 2644073395 | 339 |
| 198 | iso_pu_bacteria | 2643221652 | 2644296439 | 339 |
| 199 | iso_pu_bacteria | 2643221717 | 2644647130 | 339 |
| 200 | iso_pu_bacteria | 2738543012 | 2739244315 | 339 |
| 201 | iso_pu_bacteria | 2816332133 | 2816469746 | 339 |
| 202 | iso_pu_bacteria | 2919704043 | 2919705023 | 339 |
| 203 | iso_pu_bacteria | 2990710928 | 2990715225 | 339 |
| 204 | 3300003187 | JGI25151J46595_10000545 | JGI25151J46595_1000054514 | 340 |
| 205 | 3300003751 | Ga0055538_1000010 | Ga0055538_1000010270 | 340 |
| 206 | 3300003752 | Ga0055539_1000015 | Ga0055539_1000015270 | 340 |
| 207 | 3300003756 | Ga0055533_1000018 | Ga0055533_1000018270 | 340 |
| 208 | 3300003759 | Ga0055525_1000020 | Ga0055525_1000020270 | 340 |
| 209 | 3300003771 | Ga0055526_1000336 | Ga0055526_100033615 | 340 |
| 210 | 3300003771 | Ga0055526_1004371 | Ga0055526_10043715 | 340 |
| 211 | 3300003773 | Ga0055537_1000060 | Ga0055537_10000604 | 340 |
| 212 | 3300003773 | Ga0055537_1001197 | Ga0055537_10011974 | 340 |
| 213 | 3300003775 | Ga0055524_1001147 | Ga0055524_10011477 | 340 |
| 214 | 3300003775 | Ga0055524_1001729 | Ga0055524_10017295 | 340 |
| 215 | 3300003775 | Ga0055524_1005063 | Ga0055524_10050632 | 340 |
| 216 | 3300003784 | Ga0055534_1000009 | Ga0055534_100000943 | 340 |
| 217 | 3300003784 | Ga0055534_1000341 | Ga0055534_100034114 | 340 |
| 218 | 3300003784 | Ga0055534_1000777 | Ga0055534_100077711 | 340 |
| 219 | 3300003790 | Ga0055528_1000012 | Ga0055528_1000012136 | 340 |
| 220 | 3300003791 | Ga0055530_10003376 | Ga0055530_100033763 | 340 |
| 221 | 3300003792 | Ga0055540_1000016 | Ga0055540_100001685 | 340 |
| 222 | 3300003841 | Ga0055541_1000011 | Ga0055541_1000011270 | 340 |
| 223 | 3300005295 | Ga0065707_10084750 | Ga0065707_100847507 | 340 |
| 224 | 3300005329 | Ga0070683_100065312 | Ga0070683_1000653122 | 340 |
| 225 | 3300005336 | Ga0070680_100011410 | Ga0070680_1000114105 | 340 |
| 226 | 3300005337 | Ga0070682_100000252 | Ga0070682_10000025212 | 340 |
| 227 | 3300005338 | Ga0068868_100140159 | Ga0068868_1001401592 | 340 |
| 228 | 3300005338 | Ga0068868_100172909 | Ga0068868_1001729092 | 340 |
| 229 | 3300005353 | Ga0070669_100049967 | Ga0070669_1000499673 | 340 |
| 230 | 3300005354 | Ga0070675_100250598 | Ga0070675_1002505982 | 340 |
| 231 | 3300005364 | Ga0070673_100086512 | Ga0070673_1000865123 | 340 |
| 232 | 3300005367 | Ga0070667_100038773 | Ga0070667_1000387733 | 340 |
| 233 | 3300005441 | Ga0070700_100122036 | Ga0070700_1001220362 | 340 |
| 234 | 3300005455 | Ga0070663_100137140 | Ga0070663_1001371402 | 340 |
| 235 | 3300005455 | Ga0070663_100148612 | Ga0070663_1001486122 | 340 |
| 236 | 3300005456 | Ga0070678_100109558 | Ga0070678_1001095582 | 340 |
| 237 | 3300005459 | Ga0068867_100001563 | Ga0068867_1000015638 | 340 |
| 238 | 3300005459 | Ga0068867_100212036 | Ga0068867_1002120362 | 340 |
| 239 | 3300005530 | Ga0070679_100000180 | Ga0070679_10000018022 | 340 |
| 240 | 3300005539 | Ga0068853_100145864 | Ga0068853_1001458642 | 340 |
| 241 | 3300005543 | Ga0070672_100014528 | Ga0070672_1000145284 | 340 |
| 242 | 3300005543 | Ga0070672_100109350 | Ga0070672_1001093502 | 340 |
| 243 | 3300005548 | Ga0070665_100094448 | Ga0070665_1000944485 | 340 |
| 244 | 3300005548 | Ga0070665_100218435 | Ga0070665_1002184352 | 340 |
| 245 | 3300005577 | Ga0068857_100005085 | Ga0068857_1000050859 | 340 |
| 246 | 3300005578 | Ga0068854_100036656 | Ga0068854_1000366562 | 340 |
| 247 | 3300005614 | Ga0068856_100501402 | Ga0068856_1005014022 | 340 |
| 248 | 3300005617 | Ga0068859_100033265 | Ga0068859_1000332653 | 340 |
| 249 | 3300005617 | Ga0068859_100126907 | Ga0068859_1001269073 | 340 |
| 250 | 3300005718 | Ga0068866_10160338 | Ga0068866_101603381 | 340 |
| 251 | 3300005719 | Ga0068861_100000654 | Ga0068861_1000006547 | 340 |
| 252 | 3300005719 | Ga0068861_100180278 | Ga0068861_1001802782 | 340 |
| 253 | 3300005841 | Ga0068863_100206010 | Ga0068863_1002060103 | 340 |
| 254 | 3300005842 | Ga0068858_100269925 | Ga0068858_1002699252 | 340 |
| 255 | 3300005843 | Ga0068860_100000602 | Ga0068860_10000060237 | 340 |
| 256 | 3300005844 | Ga0068862_100004504 | Ga0068862_1000045047 | 340 |
| 257 | 3300005844 | Ga0068862_100032137 | Ga0068862_1000321372 | 340 |
| 258 | 3300005844 | Ga0068862_100057123 | Ga0068862_1000571233 | 340 |
| 259 | 3300006195 | Ga0075366_10002354 | Ga0075366_100023549 | 340 |
| 260 | 3300006195 | Ga0075366_10020394 | Ga0075366_100203942 | 340 |
| 261 | 3300006195 | Ga0075366_10056364 | Ga0075366_100563642 | 340 |
| 262 | 3300006195 | Ga0075366_10060174 | Ga0075366_100601743 | 340 |
| 263 | 3300006358 | Ga0068871_100019604 | Ga0068871_1000196044 | 340 |
| 264 | 3300006881 | Ga0068865_100002296 | Ga0068865_10000229610 | 340 |
| 265 | 3300006881 | Ga0068865_100118490 | Ga0068865_1001184902 | 340 |
| 266 | 3300006931 | Ga0097620_100033265 | Ga0097620_1000332653 | 340 |
| 267 | 3300006931 | Ga0097620_100126910 | Ga0097620_1001269103 | 340 |
| 268 | 3300009093 | Ga0105240_10001549 | Ga0105240_1000154910 | 340 |
| 269 | 3300009093 | Ga0105240_10205200 | Ga0105240_102052002 | 340 |
| 270 | 3300009098 | Ga0105245_10000304 | Ga0105245_1000030417 | 340 |
| 271 | 3300009545 | Ga0105237_10003670 | Ga0105237_100036706 | 340 |
| 272 | 3300009545 | Ga0105237_10003738 | Ga0105237_100037389 | 340 |
| 273 | 3300009551 | Ga0105238_10004877 | Ga0105238_100048778 | 340 |
| 274 | 3300009551 | Ga0105238_10017238 | Ga0105238_100172386 | 340 |
| 275 | 3300009551 | Ga0105238_10071110 | Ga0105238_100711103 | 340 |
| 276 | 3300009551 | Ga0105238_10209044 | Ga0105238_102090442 | 340 |
| 277 | 3300010375 | Ga0105239_10005317 | Ga0105239_100053176 | 340 |
| 278 | 3300010375 | Ga0105239_10060721 | Ga0105239_100607212 | 340 |
| 279 | 3300010375 | Ga0105239_10345655 | Ga0105239_103456552 | 340 |
| 280 | 3300011119 | Ga0105246_10128394 | Ga0105246_101283942 | 340 |
| 281 | 3300013296 | Ga0157374_10370200 | Ga0157374_103702002 | 340 |
| 282 | 3300013297 | Ga0157378_10001074 | Ga0157378_100010749 | 340 |
| 283 | 3300013297 | Ga0157378_10005793 | Ga0157378_100057932 | 340 |
| 284 | 3300013307 | Ga0157372_10299267 | Ga0157372_102992672 | 340 |
| 285 | 3300014326 | Ga0157380_10184998 | Ga0157380_101849982 | 340 |
| 286 | 3300014326 | Ga0157380_10188195 | Ga0157380_101881952 | 340 |
| 287 | 3300014745 | Ga0157377_10169970 | Ga0157377_101699702 | 340 |
| 288 | 3300014968 | Ga0157379_10029133 | Ga0157379_100291334 | 340 |
| 289 | 3300015261 | Ga0182006_1000802 | Ga0182006_100080213 | 340 |
| 290 | 3300021361 | Ga0213872_10000547 | Ga0213872_1000054717 | 340 |
| 291 | 3300021361 | Ga0213872_10007605 | Ga0213872_100076053 | 340 |
| 292 | 3300021361 | Ga0213872_10036381 | Ga0213872_100363812 | 340 |
| 293 | 3300025224 | Ga0209784_100025 | Ga0209784_100025267 | 340 |
| 294 | 3300025225 | Ga0209566_100025 | Ga0209566_100025267 | 340 |
| 295 | 3300025226 | Ga0209674_100042 | Ga0209674_100042267 | 340 |
| 296 | 3300025230 | Ga0209563_100046 | Ga0209563_100046267 | 340 |
| 297 | 3300025253 | Ga0209677_100027 | Ga0209677_100027267 | 340 |
| 298 | 3300025253 | Ga0209677_100280 | Ga0209677_10028012 | 340 |
| 299 | 3300025261 | Ga0209233_1002090 | Ga0209233_10020905 | 340 |
| 300 | 3300025263 | Ga0209565_1000015 | Ga0209565_1000015319 | 340 |
| 301 | 3300025263 | Ga0209565_1000086 | Ga0209565_1000086110 | 340 |
| 302 | 3300025263 | Ga0209565_1007495 | Ga0209565_10074952 | 340 |
| 303 | 3300025272 | Ga0209455_1001166 | Ga0209455_100116611 | 340 |
| 304 | 3300025273 | Ga0209673_1000017 | Ga0209673_1000017210 | 340 |
| 305 | 3300025291 | Ga0209675_1000012 | Ga0209675_1000012163 | 340 |
| 306 | 3300025291 | Ga0209675_1000510 | Ga0209675_100051013 | 340 |
| 307 | 3300025291 | Ga0209675_1001661 | Ga0209675_10016612 | 340 |
| 308 | 3300025291 | Ga0209675_1001762 | Ga0209675_10017628 | 340 |
| 309 | 3300025294 | Ga0209025_1000059 | Ga0209025_1000059177 | 340 |
| 310 | 3300025294 | Ga0209025_1000380 | Ga0209025_100038011 | 340 |
| 311 | 3300025294 | Ga0209025_1000550 | Ga0209025_100055046 | 340 |
| 312 | 3300025295 | Ga0209564_1000016 | Ga0209564_1000016276 | 340 |
| 313 | 3300025295 | Ga0209564_1000814 | Ga0209564_100081424 | 340 |
| 314 | 3300025295 | Ga0209564_1001766 | Ga0209564_10017665 | 340 |
| 315 | 3300025295 | Ga0209564_1002095 | Ga0209564_10020954 | 340 |
| 316 | 3300025298 | Ga0209050_1000082 | Ga0209050_1000082120 | 340 |
| 317 | 3300025298 | Ga0209050_1004407 | Ga0209050_10044078 | 340 |
| 318 | 3300025299 | Ga0209256_1000045 | Ga0209256_100004567 | 340 |
| 319 | 3300025299 | Ga0209256_1000086 | Ga0209256_1000086102 | 340 |
| 320 | 3300025299 | Ga0209256_1000314 | Ga0209256_100031440 | 340 |
| 321 | 3300025299 | Ga0209256_1003909 | Ga0209256_10039093 | 340 |
| 322 | 3300025303 | Ga0209051_1000029 | Ga0209051_1000029120 | 340 |
| 323 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030113 | 340 |
| 324 | 3300025907 | Ga0207645_10218132 | Ga0207645_102181322 | 340 |
| 325 | 3300025913 | Ga0207695_10037106 | Ga0207695_100371062 | 340 |
| 326 | 3300025921 | Ga0207652_10009390 | Ga0207652_100093906 | 340 |
| 327 | 3300025923 | Ga0207681_10082670 | Ga0207681_100826702 | 340 |
| 328 | 3300025924 | Ga0207694_10004641 | Ga0207694_100046414 | 340 |
| 329 | 3300025924 | Ga0207694_10091014 | Ga0207694_100910142 | 340 |
| 330 | 3300025925 | Ga0207650_10056708 | Ga0207650_100567083 | 340 |
| 331 | 3300025926 | Ga0207659_10216757 | Ga0207659_102167572 | 340 |
| 332 | 3300025927 | Ga0207687_10006397 | Ga0207687_100063977 | 340 |
| 333 | 3300025935 | Ga0207709_10089506 | Ga0207709_100895063 | 340 |
| 334 | 3300025940 | Ga0207691_10012884 | Ga0207691_100128842 | 340 |
| 335 | 3300025940 | Ga0207691_10028712 | Ga0207691_100287122 | 340 |
| 336 | 3300025942 | Ga0207689_10075235 | Ga0207689_100752352 | 340 |
| 337 | 3300025949 | Ga0207667_10009983 | Ga0207667_100099835 | 340 |
| 338 | 3300025949 | Ga0207667_10218116 | Ga0207667_102181162 | 340 |
| 339 | 3300025981 | Ga0207640_10059297 | Ga0207640_100592972 | 340 |
| 340 | 3300026035 | Ga0207703_10165759 | Ga0207703_101657592 | 340 |
| 341 | 3300026067 | Ga0207678_10351679 | Ga0207678_103516792 | 340 |
| 342 | 3300026089 | Ga0207648_10000582 | Ga0207648_1000058230 | 340 |
| 343 | 3300026089 | Ga0207648_10109504 | Ga0207648_101095043 | 340 |
| 344 | 3300026116 | Ga0207674_10002404 | Ga0207674_100024044 | 340 |
| 345 | 3300026118 | Ga0207675_100000601 | Ga0207675_10000060128 | 340 |
| 346 | 3300026118 | Ga0207675_100087055 | Ga0207675_1000870553 | 340 |
| 347 | 3300026121 | Ga0207683_10071593 | Ga0207683_100715933 | 340 |
| 348 | 3300026142 | Ga0207698_10112555 | Ga0207698_101125553 | 340 |
| 349 | 3300027552 | Ga0209982_1004484 | Ga0209982_10044843 | 340 |
| 350 | 3300028379 | Ga0268266_10216977 | Ga0268266_102169772 | 340 |
| 351 | 3300028379 | Ga0268266_10329639 | Ga0268266_103296392 | 340 |
| 352 | 3300028380 | Ga0268265_10003246 | Ga0268265_100032468 | 340 |
| 353 | 3300028380 | Ga0268265_10210613 | Ga0268265_102106132 | 340 |
| 354 | 3300028381 | Ga0268264_10001438 | Ga0268264_1000143815 | 340 |
| 355 | 3300028556 | Ga0265337_1001439 | Ga0265337_10014394 | 340 |
| 356 | 3300028558 | Ga0265326_10001380 | Ga0265326_100013803 | 340 |
| 357 | 3300028563 | Ga0265319_1002798 | Ga0265319_10027989 | 340 |
| 358 | 3300028573 | Ga0265334_10005260 | Ga0265334_100052605 | 340 |
| 359 | 3300028577 | Ga0265318_10003474 | Ga0265318_100034747 | 340 |
| 360 | 3300028653 | Ga0265323_10000992 | Ga0265323_100009923 | 340 |
| 361 | 3300028654 | Ga0265322_10002589 | Ga0265322_100025893 | 340 |
| 362 | 3300028666 | Ga0265336_10000063 | Ga0265336_1000006377 | 340 |
| 363 | 3300028786 | Ga0307517_10095068 | Ga0307517_100950682 | 340 |
| 364 | 3300028800 | Ga0265338_10000087 | Ga0265338_10000087143 | 340 |
| 365 | 3300028800 | Ga0265338_10000154 | Ga0265338_1000015417 | 340 |
| 366 | 3300028800 | Ga0265338_10003118 | Ga0265338_1000311824 | 340 |
| 367 | 3300029957 | Ga0265324_10001590 | Ga0265324_1000159011 | 340 |
| 368 | 3300030521 | Ga0307511_10076742 | Ga0307511_100767422 | 340 |
| 369 | 3300031247 | Ga0265340_10032584 | Ga0265340_100325842 | 340 |
| 370 | 3300031507 | Ga0307509_10009946 | Ga0307509_100099466 | 340 |
| 371 | 3300031616 | Ga0307508_10011607 | Ga0307508_100116073 | 340 |
| 372 | 3300031730 | Ga0307516_10083114 | Ga0307516_100831142 | 340 |
