F494551

General Info

Members Datasets Scaffolds Average Seq Length
1523 612 1409 342

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000702|Ga0453684_0000702_22925_24145
Length 406
Sequence MLGRLADAAANGNLAHGAQVAKVGYLFLHSYTKILYQIGQIGMAIESARRILPQEKNSRYWKGQAVIIDIHGHYTTAPKALEEWRKRQIEGIKQPALMPKVSELKISDDELRESIETNQLKKMKERGSDLTIFSPRASFMAHHIGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAMLPQSPGVDPATCVPELEKAVKQYGFVGINLNPDPSGGHWKEPPLTSRHWYPIYEKMVEYGIPAMIHVSTSCNECFHTTGAHYINADTTAFMQLIQGDLFKDFPDMKFVIPHGGGAAPYHWGRYRGLAQELKKPLLDEHLLNNVFFDTCVYHQPGIDLLTRVIPLKNVLFASEMIGAVKGIDPQTGHNFDDTKRYIEGADLTADERHMIYEGNARRVYPRLDAALKQKGK

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
5 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
6 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
7 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
8 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
9 2547132374 Acidovorax radicis N35 Isolate Unclassified
10 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
11 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
12 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
13 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
14 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
15 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
16 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
17 2643221570 Acidovorax sp. Root568 Isolate Unclassified
18 2643221596 Acidovorax sp. Root70 Isolate Unclassified
19 2643221609 Acidovorax sp. Root217 Isolate Unclassified
20 2643221611 Acidovorax sp. Root219 Isolate Unclassified
21 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
22 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
23 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
24 2643221652 Acidovorax sp. Root402 Isolate Unclassified
25 2643221658 Variovorax sp. Root411 Isolate Unclassified
26 2643221717 Acidovorax sp. Root267 Isolate Unclassified
27 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
28 2721755523 Delftia sp. HK171 Isolate Unclassified
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
31 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
32 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
33 2738541307 Variovorax sp. GV008 Isolate Unclassified
34 2738541337 Pelomonas sp. BT06 Isolate Unclassified
35 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
36 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
37 2738543012 Acidovorax sp. CF301 Isolate Unclassified
38 2738543013 Variovorax sp. BT01 Isolate Unclassified
39 2738543019 Variovorax sp. GV040 Isolate Unclassified
40 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
41 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
42 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
43 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
44 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
45 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
46 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
47 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
48 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
49 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
50 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
51 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
52 2808606448 Streptomyces sp. 193411 Isolate Unclassified
53 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
54 2816332133 Acidovorax radicis 2721A Isolate Unclassified
55 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
56 2831864461 Roseateles noduli HZ7 Isolate Nodule
57 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
58 2842711865 Duganella sp. R-73148 Isolate Unclassified
59 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
60 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
61 2857553236 Duganella sp. R-74557 Isolate Unclassified
62 2857564685 Duganella sp. R-74599 Isolate Unclassified
63 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
64 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
65 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
66 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
67 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
68 2885198086 Variovorax sp. 679 Isolate Unclassified
69 2885211737 Variovorax sp. 553 Isolate Unclassified
70 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
71 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
72 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
73 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
74 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
75 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
76 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
77 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
78 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
79 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
80 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
81 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
82 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
83 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
84 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
85 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
86 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
87 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
88 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
89 2928070936 Variovorax gossypii 1167 Isolate Unclassified
90 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
91 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
92 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
93 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
94 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
95 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
96 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
97 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
98 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
99 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
100 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
101 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
102 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
103 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
104 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
105 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
106 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
107 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
108 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
109 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
110 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
111 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
112 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
114 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
115 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
116 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
117 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
118 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
119 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
120 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
121 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
122 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
123 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
124 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
125 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
126 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
127 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
128 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
129 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
130 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
131 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
132 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
133 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
134 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
135 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
136 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
137 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
138 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
139 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
140 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
141 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
142 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
143 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
144 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
145 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
146 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
147 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
148 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
149 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
150 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
151 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
152 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
153 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
154 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
155 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
156 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
157 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
158 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
159 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
160 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
161 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
162 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
163 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
164 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
165 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
166 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
167 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
168 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
169 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
170 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
171 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
172 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
173 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
174 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
175 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
176 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
177 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
178 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
179 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
180 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
181 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
182 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
183 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
184 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
185 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
186 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
187 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
188 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
189 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
190 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
191 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
192 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
193 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
194 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
195 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
196 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