| 373 | 3300031730 | Ga0307516_10176584 | Ga0307516_101765841 | 340 |
| 374 | 3300031838 | Ga0307518_10038656 | Ga0307518_100386563 | 340 |
| 375 | 3300032133 | Ga0316583_10002590 | Ga0316583_100025903 | 340 |
| 376 | 3300033180 | Ga0307510_10025998 | Ga0307510_100259984 | 340 |
| 377 | 3300033180 | Ga0307510_10052888 | Ga0307510_100528883 | 340 |
| 378 | 3300035695 | Ga0373927_0088386 | Ga0373927_0088386_651_1682 | 340 |
| 379 | 3300036401 | Ga0373937_0323570 | Ga0373937_0323570_324_1349 | 340 |
| 380 | 3300036712 | Ga0316584_0002088 | Ga0316584_0002088_6311_7348 | 340 |
| 381 | 3300037068 | Ga0373925_0004343 | Ga0373925_0004343_4958_5983 | 340 |
| 382 | 3300037471 | Ga0395905_0002007 | Ga0395905_0002007_2604_3650 | 340 |
| 383 | 3300039437 | Ga0436365_0082862 | Ga0436365_0082862_434_1459 | 340 |
| 384 | 3300039437 | Ga0436365_1221318 | Ga0436365_1221318_148_1173 | 340 |
| 385 | 3300039447 | Ga0436361_0527730 | Ga0436361_0527730_24272_25309 | 340 |
| 386 | 3300039447 | Ga0436361_0632584 | Ga0436361_0632584_2183_3208 | 340 |
| 387 | 3300039447 | Ga0436361_0761768 | Ga0436361_0761768_4771_5808 | 340 |
| 388 | 3300042007 | Ga0439449_0005387 | Ga0439449_0005387_3631_4668 | 340 |
| 389 | 3300042876 | Ga0451577_0000271 | Ga0451577_0000271_20550_21575 | 340 |
| 390 | 3300044684 | Ga0466966_0009768 | Ga0466966_0009768_2588_3625 | 340 |
| 391 | 3300044694 | Ga0466963_0000320 | Ga0466963_0000320_7658_8686 | 340 |
| 392 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_97027_98052 | 340 |
| 393 | 3300044712 | Ga0453684_0000583 | Ga0453684_0000583_130675_131700 | 340 |
| 394 | 3300044712 | Ga0453684_0000702 | Ga0453684_0000702_22925_24145 | 340 |
| 395 | 3300044712 | Ga0453684_0006332 | Ga0453684_0006332_3925_4950 | 340 |
| 396 | 3300044735 | Ga0466968_0002656 | Ga0466968_0002656_5080_6105 | 340 |
| 397 | 3300044842 | Ga0466957_0036330 | Ga0466957_0036330_22_1065 | 340 |
| 398 | 3300045051 | Ga0451576_0000137 | Ga0451576_0000137_4241_5266 | 340 |
| 399 | 3300045051 | Ga0451576_0000259 | Ga0451576_0000259_37792_38817 | 340 |
| 400 | 3300045976 | Ga0466967_0236995 | Ga0466967_0236995_463_1491 | 340 |
| 401 | 3300046453 | Ga0495627_000007 | Ga0495627_000007_358045_359082 | 340 |
| 402 | 3300046457 | Ga0495590_0000008 | Ga0495590_0000008_28252_29295 | 340 |
| 403 | 3300046458 | Ga0495591_000043 | Ga0495591_000043_98096_99127 | 340 |
| 404 | 3300046463 | Ga0495653_0000002 | Ga0495653_0000002_301091_302116 | 340 |
| 405 | 3300046463 | Ga0495653_0012104 | Ga0495653_0012104_2471_3508 | 340 |
| 406 | 3300046474 | Ga0495605_0008667 | Ga0495605_0008667_1063_2100 | 340 |
| 407 | 3300046491 | Ga0495584_0000025 | Ga0495584_0000025_29489_30520 | 340 |
| 408 | 3300046491 | Ga0495584_0000173 | Ga0495584_0000173_6252_7289 | 340 |
| 409 | 3300046492 | Ga0495585_0004296 | Ga0495585_0004296_2006_3043 | 340 |
| 410 | 3300046492 | Ga0495585_0055384 | Ga0495585_0055384_610_1641 | 340 |
| 411 | 3300046499 | Ga0495594_0038315 | Ga0495594_0038315_970_1995 | 340 |
| 412 | 3300046500 | Ga0495596_0000604 | Ga0495596_0000604_15551_16588 | 340 |
| 413 | 3300046500 | Ga0495596_0004602 | Ga0495596_0004602_3872_4909 | 340 |
| 414 | 3300046500 | Ga0495596_0019695 | Ga0495596_0019695_1148_2179 | 340 |
| 415 | 3300046501 | Ga0495607_0014372 | Ga0495607_0014372_1164_2201 | 340 |
| 416 | 3300046506 | Ga0495583_0000011 | Ga0495583_0000011_173428_174465 | 340 |
| 417 | 3300046506 | Ga0495583_0000512 | Ga0495583_0000512_25597_26628 | 340 |
| 418 | 3300046506 | Ga0495583_0036138 | Ga0495583_0036138_1057_2094 | 340 |
| 419 | 3300046512 | Ga0495610_0002865 | Ga0495610_0002865_7733_8764 | 340 |
| 420 | 3300046512 | Ga0495610_0012368 | Ga0495610_0012368_2199_3236 | 340 |
| 421 | 3300046513 | Ga0495616_0000643 | Ga0495616_0000643_22981_24018 | 340 |
| 422 | 3300046513 | Ga0495616_0034632 | Ga0495616_0034632_366_1403 | 340 |
| 423 | 3300046518 | Ga0495631_0000337 | Ga0495631_0000337_3814_4851 | 340 |
| 424 | 3300046518 | Ga0495631_0018893 | Ga0495631_0018893_841_1884 | 340 |
| 425 | 3300046518 | Ga0495631_0023463 | Ga0495631_0023463_975_2006 | 340 |
| 426 | 3300046519 | Ga0495632_0017507 | Ga0495632_0017507_1128_2165 | 340 |
| 427 | 3300046520 | Ga0495637_0000009 | Ga0495637_0000009_311047_312078 | 340 |
| 428 | 3300046522 | Ga0495643_0000028 | Ga0495643_0000028_259353_260390 | 340 |
| 429 | 3300046522 | Ga0495643_0092054 | Ga0495643_0092054_301_1326 | 340 |
| 430 | 3300046523 | Ga0495644_0000119 | Ga0495644_0000119_10058_11095 | 340 |
| 431 | 3300046523 | Ga0495644_0023099 | Ga0495644_0023099_700_1737 | 340 |
| 432 | 3300046523 | Ga0495644_0074202 | Ga0495644_0074202_140_1171 | 340 |
| 433 | 3300046524 | Ga0495648_0062334 | Ga0495648_0062334_1047_2084 | 340 |
| 434 | 3300046528 | Ga0495642_0011402 | Ga0495642_0011402_2197_3234 | 340 |
| 435 | 3300046538 | Ga0495609_0000647 | Ga0495609_0000647_22442_23479 | 340 |
| 436 | 3300046542 | Ga0495597_0000762 | Ga0495597_0000762_2057_3094 | 340 |
| 437 | 3300046542 | Ga0495597_0000911 | Ga0495597_0000911_76_1113 | 340 |
| 438 | 3300046557 | Ga0495622_0000092 | Ga0495622_0000092_7079_8116 | 340 |
| 439 | 3300046558 | Ga0495633_0000181 | Ga0495633_0000181_50943_51980 | 340 |
| 440 | 3300046558 | Ga0495633_0000742 | Ga0495633_0000742_888_1925 | 340 |
| 441 | 3300046558 | Ga0495633_0004718 | Ga0495633_0004718_561_1598 | 340 |
| 442 | 3300046616 | Ga0495668_0000018 | Ga0495668_0000018_170644_171681 | 340 |
| 443 | 3300046616 | Ga0495668_0000028 | Ga0495668_0000028_96207_97244 | 340 |
| 444 | 3300046616 | Ga0495668_0042735 | Ga0495668_0042735_20_1057 | 340 |
| 445 | 3300046648 | Ga0495611_0000361 | Ga0495611_0000361_1075_2106 | 340 |
| 446 | 3300046648 | Ga0495611_0001188 | Ga0495611_0001188_2011_3048 | 340 |
| 447 | 3300046648 | Ga0495611_0006888 | Ga0495611_0006888_331_1368 | 340 |
| 448 | 3300046648 | Ga0495611_0013006 | Ga0495611_0013006_1129_2166 | 340 |
| 449 | 3300046660 | Ga0495625_0077111 | Ga0495625_0077111_556_1581 | 340 |
| 450 | 3300046665 | Ga0495661_0003126 | Ga0495661_0003126_6771_7808 | 340 |
| 451 | 3300046665 | Ga0495661_0007978 | Ga0495661_0007978_707_1744 | 340 |
| 452 | 3300046665 | Ga0495661_0034022 | Ga0495661_0034022_757_1794 | 340 |
| 453 | 3300046665 | Ga0495661_0178883 | Ga0495661_0178883_38_1069 | 340 |
| 454 | 3300046681 | Ga0495647_0001791 | Ga0495647_0001791_4904_5929 | 340 |
| 455 | 3300046684 | Ga0495669_0007195 | Ga0495669_0007195_2669_3706 | 340 |
| 456 | 3300046691 | Ga0495670_0000053 | Ga0495670_0000053_27548_28585 | 340 |
| 457 | 3300046691 | Ga0495670_0012551 | Ga0495670_0012551_2449_3486 | 340 |
| 458 | 3300046694 | Ga0495649_0000028 | Ga0495649_0000028_112506_113537 | 340 |
| 459 | 3300046694 | Ga0495649_0032021 | Ga0495649_0032021_1707_2732 | 340 |
| 460 | 3300046794 | Ga0495589_0018666 | Ga0495589_0018666_1422_2447 | 340 |
| 461 | 3300046810 | Ga0495660_0020740 | Ga0495660_0020740_1509_2534 | 340 |
| 462 | 3300046810 | Ga0495660_0085207 | Ga0495660_0085207_478_1503 | 340 |
| 463 | 3300047318 | Ga0495636_0004208 | Ga0495636_0004208_1206_2231 | 340 |
| 464 | 3300047320 | Ga0495672_0000055 | Ga0495672_0000055_98048_99079 | 340 |
| 465 | 3300047320 | Ga0495672_0003194 | Ga0495672_0003194_6985_8022 | 340 |
| 466 | 3300047320 | Ga0495672_0019403 | Ga0495672_0019403_3180_4205 | 340 |
| 467 | 3300047323 | Ga0495683_0000047 | Ga0495683_0000047_95164_96195 | 340 |
| 468 | 3300047443 | Ga0495687_003723 | Ga0495687_003723_1917_2954 | 340 |
| 469 | 3300047443 | Ga0495687_010481 | Ga0495687_010481_2974_3999 | 340 |
| 470 | 3300047443 | Ga0495687_011218 | Ga0495687_011218_2004_3029 | 340 |
| 471 | 3300047445 | Ga0495677_0000986 | Ga0495677_0000986_9991_11028 | 340 |
| 472 | 3300047445 | Ga0495677_0007612 | Ga0495677_0007612_2841_3878 | 340 |
| 473 | 3300047445 | Ga0495677_0011525 | Ga0495677_0011525_2182_3219 | 340 |
| 474 | 3300047445 | Ga0495677_0025374 | Ga0495677_0025374_549_1586 | 340 |
| 475 | 3300047446 | Ga0495679_010120 | Ga0495679_010120_2143_3174 | 340 |
| 476 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_429396_430433 | 340 |
| 477 | 3300047470 | Ga0495681_0006008 | Ga0495681_0006008_3846_4883 | 340 |
| 478 | 3300047470 | Ga0495681_0011106 | Ga0495681_0011106_212_1249 | 340 |
| 479 | 3300048088 | Ga0495602_0307882 | Ga0495602_0307882_45_1094 | 340 |
| 480 | 3300048091 | Ga0495626_0007108 | Ga0495626_0007108_2278_3315 | 340 |
| 481 | 3300048091 | Ga0495626_0007741 | Ga0495626_0007741_1892_2929 | 340 |
| 482 | 3300048091 | Ga0495626_0030425 | Ga0495626_0030425_163_1200 | 340 |
| 483 | 3300048903 | Ga0496100_0000929 | Ga0496100_0000929_4659_5684 | 340 |
| 484 | 3300048904 | Ga0496101_0005022 | Ga0496101_0005022_852_1877 | 340 |
| 485 | 3300048905 | Ga0496102_0014718 | Ga0496102_0014718_3379_4404 | 340 |
| 486 | 3300048905 | Ga0496102_0199474 | Ga0496102_0199474_602_1627 | 340 |
| 487 | 3300048906 | Ga0496103_0016204 | Ga0496103_0016204_2287_3312 | 340 |
| 488 | 3300048907 | Ga0496104_0002648 | Ga0496104_0002648_6476_7501 | 340 |
| 489 | 3300048907 | Ga0496104_0150125 | Ga0496104_0150125_719_1744 | 340 |
| 490 | 3300048909 | Ga0496106_0004659 | Ga0496106_0004659_4280_5305 | 340 |
| 491 | 3300048910 | Ga0496107_0025568 | Ga0496107_0025568_2440_3465 | 340 |
| 492 | 3300048911 | Ga0496108_0008379 | Ga0496108_0008379_5123_6148 | 340 |
| 493 | 3300048911 | Ga0496108_0077250 | Ga0496108_0077250_847_1872 | 340 |
| 494 | 3300048912 | Ga0496109_0022002 | Ga0496109_0022002_1526_2551 | 340 |
| 495 | 3300048913 | Ga0496110_0000729 | Ga0496110_0000729_13547_14572 | 340 |
| 496 | 3300048913 | Ga0496110_0008923 | Ga0496110_0008923_4985_6010 | 340 |
| 497 | 3300048914 | Ga0496111_0004705 | Ga0496111_0004705_597_1622 | 340 |
| 498 | 3300048914 | Ga0496111_0069535 | Ga0496111_0069535_1380_2405 | 340 |
| 499 | 3300048915 | Ga0496112_0005808 | Ga0496112_0005808_3072_4097 | 340 |
| 500 | 3300048916 | Ga0496113_0016931 | Ga0496113_0016931_3170_4195 | 340 |
| 501 | 3300048916 | Ga0496113_0042675 | Ga0496113_0042675_1584_2609 | 340 |
| 502 | 3300048918 | Ga0496115_0007693 | Ga0496115_0007693_2443_3468 | 340 |
| 503 | 3300048919 | Ga0496116_0064205 | Ga0496116_0064205_460_1491 | 340 |
| 504 | 3300048924 | Ga0496121_0055079 | Ga0496121_0055079_404_1429 | 340 |
| 505 | 3300049459 | Ga0495678_000060 | Ga0495678_000060_112567_113604 | 340 |
| 506 | 3300049459 | Ga0495678_000266 | Ga0495678_000266_36022_37059 | 340 |
| 507 | 3300049459 | Ga0495678_039730 | Ga0495678_039730_577_1623 | 340 |
| 508 | 3300049459 | Ga0495678_039877 | Ga0495678_039877_459_1496 | 340 |
| 509 | 3300049460 | Ga0495682_0000035 | Ga0495682_0000035_64185_65222 | 340 |
| 510 | 3300049568 | Ga0501031_0239964 | Ga0501031_0239964_22_1050 | 340 |
| 511 | 3300049571 | Ga0501034_0274409 | Ga0501034_0274409_478_1506 | 340 |
| 512 | 3300049572 | Ga0501036_0105368 | Ga0501036_0105368_1210_2238 | 340 |
| 513 | 3300049573 | Ga0501037_0164638 | Ga0501037_0164638_292_1320 | 340 |
| 514 | 3300049574 | Ga0501038_0023790 | Ga0501038_0023790_2977_4002 | 340 |
| 515 | 3300049578 | Ga0501042_0056056 | Ga0501042_0056056_1693_2721 | 340 |
| 516 | 3300049579 | Ga0501043_0021150 | Ga0501043_0021150_3965_4993 | 340 |
| 517 | 3300049579 | Ga0501043_0292325 | Ga0501043_0292325_60_1088 | 340 |
| 518 | 3300049580 | Ga0501046_0094302 | Ga0501046_0094302_241_1269 | 340 |
| 519 | 3300049580 | Ga0501046_0182877 | Ga0501046_0182877_228_1256 | 340 |
| 520 | 3300049581 | Ga0501047_0004563 | Ga0501047_0004563_7173_8201 | 340 |
| 521 | 3300049581 | Ga0501047_0101760 | Ga0501047_0101760_946_1974 | 340 |
| 522 | 3300049582 | Ga0501048_0008908 | Ga0501048_0008908_101_1129 | 340 |
| 523 | 3300049582 | Ga0501048_0042759 | Ga0501048_0042759_1265_2293 | 340 |
| 524 | 3300049822 | Ga0501035_0024668 | Ga0501035_0024668_4364_5392 | 340 |
| 525 | 3300049823 | Ga0501044_0011617 | Ga0501044_0011617_7320_8345 | 340 |
| 526 | 3300049823 | Ga0501044_0046836 | Ga0501044_0046836_124_1152 | 340 |
| 527 | 3300049823 | Ga0501044_0047853 | Ga0501044_0047853_1857_2885 | 340 |
| 528 | 3300049823 | Ga0501044_0049233 | Ga0501044_0049233_2075_3103 | 340 |
| 529 | 3300049824 | Ga0501045_0037446 | Ga0501045_0037446_160_1185 | 340 |
| 530 | 3300050493 | nmdc:mga0k408_221_c1 | nmdc:mga0k408_221_c1_12552_13577 | 340 |
| 531 | 3300050493 | nmdc:mga0k408_62462_c1 | nmdc:mga0k408_62462_c1_101_1126 | 340 |
| 532 | 3300053117 | Ga0500593_000250 | Ga0500593_000250_13946_14977 | 340 |