197 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
198 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
199 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
200 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
201 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
202 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
203 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
204 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
205 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
206 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
207 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
208 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
209 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
210 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
211 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
212 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
213 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
214 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
215 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
216 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
217 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
218 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
219 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
220 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
221 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
222 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
223 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
224 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
225 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
226 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
227 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
228 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
229 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
230 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
231 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
232 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
233 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
234 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
235 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
236 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
237 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
238 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
239 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
240 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
241 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
242 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
245 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
246 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
247 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
248 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
249 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
250 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
251 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
252 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
253 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
254 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
255 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
256 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
257 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
258 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
259 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
260 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
261 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
262 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
263 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
270 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
272 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
273 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
277 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
278 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
281 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
283 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
286 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
353 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
357 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
361 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
362 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
363 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
364 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
365 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
366 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
367 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
368 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
369 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
370 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
371 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
372 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
373 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
374 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
375 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
376 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
377 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
378 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
379 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
380 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
381 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
382 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
383 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
384 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
385 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
386 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
387 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
388 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
389 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
390 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
391 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
392 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
393 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
394 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
395 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
396 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
397 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
398 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
399 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
400 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
401 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
402 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
403 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
404 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
405 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
406 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
407 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
408 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
409 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
410 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
411 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
412 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
413 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
414 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
415 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
416 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
417 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
418 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
419 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
420 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
421 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
422 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
423 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
424 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
425 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
426 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
427 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
428 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
429 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
430 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
431 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
432 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
433 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
434 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
435 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
436 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
437 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
438 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
439 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
440 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
441 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
442 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
443 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
444 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
445 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
446 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
447 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
448 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
449 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
450 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
451 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
452 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
453 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
454 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
455 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
456 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
457 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
458 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
459 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
460 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
461 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
462 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
463 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
464 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
465 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
466 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
467 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
468 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
469 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
470 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
471 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
472 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
473 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
474 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
475 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
476 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
477 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
478 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
479 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
480 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
481 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
482 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
483 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
484 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
485 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
486 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
487 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
488 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
489 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
490 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
491 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
492 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
493 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
494 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
495 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
496 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
497 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
498 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
499 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
500 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
501 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
502 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
503 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
504 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
505 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
506 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
507 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
508 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
509 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
510 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
511 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
512 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
513 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
514 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
515 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
516 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
517 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
518 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
519 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
520 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
521 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
522 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
523 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
524 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
525 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
526 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
527 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
528 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
529 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
530 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
531 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
532 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
533 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
534 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
535 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
536 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
537 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
538 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
539 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
540 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
541 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
542 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
543 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
544 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
545 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
546 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
547 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
548 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
549 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
550 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
551 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
552 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
556 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
559 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
560 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
563 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
564 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
565 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
566 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
567 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
568 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
569 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
570 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
571 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
572 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
573 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
574 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
575 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
576 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
577 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
578 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
579 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
580 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
583 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
584 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
585 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
586 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
587 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
588 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
589 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
590 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
591 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
592 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
593 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
594 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
595 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
596 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
597 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
598 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
599 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
600 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
601 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
602 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
603 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
604 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
605 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
607 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
608 639633007 Azoarcus olearius BH72 Isolate Unclassified
609 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
610 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
611 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
612 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.45
Metatranscriptomes 0.07
Isolates 7.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.98
Nodule 0.53
Rhizoplane 4.4
Rhizosphere 75.57
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000797 3300001991 Bacteria 3963
2 JGI24745J21846_1009742 3300002073 Bacteria 1091
3 JGI24742J22300_10009999 3300002244 Bacteria 1567
4 JGI25152J39213_1004123 3300002773 Bacteria 4692
5 JGI25159J45721_1007113 3300002987 Bacteria 3252
6 JGI25151J46595_10000545 3300003187 Bacteria 34695
7 JGI25151J46595_10003021 3300003187 Bacteria 9562
8 JGI25406J46586_10000250 3300003203 Bacteria 23917
9 JGI25406J46586_10004727 3300003203 Bacteria 6337
10 JGI25406J46586_10007846 3300003203 Bacteria 4856
11 JGI25153J46596_10000540 3300003215 Bacteria 23618
12 JGI25153J46596_10002993 3300003215 Bacteria 9562
13 JGI25160J50197_1020348 3300003354 Bacteria 2005
14 Ga0055538_1000010 3300003751 Bacteria 376599
15 Ga0055539_1000015 3300003752 Bacteria 376599
16 Ga0055533_1000018 3300003756 Bacteria 376599
17 Ga0055525_1000020 3300003759 Bacteria 376599
18 Ga0055526_1000336 3300003771 Bacteria 38625
19 Ga0055526_1004371 3300003771 Bacteria 8524
20 Ga0055526_1005207 3300003771 Bacteria 7552
21 Ga0055537_1000060 3300003773 Bacteria 79376
22 Ga0055537_1001197 3300003773 Bacteria 11019
23 Ga0055524_1000157 3300003775 Bacteria 79002
24 Ga0055524_1001147 3300003775 Bacteria 15953
25 Ga0055524_1001729 3300003775 Bacteria 12127
26 Ga0055524_1005063 3300003775 Bacteria 5960
27 Ga0055536_1003357 3300003781 Bacteria 8644
28 Ga0055536_1004808 3300003781 Bacteria 6764
29 Ga0055534_1000009 3300003784 Bacteria 210256
30 Ga0055534_1000341 3300003784 Bacteria 30179
31 Ga0055534_1000777 3300003784 Bacteria 14972
32 Ga0055534_1000858 3300003784 Bacteria 13928
33 Ga0055534_1001653 3300003784 Bacteria 8599
34 Ga0055528_1000012 3300003790 Bacteria 182704
35 Ga0055530_10000311 3300003791 Bacteria 44214
36 Ga0055530_10003376 3300003791 Bacteria 9129
37 Ga0055540_1000016 3300003792 Bacteria 232942
38 Ga0055540_1001497 3300003792 Bacteria 13893
39 Ga0055540_1001826 3300003792 Bacteria 12052
40 Ga0055540_1005932 3300003792 Bacteria 4975
41 Ga0055540_1025950 3300003792 Bacteria 1425
42 Ga0055531_10000103 3300003794 Bacteria 92298
43 Ga0055531_10001224 3300003794 Bacteria 19583
44 Ga0055531_10001302 3300003794 Bacteria 18802
45 Ga0055531_10001335 3300003794 Bacteria 18427
46 Ga0055531_10002563 3300003794 Bacteria 12070
47 Ga0055541_1000011 3300003841 Bacteria 376599
48 Ga0065165_1000834 3300005262 Bacteria 40482
49 Ga0065165_1002832 3300005262 Bacteria 13534
50 Ga0065714_10092228 3300005288 Bacteria 1878
51 Ga0065712_10080409 3300005290 Bacteria 3108
52 Ga0065712_10106004 3300005290 Bacteria 1927
53 Ga0065715_10118502 3300005293 Bacteria 2310
54 Ga0065707_10084750 3300005295 Bacteria 6818
55 Ga0070658_10000534 3300005327 Bacteria 33047
56 Ga0070658_10229495 3300005327 Bacteria 1571
57 Ga0070676_10002014 3300005328 Bacteria 10326
58 Ga0070676_10012319 3300005328 Bacteria 4663
59 Ga0070676_10026321 3300005328 Bacteria 3293
60 Ga0070683_100024091 3300005329 Bacteria 5447
61 Ga0070683_100024988 3300005329 Bacteria 5358
62 Ga0070683_100049447 3300005329 Bacteria 3889
63 Ga0070683_100065312 3300005329 Bacteria 3388
64 Ga0070683_100246277 3300005329 Bacteria 1700
65 Ga0070690_100007036 3300005330 Bacteria 6415
66 Ga0070690_100009057 3300005330 Bacteria 5755
67 Ga0070690_100016117 3300005330 Bacteria 4471
68 Ga0070690_100029571 3300005330 Bacteria 3399
69 Ga0070690_100069749 3300005330 Bacteria 2281
70 Ga0070670_100000863 3300005331 Bacteria 23798
71 Ga0070670_100001673 3300005331 Bacteria 17995
72 Ga0070670_100017556 3300005331 Bacteria 6140
73 Ga0070670_100018340 3300005331 Bacteria 6004
74 Ga0070670_100070670 3300005331 Bacteria 2997
75 Ga0070677_10002127 3300005333 Bacteria 6322
76 Ga0068869_100004158 3300005334 Bacteria 8979
77 Ga0068869_100038646 3300005334 Bacteria 3404
78 Ga0068869_100053280 3300005334 Bacteria 2940
79 Ga0068869_100099685 3300005334 Bacteria 2196
80 Ga0068869_100168305 3300005334 Bacteria 1710
81 Ga0070666_10001432 3300005335 Bacteria 14445
82 Ga0070666_10006463 3300005335 Bacteria 7206
83 Ga0070666_10204678 3300005335 Bacteria 1389
84 Ga0070680_100011410 3300005336 Bacteria 6872
85 Ga0070682_100000252 3300005337 Bacteria 38842
86 Ga0068868_100007971 3300005338 Bacteria 7568
87 Ga0068868_100012306 3300005338 Bacteria 6251
88 Ga0068868_100018460 3300005338 Bacteria 5215
89 Ga0068868_100045303 3300005338 Bacteria 3441
90 Ga0068868_100140159 3300005338 Bacteria 1984
91 Ga0068868_100172909 3300005338 Bacteria 1789
92 Ga0068868_100206984 3300005338 Bacteria 1638
93 Ga0068868_100237010 3300005338 Bacteria 1532
94 Ga0070660_100004251 3300005339 Bacteria 9883
95 Ga0070660_100148018 3300005339 Bacteria 1887
96 Ga0070660_100236251 3300005339 Bacteria 1488