| 533 | 3300053145 | Ga0500586_000197 | Ga0500586_000197_10549_11586 | 340 |
| 534 | 3300053161 | Ga0500634_0001009 | Ga0500634_0001009_2441_3466 | 340 |
| 535 | iso_pu_bacteria | 2765235838 | 2765570804 | 340 |
| 536 | iso_pu_bacteria | 2808606386 | 2808984141 | 340 |
| 537 | iso_pu_bacteria | 2808606415 | 2809131945 | 340 |
| 538 | iso_pu_bacteria | 2808606418 | 2809146995 | 340 |
| 539 | iso_pu_bacteria | 2808606419 | 2809151568 | 340 |
| 540 | iso_pu_bacteria | 2842711865 | 2842715392 | 340 |
| 541 | iso_pu_bacteria | 2852618963 | 2852622973 | 340 |
| 542 | iso_pu_bacteria | 2857553236 | 2857554544 | 340 |
| 543 | iso_pu_bacteria | 2904439833 | 2904440011 | 340 |
| 544 | iso_pu_bacteria | 2904530477 | 2904531041 | 340 |
| 545 | iso_pu_bacteria | 2904584206 | 2904587314 | 340 |
| 546 | iso_pu_bacteria | 2904589729 | 2904592651 | 340 |
| 547 | iso_pu_bacteria | 2904601388 | 2904604567 | 340 |
| 548 | iso_pu_bacteria | 2919046199 | 2919050339 | 340 |
| 549 | iso_pu_bacteria | 2919079590 | 2919082388 | 340 |
| 550 | 3300001991 | JGI24743J22301_10000797 | JGI24743J22301_100007972 | 341 |
| 551 | 3300002073 | JGI24745J21846_1009742 | JGI24745J21846_10097421 | 341 |
| 552 | 3300002244 | JGI24742J22300_10009999 | JGI24742J22300_100099992 | 341 |
| 553 | 3300002773 | JGI25152J39213_1004123 | JGI25152J39213_10041233 | 341 |
| 554 | 3300002987 | JGI25159J45721_1007113 | JGI25159J45721_10071133 | 341 |
| 555 | 3300003187 | JGI25151J46595_10003021 | JGI25151J46595_100030218 | 341 |
| 556 | 3300003203 | JGI25406J46586_10004727 | JGI25406J46586_100047277 | 341 |
| 557 | 3300003203 | JGI25406J46586_10007846 | JGI25406J46586_100078464 | 341 |
| 558 | 3300003215 | JGI25153J46596_10000540 | JGI25153J46596_1000054014 | 341 |
| 559 | 3300003215 | JGI25153J46596_10002993 | JGI25153J46596_100029938 | 341 |
| 560 | 3300003354 | JGI25160J50197_1020348 | JGI25160J50197_10203482 | 341 |
| 561 | 3300003771 | Ga0055526_1005207 | Ga0055526_10052077 | 341 |
| 562 | 3300003775 | Ga0055524_1000157 | Ga0055524_100015722 | 341 |
| 563 | 3300003781 | Ga0055536_1003357 | Ga0055536_10033573 | 341 |
| 564 | 3300003781 | Ga0055536_1004808 | Ga0055536_10048084 | 341 |
| 565 | 3300003784 | Ga0055534_1000858 | Ga0055534_100085810 | 341 |
| 566 | 3300003784 | Ga0055534_1001653 | Ga0055534_10016534 | 341 |
| 567 | 3300003791 | Ga0055530_10000311 | Ga0055530_1000031111 | 341 |
| 568 | 3300003792 | Ga0055540_1001497 | Ga0055540_10014974 | 341 |
| 569 | 3300003792 | Ga0055540_1001826 | Ga0055540_100182613 | 341 |
| 570 | 3300003792 | Ga0055540_1005932 | Ga0055540_10059325 | 341 |
| 571 | 3300003792 | Ga0055540_1025950 | Ga0055540_10259502 | 341 |
| 572 | 3300003794 | Ga0055531_10000103 | Ga0055531_1000010333 | 341 |
| 573 | 3300003794 | Ga0055531_10001224 | Ga0055531_1000122415 | 341 |
| 574 | 3300003794 | Ga0055531_10001302 | Ga0055531_100013024 | 341 |
| 575 | 3300003794 | Ga0055531_10001335 | Ga0055531_100013359 | 341 |
| 576 | 3300003794 | Ga0055531_10002563 | Ga0055531_1000256313 | 341 |
| 577 | 3300005262 | Ga0065165_1000834 | Ga0065165_10008346 | 341 |
| 578 | 3300005262 | Ga0065165_1002832 | Ga0065165_10028323 | 341 |
| 579 | 3300005288 | Ga0065714_10092228 | Ga0065714_100922281 | 341 |
| 580 | 3300005290 | Ga0065712_10080409 | Ga0065712_100804092 | 341 |
| 581 | 3300005290 | Ga0065712_10106004 | Ga0065712_101060043 | 341 |
| 582 | 3300005293 | Ga0065715_10118502 | Ga0065715_101185023 | 341 |
| 583 | 3300005327 | Ga0070658_10000534 | Ga0070658_1000053424 | 341 |
| 584 | 3300005327 | Ga0070658_10229495 | Ga0070658_102294952 | 341 |
| 585 | 3300005328 | Ga0070676_10002014 | Ga0070676_100020149 | 341 |
| 586 | 3300005328 | Ga0070676_10012319 | Ga0070676_100123193 | 341 |
| 587 | 3300005328 | Ga0070676_10026321 | Ga0070676_100263214 | 341 |
| 588 | 3300005329 | Ga0070683_100024091 | Ga0070683_1000240916 | 341 |
| 589 | 3300005329 | Ga0070683_100024988 | Ga0070683_1000249882 | 341 |
| 590 | 3300005329 | Ga0070683_100246277 | Ga0070683_1002462772 | 341 |
| 591 | 3300005330 | Ga0070690_100007036 | Ga0070690_1000070363 | 341 |
| 592 | 3300005330 | Ga0070690_100009057 | Ga0070690_1000090572 | 341 |
| 593 | 3300005330 | Ga0070690_100016117 | Ga0070690_1000161174 | 341 |
| 594 | 3300005330 | Ga0070690_100029571 | Ga0070690_1000295712 | 341 |
| 595 | 3300005330 | Ga0070690_100069749 | Ga0070690_1000697493 | 341 |
| 596 | 3300005331 | Ga0070670_100000863 | Ga0070670_10000086316 | 341 |
| 597 | 3300005331 | Ga0070670_100001673 | Ga0070670_1000016734 | 341 |
| 598 | 3300005331 | Ga0070670_100017556 | Ga0070670_1000175562 | 341 |
| 599 | 3300005331 | Ga0070670_100018340 | Ga0070670_1000183404 | 341 |
| 600 | 3300005331 | Ga0070670_100070670 | Ga0070670_1000706702 | 341 |
| 601 | 3300005333 | Ga0070677_10002127 | Ga0070677_100021274 | 341 |
| 602 | 3300005334 | Ga0068869_100004158 | Ga0068869_1000041584 | 341 |
| 603 | 3300005334 | Ga0068869_100038646 | Ga0068869_1000386463 | 341 |
| 604 | 3300005334 | Ga0068869_100053280 | Ga0068869_1000532803 | 341 |
| 605 | 3300005334 | Ga0068869_100099685 | Ga0068869_1000996852 | 341 |
| 606 | 3300005334 | Ga0068869_100168305 | Ga0068869_1001683052 | 341 |
| 607 | 3300005335 | Ga0070666_10001432 | Ga0070666_100014322 | 341 |
| 608 | 3300005335 | Ga0070666_10006463 | Ga0070666_100064633 | 341 |
| 609 | 3300005335 | Ga0070666_10204678 | Ga0070666_102046781 | 341 |
| 610 | 3300005338 | Ga0068868_100007971 | Ga0068868_1000079715 | 341 |
| 611 | 3300005338 | Ga0068868_100012306 | Ga0068868_1000123065 | 341 |
| 612 | 3300005338 | Ga0068868_100018460 | Ga0068868_1000184605 | 341 |
| 613 | 3300005338 | Ga0068868_100045303 | Ga0068868_1000453033 | 341 |
| 614 | 3300005338 | Ga0068868_100206984 | Ga0068868_1002069842 | 341 |
| 615 | 3300005338 | Ga0068868_100237010 | Ga0068868_1002370101 | 341 |
| 616 | 3300005339 | Ga0070660_100004251 | Ga0070660_1000042517 | 341 |
| 617 | 3300005339 | Ga0070660_100148018 | Ga0070660_1001480182 | 341 |
| 618 | 3300005339 | Ga0070660_100236251 | Ga0070660_1002362512 | 341 |
| 619 | 3300005340 | Ga0070689_100002998 | Ga0070689_1000029984 | 341 |
| 620 | 3300005340 | Ga0070689_100008431 | Ga0070689_1000084312 | 341 |
| 621 | 3300005340 | Ga0070689_100010538 | Ga0070689_1000105382 | 341 |
| 622 | 3300005340 | Ga0070689_100019686 | Ga0070689_1000196865 | 341 |
| 623 | 3300005340 | Ga0070689_100027445 | Ga0070689_1000274453 | 341 |
| 624 | 3300005340 | Ga0070689_100405937 | Ga0070689_1004059371 | 341 |
| 625 | 3300005343 | Ga0070687_100100407 | Ga0070687_1001004071 | 341 |
| 626 | 3300005343 | Ga0070687_100126658 | Ga0070687_1001266582 | 341 |
| 627 | 3300005344 | Ga0070661_100035765 | Ga0070661_1000357653 | 341 |
| 628 | 3300005344 | Ga0070661_100064928 | Ga0070661_1000649282 | 341 |
| 629 | 3300005344 | Ga0070661_100091323 | Ga0070661_1000913232 | 341 |
| 630 | 3300005344 | Ga0070661_100181651 | Ga0070661_1001816512 | 341 |
| 631 | 3300005345 | Ga0070692_10017952 | Ga0070692_100179521 | 341 |
| 632 | 3300005345 | Ga0070692_10034767 | Ga0070692_100347672 | 341 |
| 633 | 3300005345 | Ga0070692_10071600 | Ga0070692_100716002 | 341 |
| 634 | 3300005347 | Ga0070668_100005618 | Ga0070668_1000056186 | 341 |
| 635 | 3300005347 | Ga0070668_100085408 | Ga0070668_1000854082 | 341 |
| 636 | 3300005353 | Ga0070669_100003725 | Ga0070669_1000037259 | 341 |
| 637 | 3300005353 | Ga0070669_100111702 | Ga0070669_1001117021 | 341 |
| 638 | 3300005353 | Ga0070669_100192789 | Ga0070669_1001927892 | 341 |
| 639 | 3300005354 | Ga0070675_100000605 | Ga0070675_10000060517 | 341 |
| 640 | 3300005354 | Ga0070675_100011272 | Ga0070675_1000112724 | 341 |
| 641 | 3300005354 | Ga0070675_100041359 | Ga0070675_1000413593 | 341 |
| 642 | 3300005354 | Ga0070675_100049771 | Ga0070675_1000497712 | 341 |
| 643 | 3300005354 | Ga0070675_100060864 | Ga0070675_1000608642 | 341 |
| 644 | 3300005354 | Ga0070675_100091225 | Ga0070675_1000912252 | 341 |
| 645 | 3300005354 | Ga0070675_100098724 | Ga0070675_1000987242 | 341 |
| 646 | 3300005355 | Ga0070671_100010636 | Ga0070671_1000106364 | 341 |
| 647 | 3300005355 | Ga0070671_100033086 | Ga0070671_1000330863 | 341 |
| 648 | 3300005355 | Ga0070671_100043588 | Ga0070671_1000435882 | 341 |
| 649 | 3300005355 | Ga0070671_100064323 | Ga0070671_1000643233 | 341 |
| 650 | 3300005355 | Ga0070671_100216519 | Ga0070671_1002165191 | 341 |
| 651 | 3300005355 | Ga0070671_100223975 | Ga0070671_1002239752 | 341 |
| 652 | 3300005356 | Ga0070674_100005518 | Ga0070674_1000055185 | 341 |
| 653 | 3300005356 | Ga0070674_100008774 | Ga0070674_1000087744 | 341 |
| 654 | 3300005356 | Ga0070674_100011027 | Ga0070674_1000110274 | 341 |
| 655 | 3300005356 | Ga0070674_100012896 | Ga0070674_1000128962 | 341 |
| 656 | 3300005356 | Ga0070674_100088011 | Ga0070674_1000880112 | 341 |
| 657 | 3300005364 | Ga0070673_100000416 | Ga0070673_1000004166 | 341 |
| 658 | 3300005364 | Ga0070673_100004008 | Ga0070673_1000040087 | 341 |
| 659 | 3300005364 | Ga0070673_100027949 | Ga0070673_1000279494 | 341 |
| 660 | 3300005364 | Ga0070673_100031352 | Ga0070673_1000313522 | 341 |
| 661 | 3300005364 | Ga0070673_100037138 | Ga0070673_1000371383 | 341 |
| 662 | 3300005364 | Ga0070673_100048421 | Ga0070673_1000484213 | 341 |
| 663 | 3300005364 | Ga0070673_100106692 | Ga0070673_1001066922 | 341 |
| 664 | 3300005365 | Ga0070688_100004155 | Ga0070688_1000041556 | 341 |
| 665 | 3300005365 | Ga0070688_100004763 | Ga0070688_1000047635 | 341 |
| 666 | 3300005366 | Ga0070659_100007556 | Ga0070659_1000075566 | 341 |
| 667 | 3300005366 | Ga0070659_100261485 | Ga0070659_1002614852 | 341 |
| 668 | 3300005367 | Ga0070667_100004143 | Ga0070667_1000041434 | 341 |
| 669 | 3300005367 | Ga0070667_100006265 | Ga0070667_1000062654 | 341 |
| 670 | 3300005367 | Ga0070667_100017248 | Ga0070667_1000172481 | 341 |
| 671 | 3300005367 | Ga0070667_100039343 | Ga0070667_1000393433 | 341 |
| 672 | 3300005367 | Ga0070667_100062521 | Ga0070667_1000625212 | 341 |
| 673 | 3300005367 | Ga0070667_100067596 | Ga0070667_1000675962 | 341 |
| 674 | 3300005367 | Ga0070667_100291399 | Ga0070667_1002913992 | 341 |
| 675 | 3300005434 | Ga0070709_10000424 | Ga0070709_1000042415 | 341 |
| 676 | 3300005434 | Ga0070709_10003057 | Ga0070709_100030577 | 341 |
| 677 | 3300005435 | Ga0070714_100003678 | Ga0070714_10000367810 | 341 |
| 678 | 3300005435 | Ga0070714_100005399 | Ga0070714_1000053992 | 341 |
| 679 | 3300005436 | Ga0070713_100000019 | Ga0070713_10000001929 | 341 |
| 680 | 3300005436 | Ga0070713_100015895 | Ga0070713_1000158954 | 341 |
| 681 | 3300005436 | Ga0070713_100048177 | Ga0070713_1000481772 | 341 |
| 682 | 3300005436 | Ga0070713_100519499 | Ga0070713_1005194991 | 341 |
| 683 | 3300005437 | Ga0070710_10001915 | Ga0070710_100019157 | 341 |
| 684 | 3300005438 | Ga0070701_10004081 | Ga0070701_100040814 | 341 |
| 685 | 3300005438 | Ga0070701_10009235 | Ga0070701_100092353 | 341 |
| 686 | 3300005439 | Ga0070711_100001539 | Ga0070711_10000153910 | 341 |
| 687 | 3300005439 | Ga0070711_100002750 | Ga0070711_10000275012 | 341 |
| 688 | 3300005439 | Ga0070711_100120904 | Ga0070711_1001209042 | 341 |
| 689 | 3300005439 | Ga0070711_100256866 | Ga0070711_1002568662 | 341 |
| 690 | 3300005441 | Ga0070700_100004241 | Ga0070700_1000042415 | 341 |
| 691 | 3300005445 | Ga0070708_100000889 | Ga0070708_10000088916 | 341 |
| 692 | 3300005455 | Ga0070663_100008820 | Ga0070663_1000088206 | 341 |
| 693 | 3300005455 | Ga0070663_100052002 | Ga0070663_1000520023 | 341 |
| 694 | 3300005456 | Ga0070678_100002173 | Ga0070678_1000021736 | 341 |
| 695 | 3300005456 | Ga0070678_100007462 | Ga0070678_1000074623 | 341 |
| 696 | 3300005456 | Ga0070678_100104983 | Ga0070678_1001049833 | 341 |
| 697 | 3300005456 | Ga0070678_100106303 | Ga0070678_1001063032 | 341 |
| 698 | 3300005456 | Ga0070678_100153245 | Ga0070678_1001532452 | 341 |
| 699 | 3300005457 | Ga0070662_100000546 | Ga0070662_10000054621 | 341 |
| 700 | 3300005457 | Ga0070662_100109421 | Ga0070662_1001094212 | 341 |
| 701 | 3300005458 | Ga0070681_10002422 | Ga0070681_1000242210 | 341 |
| 702 | 3300005458 | Ga0070681_10156558 | Ga0070681_101565581 | 341 |
| 703 | 3300005459 | Ga0068867_100000041 | Ga0068867_10000004139 | 341 |
| 704 | 3300005459 | Ga0068867_100001878 | Ga0068867_10000187810 | 341 |
| 705 | 3300005459 | Ga0068867_100005891 | Ga0068867_1000058915 | 341 |
| 706 | 3300005459 | Ga0068867_100007968 | Ga0068867_1000079683 | 341 |
| 707 | 3300005459 | Ga0068867_100044748 | Ga0068867_1000447481 | 341 |
| 708 | 3300005459 | Ga0068867_100129629 | Ga0068867_1001296292 | 341 |
| 709 | 3300005459 | Ga0068867_100158557 | Ga0068867_1001585571 | 341 |
| 710 | 3300005466 | Ga0070685_10013969 | Ga0070685_100139692 | 341 |
| 711 | 3300005466 | Ga0070685_10016951 | Ga0070685_100169515 | 341 |
| 712 | 3300005466 | Ga0070685_10024895 | Ga0070685_100248953 | 341 |
| 713 | 3300005466 | Ga0070685_10084117 | Ga0070685_100841172 | 341 |
| 714 | 3300005467 | Ga0070706_100003229 | Ga0070706_10000322913 | 341 |
| 715 | 3300005467 | Ga0070706_100270019 | Ga0070706_1002700191 | 341 |
| 716 | 3300005468 | Ga0070707_100023650 | Ga0070707_1000236503 | 341 |
| 717 | 3300005468 | Ga0070707_100243072 | Ga0070707_1002430722 | 341 |
| 718 | 3300005471 | Ga0070698_100269772 | Ga0070698_1002697722 | 341 |
| 719 | 3300005530 | Ga0070679_100079119 | Ga0070679_1000791192 | 341 |
| 720 | 3300005530 | Ga0070679_100217475 | Ga0070679_1002174752 | 341 |
| 721 | 3300005530 | Ga0070679_100220439 | Ga0070679_1002204392 | 341 |
| 722 | 3300005535 | Ga0070684_100000578 | Ga0070684_1000005787 | 341 |
| 723 | 3300005535 | Ga0070684_100004669 | Ga0070684_1000046697 | 341 |
| 724 | 3300005535 | Ga0070684_100020163 | Ga0070684_1000201633 | 341 |
| 725 | 3300005535 | Ga0070684_100077838 | Ga0070684_1000778383 | 341 |
| 726 | 3300005539 | Ga0068853_100005895 | Ga0068853_1000058953 | 341 |
| 727 | 3300005539 | Ga0068853_100021596 | Ga0068853_1000215966 | 341 |
| 728 | 3300005539 | Ga0068853_100034801 | Ga0068853_1000348015 | 341 |
| 729 | 3300005539 | Ga0068853_100061464 | Ga0068853_1000614644 | 341 |
| 730 | 3300005539 | Ga0068853_100108685 | Ga0068853_1001086852 | 341 |
| 731 | 3300005539 | Ga0068853_100123705 | Ga0068853_1001237052 | 341 |
| 732 | 3300005543 | Ga0070672_100000414 | Ga0070672_1000004144 | 341 |
| 733 | 3300005543 | Ga0070672_100008479 | Ga0070672_1000084797 | 341 |
| 734 | 3300005543 | Ga0070672_100008902 | Ga0070672_10000890210 | 341 |
| 735 | 3300005543 | Ga0070672_100011272 | Ga0070672_1000112724 | 341 |
| 736 | 3300005543 | Ga0070672_100045698 | Ga0070672_1000456982 | 341 |
| 737 | 3300005543 | Ga0070672_100071345 | Ga0070672_1000713452 | 341 |
| 738 | 3300005543 | Ga0070672_100148133 | Ga0070672_1001481332 | 341 |
| 739 | 3300005543 | Ga0070672_100255976 | Ga0070672_1002559762 | 341 |
| 740 | 3300005543 | Ga0070672_100262709 | Ga0070672_1002627092 | 341 |
| 741 | 3300005543 | Ga0070672_100451935 | Ga0070672_1004519351 | 341 |
| 742 | 3300005544 | Ga0070686_100009212 | Ga0070686_1000092124 | 341 |
| 743 | 3300005544 | Ga0070686_100017437 | Ga0070686_1000174373 | 341 |
| 744 | 3300005547 | Ga0070693_100070874 | Ga0070693_1000708742 | 341 |
| 745 | 3300005548 | Ga0070665_100002566 | Ga0070665_10000256616 | 341 |
| 746 | 3300005548 | Ga0070665_100010851 | Ga0070665_10001085110 | 341 |
| 747 | 3300005548 | Ga0070665_100017168 | Ga0070665_1000171685 | 341 |
| 748 | 3300005548 | Ga0070665_100080934 | Ga0070665_1000809342 | 341 |
| 749 | 3300005548 | Ga0070665_100093316 | Ga0070665_1000933163 | 341 |
| 750 | 3300005548 | Ga0070665_100174660 | Ga0070665_1001746603 | 341 |
| 751 | 3300005549 | Ga0070704_100050726 | Ga0070704_1000507262 | 341 |
| 752 | 3300005549 | Ga0070704_100085978 | Ga0070704_1000859782 | 341 |
| 753 | 3300005563 | Ga0068855_100001533 | Ga0068855_10000153311 | 341 |
| 754 | 3300005563 | Ga0068855_100008719 | Ga0068855_1000087193 | 341 |
| 755 | 3300005563 | Ga0068855_100016734 | Ga0068855_1000167345 | 341 |
| 756 | 3300005563 | Ga0068855_100051277 | Ga0068855_1000512774 | 341 |
| 757 | 3300005563 | Ga0068855_100132479 | Ga0068855_1001324792 | 341 |
| 758 | 3300005563 | Ga0068855_100332842 | Ga0068855_1003328421 | 341 |
| 759 | 3300005563 | Ga0068855_100462796 | Ga0068855_1004627962 | 341 |
| 760 | 3300005564 | Ga0070664_100001978 | Ga0070664_1000019789 | 341 |
| 761 | 3300005564 | Ga0070664_100021313 | Ga0070664_1000213133 | 341 |
| 762 | 3300005564 | Ga0070664_100111346 | Ga0070664_1001113462 | 341 |
| 763 | 3300005564 | Ga0070664_100343365 | Ga0070664_1003433652 | 341 |
| 764 | 3300005564 | Ga0070664_100440653 | Ga0070664_1004406532 | 341 |
| 765 | 3300005577 | Ga0068857_100012412 | Ga0068857_1000124124 | 341 |
| 766 | 3300005577 | Ga0068857_100020815 | Ga0068857_1000208153 | 341 |
| 767 | 3300005577 | Ga0068857_100029733 | Ga0068857_1000297332 | 341 |
| 768 | 3300005577 | Ga0068857_100233400 | Ga0068857_1002334002 | 341 |
| 769 | 3300005578 | Ga0068854_100051600 | Ga0068854_1000516003 | 341 |
| 770 | 3300005614 | Ga0068856_100000409 | Ga0068856_1000004097 | 341 |
| 771 | 3300005614 | Ga0068856_100000762 | Ga0068856_10000076231 | 341 |
| 772 | 3300005614 | Ga0068856_100026700 | Ga0068856_1000267003 | 341 |
| 773 | 3300005614 | Ga0068856_100093824 | Ga0068856_1000938242 | 341 |
| 774 | 3300005614 | Ga0068856_100150706 | Ga0068856_1001507062 | 341 |
| 775 | 3300005615 | Ga0070702_100058566 | Ga0070702_1000585662 | 341 |
| 776 | 3300005616 | Ga0068852_100003141 | Ga0068852_10000314111 | 341 |
| 777 | 3300005616 | Ga0068852_100069880 | Ga0068852_1000698802 | 341 |
| 778 | 3300005616 | Ga0068852_100070212 | Ga0068852_1000702122 | 341 |
| 779 | 3300005616 | Ga0068852_100169402 | Ga0068852_1001694022 | 341 |
| 780 | 3300005617 | Ga0068859_100001521 | Ga0068859_1000015213 | 341 |
| 781 | 3300005617 | Ga0068859_100005041 | Ga0068859_1000050413 | 341 |
| 782 | 3300005617 | Ga0068859_100023535 | Ga0068859_1000235356 | 341 |
| 783 | 3300005617 | Ga0068859_100027160 | Ga0068859_1000271604 | 341 |
| 784 | 3300005617 | Ga0068859_100128172 | Ga0068859_1001281722 | 341 |
| 785 | 3300005618 | Ga0068864_100000365 | Ga0068864_1000003652 | 341 |
| 786 | 3300005618 | Ga0068864_100005574 | Ga0068864_1000055747 | 341 |
| 787 | 3300005618 | Ga0068864_100033367 | Ga0068864_1000333674 | 341 |
| 788 | 3300005618 | Ga0068864_100034309 | Ga0068864_1000343094 | 341 |
| 789 | 3300005718 | Ga0068866_10018183 | Ga0068866_100181832 | 341 |
| 790 | 3300005719 | Ga0068861_100004095 | Ga0068861_1000040958 | 341 |
| 791 | 3300005719 | Ga0068861_100072427 | Ga0068861_1000724272 | 341 |
| 792 | 3300005719 | Ga0068861_100109272 | Ga0068861_1001092723 | 341 |
| 793 | 3300005834 | Ga0068851_10001795 | Ga0068851_100017959 | 341 |
| 794 | 3300005834 | Ga0068851_10017743 | Ga0068851_100177434 | 341 |
| 795 | 3300005840 | Ga0068870_10009255 | Ga0068870_100092553 | 341 |
| 796 | 3300005841 | Ga0068863_100011694 | Ga0068863_1000116948 | 341 |
| 797 | 3300005841 | Ga0068863_100014739 | Ga0068863_1000147394 | 341 |
| 798 | 3300005841 | Ga0068863_100027447 | Ga0068863_1000274472 | 341 |
| 799 | 3300005841 | Ga0068863_100037388 | Ga0068863_1000373886 | 341 |
| 800 | 3300005841 | Ga0068863_100047519 | Ga0068863_1000475196 | 341 |
| 801 | 3300005842 | Ga0068858_100000738 | Ga0068858_10000073834 | 341 |
| 802 | 3300005842 | Ga0068858_100016017 | Ga0068858_1000160177 | 341 |
| 803 | 3300005842 | Ga0068858_100038510 | Ga0068858_1000385103 | 341 |
| 804 | 3300005842 | Ga0068858_100038617 | Ga0068858_1000386172 | 341 |
| 805 | 3300005842 | Ga0068858_100042577 | Ga0068858_1000425775 | 341 |
| 806 | 3300005842 | Ga0068858_100110531 | Ga0068858_1001105311 | 341 |
| 807 | 3300005842 | Ga0068858_100135674 | Ga0068858_1001356742 | 341 |
| 808 | 3300005843 | Ga0068860_100000101 | Ga0068860_10000010169 | 341 |
| 809 | 3300005843 | Ga0068860_100018313 | Ga0068860_1000183134 | 341 |
| 810 | 3300005843 | Ga0068860_100071506 | Ga0068860_1000715063 | 341 |
| 811 | 3300005843 | Ga0068860_100105526 | Ga0068860_1001055263 | 341 |
| 812 | 3300005843 | Ga0068860_100169807 | Ga0068860_1001698072 | 341 |
| 813 | 3300005843 | Ga0068860_100275266 | Ga0068860_1002752662 | 341 |
| 814 | 3300005844 | Ga0068862_100021693 | Ga0068862_1000216935 | 341 |
| 815 | 3300005844 | Ga0068862_100028032 | Ga0068862_1000280325 | 341 |
| 816 | 3300005844 | Ga0068862_100110564 | Ga0068862_1001105642 | 341 |
| 817 | 3300005937 | Ga0081455_10008730 | Ga0081455_100087304 | 341 |
| 818 | 3300005937 | Ga0081455_10027965 | Ga0081455_100279653 | 341 |
| 819 | 3300005983 | Ga0081540_1003649 | Ga0081540_10036499 | 341 |
| 820 | 3300005983 | Ga0081540_1008233 | Ga0081540_10082337 | 341 |
| 821 | 3300005985 | Ga0081539_10000220 | Ga0081539_100002208 | 341 |
| 822 | 3300005985 | Ga0081539_10045408 | Ga0081539_100454082 | 341 |
| 823 | 3300006163 | Ga0070715_10034825 | Ga0070715_100348254 | 341 |
| 824 | 3300006173 | Ga0070716_100008627 | Ga0070716_1000086273 | 341 |
| 825 | 3300006175 | Ga0070712_100012323 | Ga0070712_1000123233 | 341 |
| 826 | 3300006175 | Ga0070712_100044445 | Ga0070712_1000444453 | 341 |
| 827 | 3300006177 | Ga0075362_10016232 | Ga0075362_100162325 | 341 |
| 828 | 3300006195 | Ga0075366_10045457 | Ga0075366_100454573 | 341 |
| 829 | 3300006195 | Ga0075366_10079395 | Ga0075366_100793952 | 341 |
| 830 | 3300006195 | Ga0075366_10085256 | Ga0075366_100852562 | 341 |
| 831 | 3300006237 | Ga0097621_100001636 | Ga0097621_1000016363 | 341 |
| 832 | 3300006237 | Ga0097621_100022241 | Ga0097621_1000222417 | 341 |
| 833 | 3300006237 | Ga0097621_100025888 | Ga0097621_1000258885 | 341 |
| 834 | 3300006237 | Ga0097621_100039233 | Ga0097621_1000392334 | 341 |
| 835 | 3300006237 | Ga0097621_100083635 | Ga0097621_1000836352 | 341 |
| 836 | 3300006237 | Ga0097621_100221579 | Ga0097621_1002215792 | 341 |
| 837 | 3300006237 | Ga0097621_100276649 | Ga0097621_1002766492 | 341 |
| 838 | 3300006237 | Ga0097621_100290580 | Ga0097621_1002905802 | 341 |
| 839 | 3300006353 | Ga0075370_10003026 | Ga0075370_100030265 | 341 |
| 840 | 3300006353 | Ga0075370_10022952 | Ga0075370_100229522 | 341 |
| 841 | 3300006353 | Ga0075370_10041483 | Ga0075370_100414833 | 341 |
| 842 | 3300006358 | Ga0068871_100047818 | Ga0068871_1000478184 | 341 |
| 843 | 3300006358 | Ga0068871_100051822 | Ga0068871_1000518222 | 341 |
| 844 | 3300006358 | Ga0068871_100061257 | Ga0068871_1000612572 | 341 |
| 845 | 3300006358 | Ga0068871_100067090 | Ga0068871_1000670904 | 341 |
| 846 | 3300006358 | Ga0068871_100161611 | Ga0068871_1001616112 | 341 |
| 847 | 3300006844 | Ga0075428_100195429 | Ga0075428_1001954293 | 341 |
| 848 | 3300006846 | Ga0075430_100017933 | Ga0075430_1000179333 | 341 |
| 849 | 3300006871 | Ga0075434_100014097 | Ga0075434_1000140979 | 341 |
| 850 | 3300006871 | Ga0075434_100183202 | Ga0075434_1001832022 | 341 |
| 851 | 3300006871 | Ga0075434_100422475 | Ga0075434_1004224752 | 341 |
| 852 | 3300006881 | Ga0068865_100130634 | Ga0068865_1001306342 | 341 |
| 853 | 3300006931 | Ga0097620_100001521 | Ga0097620_10000152125 | 341 |
| 854 | 3300006931 | Ga0097620_100005041 | Ga0097620_1000050413 | 341 |
| 855 | 3300006931 | Ga0097620_100023534 | Ga0097620_1000235346 | 341 |
| 856 | 3300006931 | Ga0097620_100027159 | Ga0097620_1000271594 | 341 |
| 857 | 3300006931 | Ga0097620_100128181 | Ga0097620_1001281812 | 341 |
| 858 | 3300006946 | Ga0079104_1000724 | Ga0079104_10007245 | 341 |
| 859 | 3300009092 | Ga0105250_10014017 | Ga0105250_100140173 | 341 |
| 860 | 3300009092 | Ga0105250_10024702 | Ga0105250_100247022 | 341 |
| 861 | 3300009093 | Ga0105240_10000369 | Ga0105240_1000036956 | 341 |
| 862 | 3300009093 | Ga0105240_10017113 | Ga0105240_100171137 | 341 |
| 863 | 3300009093 | Ga0105240_10028585 | Ga0105240_100285856 | 341 |
| 864 | 3300009093 | Ga0105240_10274468 | Ga0105240_102744682 | 341 |
| 865 | 3300009098 | Ga0105245_10007246 | Ga0105245_100072465 | 341 |
| 866 | 3300009101 | Ga0105247_10012839 | Ga0105247_100128393 | 341 |
| 867 | 3300009101 | Ga0105247_10014160 | Ga0105247_100141604 | 341 |
| 868 | 3300009101 | Ga0105247_10136194 | Ga0105247_101361942 | 341 |
| 869 | 3300009147 | Ga0114129_10008622 | Ga0114129_100086229 | 341 |
| 870 | 3300009147 | Ga0114129_10693764 | Ga0114129_106937642 | 341 |
| 871 | 3300009148 | Ga0105243_10001818 | Ga0105243_100018183 | 341 |
| 872 | 3300009148 | Ga0105243_10004635 | Ga0105243_100046358 | 341 |
| 873 | 3300009148 | Ga0105243_10015365 | Ga0105243_100153654 | 341 |
| 874 | 3300009174 | Ga0105241_10213251 | Ga0105241_102132512 | 341 |
| 875 | 3300009174 | Ga0105241_10273242 | Ga0105241_102732421 | 341 |
| 876 | 3300009176 | Ga0105242_10014388 | Ga0105242_100143886 | 341 |
| 877 | 3300009177 | Ga0105248_10003092 | Ga0105248_100030925 | 341 |