97 Ga0070689_100002998 3300005340 Bacteria 11106
98 Ga0070689_100008431 3300005340 Bacteria 7259
99 Ga0070689_100010538 3300005340 Bacteria 6588
100 Ga0070689_100019686 3300005340 Bacteria 4993
101 Ga0070689_100027445 3300005340 Bacteria 4292
102 Ga0070689_100405937 3300005340 Bacteria 1152
103 Ga0070687_100100407 3300005343 Bacteria 1619
104 Ga0070687_100126658 3300005343 Bacteria 1469
105 Ga0070661_100035765 3300005344 Bacteria 3609
106 Ga0070661_100064928 3300005344 Bacteria 2682
107 Ga0070661_100091323 3300005344 Bacteria 2255
108 Ga0070661_100181651 3300005344 Bacteria 1601
109 Ga0070692_10017952 3300005345 Bacteria 3392
110 Ga0070692_10034767 3300005345 Bacteria 2548
111 Ga0070692_10071600 3300005345 Bacteria 1848
112 Ga0070668_100005618 3300005347 Bacteria 9297
113 Ga0070668_100085408 3300005347 Bacteria 2480
114 Ga0070669_100003725 3300005353 Bacteria 11006
115 Ga0070669_100049967 3300005353 Bacteria 3054
116 Ga0070669_100111702 3300005353 Bacteria 2075
117 Ga0070669_100192789 3300005353 Bacteria 1599
118 Ga0070675_100000605 3300005354 Bacteria 24695
119 Ga0070675_100011272 3300005354 Bacteria 6998
120 Ga0070675_100041359 3300005354 Bacteria 3765
121 Ga0070675_100049771 3300005354 Bacteria 3440
122 Ga0070675_100060864 3300005354 Bacteria 3117
123 Ga0070675_100091225 3300005354 Bacteria 2552
124 Ga0070675_100098724 3300005354 Bacteria 2457
125 Ga0070675_100250598 3300005354 Bacteria 1550
126 Ga0070671_100010636 3300005355 Bacteria 7384
127 Ga0070671_100033086 3300005355 Bacteria 4274
128 Ga0070671_100043588 3300005355 Bacteria 3728
129 Ga0070671_100064323 3300005355 Bacteria 3055
130 Ga0070671_100216519 3300005355 Bacteria 1625
131 Ga0070671_100223975 3300005355 Bacteria 1596
132 Ga0070674_100005518 3300005356 Bacteria 7313
133 Ga0070674_100008774 3300005356 Bacteria 6032
134 Ga0070674_100011027 3300005356 Bacteria 5483
135 Ga0070674_100012896 3300005356 Bacteria 5147
136 Ga0070674_100088011 3300005356 Bacteria 2234
137 Ga0070673_100000416 3300005364 Bacteria 22479
138 Ga0070673_100004008 3300005364 Bacteria 9269
139 Ga0070673_100027949 3300005364 Bacteria 4189
140 Ga0070673_100031352 3300005364 Bacteria 3988
141 Ga0070673_100037138 3300005364 Bacteria 3709
142 Ga0070673_100048421 3300005364 Bacteria 3314
143 Ga0070673_100086512 3300005364 Bacteria 2554
144 Ga0070673_100106692 3300005364 Bacteria 2316
145 Ga0070673_100130251 3300005364 Bacteria 2109
146 Ga0070688_100004155 3300005365 Bacteria 7512
147 Ga0070688_100004763 3300005365 Bacteria 7090
148 Ga0070659_100007556 3300005366 Bacteria 7899
149 Ga0070659_100261485 3300005366 Bacteria 1436
150 Ga0070667_100004143 3300005367 Bacteria 12254
151 Ga0070667_100006265 3300005367 Bacteria 9890
152 Ga0070667_100017248 3300005367 Bacteria 5981
153 Ga0070667_100038773 3300005367 Bacteria 3995
154 Ga0070667_100039343 3300005367 Bacteria 3963
155 Ga0070667_100062521 3300005367 Bacteria 3154
156 Ga0070667_100067596 3300005367 Bacteria 3038
157 Ga0070667_100291399 3300005367 Bacteria 1468
158 Ga0070709_10000424 3300005434 Bacteria 25604
159 Ga0070709_10003057 3300005434 Bacteria 8983
160 Ga0070714_100003678 3300005435 Bacteria 11483
161 Ga0070714_100005399 3300005435 Bacteria 9753
162 Ga0070714_100058748 3300005435 Bacteria 3296
163 Ga0070713_100000019 3300005436 Bacteria 110100
164 Ga0070713_100015895 3300005436 Bacteria 5643
165 Ga0070713_100048177 3300005436 Bacteria 3507
166 Ga0070713_100062064 3300005436 Bacteria 3129
167 Ga0070713_100519499 3300005436 Bacteria 1125
168 Ga0070710_10001915 3300005437 Bacteria 9853
169 Ga0070710_10055704 3300005437 Bacteria 2235
170 Ga0070710_10087640 3300005437 Bacteria 1830
171 Ga0070701_10004081 3300005438 Bacteria 5860
172 Ga0070701_10009235 3300005438 Bacteria 4311
173 Ga0070711_100001539 3300005439 Bacteria 12700
174 Ga0070711_100002750 3300005439 Bacteria 10085
175 Ga0070711_100120904 3300005439 Bacteria 1937
176 Ga0070711_100256708 3300005439 Bacteria 1373
177 Ga0070711_100256866 3300005439 Bacteria 1373
178 Ga0070700_100004241 3300005441 Bacteria 7486
179 Ga0070700_100122036 3300005441 Bacteria 1747
180 Ga0070708_100000889 3300005445 Bacteria 22619
181 Ga0070663_100008820 3300005455 Bacteria 6222
182 Ga0070663_100052002 3300005455 Bacteria 2920
183 Ga0070663_100137140 3300005455 Bacteria 1864
184 Ga0070663_100148612 3300005455 Bacteria 1795
185 Ga0070678_100002173 3300005456 Bacteria 10652
186 Ga0070678_100007462 3300005456 Bacteria 6493
187 Ga0070678_100104983 3300005456 Bacteria 2198
188 Ga0070678_100106303 3300005456 Bacteria 2187
189 Ga0070678_100109558 3300005456 Bacteria 2158
190 Ga0070678_100153245 3300005456 Bacteria 1859
191 Ga0070662_100000546 3300005457 Bacteria 22896
192 Ga0070662_100016857 3300005457 Bacteria 4911
193 Ga0070662_100109421 3300005457 Bacteria 2103
194 Ga0070681_10002422 3300005458 Bacteria 17060
195 Ga0070681_10007525 3300005458 Bacteria 10643
196 Ga0070681_10156558 3300005458 Bacteria 2203
197 Ga0068867_100000041 3300005459 Bacteria 78472
198 Ga0068867_100001563 3300005459 Bacteria 15894
199 Ga0068867_100001878 3300005459 Bacteria 14605
200 Ga0068867_100005891 3300005459 Bacteria 8697
201 Ga0068867_100007968 3300005459 Bacteria 7484
202 Ga0068867_100044748 3300005459 Bacteria 3244
203 Ga0068867_100129629 3300005459 Bacteria 1958
204 Ga0068867_100158557 3300005459 Bacteria 1783
205 Ga0068867_100212036 3300005459 Bacteria 1556
206 Ga0070685_10013969 3300005466 Bacteria 4248
207 Ga0070685_10016951 3300005466 Bacteria 3890
208 Ga0070685_10024895 3300005466 Bacteria 3292
209 Ga0070685_10084117 3300005466 Bacteria 1913
210 Ga0070706_100003229 3300005467 Bacteria 16104
211 Ga0070706_100270019 3300005467 Bacteria 1587
212 Ga0070707_100023650 3300005468 Bacteria 5812
213 Ga0070707_100243072 3300005468 Bacteria 1752
214 Ga0070698_100081425 3300005471 Bacteria 3232
215 Ga0070698_100269772 3300005471 Bacteria 1633
216 Ga0070699_100200393 3300005518 Bacteria 1775
217 Ga0070679_100000180 3300005530 Bacteria 50879
218 Ga0070679_100079119 3300005530 Bacteria 3277
219 Ga0070679_100217475 3300005530 Bacteria 1873
220 Ga0070679_100220439 3300005530 Bacteria 1858
221 Ga0070684_100000578 3300005535 Bacteria 25373
222 Ga0070684_100004669 3300005535 Bacteria 10461
223 Ga0070684_100020163 3300005535 Bacteria 5531
224 Ga0070684_100077838 3300005535 Bacteria 2929
225 Ga0070697_100025578 3300005536 Bacteria 4708
226 Ga0070697_100235223 3300005536 Bacteria 1563
227 Ga0068853_100005895 3300005539 Bacteria 9666
228 Ga0068853_100021596 3300005539 Bacteria 5370
229 Ga0068853_100034801 3300005539 Bacteria 4277
230 Ga0068853_100061464 3300005539 Bacteria 3249
231 Ga0068853_100104878 3300005539 Bacteria 2503
232 Ga0068853_100108685 3300005539 Bacteria 2461
233 Ga0068853_100123705 3300005539 Bacteria 2310
234 Ga0068853_100145864 3300005539 Bacteria 2127
235 Ga0070672_100000414 3300005543 Bacteria 24728
236 Ga0070672_100008479 3300005543 Bacteria 7034
237 Ga0070672_100008902 3300005543 Bacteria 6896
238 Ga0070672_100011272 3300005543 Bacteria 6234
239 Ga0070672_100014528 3300005543 Bacteria 5582
240 Ga0070672_100045698 3300005543 Bacteria 3389
241 Ga0070672_100071345 3300005543 Bacteria 2763
242 Ga0070672_100109350 3300005543 Bacteria 2251
243 Ga0070672_100148133 3300005543 Bacteria 1940
244 Ga0070672_100255976 3300005543 Bacteria 1475
245 Ga0070672_100262709 3300005543 Bacteria 1456
246 Ga0070672_100451935 3300005543 Bacteria 1107
247 Ga0070686_100009212 3300005544 Bacteria 5541
248 Ga0070686_100017437 3300005544 Bacteria 4196
249 Ga0070693_100070874 3300005547 Bacteria 2052
250 Ga0070665_100002566 3300005548 Bacteria 19913
251 Ga0070665_100010851 3300005548 Bacteria 9213
252 Ga0070665_100017168 3300005548 Bacteria 7262
253 Ga0070665_100080934 3300005548 Bacteria 3253
254 Ga0070665_100093316 3300005548 Bacteria 3015
255 Ga0070665_100094448 3300005548 Bacteria 2995
256 Ga0070665_100174660 3300005548 Bacteria 2149
257 Ga0070665_100218435 3300005548 Bacteria 1907
258 Ga0070704_100050726 3300005549 Bacteria 2918
259 Ga0070704_100085978 3300005549 Bacteria 2329
260 Ga0068855_100001533 3300005563 Bacteria 29006
261 Ga0068855_100008719 3300005563 Bacteria 12260
262 Ga0068855_100016734 3300005563 Bacteria 8819
263 Ga0068855_100051277 3300005563 Bacteria 4860
264 Ga0068855_100132479 3300005563 Bacteria 2846
265 Ga0068855_100332842 3300005563 Bacteria 1676
266 Ga0068855_100462796 3300005563 Bacteria 1383
267 Ga0070664_100001978 3300005564 Bacteria 16414
268 Ga0070664_100021313 3300005564 Bacteria 5340
269 Ga0070664_100057585 3300005564 Bacteria 3303
270 Ga0070664_100111346 3300005564 Bacteria 2390
271 Ga0070664_100343365 3300005564 Bacteria 1357
272 Ga0070664_100440653 3300005564 Bacteria 1195
273 Ga0068857_100005085 3300005577 Bacteria 11181
274 Ga0068857_100012412 3300005577 Bacteria 7417
275 Ga0068857_100020815 3300005577 Bacteria 5770
276 Ga0068857_100029733 3300005577 Bacteria 4821
277 Ga0068857_100233400 3300005577 Bacteria 1683
278 Ga0068854_100036656 3300005578 Bacteria 3439
279 Ga0068854_100051600 3300005578 Bacteria 2947
280 Ga0068856_100000409 3300005614 Bacteria 47269
281 Ga0068856_100000762 3300005614 Bacteria 34958
282 Ga0068856_100026700 3300005614 Bacteria 5631
283 Ga0068856_100093824 3300005614 Bacteria 2987
284 Ga0068856_100150706 3300005614 Bacteria 2335
285 Ga0068856_100501402 3300005614 Bacteria 1235
286 Ga0070702_100058566 3300005615 Bacteria 2232
287 Ga0068852_100003141 3300005616 Bacteria 11513
288 Ga0068852_100069880 3300005616 Bacteria 3079
289 Ga0068852_100070212 3300005616 Bacteria 3072
290 Ga0068852_100169402 3300005616 Bacteria 2046
291 Ga0068859_100001521 3300005617 Bacteria 23669
292 Ga0068859_100005041 3300005617 Bacteria 13404
293 Ga0068859_100023535 3300005617 Bacteria 6181
294 Ga0068859_100027160 3300005617 Bacteria 5743
295 Ga0068859_100033265 3300005617 Bacteria 5178
296 Ga0068859_100126907 3300005617 Bacteria 2621
297 Ga0068859_100128172 3300005617 Bacteria 2608
298 Ga0068864_100000365 3300005618 Bacteria 39562
299 Ga0068864_100005574 3300005618 Bacteria 10321
300 Ga0068864_100033367 3300005618 Bacteria 4376
301 Ga0068864_100034309 3300005618 Bacteria 4315
302 Ga0068866_10018183 3300005718 Bacteria 3174
303 Ga0068866_10160338 3300005718 Bacteria 1311
304 Ga0068861_100000654 3300005719 Bacteria 20566
305 Ga0068861_100004095 3300005719 Bacteria 9773
306 Ga0068861_100072427 3300005719 Bacteria 2673
307 Ga0068861_100109272 3300005719 Bacteria 2213
308 Ga0068861_100180278 3300005719 Bacteria 1758
309 Ga0068851_10001795 3300005834 Bacteria 9394
310 Ga0068851_10017743 3300005834 Bacteria 3423
311 Ga0068870_10009255 3300005840 Bacteria 4473
312 Ga0068863_100011694 3300005841 Bacteria 8487
313 Ga0068863_100014739 3300005841 Bacteria 7521
314 Ga0068863_100027447 3300005841 Bacteria 5430
315 Ga0068863_100037388 3300005841 Bacteria 4622
316 Ga0068863_100047519 3300005841 Bacteria 4070
317 Ga0068863_100206010 3300005841 Bacteria 1893
318 Ga0068858_100000738 3300005842 Bacteria 34250
319 Ga0068858_100016017 3300005842 Bacteria 7041
320 Ga0068858_100038510 3300005842 Bacteria 4435
321 Ga0068858_100038617 3300005842 Bacteria 4429
322 Ga0068858_100042577 3300005842 Bacteria 4210
323 Ga0068858_100110531 3300005842 Bacteria 2566
324 Ga0068858_100135674 3300005842 Bacteria 2309
325 Ga0068858_100212532 3300005842 Bacteria 1831
326 Ga0068858_100269925 3300005842 Bacteria 1619
327 Ga0068860_100000101 3300005843 Bacteria 142856
328 Ga0068860_100000602 3300005843 Bacteria 42928
329 Ga0068860_100018313 3300005843 Bacteria 6814
330 Ga0068860_100071506 3300005843 Bacteria 3297
331 Ga0068860_100105526 3300005843 Bacteria 2691
332 Ga0068860_100169807 3300005843 Bacteria 2106