| 878 | 3300009177 | Ga0105248_10016194 | Ga0105248_100161945 | 341 |
| 879 | 3300009177 | Ga0105248_10020577 | Ga0105248_100205778 | 341 |
| 880 | 3300009177 | Ga0105248_10126259 | Ga0105248_101262592 | 341 |
| 881 | 3300009177 | Ga0105248_10217614 | Ga0105248_102176142 | 341 |
| 882 | 3300009545 | Ga0105237_10000102 | Ga0105237_1000010289 | 341 |
| 883 | 3300009545 | Ga0105237_10006549 | Ga0105237_1000654910 | 341 |
| 884 | 3300009545 | Ga0105237_10082720 | Ga0105237_100827204 | 341 |
| 885 | 3300009545 | Ga0105237_10122526 | Ga0105237_101225263 | 341 |
| 886 | 3300009551 | Ga0105238_10005947 | Ga0105238_1000594710 | 341 |
| 887 | 3300009551 | Ga0105238_10008650 | Ga0105238_100086503 | 341 |
| 888 | 3300009551 | Ga0105238_10224467 | Ga0105238_102244672 | 341 |
| 889 | 3300009553 | Ga0105249_10079548 | Ga0105249_100795484 | 341 |
| 890 | 3300009553 | Ga0105249_10340160 | Ga0105249_103401601 | 341 |
| 891 | 3300009553 | Ga0105249_10508969 | Ga0105249_105089692 | 341 |
| 892 | 3300010375 | Ga0105239_10004222 | Ga0105239_1000422213 | 341 |
| 893 | 3300010375 | Ga0105239_10023690 | Ga0105239_100236906 | 341 |
| 894 | 3300010375 | Ga0105239_10072813 | Ga0105239_100728132 | 341 |
| 895 | 3300010375 | Ga0105239_10233481 | Ga0105239_102334812 | 341 |
| 896 | 3300010375 | Ga0105239_10243732 | Ga0105239_102437322 | 341 |
| 897 | 3300011119 | Ga0105246_10149026 | Ga0105246_101490262 | 341 |
| 898 | 3300012497 | Ga0157319_1000005 | Ga0157319_1000005213 | 341 |
| 899 | 3300013100 | Ga0157373_10038570 | Ga0157373_100385702 | 341 |
| 900 | 3300013100 | Ga0157373_10046395 | Ga0157373_100463951 | 341 |
| 901 | 3300013102 | Ga0157371_10001396 | Ga0157371_1000139623 | 341 |
| 902 | 3300013104 | Ga0157370_10003812 | Ga0157370_1000381213 | 341 |
| 903 | 3300013104 | Ga0157370_10077047 | Ga0157370_100770472 | 341 |
| 904 | 3300013104 | Ga0157370_10077682 | Ga0157370_100776822 | 341 |
| 905 | 3300013104 | Ga0157370_10102792 | Ga0157370_101027923 | 341 |
| 906 | 3300013104 | Ga0157370_10133981 | Ga0157370_101339811 | 341 |
| 907 | 3300013104 | Ga0157370_10205156 | Ga0157370_102051562 | 341 |
| 908 | 3300013105 | Ga0157369_10015817 | Ga0157369_100158176 | 341 |
| 909 | 3300013105 | Ga0157369_10062589 | Ga0157369_100625893 | 341 |
| 910 | 3300013105 | Ga0157369_10120918 | Ga0157369_101209182 | 341 |
| 911 | 3300013296 | Ga0157374_10030166 | Ga0157374_100301662 | 341 |
| 912 | 3300013296 | Ga0157374_10037518 | Ga0157374_100375184 | 341 |
| 913 | 3300013296 | Ga0157374_10214331 | Ga0157374_102143311 | 341 |
| 914 | 3300013296 | Ga0157374_10281971 | Ga0157374_102819712 | 341 |
| 915 | 3300013296 | Ga0157374_10456079 | Ga0157374_104560791 | 341 |
| 916 | 3300013297 | Ga0157378_10039983 | Ga0157378_100399834 | 341 |
| 917 | 3300013306 | Ga0163162_10000673 | Ga0163162_1000067318 | 341 |
| 918 | 3300013306 | Ga0163162_10027327 | Ga0163162_100273276 | 341 |
| 919 | 3300013306 | Ga0163162_10028459 | Ga0163162_100284592 | 341 |
| 920 | 3300013306 | Ga0163162_10166561 | Ga0163162_101665612 | 341 |
| 921 | 3300013306 | Ga0163162_10403665 | Ga0163162_104036652 | 341 |
| 922 | 3300013307 | Ga0157372_10002169 | Ga0157372_1000216918 | 341 |
| 923 | 3300013307 | Ga0157372_10003163 | Ga0157372_1000316311 | 341 |
| 924 | 3300013307 | Ga0157372_10065457 | Ga0157372_100654575 | 341 |
| 925 | 3300013307 | Ga0157372_10073975 | Ga0157372_100739753 | 341 |
| 926 | 3300013307 | Ga0157372_10110633 | Ga0157372_101106333 | 341 |
| 927 | 3300013307 | Ga0157372_10195141 | Ga0157372_101951412 | 341 |
| 928 | 3300013307 | Ga0157372_10238262 | Ga0157372_102382622 | 341 |
| 929 | 3300013307 | Ga0157372_10604190 | Ga0157372_106041901 | 341 |
| 930 | 3300013308 | Ga0157375_10000903 | Ga0157375_1000090317 | 341 |
| 931 | 3300013308 | Ga0157375_10025478 | Ga0157375_100254786 | 341 |
| 932 | 3300013308 | Ga0157375_10034886 | Ga0157375_100348864 | 341 |
| 933 | 3300013308 | Ga0157375_10058213 | Ga0157375_100582133 | 341 |
| 934 | 3300013308 | Ga0157375_10064446 | Ga0157375_100644464 | 341 |
| 935 | 3300013308 | Ga0157375_10109092 | Ga0157375_101090922 | 341 |
| 936 | 3300013308 | Ga0157375_10136678 | Ga0157375_101366783 | 341 |
| 937 | 3300014325 | Ga0163163_10021170 | Ga0163163_100211702 | 341 |
| 938 | 3300014325 | Ga0163163_10112854 | Ga0163163_101128542 | 341 |
| 939 | 3300014325 | Ga0163163_10194059 | Ga0163163_101940593 | 341 |
| 940 | 3300014325 | Ga0163163_10230312 | Ga0163163_102303122 | 341 |
| 941 | 3300014326 | Ga0157380_10028852 | Ga0157380_100288523 | 341 |
| 942 | 3300014745 | Ga0157377_10000020 | Ga0157377_1000002076 | 341 |
| 943 | 3300014745 | Ga0157377_10001422 | Ga0157377_100014227 | 341 |
| 944 | 3300014968 | Ga0157379_10001219 | Ga0157379_100012198 | 341 |
| 945 | 3300014968 | Ga0157379_10010297 | Ga0157379_100102976 | 341 |
| 946 | 3300014968 | Ga0157379_10020285 | Ga0157379_100202852 | 341 |
| 947 | 3300014968 | Ga0157379_10066515 | Ga0157379_100665152 | 341 |
| 948 | 3300014968 | Ga0157379_10314292 | Ga0157379_103142922 | 341 |
| 949 | 3300014968 | Ga0157379_10355302 | Ga0157379_103553021 | 341 |
| 950 | 3300014969 | Ga0157376_10015296 | Ga0157376_100152963 | 341 |
| 951 | 3300014969 | Ga0157376_10016372 | Ga0157376_100163723 | 341 |
| 952 | 3300014969 | Ga0157376_10027198 | Ga0157376_100271983 | 341 |
| 953 | 3300014969 | Ga0157376_10047085 | Ga0157376_100470852 | 341 |
| 954 | 3300015262 | Ga0182007_10005892 | Ga0182007_100058923 | 341 |
| 955 | 3300015265 | Ga0182005_1004230 | Ga0182005_10042303 | 341 |
| 956 | 3300015683 | Ga0183362_10002 | Ga0183362_10002612 | 341 |
| 957 | 3300016635 | Ga0183361_10005 | Ga0183361_10005218 | 341 |
| 958 | 3300017792 | Ga0163161_10029083 | Ga0163161_100290833 | 341 |
| 959 | 3300017792 | Ga0163161_10070546 | Ga0163161_100705463 | 341 |
| 960 | 3300017792 | Ga0163161_10088500 | Ga0163161_100885002 | 341 |
| 961 | 3300021384 | Ga0213876_10001330 | Ga0213876_1000133013 | 341 |
| 962 | 3300021384 | Ga0213876_10003361 | Ga0213876_100033616 | 341 |
| 963 | 3300021384 | Ga0213876_10003916 | Ga0213876_100039161 | 341 |
| 964 | 3300021388 | Ga0213875_10007526 | Ga0213875_100075266 | 341 |
| 965 | 3300025228 | Ga0209672_106442 | Ga0209672_1064422 | 341 |
| 966 | 3300025242 | Ga0209258_102632 | Ga0209258_1026324 | 341 |
| 967 | 3300025245 | Ga0207425_1001488 | Ga0207425_10014887 | 341 |
| 968 | 3300025258 | Ga0209129_1002187 | Ga0209129_10021874 | 341 |
| 969 | 3300025258 | Ga0209129_1015638 | Ga0209129_10156382 | 341 |
| 970 | 3300025272 | Ga0209455_1000337 | Ga0209455_100033717 | 341 |
| 971 | 3300025284 | Ga0209130_1001292 | Ga0209130_100129215 | 341 |
| 972 | 3300025284 | Ga0209130_1002441 | Ga0209130_10024414 | 341 |
| 973 | 3300025290 | Ga0207673_1003069 | Ga0207673_10030693 | 341 |
| 974 | 3300025291 | Ga0209675_1001682 | Ga0209675_10016826 | 341 |
| 975 | 3300025291 | Ga0209675_1002042 | Ga0209675_10020429 | 341 |
| 976 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004751 | 341 |
| 977 | 3300025292 | Ga0209676_1000026 | Ga0209676_100002619 | 341 |
| 978 | 3300025292 | Ga0209676_1000172 | Ga0209676_100017216 | 341 |
| 979 | 3300025292 | Ga0209676_1010011 | Ga0209676_10100112 | 341 |
| 980 | 3300025294 | Ga0209025_1005956 | Ga0209025_10059564 | 341 |
| 981 | 3300025295 | Ga0209564_1000021 | Ga0209564_1000021164 | 341 |
| 982 | 3300025297 | Ga0209758_1000122 | Ga0209758_100012226 | 341 |
| 983 | 3300025297 | Ga0209758_1004631 | Ga0209758_10046314 | 341 |
| 984 | 3300025298 | Ga0209050_1000002 | Ga0209050_10000021261 | 341 |
| 985 | 3300025298 | Ga0209050_1000509 | Ga0209050_100050953 | 341 |
| 986 | 3300025298 | Ga0209050_1005094 | Ga0209050_10050947 | 341 |
| 987 | 3300025298 | Ga0209050_1019763 | Ga0209050_10197632 | 341 |
| 988 | 3300025299 | Ga0209256_1000177 | Ga0209256_100017742 | 341 |
| 989 | 3300025302 | Ga0207426_1000264 | Ga0207426_1000264103 | 341 |
| 990 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021031 | 341 |
| 991 | 3300025303 | Ga0209051_1000055 | Ga0209051_1000055249 | 341 |
| 992 | 3300025303 | Ga0209051_1000074 | Ga0209051_1000074179 | 341 |
| 993 | 3300025303 | Ga0209051_1000096 | Ga0209051_1000096154 | 341 |
| 994 | 3300025303 | Ga0209051_1007768 | Ga0209051_10077687 | 341 |
| 995 | 3300025303 | Ga0209051_1027528 | Ga0209051_10275282 | 341 |
| 996 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021172 | 341 |
| 997 | 3300025304 | Ga0209257_1000072 | Ga0209257_1000072180 | 341 |
| 998 | 3300025304 | Ga0209257_1000101 | Ga0209257_1000101223 | 341 |
| 999 | 3300025304 | Ga0209257_1000131 | Ga0209257_1000131162 | 341 |
| 1000 | 3300025304 | Ga0209257_1000347 | Ga0209257_100034752 | 341 |
| 1001 | 3300025304 | Ga0209257_1008032 | Ga0209257_10080325 | 341 |
| 1002 | 3300025315 | Ga0207697_10003899 | Ga0207697_100038996 | 341 |
| 1003 | 3300025321 | Ga0207656_10008913 | Ga0207656_100089134 | 341 |
| 1004 | 3300025321 | Ga0207656_10013605 | Ga0207656_100136053 | 341 |
| 1005 | 3300025321 | Ga0207656_10063702 | Ga0207656_100637022 | 341 |
| 1006 | 3300025711 | Ga0207696_1016362 | Ga0207696_10163622 | 341 |
| 1007 | 3300025893 | Ga0207682_10000076 | Ga0207682_1000007638 | 341 |
| 1008 | 3300025893 | Ga0207682_10041995 | Ga0207682_100419952 | 341 |
| 1009 | 3300025898 | Ga0207692_10000738 | Ga0207692_100007386 | 341 |
| 1010 | 3300025901 | Ga0207688_10019333 | Ga0207688_100193333 | 341 |
| 1011 | 3300025901 | Ga0207688_10022933 | Ga0207688_100229332 | 341 |
| 1012 | 3300025903 | Ga0207680_10041485 | Ga0207680_100414852 | 341 |
| 1013 | 3300025903 | Ga0207680_10067513 | Ga0207680_100675133 | 341 |
| 1014 | 3300025903 | Ga0207680_10181731 | Ga0207680_101817312 | 341 |
| 1015 | 3300025904 | Ga0207647_10068431 | Ga0207647_100684312 | 341 |
| 1016 | 3300025905 | Ga0207685_10025834 | Ga0207685_100258342 | 341 |
| 1017 | 3300025906 | Ga0207699_10000465 | Ga0207699_100004657 | 341 |
| 1018 | 3300025906 | Ga0207699_10020690 | Ga0207699_100206902 | 341 |
| 1019 | 3300025907 | Ga0207645_10001421 | Ga0207645_1000142114 | 341 |
| 1020 | 3300025907 | Ga0207645_10003433 | Ga0207645_100034337 | 341 |
| 1021 | 3300025907 | Ga0207645_10011482 | Ga0207645_100114826 | 341 |
| 1022 | 3300025907 | Ga0207645_10028308 | Ga0207645_100283083 | 341 |
| 1023 | 3300025907 | Ga0207645_10179074 | Ga0207645_101790741 | 341 |
| 1024 | 3300025908 | Ga0207643_10000904 | Ga0207643_1000090411 | 341 |
| 1025 | 3300025908 | Ga0207643_10021409 | Ga0207643_100214093 | 341 |
| 1026 | 3300025908 | Ga0207643_10141620 | Ga0207643_101416202 | 341 |
| 1027 | 3300025909 | Ga0207705_10026384 | Ga0207705_100263842 | 341 |
| 1028 | 3300025910 | Ga0207684_10043697 | Ga0207684_100436972 | 341 |
| 1029 | 3300025910 | Ga0207684_10086433 | Ga0207684_100864331 | 341 |
| 1030 | 3300025912 | Ga0207707_10002364 | Ga0207707_1000236410 | 341 |
| 1031 | 3300025912 | Ga0207707_10223708 | Ga0207707_102237082 | 341 |
| 1032 | 3300025912 | Ga0207707_10381337 | Ga0207707_103813371 | 341 |
| 1033 | 3300025913 | Ga0207695_10000923 | Ga0207695_1000092349 | 341 |
| 1034 | 3300025913 | Ga0207695_10019147 | Ga0207695_100191474 | 341 |
| 1035 | 3300025913 | Ga0207695_10328926 | Ga0207695_103289262 | 341 |
| 1036 | 3300025914 | Ga0207671_10000201 | Ga0207671_100002013 | 341 |
| 1037 | 3300025914 | Ga0207671_10006455 | Ga0207671_100064555 | 341 |
| 1038 | 3300025914 | Ga0207671_10021491 | Ga0207671_100214913 | 341 |
| 1039 | 3300025915 | Ga0207693_10001447 | Ga0207693_1000144719 | 341 |
| 1040 | 3300025915 | Ga0207693_10003980 | Ga0207693_100039802 | 341 |
| 1041 | 3300025915 | Ga0207693_10016361 | Ga0207693_100163613 | 341 |
| 1042 | 3300025916 | Ga0207663_10004872 | Ga0207663_100048725 | 341 |
| 1043 | 3300025916 | Ga0207663_10014014 | Ga0207663_100140143 | 341 |
| 1044 | 3300025916 | Ga0207663_10096804 | Ga0207663_100968042 | 341 |
| 1045 | 3300025916 | Ga0207663_10137224 | Ga0207663_101372241 | 341 |
| 1046 | 3300025916 | Ga0207663_10154064 | Ga0207663_101540642 | 341 |
| 1047 | 3300025918 | Ga0207662_10000340 | Ga0207662_100003404 | 341 |
| 1048 | 3300025918 | Ga0207662_10076027 | Ga0207662_100760271 | 341 |
| 1049 | 3300025919 | Ga0207657_10001161 | Ga0207657_1000116118 | 341 |
| 1050 | 3300025919 | Ga0207657_10001611 | Ga0207657_1000161117 | 341 |
| 1051 | 3300025920 | Ga0207649_10019565 | Ga0207649_100195653 | 341 |
| 1052 | 3300025920 | Ga0207649_10028161 | Ga0207649_100281612 | 341 |
| 1053 | 3300025921 | Ga0207652_10032624 | Ga0207652_100326242 | 341 |
| 1054 | 3300025921 | Ga0207652_10043028 | Ga0207652_100430283 | 341 |
| 1055 | 3300025921 | Ga0207652_10226530 | Ga0207652_102265302 | 341 |
| 1056 | 3300025921 | Ga0207652_10294907 | Ga0207652_102949072 | 341 |
| 1057 | 3300025922 | Ga0207646_10046772 | Ga0207646_100467722 | 341 |
| 1058 | 3300025923 | Ga0207681_10002291 | Ga0207681_1000229112 | 341 |
| 1059 | 3300025923 | Ga0207681_10039259 | Ga0207681_100392594 | 341 |
| 1060 | 3300025923 | Ga0207681_10083909 | Ga0207681_100839092 | 341 |
| 1061 | 3300025924 | Ga0207694_10003707 | Ga0207694_100037074 | 341 |
| 1062 | 3300025924 | Ga0207694_10041991 | Ga0207694_100419913 | 341 |
| 1063 | 3300025924 | Ga0207694_10187123 | Ga0207694_101871232 | 341 |
| 1064 | 3300025924 | Ga0207694_10378800 | Ga0207694_103788001 | 341 |
| 1065 | 3300025925 | Ga0207650_10000326 | Ga0207650_1000032616 | 341 |
| 1066 | 3300025925 | Ga0207650_10022991 | Ga0207650_100229911 | 341 |
| 1067 | 3300025925 | Ga0207650_10024020 | Ga0207650_100240202 | 341 |
| 1068 | 3300025925 | Ga0207650_10051006 | Ga0207650_100510062 | 341 |
| 1069 | 3300025925 | Ga0207650_10096005 | Ga0207650_100960052 | 341 |
| 1070 | 3300025926 | Ga0207659_10000299 | Ga0207659_1000029918 | 341 |
| 1071 | 3300025926 | Ga0207659_10002670 | Ga0207659_100026705 | 341 |
| 1072 | 3300025926 | Ga0207659_10025069 | Ga0207659_100250694 | 341 |
| 1073 | 3300025926 | Ga0207659_10029291 | Ga0207659_100292912 | 341 |
| 1074 | 3300025926 | Ga0207659_10116489 | Ga0207659_101164892 | 341 |
| 1075 | 3300025926 | Ga0207659_10195984 | Ga0207659_101959841 | 341 |
| 1076 | 3300025927 | Ga0207687_10000963 | Ga0207687_1000096321 | 341 |
| 1077 | 3300025928 | Ga0207700_10000035 | Ga0207700_1000003558 | 341 |
| 1078 | 3300025928 | Ga0207700_10458174 | Ga0207700_104581741 | 341 |
| 1079 | 3300025929 | Ga0207664_10027742 | Ga0207664_100277425 | 341 |
| 1080 | 3300025931 | Ga0207644_10001354 | Ga0207644_100013543 | 341 |
| 1081 | 3300025931 | Ga0207644_10013170 | Ga0207644_100131707 | 341 |
| 1082 | 3300025931 | Ga0207644_10013287 | Ga0207644_100132872 | 341 |
| 1083 | 3300025931 | Ga0207644_10018325 | Ga0207644_100183253 | 341 |
| 1084 | 3300025931 | Ga0207644_10127407 | Ga0207644_101274072 | 341 |
| 1085 | 3300025931 | Ga0207644_10233436 | Ga0207644_102334362 | 341 |
| 1086 | 3300025931 | Ga0207644_10254365 | Ga0207644_102543652 | 341 |
| 1087 | 3300025932 | Ga0207690_10000957 | Ga0207690_100009576 | 341 |
| 1088 | 3300025932 | Ga0207690_10013743 | Ga0207690_100137432 | 341 |
| 1089 | 3300025932 | Ga0207690_10015013 | Ga0207690_100150134 | 341 |
| 1090 | 3300025933 | Ga0207706_10000267 | Ga0207706_1000026746 | 341 |
| 1091 | 3300025933 | Ga0207706_10052609 | Ga0207706_100526093 | 341 |
| 1092 | 3300025933 | Ga0207706_10091118 | Ga0207706_100911183 | 341 |
| 1093 | 3300025933 | Ga0207706_10139430 | Ga0207706_101394302 | 341 |
| 1094 | 3300025933 | Ga0207706_10188407 | Ga0207706_101884072 | 341 |
| 1095 | 3300025934 | Ga0207686_10050543 | Ga0207686_100505433 | 341 |
| 1096 | 3300025935 | Ga0207709_10000172 | Ga0207709_100001728 | 341 |
| 1097 | 3300025935 | Ga0207709_10003347 | Ga0207709_100033477 | 341 |
| 1098 | 3300025935 | Ga0207709_10085856 | Ga0207709_100858562 | 341 |
| 1099 | 3300025936 | Ga0207670_10000064 | Ga0207670_1000006411 | 341 |
| 1100 | 3300025936 | Ga0207670_10005667 | Ga0207670_100056677 | 341 |
| 1101 | 3300025936 | Ga0207670_10007685 | Ga0207670_100076854 | 341 |
| 1102 | 3300025936 | Ga0207670_10021513 | Ga0207670_100215135 | 341 |
| 1103 | 3300025936 | Ga0207670_10029379 | Ga0207670_100293793 | 341 |
| 1104 | 3300025937 | Ga0207669_10013588 | Ga0207669_100135882 | 341 |
| 1105 | 3300025937 | Ga0207669_10021010 | Ga0207669_100210102 | 341 |
| 1106 | 3300025937 | Ga0207669_10060872 | Ga0207669_100608723 | 341 |
| 1107 | 3300025937 | Ga0207669_10063459 | Ga0207669_100634593 | 341 |
| 1108 | 3300025937 | Ga0207669_10076252 | Ga0207669_100762522 | 341 |
| 1109 | 3300025938 | Ga0207704_10008488 | Ga0207704_100084883 | 341 |
| 1110 | 3300025938 | Ga0207704_10155721 | Ga0207704_101557212 | 341 |
| 1111 | 3300025939 | Ga0207665_10002891 | Ga0207665_1000289111 | 341 |
| 1112 | 3300025939 | Ga0207665_10025629 | Ga0207665_100256293 | 341 |
| 1113 | 3300025940 | Ga0207691_10000049 | Ga0207691_1000004921 | 341 |
| 1114 | 3300025940 | Ga0207691_10004263 | Ga0207691_100042638 | 341 |
| 1115 | 3300025940 | Ga0207691_10005602 | Ga0207691_100056028 | 341 |
| 1116 | 3300025940 | Ga0207691_10007985 | Ga0207691_100079856 | 341 |
| 1117 | 3300025940 | Ga0207691_10010067 | Ga0207691_100100678 | 341 |
| 1118 | 3300025940 | Ga0207691_10017331 | Ga0207691_100173312 | 341 |
| 1119 | 3300025940 | Ga0207691_10020338 | Ga0207691_100203384 | 341 |
| 1120 | 3300025940 | Ga0207691_10027190 | Ga0207691_100271902 | 341 |
| 1121 | 3300025940 | Ga0207691_10050504 | Ga0207691_100505043 | 341 |
| 1122 | 3300025940 | Ga0207691_10190681 | Ga0207691_101906811 | 341 |
| 1123 | 3300025940 | Ga0207691_10201265 | Ga0207691_102012652 | 341 |
| 1124 | 3300025941 | Ga0207711_10001803 | Ga0207711_100018032 | 341 |
| 1125 | 3300025941 | Ga0207711_10026718 | Ga0207711_100267185 | 341 |
| 1126 | 3300025941 | Ga0207711_10034266 | Ga0207711_100342664 | 341 |
| 1127 | 3300025941 | Ga0207711_10094747 | Ga0207711_100947472 | 341 |
| 1128 | 3300025941 | Ga0207711_10221904 | Ga0207711_102219042 | 341 |
| 1129 | 3300025941 | Ga0207711_10234553 | Ga0207711_102345532 | 341 |
| 1130 | 3300025942 | Ga0207689_10004241 | Ga0207689_100042414 | 341 |
| 1131 | 3300025942 | Ga0207689_10007394 | Ga0207689_100073946 | 341 |
| 1132 | 3300025942 | Ga0207689_10007729 | Ga0207689_100077293 | 341 |
| 1133 | 3300025942 | Ga0207689_10016503 | Ga0207689_100165034 | 341 |
| 1134 | 3300025942 | Ga0207689_10070339 | Ga0207689_100703392 | 341 |
| 1135 | 3300025944 | Ga0207661_10000444 | Ga0207661_1000044417 | 341 |
| 1136 | 3300025944 | Ga0207661_10003085 | Ga0207661_100030855 | 341 |
| 1137 | 3300025944 | Ga0207661_10213112 | Ga0207661_102131122 | 341 |
| 1138 | 3300025945 | Ga0207679_10007980 | Ga0207679_100079804 | 341 |
| 1139 | 3300025945 | Ga0207679_10050694 | Ga0207679_100506941 | 341 |
| 1140 | 3300025945 | Ga0207679_10120783 | Ga0207679_101207832 | 341 |
| 1141 | 3300025945 | Ga0207679_10234570 | Ga0207679_102345702 | 341 |
| 1142 | 3300025949 | Ga0207667_10003714 | Ga0207667_1000371417 | 341 |
| 1143 | 3300025949 | Ga0207667_10032865 | Ga0207667_100328654 | 341 |
| 1144 | 3300025949 | Ga0207667_10066981 | Ga0207667_100669812 | 341 |
| 1145 | 3300025949 | Ga0207667_10308933 | Ga0207667_103089332 | 341 |
| 1146 | 3300025949 | Ga0207667_10514076 | Ga0207667_105140762 | 341 |
| 1147 | 3300025960 | Ga0207651_10000587 | Ga0207651_100005876 | 341 |
| 1148 | 3300025960 | Ga0207651_10000834 | Ga0207651_100008345 | 341 |
| 1149 | 3300025960 | Ga0207651_10012045 | Ga0207651_100120453 | 341 |
| 1150 | 3300025960 | Ga0207651_10015130 | Ga0207651_100151307 | 341 |
| 1151 | 3300025960 | Ga0207651_10021090 | Ga0207651_100210904 | 341 |
| 1152 | 3300025960 | Ga0207651_10030616 | Ga0207651_100306162 | 341 |
| 1153 | 3300025960 | Ga0207651_10032496 | Ga0207651_100324964 | 341 |
| 1154 | 3300025960 | Ga0207651_10033171 | Ga0207651_100331713 | 341 |
| 1155 | 3300025960 | Ga0207651_10101855 | Ga0207651_101018552 | 341 |
| 1156 | 3300025960 | Ga0207651_10268474 | Ga0207651_102684741 | 341 |
| 1157 | 3300025961 | Ga0207712_10020569 | Ga0207712_100205692 | 341 |
| 1158 | 3300025972 | Ga0207668_10025834 | Ga0207668_100258342 | 341 |
| 1159 | 3300025972 | Ga0207668_10034750 | Ga0207668_100347503 | 341 |
| 1160 | 3300025972 | Ga0207668_10080871 | Ga0207668_100808711 | 341 |
| 1161 | 3300025972 | Ga0207668_10202939 | Ga0207668_102029392 | 341 |
| 1162 | 3300025981 | Ga0207640_10022288 | Ga0207640_100222884 | 341 |
| 1163 | 3300025986 | Ga0207658_10006530 | Ga0207658_100065304 | 341 |
| 1164 | 3300025986 | Ga0207658_10019879 | Ga0207658_100198794 | 341 |
| 1165 | 3300025986 | Ga0207658_10038169 | Ga0207658_100381692 | 341 |
| 1166 | 3300025986 | Ga0207658_10096999 | Ga0207658_100969992 | 341 |
| 1167 | 3300025986 | Ga0207658_10107171 | Ga0207658_101071713 | 341 |
| 1168 | 3300025986 | Ga0207658_10347280 | Ga0207658_103472802 | 341 |
| 1169 | 3300026023 | Ga0207677_10001996 | Ga0207677_100019962 | 341 |
| 1170 | 3300026023 | Ga0207677_10040842 | Ga0207677_100408424 | 341 |
| 1171 | 3300026023 | Ga0207677_10053078 | Ga0207677_100530783 | 341 |
| 1172 | 3300026023 | Ga0207677_10109729 | Ga0207677_101097292 | 341 |
| 1173 | 3300026035 | Ga0207703_10002691 | Ga0207703_100026918 | 341 |
| 1174 | 3300026035 | Ga0207703_10003961 | Ga0207703_100039618 | 341 |
| 1175 | 3300026035 | Ga0207703_10010840 | Ga0207703_100108404 | 341 |
| 1176 | 3300026035 | Ga0207703_10115956 | Ga0207703_101159562 | 341 |
| 1177 | 3300026041 | Ga0207639_10082656 | Ga0207639_100826563 | 341 |
| 1178 | 3300026041 | Ga0207639_10107994 | Ga0207639_101079942 | 341 |
| 1179 | 3300026041 | Ga0207639_10135950 | Ga0207639_101359502 | 341 |
| 1180 | 3300026041 | Ga0207639_10137019 | Ga0207639_101370192 | 341 |
| 1181 | 3300026041 | Ga0207639_10161416 | Ga0207639_101614162 | 341 |
| 1182 | 3300026041 | Ga0207639_10313384 | Ga0207639_103133842 | 341 |
| 1183 | 3300026067 | Ga0207678_10001480 | Ga0207678_1000148016 | 341 |
| 1184 | 3300026067 | Ga0207678_10009973 | Ga0207678_100099734 | 341 |
| 1185 | 3300026075 | Ga0207708_10002639 | Ga0207708_1000263913 | 341 |
| 1186 | 3300026075 | Ga0207708_10110506 | Ga0207708_101105063 | 341 |
| 1187 | 3300026075 | Ga0207708_10245971 | Ga0207708_102459712 | 341 |
| 1188 | 3300026078 | Ga0207702_10021218 | Ga0207702_100212182 | 341 |
| 1189 | 3300026078 | Ga0207702_10062188 | Ga0207702_100621882 | 341 |
| 1190 | 3300026078 | Ga0207702_10266940 | Ga0207702_102669402 | 341 |
| 1191 | 3300026078 | Ga0207702_10275424 | Ga0207702_102754242 | 341 |
| 1192 | 3300026088 | Ga0207641_10002409 | Ga0207641_1000240913 | 341 |
| 1193 | 3300026088 | Ga0207641_10011015 | Ga0207641_100110151 | 341 |
| 1194 | 3300026088 | Ga0207641_10112533 | Ga0207641_101125332 | 341 |
| 1195 | 3300026088 | Ga0207641_10166073 | Ga0207641_101660733 | 341 |
| 1196 | 3300026088 | Ga0207641_10363514 | Ga0207641_103635142 | 341 |
| 1197 | 3300026089 | Ga0207648_10000026 | Ga0207648_1000002666 | 341 |
| 1198 | 3300026089 | Ga0207648_10000984 | Ga0207648_1000098428 | 341 |
| 1199 | 3300026089 | Ga0207648_10002748 | Ga0207648_100027489 | 341 |
| 1200 | 3300026089 | Ga0207648_10006618 | Ga0207648_1000661812 | 341 |
| 1201 | 3300026089 | Ga0207648_10022764 | Ga0207648_100227643 | 341 |
| 1202 | 3300026089 | Ga0207648_10114654 | Ga0207648_101146542 | 341 |
| 1203 | 3300026095 | Ga0207676_10003531 | Ga0207676_100035316 | 341 |
| 1204 | 3300026095 | Ga0207676_10006625 | Ga0207676_100066254 | 341 |
| 1205 | 3300026095 | Ga0207676_10032058 | Ga0207676_100320582 | 341 |
| 1206 | 3300026095 | Ga0207676_10042277 | Ga0207676_100422775 | 341 |
| 1207 | 3300026116 | Ga0207674_10002741 | Ga0207674_100027418 | 341 |
| 1208 | 3300026116 | Ga0207674_10010615 | Ga0207674_100106156 | 341 |
| 1209 | 3300026116 | Ga0207674_10017659 | Ga0207674_100176593 | 341 |
| 1210 | 3300026116 | Ga0207674_10024563 | Ga0207674_100245634 | 341 |
| 1211 | 3300026118 | Ga0207675_100001389 | Ga0207675_10000138911 | 341 |
| 1212 | 3300026118 | Ga0207675_100023734 | Ga0207675_1000237345 | 341 |
| 1213 | 3300026118 | Ga0207675_100035627 | Ga0207675_1000356272 | 341 |
| 1214 | 3300026118 | Ga0207675_100043728 | Ga0207675_1000437284 | 341 |
| 1215 | 3300026118 | Ga0207675_100078131 | Ga0207675_1000781313 | 341 |
| 1216 | 3300026121 | Ga0207683_10001689 | Ga0207683_100016894 | 341 |
| 1217 | 3300026121 | Ga0207683_10006288 | Ga0207683_100062886 | 341 |
| 1218 | 3300026121 | Ga0207683_10007344 | Ga0207683_100073448 | 341 |
| 1219 | 3300026121 | Ga0207683_10016814 | Ga0207683_100168143 | 341 |
| 1220 | 3300026121 | Ga0207683_10044697 | Ga0207683_100446974 | 341 |
| 1221 | 3300026121 | Ga0207683_10109066 | Ga0207683_101090662 | 341 |
| 1222 | 3300026121 | Ga0207683_10319470 | Ga0207683_103194702 | 341 |
| 1223 | 3300026142 | Ga0207698_10010328 | Ga0207698_100103285 | 341 |
| 1224 | 3300026142 | Ga0207698_10164339 | Ga0207698_101643392 | 341 |