333 Ga0068860_100275266 3300005843 Bacteria 1644
334 Ga0068862_100004504 3300005844 Bacteria 11751
335 Ga0068862_100021693 3300005844 Bacteria 5371
336 Ga0068862_100028032 3300005844 Bacteria 4743
337 Ga0068862_100032137 3300005844 Bacteria 4434
338 Ga0068862_100057123 3300005844 Bacteria 3345
339 Ga0068862_100110564 3300005844 Bacteria 2411
340 Ga0081455_10008730 3300005937 Bacteria 10495
341 Ga0081455_10027965 3300005937 Bacteria 5158
342 Ga0081540_1003649 3300005983 Bacteria 12076
343 Ga0081540_1008233 3300005983 Bacteria 7307
344 Ga0081539_10000220 3300005985 Bacteria 133834
345 Ga0081539_10001407 3300005985 Bacteria 41418
346 Ga0081539_10006668 3300005985 Bacteria 10929
347 Ga0081539_10045408 3300005985 Bacteria 2527
348 Ga0070717_10090988 3300006028 Bacteria 2575
349 Ga0075368_10039532 3300006042 Bacteria 1849
350 Ga0070715_10034825 3300006163 Bacteria 2067
351 Ga0070716_100008627 3300006173 Bacteria 5065
352 Ga0070716_100039217 3300006173 Bacteria 2628
353 Ga0070712_100012323 3300006175 Bacteria 5433
354 Ga0070712_100044445 3300006175 Bacteria 3063
355 Ga0075362_10016232 3300006177 Bacteria 3046
356 Ga0075367_10020407 3300006178 Bacteria 3689
357 Ga0075369_10034115 3300006186 Bacteria 2159
358 Ga0075366_10002354 3300006195 Bacteria 9680
359 Ga0075366_10020394 3300006195 Bacteria 3846
360 Ga0075366_10045457 3300006195 Bacteria 2602
361 Ga0075366_10056364 3300006195 Bacteria 2334
362 Ga0075366_10060174 3300006195 Bacteria 2256
363 Ga0075366_10071982 3300006195 Bacteria 2060
364 Ga0075366_10079395 3300006195 Bacteria 1959
365 Ga0075366_10085256 3300006195 Bacteria 1889
366 Ga0097621_100001636 3300006237 Bacteria 15349
367 Ga0097621_100022241 3300006237 Bacteria 4920
368 Ga0097621_100025888 3300006237 Bacteria 4595
369 Ga0097621_100039233 3300006237 Bacteria 3803
370 Ga0097621_100083635 3300006237 Bacteria 2660
371 Ga0097621_100221579 3300006237 Bacteria 1648
372 Ga0097621_100276649 3300006237 Bacteria 1477
373 Ga0097621_100290580 3300006237 Bacteria 1441
374 Ga0075370_10003026 3300006353 Bacteria 7925
375 Ga0075370_10022952 3300006353 Bacteria 3432
376 Ga0075370_10041483 3300006353 Bacteria 2598
377 Ga0068871_100019604 3300006358 Bacteria 5167
378 Ga0068871_100047818 3300006358 Bacteria 3451
379 Ga0068871_100051822 3300006358 Bacteria 3323
380 Ga0068871_100061257 3300006358 Bacteria 3072
381 Ga0068871_100067090 3300006358 Bacteria 2942
382 Ga0068871_100161611 3300006358 Bacteria 1916
383 Ga0075428_100195429 3300006844 Bacteria 2188
384 Ga0075430_100017933 3300006846 Bacteria 6024
385 Ga0075431_100422198 3300006847 Bacteria 1333
386 Ga0075434_100014097 3300006871 Bacteria 7633
387 Ga0075434_100183202 3300006871 Bacteria 2115
388 Ga0075434_100422475 3300006871 Bacteria 1354
389 Ga0068865_100002296 3300006881 Bacteria 11265
390 Ga0068865_100118490 3300006881 Bacteria 1964
391 Ga0068865_100130634 3300006881 Bacteria 1881
392 Ga0097620_100001521 3300006931 Bacteria 23669
393 Ga0097620_100005041 3300006931 Bacteria 13404
394 Ga0097620_100023534 3300006931 Bacteria 6181
395 Ga0097620_100027159 3300006931 Bacteria 5743
396 Ga0097620_100033265 3300006931 Bacteria 5178
397 Ga0097620_100126910 3300006931 Bacteria 2621
398 Ga0097620_100128181 3300006931 Bacteria 2608
399 Ga0079104_1000724 3300006946 Bacteria 29488
400 Ga0105250_10014017 3300009092 Bacteria 3300
401 Ga0105250_10024702 3300009092 Bacteria 2420
402 Ga0105240_10000369 3300009093 Bacteria 84513
403 Ga0105240_10001549 3300009093 Bacteria 39012
404 Ga0105240_10003856 3300009093 Bacteria 23162
405 Ga0105240_10017113 3300009093 Bacteria 9788
406 Ga0105240_10028585 3300009093 Bacteria 7279
407 Ga0105240_10205200 3300009093 Bacteria 2307
408 Ga0105240_10274468 3300009093 Bacteria 1940
409 Ga0105245_10000304 3300009098 Bacteria 47231
410 Ga0105245_10007246 3300009098 Bacteria 9713
411 Ga0105247_10012839 3300009101 Bacteria 5027
412 Ga0105247_10014160 3300009101 Bacteria 4784
413 Ga0105247_10136194 3300009101 Bacteria 1605
414 Ga0114129_10008622 3300009147 Bacteria 14537
415 Ga0114129_10693764 3300009147 Bacteria 1309
416 Ga0105243_10001818 3300009148 Bacteria 18256
417 Ga0105243_10004635 3300009148 Bacteria 10832
418 Ga0105243_10015365 3300009148 Bacteria 5791
419 Ga0105241_10213251 3300009174 Bacteria 1619
420 Ga0105241_10273242 3300009174 Bacteria 1441
421 Ga0105242_10014388 3300009176 Bacteria 6130
422 Ga0105248_10003092 3300009177 Bacteria 18448
423 Ga0105248_10016194 3300009177 Bacteria 8205
424 Ga0105248_10020577 3300009177 Bacteria 7312
425 Ga0105248_10126259 3300009177 Bacteria 2886
426 Ga0105248_10217614 3300009177 Bacteria 2151
427 Ga0105237_10000102 3300009545 Bacteria 118684
428 Ga0105237_10003670 3300009545 Bacteria 18091
429 Ga0105237_10003738 3300009545 Bacteria 17928
430 Ga0105237_10006549 3300009545 Bacteria 12884
431 Ga0105237_10082720 3300009545 Bacteria 3201
432 Ga0105237_10122526 3300009545 Bacteria 2594
433 Ga0105238_10004877 3300009551 Bacteria 13269
434 Ga0105238_10005947 3300009551 Bacteria 12095
435 Ga0105238_10008650 3300009551 Bacteria 10187
436 Ga0105238_10017238 3300009551 Bacteria 7338
437 Ga0105238_10071110 3300009551 Bacteria 3476
438 Ga0105238_10209044 3300009551 Bacteria 1927
439 Ga0105238_10224467 3300009551 Bacteria 1855
440 Ga0105249_10079548 3300009553 Bacteria 3043
441 Ga0105249_10340160 3300009553 Bacteria 1517
442 Ga0105249_10508969 3300009553 Bacteria 1250
443 Ga0105239_10004222 3300010375 Bacteria 17259
444 Ga0105239_10005317 3300010375 Bacteria 15112
445 Ga0105239_10023690 3300010375 Bacteria 6758
446 Ga0105239_10060721 3300010375 Bacteria 4149
447 Ga0105239_10072813 3300010375 Bacteria 3778
448 Ga0105239_10233481 3300010375 Bacteria 2064
449 Ga0105239_10243732 3300010375 Bacteria 2018
450 Ga0105239_10345655 3300010375 Bacteria 1679
451 Ga0105246_10128394 3300011119 Bacteria 1890
452 Ga0105246_10149026 3300011119 Bacteria 1769
453 Ga0157319_1000005 3300012497 Bacteria 372810
454 Ga0157373_10038570 3300013100 Bacteria 3424
455 Ga0157373_10046395 3300013100 Bacteria 3100
456 Ga0157371_10000013 3300013102 Bacteria 352631
457 Ga0157371_10001396 3300013102 Bacteria 25235
458 Ga0157370_10003812 3300013104 Bacteria 17590
459 Ga0157370_10077047 3300013104 Bacteria 3141
460 Ga0157370_10077682 3300013104 Bacteria 3127
461 Ga0157370_10102792 3300013104 Bacteria 2675
462 Ga0157370_10133981 3300013104 Bacteria 2310
463 Ga0157370_10205156 3300013104 Bacteria 1828
464 Ga0157369_10015817 3300013105 Bacteria 8498
465 Ga0157369_10062589 3300013105 Bacteria 4009
466 Ga0157369_10120918 3300013105 Bacteria 2779
467 Ga0157374_10030166 3300013296 Bacteria 4920
468 Ga0157374_10037518 3300013296 Bacteria 4448
469 Ga0157374_10214331 3300013296 Bacteria 1889
470 Ga0157374_10281971 3300013296 Bacteria 1641
471 Ga0157374_10370200 3300013296 Bacteria 1426
472 Ga0157374_10456079 3300013296 Bacteria 1280
473 Ga0157378_10001074 3300013297 Bacteria 24973
474 Ga0157378_10005793 3300013297 Bacteria 10829
475 Ga0157378_10039983 3300013297 Bacteria 4160
476 Ga0157378_10232360 3300013297 Bacteria 1758
477 Ga0163162_10000673 3300013306 Bacteria 31751
478 Ga0163162_10027327 3300013306 Bacteria 5642
479 Ga0163162_10028459 3300013306 Bacteria 5530
480 Ga0163162_10166561 3300013306 Bacteria 2328
481 Ga0163162_10403665 3300013306 Bacteria 1499
482 Ga0157372_10002169 3300013307 Bacteria 21364
483 Ga0157372_10003163 3300013307 Bacteria 17748
484 Ga0157372_10065457 3300013307 Bacteria 4081
485 Ga0157372_10073975 3300013307 Bacteria 3841
486 Ga0157372_10110633 3300013307 Bacteria 3147
487 Ga0157372_10195141 3300013307 Bacteria 2345
488 Ga0157372_10238262 3300013307 Bacteria 2111
489 Ga0157372_10299267 3300013307 Bacteria 1871
490 Ga0157372_10604190 3300013307 Bacteria 1278
491 Ga0157375_10000903 3300013308 Bacteria 25828
492 Ga0157375_10025478 3300013308 Bacteria 5497
493 Ga0157375_10034886 3300013308 Bacteria 4796
494 Ga0157375_10058213 3300013308 Bacteria 3823
495 Ga0157375_10064446 3300013308 Bacteria 3648
496 Ga0157375_10109092 3300013308 Bacteria 2864
497 Ga0157375_10136678 3300013308 Bacteria 2576
498 Ga0157375_10247396 3300013308 Bacteria 1943
499 Ga0163163_10021170 3300014325 Bacteria 6133
500 Ga0163163_10112854 3300014325 Bacteria 2747
501 Ga0163163_10194059 3300014325 Bacteria 2078
502 Ga0163163_10230312 3300014325 Bacteria 1902
503 Ga0157380_10028852 3300014326 Bacteria 4236
504 Ga0157380_10184998 3300014326 Bacteria 1834
505 Ga0157380_10188195 3300014326 Bacteria 1820
506 Ga0157377_10000020 3300014745 Bacteria 151620
507 Ga0157377_10001422 3300014745 Bacteria 10332
508 Ga0157377_10169970 3300014745 Bacteria 1363
509 Ga0157379_10001219 3300014968 Bacteria 20902
510 Ga0157379_10010297 3300014968 Bacteria 8141
511 Ga0157379_10020285 3300014968 Bacteria 5876
512 Ga0157379_10029133 3300014968 Bacteria 4911
513 Ga0157379_10066515 3300014968 Bacteria 3222
514 Ga0157379_10314292 3300014968 Bacteria 1429
515 Ga0157379_10355302 3300014968 Bacteria 1342
516 Ga0157376_10015296 3300014969 Bacteria 5792
517 Ga0157376_10016372 3300014969 Bacteria 5628
518 Ga0157376_10027198 3300014969 Bacteria 4531
519 Ga0157376_10047085 3300014969 Bacteria 3559
520 Ga0182006_1000802 3300015261 Bacteria 21095
521 Ga0182007_10005892 3300015262 Bacteria 5323
522 Ga0182005_1004230 3300015265 Bacteria 4684
523 Ga0183362_10002 3300015683 Bacteria 1432711
524 Ga0183361_10005 3300016635 Bacteria 413599
525 Ga0163161_10029083 3300017792 Bacteria 3927
526 Ga0163161_10070546 3300017792 Bacteria 2554
527 Ga0163161_10088500 3300017792 Bacteria 2289
528 Ga0213872_10000547 3300021361 Bacteria 29250
529 Ga0213872_10007605 3300021361 Bacteria 5314
530 Ga0213872_10036381 3300021361 Bacteria 2250
531 Ga0213876_10001330 3300021384 Bacteria 15523
532 Ga0213876_10003361 3300021384 Bacteria 9159
533 Ga0213876_10003916 3300021384 Bacteria 8411
534 Ga0213875_10007526 3300021388 Bacteria 5615
535 Ga0209784_100025 3300025224 Bacteria 376681
536 Ga0209566_100025 3300025225 Bacteria 376681
537 Ga0209674_100042 3300025226 Bacteria 376681
538 Ga0209672_106442 3300025228 Bacteria 1905
539 Ga0209563_100046 3300025230 Bacteria 376681
540 Ga0209258_102632 3300025242 Bacteria 4459
541 Ga0207425_1001488 3300025245 Bacteria 9731
542 Ga0209677_100027 3300025253 Bacteria 376681
543 Ga0209677_100280 3300025253 Bacteria 34034
544 Ga0209129_1002187 3300025258 Bacteria 9834
545 Ga0209129_1015638 3300025258 Bacteria 1554
546 Ga0209233_1002090 3300025261 Bacteria 7536
547 Ga0209565_1000015 3300025263 Bacteria 494091
548 Ga0209565_1000086 3300025263 Bacteria 152204
549 Ga0209565_1007495 3300025263 Bacteria 2937
550 Ga0209455_1000337 3300025272 Bacteria 44758
551 Ga0209455_1001166 3300025272 Bacteria 12650
552 Ga0209673_1000017 3300025273 Bacteria 492994
553 Ga0209130_1001292 3300025284 Bacteria 17284
554 Ga0209130_1002441 3300025284 Bacteria 9309
555 Ga0207673_1003069 3300025290 Bacteria 1940
556 Ga0209675_1000012 3300025291 Bacteria 494061
557 Ga0209675_1000510 3300025291 Bacteria 28831
558 Ga0209675_1001661 3300025291 Bacteria 12382
559 Ga0209675_1001682 3300025291 Bacteria 12287
560 Ga0209675_1001762 3300025291 Bacteria 11860
561 Ga0209675_1002042 3300025291 Bacteria 10779
562 Ga0209676_1000004 3300025292 Bacteria 1138360
563 Ga0209676_1000026 3300025292 Bacteria 574599
564 Ga0209676_1000172 3300025292 Bacteria 153664
565 Ga0209676_1010011 3300025292 Bacteria 4010
566 Ga0209025_1000059 3300025294 Bacteria 305480
567 Ga0209025_1000380 3300025294 Bacteria 92360
568 Ga0209025_1000550 3300025294 Bacteria 70073
569 Ga0209025_1005956 3300025294 Bacteria 9704
570 Ga0209564_1000016 3300025295 Bacteria 613131
571 Ga0209564_1000021 3300025295 Bacteria 571316
572 Ga0209564_1000814 3300025295 Bacteria 42501
573 Ga0209564_1001766 3300025295 Bacteria 20140
574 Ga0209564_1002095 3300025295 Bacteria 17070
575 Ga0209758_1000122 3300025297 Bacteria 190970
576 Ga0209758_1004631 3300025297 Bacteria 11269
577 Ga0209050_1000002 3300025298 Bacteria 1792849
578 Ga0209050_1000082 3300025298 Bacteria 266864
579 Ga0209050_1000509 3300025298 Bacteria 65792
580 Ga0209050_1004407 3300025298 Bacteria 9528
581 Ga0209050_1005094 3300025298 Bacteria 8472
582 Ga0209050_1019763 3300025298 Bacteria 2542
583 Ga0209256_1000045 3300025299 Bacteria 325506
584 Ga0209256_1000086 3300025299 Bacteria 218837
585 Ga0209256_1000177 3300025299 Bacteria 125603
586 Ga0209256_1000314 3300025299 Bacteria 84164
587 Ga0209256_1003909 3300025299 Bacteria 9850
588 Ga0207426_1000264 3300025302 Bacteria 110747
589 Ga0209051_1000002 3300025303 Bacteria 1631846
590 Ga0209051_1000029 3300025303 Bacteria 403675
591 Ga0209051_1000055 3300025303 Bacteria 277194
592 Ga0209051_1000074 3300025303 Bacteria 208667
593 Ga0209051_1000096 3300025303 Bacteria 167399
594 Ga0209051_1007768 3300025303 Bacteria 5803
595 Ga0209051_1027528 3300025303 Bacteria 2263
596 Ga0209257_1000002 3300025304 Bacteria 1767052
597 Ga0209257_1000030 3300025304 Bacteria 689812
598 Ga0209257_1000072 3300025304 Bacteria 332791
599 Ga0209257_1000101 3300025304 Bacteria 251553
600 Ga0209257_1000131 3300025304 Bacteria 211464
601 Ga0209257_1000347 3300025304 Bacteria 95122
602 Ga0209257_1008032 3300025304 Bacteria 6148
603 Ga0207697_10003899 3300025315 Bacteria 7274
604 Ga0207656_10008913 3300025321 Bacteria 3716
605 Ga0207656_10013605 3300025321 Bacteria 3115
606 Ga0207656_10063702 3300025321 Bacteria 1623
607 Ga0207696_1016362 3300025711 Bacteria 2482
608 Ga0207682_10000076 3300025893 Bacteria 43305
609 Ga0207682_10041995 3300025893 Bacteria 1867
610 Ga0207692_10000738 3300025898 Bacteria 11534
611 Ga0207688_10019333 3300025901 Bacteria 3709
612 Ga0207688_10022933 3300025901 Bacteria 3416
613 Ga0207680_10041485 3300025903 Bacteria 2685
614 Ga0207680_10067513 3300025903 Bacteria 2203
615 Ga0207680_10181731 3300025903 Bacteria 1423
616 Ga0207647_10068431 3300025904 Bacteria 2149
617 Ga0207647_10085467 3300025904 Bacteria 1887
618 Ga0207685_10025834 3300025905 Bacteria 2033
619 Ga0207699_10000465 3300025906 Bacteria 20602
620 Ga0207699_10020690 3300025906 Bacteria 3532
621 Ga0207645_10001421 3300025907 Bacteria 19600
622 Ga0207645_10003433 3300025907 Bacteria 12042
623 Ga0207645_10011482 3300025907 Bacteria 6045
624 Ga0207645_10028308 3300025907 Bacteria 3618
625 Ga0207645_10179074 3300025907 Bacteria 1390
626 Ga0207645_10218132 3300025907 Bacteria 1257
627 Ga0207643_10000904 3300025908 Bacteria 17745
628 Ga0207643_10021409 3300025908 Bacteria 3552
629 Ga0207643_10141620 3300025908 Bacteria 1436
630 Ga0207705_10026384 3300025909 Bacteria 4143
631 Ga0207684_10043697 3300025910 Bacteria 3799
632 Ga0207684_10086433 3300025910 Bacteria 2671
633 Ga0207707_10002364 3300025912 Bacteria 17002
634 Ga0207707_10006120 3300025912 Bacteria 10516
635 Ga0207707_10223708 3300025912 Bacteria 1638
636 Ga0207707_10381337 3300025912 Bacteria 1212
637 Ga0207695_10000923 3300025913 Bacteria 52620
638 Ga0207695_10019147 3300025913 Bacteria 7888
639 Ga0207695_10037106 3300025913 Bacteria 5260
640 Ga0207695_10328926 3300025913 Bacteria 1417
641 Ga0207671_10000201 3300025914 Bacteria 91167
642 Ga0207671_10006455 3300025914 Bacteria 10440
643 Ga0207671_10021491 3300025914 Bacteria 4895
644 Ga0207693_10001447 3300025915 Bacteria 21016
645 Ga0207693_10002285 3300025915 Bacteria 16669
646 Ga0207693_10003980 3300025915 Bacteria 12554
647 Ga0207693_10016361 3300025915 Bacteria 5929
648 Ga0207663_10004872 3300025916 Bacteria 6718
649 Ga0207663_10014014 3300025916 Bacteria 4377
650 Ga0207663_10096804 3300025916 Bacteria 1972
651 Ga0207663_10137224 3300025916 Bacteria 1699
652 Ga0207663_10154064 3300025916 Bacteria 1615
653 Ga0207662_10000340 3300025918 Bacteria 21083
654 Ga0207662_10076027 3300025918 Bacteria 2040
655 Ga0207657_10001161 3300025919 Bacteria 28036
656 Ga0207657_10001611 3300025919 Bacteria 24269
657 Ga0207649_10019565 3300025920 Bacteria 3871
658 Ga0207649_10028161 3300025920 Bacteria 3306
659 Ga0207652_10009390 3300025921 Bacteria 7865
660 Ga0207652_10032624 3300025921 Bacteria 4380
661 Ga0207652_10043028 3300025921 Bacteria 3845
662 Ga0207652_10226530 3300025921 Bacteria 1685
663 Ga0207652_10294907 3300025921 Bacteria 1463
664 Ga0207646_10046772 3300025922 Bacteria 3882
665 Ga0207681_10002291 3300025923 Bacteria 12161
666 Ga0207681_10039259 3300025923 Bacteria 3142
667 Ga0207681_10082670 3300025923 Bacteria 2271
668 Ga0207681_10083909 3300025923 Bacteria 2256
669 Ga0207694_10003707 3300025924 Bacteria 12098
670 Ga0207694_10004641 3300025924 Bacteria 10694
671 Ga0207694_10041991 3300025924 Bacteria 3526
672 Ga0207694_10091014 3300025924 Bacteria 2407
673 Ga0207694_10187123 3300025924 Bacteria 1681
674 Ga0207694_10378800 3300025924 Bacteria 1174
675 Ga0207650_10000326 3300025925 Bacteria 46321
676 Ga0207650_10022991 3300025925 Bacteria 4417
677 Ga0207650_10024020 3300025925 Bacteria 4328
678 Ga0207650_10051006 3300025925 Bacteria 3061
679 Ga0207650_10056708 3300025925 Bacteria 2912
680 Ga0207650_10096005 3300025925 Bacteria 2273
681 Ga0207659_10000299 3300025926 Bacteria 29997
682 Ga0207659_10002670 3300025926 Bacteria 10630
683 Ga0207659_10025069 3300025926 Bacteria 4003
684 Ga0207659_10029291 3300025926 Bacteria 3751
685 Ga0207659_10116489 3300025926 Bacteria 2040
686 Ga0207659_10195984 3300025926 Bacteria 1610
687 Ga0207659_10216757 3300025926 Bacteria 1537
688 Ga0207687_10000963 3300025927 Bacteria 19570
689 Ga0207687_10006397 3300025927 Bacteria 7785
690 Ga0207700_10000035 3300025928 Bacteria 119648
691 Ga0207700_10299117 3300025928 Bacteria 1389
692 Ga0207700_10458174 3300025928 Bacteria 1125
693 Ga0207664_10027742 3300025929 Bacteria 4297
694 Ga0207664_10156051 3300025929 Bacteria 1943
695 Ga0207644_10001354 3300025931 Bacteria 15752
696 Ga0207644_10013170 3300025931 Bacteria 5508
697 Ga0207644_10013287 3300025931 Bacteria 5485
698 Ga0207644_10018325 3300025931 Bacteria 4734
699 Ga0207644_10127407 3300025931 Bacteria 1945
700 Ga0207644_10233436 3300025931 Bacteria 1462
701 Ga0207644_10254365 3300025931 Bacteria 1402
702 Ga0207690_10000957 3300025932 Bacteria 18474
703 Ga0207690_10013743 3300025932 Bacteria 4874
704 Ga0207690_10015013 3300025932 Bacteria 4688
705 Ga0207706_10000267 3300025933 Bacteria 56832
706 Ga0207706_10052609 3300025933 Bacteria 3595
707 Ga0207706_10091118 3300025933 Bacteria 2681
708 Ga0207706_10139430 3300025933 Bacteria 2133
709 Ga0207706_10188407 3300025933 Bacteria 1811
710 Ga0207706_10296846 3300025933 Bacteria 1408
711 Ga0207686_10050543 3300025934 Bacteria 2585
712 Ga0207686_10245493 3300025934 Bacteria 1305
713 Ga0207709_10000172 3300025935 Bacteria 86654
714 Ga0207709_10003347 3300025935 Bacteria 9594
715 Ga0207709_10085856 3300025935 Bacteria 2041
716 Ga0207709_10089506 3300025935 Bacteria 2007
717 Ga0207670_10000064 3300025936 Bacteria 75795
718 Ga0207670_10005667 3300025936 Bacteria 6874
719 Ga0207670_10007685 3300025936 Bacteria 6039
720 Ga0207670_10021513 3300025936 Bacteria 3981
721 Ga0207670_10029379 3300025936 Bacteria 3501
722 Ga0207669_10013588 3300025937 Bacteria 4050
723 Ga0207669_10021010 3300025937 Bacteria 3436
724 Ga0207669_10060872 3300025937 Bacteria 2317
725 Ga0207669_10063459 3300025937 Bacteria 2280
726 Ga0207669_10076252 3300025937 Bacteria 2128
727 Ga0207704_10008488 3300025938 Bacteria 4918
728 Ga0207704_10155721 3300025938 Bacteria 1619
729 Ga0207665_10002891 3300025939 Bacteria 11523
730 Ga0207665_10025629 3300025939 Bacteria 3891
731 Ga0207665_10096410 3300025939 Bacteria 2057
732 Ga0207691_10000049 3300025940 Bacteria 94813
733 Ga0207691_10004263 3300025940 Bacteria 13884
734 Ga0207691_10005602 3300025940 Bacteria 12139
735 Ga0207691_10007985 3300025940 Bacteria 10177
736 Ga0207691_10010067 3300025940 Bacteria 9075
737 Ga0207691_10012884 3300025940 Bacteria 8006
738 Ga0207691_10017331 3300025940 Bacteria 6832
739 Ga0207691_10020338 3300025940 Bacteria 6275
740 Ga0207691_10027190 3300025940 Bacteria 5366
741 Ga0207691_10028712 3300025940 Bacteria 5206
742 Ga0207691_10050504 3300025940 Bacteria 3807
743 Ga0207691_10190681 3300025940 Bacteria 1788
744 Ga0207691_10201265 3300025940 Bacteria 1733
745 Ga0207711_10001803 3300025941 Bacteria 19580
746 Ga0207711_10016290 3300025941 Bacteria 6174
747 Ga0207711_10026718 3300025941 Bacteria 4846
748 Ga0207711_10034266 3300025941 Bacteria 4301
749 Ga0207711_10094747 3300025941 Bacteria 2632
750 Ga0207711_10221904 3300025941 Bacteria 1729
751 Ga0207711_10234553 3300025941 Bacteria 1681
752 Ga0207689_10004241 3300025942 Bacteria 13040
753 Ga0207689_10007394 3300025942 Bacteria 9632
754 Ga0207689_10007729 3300025942 Bacteria 9409
755 Ga0207689_10016503 3300025942 Bacteria 6251
756 Ga0207689_10070339 3300025942 Bacteria 2875
757 Ga0207689_10075235 3300025942 Bacteria 2776
758 Ga0207661_10000444 3300025944 Bacteria 26690
759 Ga0207661_10003085 3300025944 Bacteria 11542
760 Ga0207661_10213112 3300025944 Bacteria 1703
761 Ga0207679_10007980 3300025945 Bacteria 6731
762 Ga0207679_10050694 3300025945 Bacteria 3035
763 Ga0207679_10120783 3300025945 Bacteria 2085
764 Ga0207679_10234570 3300025945 Bacteria 1551
765 Ga0207667_10003714 3300025949 Bacteria 18825
766 Ga0207667_10009983 3300025949 Bacteria 11135
767 Ga0207667_10032865 3300025949 Bacteria 5584
768 Ga0207667_10066981 3300025949 Bacteria 3741
769 Ga0207667_10218116 3300025949 Bacteria 1955
770 Ga0207667_10308933 3300025949 Bacteria 1615
771 Ga0207667_10514076 3300025949 Bacteria 1213
772 Ga0207651_10000587 3300025960 Bacteria 15314
773 Ga0207651_10000834 3300025960 Bacteria 13379
774 Ga0207651_10012045 3300025960 Bacteria 4872
775 Ga0207651_10015130 3300025960 Bacteria 4474
776 Ga0207651_10021090 3300025960 Bacteria 3950
777 Ga0207651_10030616 3300025960 Bacteria 3429
778 Ga0207651_10032496 3300025960 Bacteria 3352
779 Ga0207651_10033171 3300025960 Bacteria 3327
780 Ga0207651_10080125 3300025960 Bacteria 2349
781 Ga0207651_10101855 3300025960 Bacteria 2133
782 Ga0207651_10268474 3300025960 Bacteria 1404
783 Ga0207712_10020569 3300025961 Bacteria 4324
784 Ga0207668_10025834 3300025972 Bacteria 3806
785 Ga0207668_10034750 3300025972 Bacteria 3350
786 Ga0207668_10080871 3300025972 Bacteria 2355
787 Ga0207668_10202939 3300025972 Bacteria 1580
788 Ga0207640_10022288 3300025981 Bacteria 3788
789 Ga0207640_10059297 3300025981 Bacteria 2525
790 Ga0207658_10006530 3300025986 Bacteria 7958
791 Ga0207658_10019879 3300025986 Bacteria 4647
792 Ga0207658_10038169 3300025986 Bacteria 3458
793 Ga0207658_10096999 3300025986 Bacteria 2300
794 Ga0207658_10107171 3300025986 Bacteria 2201
795 Ga0207658_10347280 3300025986 Bacteria 1291
796 Ga0207677_10001996 3300026023 Bacteria 10780
797 Ga0207677_10040842 3300026023 Bacteria 3062
798 Ga0207677_10053078 3300026023 Bacteria 2757
799 Ga0207677_10109729 3300026023 Bacteria 2052
800 Ga0207703_10002691 3300026035 Bacteria 15245
801 Ga0207703_10003961 3300026035 Bacteria 12275
802 Ga0207703_10010840 3300026035 Bacteria 7110
803 Ga0207703_10115956 3300026035 Bacteria 2292
804 Ga0207703_10165759 3300026035 Bacteria 1939
805 Ga0207703_10314255 3300026035 Bacteria 1433
806 Ga0207639_10082656 3300026041 Bacteria 2547
807 Ga0207639_10107994 3300026041 Bacteria 2262
808 Ga0207639_10135950 3300026041 Bacteria 2041
809 Ga0207639_10137019 3300026041 Bacteria 2035
810 Ga0207639_10161416 3300026041 Bacteria 1889
811 Ga0207639_10313384 3300026041 Bacteria 1391
812 Ga0207678_10001480 3300026067 Bacteria 21540
813 Ga0207678_10009973 3300026067 Bacteria 8335
814 Ga0207678_10351679 3300026067 Bacteria 1271
815 Ga0207708_10002639 3300026075 Bacteria 13194
816 Ga0207708_10110506 3300026075 Bacteria 2133
817 Ga0207708_10245971 3300026075 Bacteria 1440
818 Ga0207702_10021218 3300026078 Bacteria 5376
819 Ga0207702_10062188 3300026078 Bacteria 3187
820 Ga0207702_10101639 3300026078 Bacteria 2539
821 Ga0207702_10183129 3300026078 Bacteria 1930
822 Ga0207702_10266940 3300026078 Bacteria 1613
823 Ga0207702_10275424 3300026078 Bacteria 1589
824 Ga0207641_10002409 3300026088 Bacteria 17271
825 Ga0207641_10011015 3300026088 Bacteria 7416
826 Ga0207641_10112533 3300026088 Bacteria 2415
827 Ga0207641_10166073 3300026088 Bacteria 2010
828 Ga0207641_10363514 3300026088 Bacteria 1382
829 Ga0207648_10000026 3300026089 Bacteria 131314
830 Ga0207648_10000582 3300026089 Bacteria 40973
831 Ga0207648_10000984 3300026089 Bacteria 32138
832 Ga0207648_10002748 3300026089 Bacteria 18702
833 Ga0207648_10006618 3300026089 Bacteria 11511
834 Ga0207648_10022764 3300026089 Bacteria 5623
835 Ga0207648_10109504 3300026089 Bacteria 2425
836 Ga0207648_10114654 3300026089 Bacteria 2368
837 Ga0207676_10003531 3300026095 Bacteria 11065
838 Ga0207676_10006625 3300026095 Bacteria 8188
839 Ga0207676_10032058 3300026095 Bacteria 3957
840 Ga0207676_10042277 3300026095 Bacteria 3504
841 Ga0207674_10002404 3300026116 Bacteria 23612
842 Ga0207674_10002741 3300026116 Bacteria 21969
843 Ga0207674_10010615 3300026116 Bacteria 10420
844 Ga0207674_10017659 3300026116 Bacteria 7778
845 Ga0207674_10024563 3300026116 Bacteria 6436
846 Ga0207675_100000601 3300026118 Bacteria 35110
847 Ga0207675_100001389 3300026118 Bacteria 24286
848 Ga0207675_100023734 3300026118 Bacteria 5706
849 Ga0207675_100035627 3300026118 Bacteria 4642
850 Ga0207675_100043728 3300026118 Bacteria 4184
851 Ga0207675_100078131 3300026118 Bacteria 3101
852 Ga0207675_100087055 3300026118 Bacteria 2934
853 Ga0207683_10001689 3300026121 Bacteria 19754
854 Ga0207683_10006288 3300026121 Bacteria 10178
855 Ga0207683_10007344 3300026121 Bacteria 9446
856 Ga0207683_10016814 3300026121 Bacteria 6225
857 Ga0207683_10044697 3300026121 Bacteria 3872
858 Ga0207683_10071593 3300026121 Bacteria 3065
859 Ga0207683_10109066 3300026121 Bacteria 2477
860 Ga0207683_10319470 3300026121 Bacteria 1422
861 Ga0207698_10010328 3300026142 Bacteria 5990
862 Ga0207698_10112555 3300026142 Bacteria 2285
863 Ga0207698_10164339 3300026142 Bacteria 1946
864 Ga0209281_1000020 3300027111 Bacteria 575972
865 Ga0209982_1004484 3300027552 Bacteria 2000
866 Ga0209970_1003020 3300027614 Bacteria 2837
867 Ga0209974_10021098 3300027876 Bacteria 2158
868 Ga0209974_10033674 3300027876 Bacteria 1700
869 Ga0207428_10016435 3300027907 Bacteria 6367
870 Ga0268266_10007672 3300028379 Bacteria 9692
871 Ga0268266_10013258 3300028379 Bacteria 7105
872 Ga0268266_10018457 3300028379 Bacteria 5944
873 Ga0268266_10077105 3300028379 Bacteria 2897
874 Ga0268266_10216977 3300028379 Bacteria 1757
875 Ga0268266_10329639 3300028379 Bacteria 1430
876 Ga0268265_10003246 3300028380 Bacteria 11804
877 Ga0268265_10052060 3300028380 Bacteria 3094
878 Ga0268265_10075457 3300028380 Bacteria 2641
879 Ga0268265_10210613 3300028380 Bacteria 1693
880 Ga0268264_10000030 3300028381 Bacteria 418542
881 Ga0268264_10001438 3300028381 Bacteria 22260
882 Ga0268264_10003226 3300028381 Bacteria 14120
883 Ga0268264_10012760 3300028381 Bacteria 6914
884 Ga0268264_10031545 3300028381 Bacteria 4343
885 Ga0268264_10059458 3300028381 Bacteria 3202
886 Ga0268264_10476689 3300028381 Bacteria 1213
887 Ga0265337_1001439 3300028556 Bacteria 11715
888 Ga0265326_10001380 3300028558 Bacteria 8553
889 Ga0265319_1002798 3300028563 Bacteria 9365
890 Ga0265334_10005260 3300028573 Bacteria 5665
891 Ga0265318_10003474 3300028577 Bacteria 7906
892 Ga0265323_10000992 3300028653 Bacteria 14760
893 Ga0265322_10002589 3300028654 Bacteria 5560
894 Ga0265336_10000003 3300028666 Bacteria 423158
895 Ga0265336_10000063 3300028666 Bacteria 98413
896 Ga0307517_10001421 3300028786 Bacteria 40285
897 Ga0307517_10055873 3300028786 Bacteria 3865
898 Ga0307517_10095068 3300028786 Bacteria 2401
899 Ga0307515_10000160 3300028794 Bacteria 164789
900 Ga0307515_10000737 3300028794 Bacteria 75687
901 Ga0307515_10028520 3300028794 Bacteria 9485
902 Ga0307515_10049556 3300028794 Bacteria 6314
903 Ga0307515_10060791 3300028794 Bacteria 5378
904 Ga0307515_10082200 3300028794 Bacteria 4171
905 Ga0265338_10000087 3300028800 Bacteria 174926
906 Ga0265338_10000154 3300028800 Bacteria 125708
907 Ga0265338_10003118 3300028800 Bacteria 23705
908 Ga0265324_10001590 3300029957 Bacteria 12642
909 Ga0265324_10003293 3300029957 Bacteria 7760
910 Ga0307511_10076742 3300030521 Bacteria 2385
911 Ga0307512_10026765 3300030522 Bacteria 5088
912 Ga0265330_10099631 3300031235 Bacteria 1244
913 Ga0265332_10000083 3300031238 Bacteria 83040
914 Ga0265332_10007298 3300031238 Bacteria 4999
915 Ga0265325_10002402 3300031241 Bacteria 12664
916 Ga0265340_10005895 3300031247 Bacteria 6775
917 Ga0265340_10032584 3300031247 Bacteria 2601
918 Ga0265339_10001335 3300031249 Bacteria 18436
919 Ga0265339_10112241 3300031249 Bacteria 1409
920 Ga0265327_10001335 3300031251 Bacteria 31984
921 Ga0265327_10005550 3300031251 Bacteria 10474
922 Ga0265316_10069195 3300031344 Bacteria 2724
923 Ga0307513_10000006 3300031456 Bacteria 470848
924 Ga0307513_10009007 3300031456 Bacteria 12663
925 Ga0307513_10015012 3300031456 Bacteria 9403
926 Ga0307513_10306852 3300031456 Bacteria 1351
927 Ga0307509_10008423 3300031507 Bacteria 13161
928 Ga0307509_10009946 3300031507 Bacteria 11750
929 Ga0307509_10062217 3300031507 Bacteria 3936
930 Ga0307509_10071416 3300031507 Bacteria 3622
931 Ga0307509_10239462 3300031507 Bacteria 1608
932 Ga0307408_100036322 3300031548 Bacteria 3463
933 Ga0265313_10004883 3300031595 Bacteria 10056
934 Ga0265313_10122378 3300031595 Bacteria 1134
935 Ga0307508_10000282 3300031616 Bacteria 62510
936 Ga0307508_10004767 3300031616 Bacteria 13094
937 Ga0307508_10011607 3300031616 Bacteria 8050
938 Ga0307508_10014131 3300031616 Bacteria 7284
939 Ga0307508_10039482 3300031616 Bacteria 4240
940 Ga0307514_10000408 3300031649 Bacteria 95961
941 Ga0307514_10017292 3300031649 Bacteria 5937
942 Ga0316575_10048438 3300031665 Bacteria 1690
943 Ga0265342_10023680 3300031712 Bacteria 3882
944 Ga0307516_10001367 3300031730 Bacteria 33805
945 Ga0307516_10002101 3300031730 Bacteria 27049
946 Ga0307516_10039313 3300031730 Bacteria 4716
947 Ga0307516_10052275 3300031730 Bacteria 3999
948 Ga0307516_10065805 3300031730 Bacteria 3499
949 Ga0307516_10083114 3300031730 Bacteria 3044
950 Ga0307516_10176584 3300031730 Bacteria 1872
951 Ga0307516_10204155 3300031730 Bacteria 1694
952 Ga0307516_10206691 3300031730 Bacteria 1680
953 Ga0307405_10062112 3300031731 Bacteria 2364
954 Ga0307405_10276730 3300031731 Bacteria 1261
955 Ga0307413_10002484 3300031824 Bacteria 7508
956 Ga0307518_10038656 3300031838 Bacteria 3469
957 Ga0307406_10073164 3300031901 Bacteria 2252
958 Ga0307412_10035132 3300031911 Bacteria 3200
959 Ga0307416_100023883 3300032002 Bacteria 4448
960 Ga0316583_10002590 3300032133 Bacteria 6300
961 Ga0307507_10044588 3300033179 Bacteria 4380
962 Ga0307510_10025998 3300033180 Bacteria 6740
963 Ga0307510_10034714 3300033180 Bacteria 5641
964 Ga0307510_10052888 3300033180 Bacteria 4274
965 Ga0307510_10066040 3300033180 Bacteria 3656
966 Ga0373949_0000342 3300035090 Bacteria 16550
967 Ga0373923_0008265 3300035111 Bacteria 3703
968 Ga0373923_0058329 3300035111 Bacteria 1634
969 Ga0373939_0000469 3300035114 Bacteria 10203
970 Ga0373953_0000542 3300035117 Bacteria 10471
971 Ga0373953_0052078 3300035117 Bacteria 1656
972 Ga0373954_0000323 3300035118 Bacteria 17518
973 Ga0373954_0003173 3300035118 Bacteria 6946
974 Ga0373954_0041561 3300035118 Bacteria 2144
975 Ga0373956_0003655 3300035119 Bacteria 6213
976 Ga0373956_0009107 3300035119 Bacteria 4026
977 Ga0373946_0043163 3300035171 Bacteria 1857
978 Ga0373955_0003057 3300035172 Bacteria 7328
979 Ga0373924_0004824 3300035410 Bacteria 4741
980 Ga0373924_0014735 3300035410 Bacteria 2958
981 Ga0373931_0047358 3300035691 Bacteria 2275
982 Ga0373935_0046730 3300035692 Bacteria 2735
983 Ga0373935_0097648 3300035692 Bacteria 1932
984 Ga0373935_0106598 3300035692 Bacteria 1855
985 Ga0373927_0088386 3300035695 Bacteria 2012
986 Ga0373933_0001324 3300035724 Bacteria 14581
987 Ga0373933_0034647 3300035724 Bacteria 2943
988 Ga0373947_0008307 3300035725 Bacteria 5980
989 Ga0373947_0018126 3300035725 Bacteria 4051
990 Ga0373947_0030133 3300035725 Bacteria 3187
991 Ga0373937_0000847 3300036401 Bacteria 26243
992 Ga0373937_0004472 3300036401 Bacteria 11874
993 Ga0373937_0007329 3300036401 Bacteria 9549
994 Ga0373937_0069648 3300036401 Bacteria 3243
995 Ga0373937_0158162 3300036401 Bacteria 2124
996 Ga0373937_0323570 3300036401 Bacteria 1459
997 Ga0316584_0002088 3300036712 Bacteria 12512
998 Ga0373925_0004343 3300037068 Bacteria 10729
999 Ga0373925_0056541 3300037068 Bacteria 2939
1000 Ga0373925_0087711 3300037068 Bacteria 2375
1001 Ga0373925_0113055 3300037068 Bacteria 2099
1002 Ga0373925_0124132 3300037068 Bacteria 2007
1003 Ga0395899_0130710 3300037312 Bacteria 1793
1004 Ga0395900_0016357 3300037418 Bacteria 7561
1005 Ga0395900_0083912 3300037418 Bacteria 3273
1006 Ga0395900_0193333 3300037418 Bacteria 2063
1007 Ga0395898_0042436 3300037466 Bacteria 4487
1008 Ga0395898_0051091 3300037466 Bacteria 4043
1009 Ga0395898_0070969 3300037466 Bacteria 3366
1010 Ga0395898_0323056 3300037466 Bacteria 1472
1011 Ga0395905_0002007 3300037471 Bacteria 23235
1012 Ga0395905_0009530 3300037471 Bacteria 9485
1013 Ga0395905_0012101 3300037471 Bacteria 8312
1014 Ga0395905_0013595 3300037471 Bacteria 7797
1015 Ga0395905_0021316 3300037471 Bacteria 6130
1016 Ga0395905_0045282 3300037471 Bacteria 4126
1017 Ga0395905_0118549 3300037471 Bacteria 2488
1018 Ga0395905_0180684 3300037471 Bacteria 1981
1019 Ga0395905_0205964 3300037471 Bacteria 1843
1020 Ga0436364_0513795 3300037853 Bacteria 7231
1021 Ga0395901_0093209 3300038443 Bacteria 3153
1022 Ga0400490_26120 3300038726 Bacteria 2446
1023 Ga0400490_31337 3300038726 Bacteria 30266
1024 Ga0400490_35285 3300038726 Bacteria 7917
1025 Ga0400490_43165 3300038726 Bacteria 39854
1026 Ga0400490_43931 3300038726 Bacteria 87826
1027 Ga0400491_00605 3300038727 Bacteria 1521
1028 Ga0400488_09907 3300038741 Bacteria 2709
1029 Ga0400488_41347 3300038741 Bacteria 2130
1030 Ga0400488_53493 3300038741 Bacteria 5647
1031 Ga0400487_23984 3300039110 Bacteria 13649
1032 Ga0400487_34028 3300039110 Bacteria 26819
1033 Ga0400487_37419 3300039110 Bacteria 2729
1034 Ga0400487_42799 3300039110 Bacteria 62577
1035 Ga0400487_44343 3300039110 Bacteria 4179
1036 Ga0436365_0082862 3300039437 Bacteria 1721
1037 Ga0436365_0894540 3300039437 Bacteria 57738
1038 Ga0436365_1221318 3300039437 Bacteria 1255
1039 Ga0436365_1549030 3300039437 Bacteria 8562
1040 Ga0436360_0275638 3300039438 Bacteria 1157
1041 Ga0436361_0193139 3300039447 Bacteria 16854
1042 Ga0436361_0527730 3300039447 Bacteria 33218
1043 Ga0436361_0632584 3300039447 Bacteria 6423
1044 Ga0436361_0761768 3300039447 Bacteria 9080
1045 Ga0436362_0663798 3300039453 Bacteria 2630
1046 Ga0451837_1009537 3300041494 Bacteria 1513
1047 Ga0439431_0009589 3300041997 Bacteria 2187
1048 Ga0439441_000337 3300042001 Bacteria 4786
1049 Ga0439449_0005387 3300042007 Bacteria 4903
1050 Ga0450890_001687 3300042127 Bacteria 3146
1051 Ga0450891_000178 3300042129 Bacteria 6142
1052 Ga0450892_001312 3300042130 Bacteria 2505
1053 Ga0439435_0000689 3300042436 Bacteria 5627
1054 Ga0439460_0027648 3300042461 Bacteria 1594
1055 Ga0450893_0001010 3300042532 Bacteria 4212
1056 Ga0451577_0000271 3300042876 Bacteria 101284
1057 Ga0451577_0106470 3300042876 Bacteria 2507
1058 Ga0466966_0009768 3300044684 Bacteria 6359
1059 Ga0466963_0000320 3300044694 Bacteria 21684
1060 Ga0453684_0000005 3300044712 Bacteria 1431632
1061 Ga0453684_0000583 3300044712 Bacteria 135940
1062 Ga0453684_0000702 3300044712 Bacteria 118936
1063 Ga0453684_0000906 3300044712 Bacteria 98768
1064 Ga0453684_0006332 3300044712 Bacteria 22593
1065 Ga0453684_0152269 3300044712 Bacteria 2746
1066 Ga0466968_0002656 3300044735 Bacteria 6584
1067 Ga0466957_0036330 3300044842 Bacteria 2961
1068 Ga0466959_0066363 3300045049 Bacteria 2618
1069 Ga0451576_0000137 3300045051 Bacteria 185212
1070 Ga0451576_0000259 3300045051 Bacteria 129591
1071 Ga0451576_0118222 3300045051 Bacteria 2759
1072 Ga0466967_0236995 3300045976 Bacteria 1739
1073 Ga0495627_000007 3300046453 Bacteria 575915
1074 Ga0495592_0000519 3300046454 Bacteria 27856
1075 Ga0495590_0000008 3300046457 Bacteria 330520
1076 Ga0495591_000043 3300046458 Bacteria 148885
1077 Ga0495629_0098817 3300046459 Bacteria 2037
1078 Ga0495651_0014174 3300046462 Bacteria 6161
1079 Ga0495651_0203056 3300046462 Bacteria 1386
1080 Ga0495653_0000002 3300046463 Bacteria 507262
1081 Ga0495653_0012104 3300046463 Bacteria 7039
1082 Ga0495650_0001530 3300046471 Bacteria 21964
1083 Ga0495650_0001834 3300046471 Bacteria 19019
1084 Ga0495650_0015649 3300046471 Bacteria 3880
1085 Ga0495582_0003052 3300046473 Bacteria 9380
1086 Ga0495605_0008667 3300046474 Bacteria 5745
1087 Ga0495584_0000025 3300046491 Bacteria 116731
1088 Ga0495584_0000173 3300046491 Bacteria 45316
1089 Ga0495585_0004296 3300046492 Bacteria 9275
1090 Ga0495585_0015337 3300046492 Bacteria 4453
1091 Ga0495585_0055384 3300046492 Bacteria 2191
1092 Ga0495594_0038315 3300046499 Bacteria 2617
1093 Ga0495596_0000604 3300046500 Bacteria 22532
1094 Ga0495596_0004602 3300046500 Bacteria 6687
1095 Ga0495596_0017045 3300046500 Bacteria 3013
1096 Ga0495596_0019695 3300046500 Bacteria 2768
1097 Ga0495607_0014372 3300046501 Bacteria 5157
1098 Ga0495583_0000011 3300046506 Bacteria 350215
1099 Ga0495583_0000306 3300046506 Bacteria 77699
1100 Ga0495583_0000512 3300046506 Bacteria 55428
1101 Ga0495583_0036138 3300046506 Bacteria 2352
1102 Ga0495608_0012098 3300046511 Bacteria 5998
1103 Ga0495610_0002865 3300046512 Bacteria 14003
1104 Ga0495610_0006324 3300046512 Bacteria 8192
1105 Ga0495610_0012368 3300046512 Bacteria 5144
1106 Ga0495616_0000643 3300046513 Bacteria 26050
1107 Ga0495616_0034632 3300046513 Bacteria 2620
1108 Ga0495628_0005737 3300046516 Bacteria 10875
1109 Ga0495631_0000337 3300046518 Bacteria 32281
1110 Ga0495631_0018893 3300046518 Bacteria 3238
1111 Ga0495631_0023463 3300046518 Bacteria 2858
1112 Ga0495632_0017507 3300046519 Bacteria 3953
1113 Ga0495637_0000009 3300046520 Bacteria 402028
1114 Ga0495643_0000028 3300046522 Bacteria 262886
1115 Ga0495643_0092054 3300046522 Bacteria 1563
1116 Ga0495644_0000119 3300046523 Bacteria 37559
1117 Ga0495644_0007875 3300046523 Bacteria 4103
1118 Ga0495644_0023099 3300046523 Bacteria 2368
1119 Ga0495644_0074202 3300046523 Bacteria 1279
1120 Ga0495648_0001735 3300046524 Bacteria 21077
1121 Ga0495648_0003308 3300046524 Bacteria 14229
1122 Ga0495648_0062334 3300046524 Bacteria 2208
1123 Ga0495642_0011402 3300046528 Bacteria 3415
1124 Ga0495652_0022690 3300046529 Bacteria 5569
1125 Ga0495652_0033439 3300046529 Bacteria 4489
1126 Ga0495654_0001482 3300046530 Bacteria 16073
1127 Ga0495654_0110646 3300046530 Bacteria 1254
1128 Ga0495586_0002965 3300046535 Bacteria 9148
1129 Ga0495586_0045669 3300046535 Bacteria 2361
1130 Ga0495587_0005573 3300046536 Bacteria 8216
1131 Ga0495598_0067512 3300046537 Bacteria 1118
1132 Ga0495609_0000647 3300046538 Bacteria 27112
1133 Ga0495609_0019622 3300046538 Bacteria 3126
1134 Ga0495621_0000113 3300046539 Bacteria 16978
1135 Ga0495621_0001756 3300046539 Bacteria 5685
1136 Ga0495597_0000762 3300046542 Bacteria 25455
1137 Ga0495597_0000911 3300046542 Bacteria 22921
1138 Ga0495597_0021496 3300046542 Bacteria 2999
1139 Ga0495645_0095615 3300046543 Bacteria 2118
1140 Ga0495645_0117138 3300046543 Bacteria 1880
1141 Ga0495622_0000092 3300046557 Bacteria 80637
1142 Ga0495633_0000181 3300046558 Bacteria 82164
1143 Ga0495633_0000742 3300046558 Bacteria 29473
1144 Ga0495633_0004718 3300046558 Bacteria 8568
1145 Ga0495633_0064321 3300046558 Bacteria 1715
1146 Ga0495667_0058675 3300046559 Bacteria 2527
1147 Ga0495656_0000383 3300046615 Bacteria 14729
1148 Ga0495668_0000018 3300046616 Bacteria 417480
1149 Ga0495668_0000028 3300046616 Bacteria 286629
1150 Ga0495668_0042735 3300046616 Bacteria 2522
1151 Ga0495611_0000361 3300046648 Bacteria 29629
1152 Ga0495611_0001188 3300046648 Bacteria 13508
1153 Ga0495611_0006888 3300046648 Bacteria 4831
1154 Ga0495611_0013006 3300046648 Bacteria 3539
1155 Ga0495625_0001300 3300046660 Bacteria 31240
1156 Ga0495625_0005155 3300046660 Bacteria 12056
1157 Ga0495625_0029787 3300046660 Bacteria 4079
1158 Ga0495625_0077111 3300046660 Bacteria 2329
1159 Ga0495635_0006348 3300046663 Bacteria 8242
1160 Ga0495635_0212429 3300046663 Bacteria 1310
1161 Ga0495661_0003126 3300046665 Bacteria 12410
1162 Ga0495661_0007978 3300046665 Bacteria 7351
1163 Ga0495661_0019488 3300046665 Bacteria 4445
1164 Ga0495661_0034022 3300046665 Bacteria 3210
1165 Ga0495661_0178883 3300046665 Bacteria 1125
1166 Ga0495657_0015234 3300046675 Bacteria 5628
1167 Ga0495599_0004863 3300046678 Bacteria 7993
1168 Ga0495623_0002882 3300046679 Bacteria 11335
1169 Ga0495623_0005974 3300046679 Bacteria 7930
1170 Ga0495623_0139277 3300046679 Bacteria 1445
1171 Ga0495646_0008308 3300046680 Bacteria 6600
1172 Ga0495647_0001791 3300046681 Bacteria 6639
1173 Ga0495669_0007195 3300046684 Bacteria 4664
1174 Ga0495670_0000053 3300046691 Bacteria 60401
1175 Ga0495670_0012551 3300046691 Bacteria 4167
1176 Ga0495671_0038435 3300046692 Bacteria 2419
1177 Ga0495649_0000028 3300046694 Bacteria 163229
1178 Ga0495649_0032021 3300046694 Bacteria 2899
1179 Ga0495589_0018666 3300046794 Bacteria 3556
1180 Ga0495600_0058069 3300046809 Bacteria 2527
1181 Ga0495660_0020740 3300046810 Bacteria 3767
1182 Ga0495660_0085207 3300046810 Bacteria 1651
1183 Ga0495604_0000893 3300047317 Bacteria 24849
1184 Ga0495604_0082744 3300047317 Bacteria 2399
1185 Ga0495604_0131342 3300047317 Bacteria 1800
1186 Ga0495636_0003446 3300047318 Bacteria 6139
1187 Ga0495636_0004208 3300047318 Bacteria 5652
1188 Ga0495674_0073493 3300047319 Bacteria 2947
1189 Ga0495672_0000055 3300047320 Bacteria 229428
1190 Ga0495672_0003194 3300047320 Bacteria 14247
1191 Ga0495672_0019403 3300047320 Bacteria 4484
1192 Ga0495680_0036120 3300047322 Bacteria 3971
1193 Ga0495680_0117364 3300047322 Bacteria 1967
1194 Ga0495683_0000047 3300047323 Bacteria 126770
1195 Ga0495683_0032671 3300047323 Bacteria 2650
1196 Ga0495687_001812 3300047443 Bacteria 18792
1197 Ga0495687_003723 3300047443 Bacteria 10818
1198 Ga0495687_010481 3300047443 Bacteria 5081
1199 Ga0495687_011218 3300047443 Bacteria 4835
1200 Ga0495675_0003845 3300047444 Bacteria 9091
1201 Ga0495675_0020051 3300047444 Bacteria 4248
1202 Ga0495677_0000986 3300047445 Bacteria 11456
1203 Ga0495677_0007612 3300047445 Bacteria 4041
1204 Ga0495677_0011525 3300047445 Bacteria 3233
1205 Ga0495677_0025374 3300047445 Bacteria 2150
1206 Ga0495679_010120 3300047446 Bacteria 3724
1207 Ga0495673_0000008 3300047469 Bacteria 752462
1208 Ga0495681_0006008 3300047470 Bacteria 8041
1209 Ga0495681_0009513 3300047470 Bacteria 5979
1210 Ga0495681_0011106 3300047470 Bacteria 5397
1211 Ga0495681_0045847 3300047470 Bacteria 2089
1212 Ga0495684_0005498 3300047471 Bacteria 9863
1213 Ga0495686_0000603 3300047472 Bacteria 49764
1214 Ga0495686_0030707 3300047472 Bacteria 3488
1215 Ga0495602_0001190 3300048088 Bacteria 25555
1216 Ga0495602_0021398 3300048088 Bacteria 6367
1217 Ga0495602_0023541 3300048088 Bacteria 5998
1218 Ga0495602_0307882 3300048088 Bacteria 1157
1219 Ga0495614_0003366 3300048089 Bacteria 7147
1220 Ga0495614_0070629 3300048089 Bacteria 1505
1221 Ga0495615_0033952 3300048090 Bacteria 1239
1222 Ga0495626_0007108 3300048091 Bacteria 6269
1223 Ga0495626_0007741 3300048091 Bacteria 5953
1224 Ga0495626_0030425 3300048091 Bacteria 2604
1225 Ga0495626_0045637 3300048091 Bacteria 2044
1226 Ga0496100_0000929 3300048903 Bacteria 13991
1227 Ga0496100_0069821 3300048903 Bacteria 2341
1228 Ga0496101_0005022 3300048904 Bacteria 8409
1229 Ga0496101_0077873 3300048904 Bacteria 2444
1230 Ga0496101_0080354 3300048904 Bacteria 2408
1231 Ga0496101_0114617 3300048904 Bacteria 2032
1232 Ga0496101_0149669 3300048904 Bacteria 1785
1233 Ga0496101_0213994 3300048904 Bacteria 1494
1234 Ga0496102_0014718 3300048905 Bacteria 6800
1235 Ga0496102_0154653 3300048905 Bacteria 2156
1236 Ga0496102_0199474 3300048905 Bacteria 1886
1237 Ga0496103_0013140 3300048906 Bacteria 4910
1238 Ga0496103_0016204 3300048906 Bacteria 4447
1239 Ga0496104_0002648 3300048907 Bacteria 15407
1240 Ga0496104_0008496 3300048907 Bacteria 9134
1241 Ga0496104_0011778 3300048907 Bacteria 7847
1242 Ga0496104_0049145 3300048907 Bacteria 3977
1243 Ga0496104_0092955 3300048907 Bacteria 2884
1244 Ga0496104_0150125 3300048907 Bacteria 2237
1245 Ga0496104_0240711 3300048907 Bacteria 1722
1246 Ga0496104_0315020 3300048907 Bacteria 1477
1247 Ga0496105_0000572 3300048908 Bacteria 24357
1248 Ga0496105_0002416 3300048908 Bacteria 13531
1249 Ga0496105_0015520 3300048908 Bacteria 6072
1250 Ga0496105_0105424 3300048908 Bacteria 2327
1251 Ga0496106_0000002 3300048909 Bacteria 377020
1252 Ga0496106_0004513 3300048909 Bacteria 10312
1253 Ga0496106_0004659 3300048909 Bacteria 10166
1254 Ga0496106_0005567 3300048909 Bacteria 9323
1255 Ga0496106_0033439 3300048909 Bacteria 3836
1256 Ga0496106_0175493 3300048909 Bacteria 1700
1257 Ga0496106_0297618 3300048909 Bacteria 1294
1258 Ga0496107_0003143 3300048910 Bacteria 10982
1259 Ga0496107_0005458 3300048910 Bacteria 8701
1260 Ga0496107_0025568 3300048910 Bacteria 4180
1261 Ga0496107_0049325 3300048910 Bacteria 3034
1262 Ga0496108_0005344 3300048911 Bacteria 10382
1263 Ga0496108_0008379 3300048911 Bacteria 8388
1264 Ga0496108_0077250 3300048911 Bacteria 2816
1265 Ga0496109_0004278 3300048912 Bacteria 11925
1266 Ga0496109_0022002 3300048912 Bacteria 5644
1267 Ga0496109_0276868 3300048912 Bacteria 1581
1268 Ga0496110_0000729 3300048913 Bacteria 22689
1269 Ga0496110_0008923 3300048913 Bacteria 8082
1270 Ga0496110_0020100 3300048913 Bacteria 5633
1271 Ga0496110_0520382 3300048913 Bacteria 1082
1272 Ga0496111_0004705 3300048914 Bacteria 8655
1273 Ga0496111_0069535 3300048914 Bacteria 2560
1274 Ga0496112_0005808 3300048915 Bacteria 10736
1275 Ga0496112_0017735 3300048915 Bacteria 6700
1276 Ga0496113_0016931 3300048916 Bacteria 5046
1277 Ga0496113_0042675 3300048916 Bacteria 3352
1278 Ga0496113_0122522 3300048916 Bacteria 2034
1279 Ga0496113_0202699 3300048916 Bacteria 1577
1280 Ga0496114_0000501 3300048917 Bacteria 28631
1281 Ga0496114_0007334 3300048917 Bacteria 8706
1282 Ga0496114_0016064 3300048917 Bacteria 6024
1283 Ga0496114_0027394 3300048917 Bacteria 4667
1284 Ga0496114_0028792 3300048917 Bacteria 4561
1285 Ga0496114_0198475 3300048917 Bacteria 1757
1286 Ga0496115_0007693 3300048918 Bacteria 7944
1287 Ga0496115_0018095 3300048918 Bacteria 5401
1288 Ga0496115_0041449 3300048918 Bacteria 3665
1289 Ga0496115_0053225 3300048918 Bacteria 3248
1290 Ga0496116_0005353 3300048919 Bacteria 11950
1291 Ga0496116_0064205 3300048919 Bacteria 2361
1292 Ga0496117_0022285 3300048920 Bacteria 5085
1293 Ga0496118_0004640 3300048921 