| 1225 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020500 | 341 |
| 1226 | 3300027614 | Ga0209970_1003020 | Ga0209970_10030202 | 341 |
| 1227 | 3300027876 | Ga0209974_10021098 | Ga0209974_100210982 | 341 |
| 1228 | 3300027876 | Ga0209974_10033674 | Ga0209974_100336742 | 341 |
| 1229 | 3300027907 | Ga0207428_10016435 | Ga0207428_100164355 | 341 |
| 1230 | 3300028379 | Ga0268266_10007672 | Ga0268266_1000767211 | 341 |
| 1231 | 3300028379 | Ga0268266_10013258 | Ga0268266_100132585 | 341 |
| 1232 | 3300028379 | Ga0268266_10018457 | Ga0268266_100184574 | 341 |
| 1233 | 3300028379 | Ga0268266_10077105 | Ga0268266_100771052 | 341 |
| 1234 | 3300028380 | Ga0268265_10052060 | Ga0268265_100520602 | 341 |
| 1235 | 3300028380 | Ga0268265_10075457 | Ga0268265_100754573 | 341 |
| 1236 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030161 | 341 |
| 1237 | 3300028381 | Ga0268264_10003226 | Ga0268264_100032269 | 341 |
| 1238 | 3300028381 | Ga0268264_10012760 | Ga0268264_100127602 | 341 |
| 1239 | 3300028381 | Ga0268264_10031545 | Ga0268264_100315452 | 341 |
| 1240 | 3300028381 | Ga0268264_10059458 | Ga0268264_100594583 | 341 |
| 1241 | 3300028381 | Ga0268264_10476689 | Ga0268264_104766891 | 341 |
| 1242 | 3300028666 | Ga0265336_10000003 | Ga0265336_1000000346 | 341 |
| 1243 | 3300028786 | Ga0307517_10001421 | Ga0307517_1000142114 | 341 |
| 1244 | 3300028786 | Ga0307517_10055873 | Ga0307517_100558733 | 341 |
| 1245 | 3300028794 | Ga0307515_10000160 | Ga0307515_10000160135 | 341 |
| 1246 | 3300028794 | Ga0307515_10000737 | Ga0307515_1000073739 | 341 |
| 1247 | 3300028794 | Ga0307515_10028520 | Ga0307515_100285206 | 341 |
| 1248 | 3300028794 | Ga0307515_10060791 | Ga0307515_100607914 | 341 |
| 1249 | 3300028794 | Ga0307515_10082200 | Ga0307515_100822003 | 341 |
| 1250 | 3300029957 | Ga0265324_10003293 | Ga0265324_100032939 | 341 |
| 1251 | 3300030522 | Ga0307512_10026765 | Ga0307512_100267652 | 341 |
| 1252 | 3300031235 | Ga0265330_10099631 | Ga0265330_100996311 | 341 |
| 1253 | 3300031238 | Ga0265332_10000083 | Ga0265332_1000008314 | 341 |
| 1254 | 3300031238 | Ga0265332_10007298 | Ga0265332_100072982 | 341 |
| 1255 | 3300031241 | Ga0265325_10002402 | Ga0265325_100024028 | 341 |
| 1256 | 3300031247 | Ga0265340_10005895 | Ga0265340_100058957 | 341 |
| 1257 | 3300031249 | Ga0265339_10001335 | Ga0265339_100013357 | 341 |
| 1258 | 3300031249 | Ga0265339_10112241 | Ga0265339_101122412 | 341 |
| 1259 | 3300031251 | Ga0265327_10001335 | Ga0265327_1000133523 | 341 |
| 1260 | 3300031251 | Ga0265327_10005550 | Ga0265327_100055506 | 341 |
| 1261 | 3300031344 | Ga0265316_10069195 | Ga0265316_100691953 | 341 |
| 1262 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006239 | 341 |
| 1263 | 3300031456 | Ga0307513_10009007 | Ga0307513_1000900711 | 341 |
| 1264 | 3300031456 | Ga0307513_10015012 | Ga0307513_100150129 | 341 |
| 1265 | 3300031456 | Ga0307513_10306852 | Ga0307513_103068522 | 341 |
| 1266 | 3300031507 | Ga0307509_10008423 | Ga0307509_100084237 | 341 |
| 1267 | 3300031507 | Ga0307509_10062217 | Ga0307509_100622172 | 341 |
| 1268 | 3300031507 | Ga0307509_10071416 | Ga0307509_100714162 | 341 |
| 1269 | 3300031507 | Ga0307509_10239462 | Ga0307509_102394622 | 341 |
| 1270 | 3300031548 | Ga0307408_100036322 | Ga0307408_1000363223 | 341 |
| 1271 | 3300031595 | Ga0265313_10004883 | Ga0265313_100048835 | 341 |
| 1272 | 3300031595 | Ga0265313_10122378 | Ga0265313_101223781 | 341 |
| 1273 | 3300031616 | Ga0307508_10000282 | Ga0307508_1000028229 | 341 |
| 1274 | 3300031616 | Ga0307508_10004767 | Ga0307508_100047678 | 341 |
| 1275 | 3300031616 | Ga0307508_10014131 | Ga0307508_100141315 | 341 |
| 1276 | 3300031616 | Ga0307508_10039482 | Ga0307508_100394824 | 341 |
| 1277 | 3300031649 | Ga0307514_10000408 | Ga0307514_1000040820 | 341 |
| 1278 | 3300031649 | Ga0307514_10017292 | Ga0307514_100172923 | 341 |
| 1279 | 3300031665 | Ga0316575_10048438 | Ga0316575_100484382 | 341 |
| 1280 | 3300031712 | Ga0265342_10023680 | Ga0265342_100236803 | 341 |
| 1281 | 3300031730 | Ga0307516_10001367 | Ga0307516_100013675 | 341 |
| 1282 | 3300031730 | Ga0307516_10002101 | Ga0307516_100021017 | 341 |
| 1283 | 3300031730 | Ga0307516_10039313 | Ga0307516_100393132 | 341 |
| 1284 | 3300031730 | Ga0307516_10052275 | Ga0307516_100522752 | 341 |
| 1285 | 3300031730 | Ga0307516_10065805 | Ga0307516_100658052 | 341 |
| 1286 | 3300031730 | Ga0307516_10204155 | Ga0307516_102041552 | 341 |
| 1287 | 3300031730 | Ga0307516_10206691 | Ga0307516_102066912 | 341 |
| 1288 | 3300031731 | Ga0307405_10062112 | Ga0307405_100621123 | 341 |
| 1289 | 3300031731 | Ga0307405_10276730 | Ga0307405_102767301 | 341 |
| 1290 | 3300031824 | Ga0307413_10002484 | Ga0307413_100024842 | 341 |
| 1291 | 3300031901 | Ga0307406_10073164 | Ga0307406_100731643 | 341 |
| 1292 | 3300031911 | Ga0307412_10035132 | Ga0307412_100351323 | 341 |
| 1293 | 3300032002 | Ga0307416_100023883 | Ga0307416_1000238833 | 341 |
| 1294 | 3300033179 | Ga0307507_10044588 | Ga0307507_100445882 | 341 |
| 1295 | 3300033180 | Ga0307510_10034714 | Ga0307510_100347146 | 341 |
| 1296 | 3300033180 | Ga0307510_10066040 | Ga0307510_100660403 | 341 |
| 1297 | 3300035090 | Ga0373949_0000342 | Ga0373949_0000342_14059_15087 | 341 |
| 1298 | 3300035111 | Ga0373923_0008265 | Ga0373923_0008265_1207_2235 | 341 |
| 1299 | 3300035111 | Ga0373923_0058329 | Ga0373923_0058329_246_1271 | 341 |
| 1300 | 3300035114 | Ga0373939_0000469 | Ga0373939_0000469_2182_3210 | 341 |
| 1301 | 3300035117 | Ga0373953_0000542 | Ga0373953_0000542_6808_7836 | 341 |
| 1302 | 3300035117 | Ga0373953_0052078 | Ga0373953_0052078_356_1381 | 341 |
| 1303 | 3300035118 | Ga0373954_0000323 | Ga0373954_0000323_9021_10049 | 341 |
| 1304 | 3300035118 | Ga0373954_0003173 | Ga0373954_0003173_5067_6095 | 341 |
| 1305 | 3300035118 | Ga0373954_0041561 | Ga0373954_0041561_679_1707 | 341 |
| 1306 | 3300035119 | Ga0373956_0003655 | Ga0373956_0003655_1871_2899 | 341 |
| 1307 | 3300035119 | Ga0373956_0009107 | Ga0373956_0009107_1314_2342 | 341 |
| 1308 | 3300035171 | Ga0373946_0043163 | Ga0373946_0043163_512_1537 | 341 |
| 1309 | 3300035172 | Ga0373955_0003057 | Ga0373955_0003057_4761_5789 | 341 |
| 1310 | 3300035410 | Ga0373924_0004824 | Ga0373924_0004824_333_1367 | 341 |
| 1311 | 3300035410 | Ga0373924_0014735 | Ga0373924_0014735_1106_2134 | 341 |
| 1312 | 3300035691 | Ga0373931_0047358 | Ga0373931_0047358_664_1692 | 341 |
| 1313 | 3300035692 | Ga0373935_0046730 | Ga0373935_0046730_916_1941 | 341 |
| 1314 | 3300035692 | Ga0373935_0106598 | Ga0373935_0106598_570_1598 | 341 |
| 1315 | 3300035724 | Ga0373933_0001324 | Ga0373933_0001324_12207_13235 | 341 |
| 1316 | 3300035724 | Ga0373933_0034647 | Ga0373933_0034647_1365_2393 | 341 |
| 1317 | 3300035725 | Ga0373947_0008307 | Ga0373947_0008307_4886_5911 | 341 |
| 1318 | 3300035725 | Ga0373947_0018126 | Ga0373947_0018126_2693_3718 | 341 |
| 1319 | 3300035725 | Ga0373947_0030133 | Ga0373947_0030133_1801_2829 | 341 |
| 1320 | 3300036401 | Ga0373937_0000847 | Ga0373937_0000847_21635_22663 | 341 |
| 1321 | 3300036401 | Ga0373937_0004472 | Ga0373937_0004472_2526_3554 | 341 |
| 1322 | 3300036401 | Ga0373937_0007329 | Ga0373937_0007329_5827_6855 | 341 |
| 1323 | 3300036401 | Ga0373937_0069648 | Ga0373937_0069648_477_1502 | 341 |
| 1324 | 3300036401 | Ga0373937_0158162 | Ga0373937_0158162_445_1473 | 341 |
| 1325 | 3300037068 | Ga0373925_0056541 | Ga0373925_0056541_1072_2100 | 341 |
| 1326 | 3300037068 | Ga0373925_0087711 | Ga0373925_0087711_1256_2284 | 341 |
| 1327 | 3300037068 | Ga0373925_0113055 | Ga0373925_0113055_411_1436 | 341 |
| 1328 | 3300037068 | Ga0373925_0124132 | Ga0373925_0124132_84_1112 | 341 |
| 1329 | 3300037312 | Ga0395899_0130710 | Ga0395899_0130710_16_1050 | 341 |
| 1330 | 3300037418 | Ga0395900_0016357 | Ga0395900_0016357_5455_6489 | 341 |
| 1331 | 3300037418 | Ga0395900_0083912 | Ga0395900_0083912_149_1183 | 341 |
| 1332 | 3300037418 | Ga0395900_0193333 | Ga0395900_0193333_615_1649 | 341 |
| 1333 | 3300037466 | Ga0395898_0042436 | Ga0395898_0042436_585_1619 | 341 |
| 1334 | 3300037466 | Ga0395898_0070969 | Ga0395898_0070969_150_1184 | 341 |
| 1335 | 3300037466 | Ga0395898_0323056 | Ga0395898_0323056_324_1358 | 341 |
| 1336 | 3300037471 | Ga0395905_0009530 | Ga0395905_0009530_3012_4040 | 341 |
| 1337 | 3300037471 | Ga0395905_0012101 | Ga0395905_0012101_468_1496 | 341 |
| 1338 | 3300037471 | Ga0395905_0013595 | Ga0395905_0013595_6709_7737 | 341 |
| 1339 | 3300037471 | Ga0395905_0021316 | Ga0395905_0021316_2580_3614 | 341 |
| 1340 | 3300037471 | Ga0395905_0045282 | Ga0395905_0045282_549_1583 | 341 |
| 1341 | 3300037471 | Ga0395905_0118549 | Ga0395905_0118549_247_1281 | 341 |
| 1342 | 3300037471 | Ga0395905_0180684 | Ga0395905_0180684_45_1073 | 341 |
| 1343 | 3300037471 | Ga0395905_0205964 | Ga0395905_0205964_587_1621 | 341 |
| 1344 | 3300037853 | Ga0436364_0513795 | Ga0436364_0513795_3682_4710 | 341 |
| 1345 | 3300038443 | Ga0395901_0093209 | Ga0395901_0093209_677_1711 | 341 |
| 1346 | 3300038726 | Ga0400490_26120 | Ga0400490_26120_1028_2056 | 341 |
| 1347 | 3300038726 | Ga0400490_31337 | Ga0400490_31337_15236_16264 | 341 |
| 1348 | 3300038726 | Ga0400490_35285 | Ga0400490_35285_1299_2327 | 341 |
| 1349 | 3300038726 | Ga0400490_43165 | Ga0400490_43165_8823_9851 | 341 |
| 1350 | 3300038726 | Ga0400490_43931 | Ga0400490_43931_32425_33453 | 341 |
| 1351 | 3300038727 | Ga0400491_00605 | Ga0400491_00605_468_1496 | 341 |
| 1352 | 3300038741 | Ga0400488_09907 | Ga0400488_09907_1341_2369 | 341 |
| 1353 | 3300038741 | Ga0400488_41347 | Ga0400488_41347_258_1286 | 341 |
| 1354 | 3300038741 | Ga0400488_53493 | Ga0400488_53493_2063_3091 | 341 |
| 1355 | 3300039110 | Ga0400487_23984 | Ga0400487_23984_12479_13507 | 341 |
| 1356 | 3300039110 | Ga0400487_34028 | Ga0400487_34028_12454_13482 | 341 |
| 1357 | 3300039110 | Ga0400487_37419 | Ga0400487_37419_522_1550 | 341 |
| 1358 | 3300039110 | Ga0400487_42799 | Ga0400487_42799_21118_22146 | 341 |
| 1359 | 3300039110 | Ga0400487_44343 | Ga0400487_44343_1667_2695 | 341 |
| 1360 | 3300039437 | Ga0436365_0894540 | Ga0436365_0894540_20683_21711 | 341 |
| 1361 | 3300039437 | Ga0436365_1549030 | Ga0436365_1549030_3197_4225 | 341 |
| 1362 | 3300039438 | Ga0436360_0275638 | Ga0436360_0275638_113_1147 | 341 |
| 1363 | 3300039447 | Ga0436361_0193139 | Ga0436361_0193139_4613_5641 | 341 |
| 1364 | 3300039453 | Ga0436362_0663798 | Ga0436362_0663798_41_1069 | 341 |
| 1365 | 3300041997 | Ga0439431_0009589 | Ga0439431_0009589_687_1715 | 341 |
| 1366 | 3300042127 | Ga0450890_001687 | Ga0450890_001687_1506_2534 | 341 |
| 1367 | 3300042129 | Ga0450891_000178 | Ga0450891_000178_1071_2099 | 341 |
| 1368 | 3300042130 | Ga0450892_001312 | Ga0450892_001312_475_1503 | 341 |
| 1369 | 3300042532 | Ga0450893_0001010 | Ga0450893_0001010_614_1642 | 341 |
| 1370 | 3300042876 | Ga0451577_0106470 | Ga0451577_0106470_1355_2383 | 341 |
| 1371 | 3300044712 | Ga0453684_0000906 | Ga0453684_0000906_65256_66308 | 341 |
| 1372 | 3300044712 | Ga0453684_0152269 | Ga0453684_0152269_1182_2210 | 341 |
| 1373 | 3300045051 | Ga0451576_0118222 | Ga0451576_0118222_438_1466 | 341 |
| 1374 | 3300046454 | Ga0495592_0000519 | Ga0495592_0000519_22311_23339 | 341 |
| 1375 | 3300046462 | Ga0495651_0014174 | Ga0495651_0014174_3958_4986 | 341 |
| 1376 | 3300046462 | Ga0495651_0203056 | Ga0495651_0203056_64_1092 | 341 |
| 1377 | 3300046471 | Ga0495650_0001530 | Ga0495650_0001530_11769_12797 | 341 |
| 1378 | 3300046471 | Ga0495650_0001834 | Ga0495650_0001834_4564_5592 | 341 |
| 1379 | 3300046471 | Ga0495650_0015649 | Ga0495650_0015649_2599_3624 | 341 |
| 1380 | 3300046500 | Ga0495596_0017045 | Ga0495596_0017045_601_1629 | 341 |
| 1381 | 3300046506 | Ga0495583_0000306 | Ga0495583_0000306_58402_59430 | 341 |
| 1382 | 3300046511 | Ga0495608_0012098 | Ga0495608_0012098_3795_4823 | 341 |
| 1383 | 3300046512 | Ga0495610_0006324 | Ga0495610_0006324_1338_2381 | 341 |
| 1384 | 3300046516 | Ga0495628_0005737 | Ga0495628_0005737_7910_8938 | 341 |
| 1385 | 3300046524 | Ga0495648_0001735 | Ga0495648_0001735_17696_18724 | 341 |
| 1386 | 3300046524 | Ga0495648_0003308 | Ga0495648_0003308_8058_9095 | 341 |
| 1387 | 3300046529 | Ga0495652_0022690 | Ga0495652_0022690_1276_2304 | 341 |
| 1388 | 3300046529 | Ga0495652_0033439 | Ga0495652_0033439_3266_4294 | 341 |
| 1389 | 3300046530 | Ga0495654_0001482 | Ga0495654_0001482_1340_2368 | 341 |
| 1390 | 3300046536 | Ga0495587_0005573 | Ga0495587_0005573_3394_4422 | 341 |
| 1391 | 3300046537 | Ga0495598_0067512 | Ga0495598_0067512_79_1107 | 341 |
| 1392 | 3300046539 | Ga0495621_0001756 | Ga0495621_0001756_4344_5372 | 341 |
| 1393 | 3300046543 | Ga0495645_0095615 | Ga0495645_0095615_790_1818 | 341 |
| 1394 | 3300046543 | Ga0495645_0117138 | Ga0495645_0117138_548_1573 | 341 |
| 1395 | 3300046559 | Ga0495667_0058675 | Ga0495667_0058675_1304_2332 | 341 |
| 1396 | 3300046615 | Ga0495656_0000383 | Ga0495656_0000383_11908_12936 | 341 |
| 1397 | 3300046660 | Ga0495625_0001300 | Ga0495625_0001300_10037_11065 | 341 |
| 1398 | 3300046660 | Ga0495625_0005155 | Ga0495625_0005155_2253_3281 | 341 |
| 1399 | 3300046660 | Ga0495625_0029787 | Ga0495625_0029787_981_2009 | 341 |
| 1400 | 3300046663 | Ga0495635_0006348 | Ga0495635_0006348_5476_6504 | 341 |
| 1401 | 3300046663 | Ga0495635_0212429 | Ga0495635_0212429_238_1266 | 341 |
| 1402 | 3300046665 | Ga0495661_0019488 | Ga0495661_0019488_2396_3424 | 341 |
| 1403 | 3300046675 | Ga0495657_0015234 | Ga0495657_0015234_4277_5305 | 341 |
| 1404 | 3300046678 | Ga0495599_0004863 | Ga0495599_0004863_1619_2647 | 341 |
| 1405 | 3300046679 | Ga0495623_0002882 | Ga0495623_0002882_3584_4612 | 341 |
| 1406 | 3300046679 | Ga0495623_0005974 | Ga0495623_0005974_2355_3383 | 341 |
| 1407 | 3300046679 | Ga0495623_0139277 | Ga0495623_0139277_107_1135 | 341 |
| 1408 | 3300046680 | Ga0495646_0008308 | Ga0495646_0008308_4199_5227 | 341 |
| 1409 | 3300046809 | Ga0495600_0058069 | Ga0495600_0058069_324_1352 | 341 |
| 1410 | 3300047317 | Ga0495604_0000893 | Ga0495604_0000893_14914_15942 | 341 |
| 1411 | 3300047317 | Ga0495604_0082744 | Ga0495604_0082744_196_1224 | 341 |
| 1412 | 3300047317 | Ga0495604_0131342 | Ga0495604_0131342_136_1164 | 341 |
| 1413 | 3300047318 | Ga0495636_0003446 | Ga0495636_0003446_3582_4637 | 341 |
| 1414 | 3300047319 | Ga0495674_0073493 | Ga0495674_0073493_1631_2659 | 341 |
| 1415 | 3300047322 | Ga0495680_0036120 | Ga0495680_0036120_1304_2332 | 341 |
| 1416 | 3300047322 | Ga0495680_0117364 | Ga0495680_0117364_909_1937 | 341 |
| 1417 | 3300047323 | Ga0495683_0032671 | Ga0495683_0032671_266_1294 | 341 |
| 1418 | 3300047443 | Ga0495687_001812 | Ga0495687_001812_6436_7464 | 341 |
| 1419 | 3300047444 | Ga0495675_0003845 | Ga0495675_0003845_6424_7452 | 341 |
| 1420 | 3300047444 | Ga0495675_0020051 | Ga0495675_0020051_678_1706 | 341 |
| 1421 | 3300047471 | Ga0495684_0005498 | Ga0495684_0005498_4390_5418 | 341 |
| 1422 | 3300047472 | Ga0495686_0000603 | Ga0495686_0000603_6840_7868 | 341 |
| 1423 | 3300047472 | Ga0495686_0030707 | Ga0495686_0030707_263_1291 | 341 |
| 1424 | 3300048088 | Ga0495602_0001190 | Ga0495602_0001190_19114_20142 | 341 |
| 1425 | 3300048088 | Ga0495602_0021398 | Ga0495602_0021398_3770_4798 | 341 |
| 1426 | 3300048088 | Ga0495602_0023541 | Ga0495602_0023541_1176_2204 | 341 |
| 1427 | 3300048089 | Ga0495614_0003366 | Ga0495614_0003366_952_1980 | 341 |
| 1428 | 3300048089 | Ga0495614_0070629 | Ga0495614_0070629_312_1340 | 341 |
| 1429 | 3300048903 | Ga0496100_0069821 | Ga0496100_0069821_201_1226 | 341 |
| 1430 | 3300048904 | Ga0496101_0077873 | Ga0496101_0077873_1148_2176 | 341 |
| 1431 | 3300048904 | Ga0496101_0080354 | Ga0496101_0080354_410_1435 | 341 |
| 1432 | 3300048904 | Ga0496101_0114617 | Ga0496101_0114617_903_1931 | 341 |
| 1433 | 3300048904 | Ga0496101_0149669 | Ga0496101_0149669_264_1292 | 341 |
| 1434 | 3300048905 | Ga0496102_0154653 | Ga0496102_0154653_783_1808 | 341 |
| 1435 | 3300048906 | Ga0496103_0013140 | Ga0496103_0013140_976_2016 | 341 |
| 1436 | 3300048907 | Ga0496104_0008496 | Ga0496104_0008496_1071_2099 | 341 |
| 1437 | 3300048907 | Ga0496104_0011778 | Ga0496104_0011778_5172_6197 | 341 |
| 1438 | 3300048907 | Ga0496104_0049145 | Ga0496104_0049145_140_1168 | 341 |
| 1439 | 3300048907 | Ga0496104_0092955 | Ga0496104_0092955_108_1136 | 341 |
| 1440 | 3300048907 | Ga0496104_0240711 | Ga0496104_0240711_589_1617 | 341 |
| 1441 | 3300048907 | Ga0496104_0315020 | Ga0496104_0315020_147_1175 | 341 |
| 1442 | 3300048908 | Ga0496105_0000572 | Ga0496105_0000572_6302_7330 | 341 |
| 1443 | 3300048908 | Ga0496105_0002416 | Ga0496105_0002416_11108_12136 | 341 |
| 1444 | 3300048908 | Ga0496105_0015520 | Ga0496105_0015520_915_1940 | 341 |
| 1445 | 3300048908 | Ga0496105_0105424 | Ga0496105_0105424_1169_2197 | 341 |
| 1446 | 3300048909 | Ga0496106_0004513 | Ga0496106_0004513_8641_9666 | 341 |
| 1447 | 3300048909 | Ga0496106_0005567 | Ga0496106_0005567_1744_2769 | 341 |
| 1448 | 3300048909 | Ga0496106_0175493 | Ga0496106_0175493_44_1069 | 341 |
| 1449 | 3300048909 | Ga0496106_0297618 | Ga0496106_0297618_242_1282 | 341 |
| 1450 | 3300048910 | Ga0496107_0005458 | Ga0496107_0005458_3176_4201 | 341 |
| 1451 | 3300048910 | Ga0496107_0049325 | Ga0496107_0049325_621_1649 | 341 |
| 1452 | 3300048911 | Ga0496108_0005344 | Ga0496108_0005344_8012_9037 | 341 |
| 1453 | 3300048912 | Ga0496109_0004278 | Ga0496109_0004278_4135_5160 | 341 |
| 1454 | 3300048912 | Ga0496109_0276868 | Ga0496109_0276868_407_1432 | 341 |
| 1455 | 3300048913 | Ga0496110_0020100 | Ga0496110_0020100_3119_4144 | 341 |
| 1456 | 3300048913 | Ga0496110_0520382 | Ga0496110_0520382_12_1037 | 341 |
| 1457 | 3300048917 | Ga0496114_0000501 | Ga0496114_0000501_21375_22403 | 341 |
| 1458 | 3300048917 | Ga0496114_0007334 | Ga0496114_0007334_1010_2038 | 341 |
| 1459 | 3300048917 | Ga0496114_0016064 | Ga0496114_0016064_34_1062 | 341 |
| 1460 | 3300048917 | Ga0496114_0027394 | Ga0496114_0027394_2112_3137 | 341 |
| 1461 | 3300048917 | Ga0496114_0198475 | Ga0496114_0198475_476_1504 | 341 |
| 1462 | 3300048918 | Ga0496115_0041449 | Ga0496115_0041449_1415_2443 | 341 |
| 1463 | 3300048918 | Ga0496115_0053225 | Ga0496115_0053225_1166_2194 | 341 |
| 1464 | 3300048919 | Ga0496116_0005353 | Ga0496116_0005353_3424_4452 | 341 |
| 1465 | 3300048920 | Ga0496117_0022285 | Ga0496117_0022285_943_1971 | 341 |
| 1466 | 3300048921 | Ga0496118_0004640 | Ga0496118_0004640_3936_4964 | 341 |
| 1467 | 3300048922 | Ga0496119_0000213 | Ga0496119_0000213_65567_66595 | 341 |
| 1468 | 3300048924 | Ga0496121_0000089 | Ga0496121_0000089_71619_72647 | 341 |
| 1469 | 3300048924 | Ga0496121_0029822 | Ga0496121_0029822_3364_4392 | 341 |
| 1470 | 3300048925 | Ga0496122_0001063 | Ga0496122_0001063_16150_17178 | 341 |
| 1471 | 3300048926 | Ga0496123_0000246 | Ga0496123_0000246_55771_56799 | 341 |
| 1472 | 3300048926 | Ga0496123_0062416 | Ga0496123_0062416_1212_2240 | 341 |
| 1473 | 3300048928 | Ga0496125_0018144 | Ga0496125_0018144_5399_6445 | 341 |
| 1474 | 3300048929 | Ga0496126_0003551 | Ga0496126_0003551_2831_3859 | 341 |
| 1475 | 3300049523 | Ga0501300_004779 | Ga0501300_004779_425_1453 | 341 |
| 1476 | 3300049568 | Ga0501031_0001824 | Ga0501031_0001824_2537_3574 | 341 |
| 1477 | 3300049571 | Ga0501034_0020044 | Ga0501034_0020044_5036_6079 | 341 |
| 1478 | 3300049571 | Ga0501034_0064115 | Ga0501034_0064115_2210_3253 | 341 |
| 1479 | 3300049572 | Ga0501036_0005963 | Ga0501036_0005963_880_1923 | 341 |
| 1480 | 3300049579 | Ga0501043_0000058 | Ga0501043_0000058_75870_76898 | 341 |
| 1481 | 3300049579 | Ga0501043_0000643 | Ga0501043_0000643_27897_28940 | 341 |
| 1482 | 3300049580 | Ga0501046_0000051 | Ga0501046_0000051_25180_26208 | 341 |
| 1483 | 3300049580 | Ga0501046_0002679 | Ga0501046_0002679_2599_3642 | 341 |
| 1484 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_482196_483224 | 341 |
| 1485 | 3300049581 | Ga0501047_0005052 | Ga0501047_0005052_5162_6205 | 341 |
| 1486 | 3300049581 | Ga0501047_0229176 | Ga0501047_0229176_126_1154 | 341 |
| 1487 | 3300049583 | Ga0501067_0014886 | Ga0501067_0014886_982_2010 | 341 |
| 1488 | 3300049586 | Ga0501070_0006327 | Ga0501070_0006327_2585_3613 | 341 |
| 1489 | 3300049589 | Ga0501073_0003296 | Ga0501073_0003296_8349_9377 | 341 |
| 1490 | 3300049589 | Ga0501073_0032616 | Ga0501073_0032616_373_1401 | 341 |
| 1491 | 3300049663 | Ga0501223_021408 | Ga0501223_021408_144_1172 | 341 |
| 1492 | 3300049705 | Ga0501225_0008344 | Ga0501225_0008344_99_1127 | 341 |
| 1493 | 3300049706 | Ga0501229_000131 | Ga0501229_000131_5402_6430 | 341 |
| 1494 | 3300049742 | Ga0501080_0012936 | Ga0501080_0012936_1410_2438 | 341 |
| 1495 | 3300049744 | Ga0501083_0048123 | Ga0501083_0048123_1026_2054 | 341 |
| 1496 | 3300049759 | Ga0501262_000404 | Ga0501262_000404_3816_4844 | 341 |
| 1497 | 3300049822 | Ga0501035_0002048 | Ga0501035_0002048_5797_6840 | 341 |
| 1498 | 3300049823 | Ga0501044_0000515 | Ga0501044_0000515_43067_44110 | 341 |
| 1499 | 3300049823 | Ga0501044_0007899 | Ga0501044_0007899_3685_4728 | 341 |
| 1500 | 3300049823 | Ga0501044_0538433 | Ga0501044_0538433_14_1042 | 341 |
| 1501 | 3300049824 | Ga0501045_0001820 | Ga0501045_0001820_4970_5998 | 341 |
| 1502 | 3300050493 | nmdc:mga0k408_15138_c1 | nmdc:mga0k408_15138_c1_2322_3350 | 341 |
| 1503 | 3300050493 | nmdc:mga0k408_206_c1 | nmdc:mga0k408_206_c1_5272_6300 | 341 |
| 1504 | 3300050493 | nmdc:mga0k408_5529_c1 | nmdc:mga0k408_5529_c1_2643_3671 | 341 |
| 1505 | 3300050493 | nmdc:mga0k408_641_c2 | nmdc:mga0k408_641_c2_6752_7780 | 341 |
| 1506 | 3300050496 | nmdc:mga07m45_138909_c1 | nmdc:mga07m45_138909_c1_354_1388 | 341 |
| 1507 | 3300050496 | nmdc:mga07m45_18057_c2 | nmdc:mga07m45_18057_c2_609_1637 | 341 |
| 1508 | 3300050496 | nmdc:mga07m45_19775_c1 | nmdc:mga07m45_19775_c1_874_1902 | 341 |
| 1509 | 3300050507 | nmdc:mga05p37_52613_c1 | nmdc:mga05p37_52613_c1_549_1577 | 341 |
| 1510 | 3300050509 | nmdc:mga0qj67_18883_c1 | nmdc:mga0qj67_18883_c1_1626_2660 | 341 |
| 1511 | 3300050511 | nmdc:mga08y16_181892_c1 | nmdc:mga08y16_181892_c1_984_2084 | 341 |
| 1512 | 3300050512 | nmdc:mga0n895_200805_c1 | nmdc:mga0n895_200805_c1_248_1276 | 341 |
| 1513 | 3300050513 | nmdc:mga0rr50_419562_c1 | nmdc:mga0rr50_419562_c1_88_1116 | 341 |
| 1514 | 3300053078 | Ga0495612_0083098 | Ga0495612_0083098_269_1294 | 341 |
| 1515 | 3300053087 | Ga0500643_007434 | Ga0500643_007434_1927_2955 | 341 |
| 1516 | 3300053093 | Ga0500651_0000087 | Ga0500651_0000087_54117_55145 | 341 |
| 1517 | 3300053093 | Ga0500651_0164338 | Ga0500651_0164338_117_1151 | 341 |
| 1518 | 3300053110 | Ga0500571_000055 | Ga0500571_000055_4122_5150 | 341 |
| 1519 | 3300053139 | Ga0500568_0009819 | Ga0500568_0009819_166_1194 | 341 |
| 1520 | 3300053156 | Ga0500622_0001145 | Ga0500622_0001145_6139_7167 | 341 |
| 1521 | 3300053156 | Ga0500622_0036726 | Ga0500622_0036726_968_1996 | 341 |
| 1522 | 3300059493 | Ga0587077_015555 | Ga0587077_015555_204_1232 | 341 |
| 1523 | iso_pu_bacteria | 2928115317 | 2928117043 | 341 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gwg-assembly1.cif.gz_A | crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66. | 0.9918 | 1 | 340 |
| 2gwg-assembly1.cif.gz_B | crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66. | 0.9881 | 1 | 340 |
| 6dxq-assembly2.cif.gz_B | crystal structure of the ligj hydratase product complex with 4-carboxy-4-hydroxy-2-oxoadipate | 0.9851 | 1 | 341 |
| 6dxq-assembly1.cif.gz_C-2 | crystal structure of the ligj hydratase product complex with 4-carboxy-4-hydroxy-2-oxoadipate | 0.9831 | 1 | 341 |
| 6dwv-assembly1.cif.gz_C | crystal structure of the ligj hydratase in the apo state | 0.9817 | 1 | 341 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gwgA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9908 | 2 | 340 | 3.20.20.140 |
| 2gwgA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9754 | 2 | 340 | 3.20.20.140 |
| 2f6kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7759 | 1 | 330 | 3.20.20.140 |
| 2f6kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7712 | 1 | 330 | 3.20.20.140 |
| 3nurA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7691 | 1 | 330 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520GG91-F1-model_v4 | Amidohydrolase | 1.004 | 1 | 69 |
GO:0016787
|
| AF-A0A7X5N713-F1-model_v4 | Amidohydrolase family protein | 1.003 | 50 | 119 |
GO:0016787
|
| AF-A0A5C9CH14-F1-model_v4 | 4-oxalmesaconate hydratase | 1.002 | 1 | 132 |
GO:0016787
|
| AF-A0A358D635-F1-model_v4 | 4-oxalomesaconate hydratase | 0.9964 | 254 | 341 |
GO:0016787
|
| AF-A0A1Y1J2L3-F1-model_v4 | 4-oxalomesaconate hydratase (Predicted metal-dependent hydrolase of the TIM-barrel fold) | 0.9954 | 1 | 341 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar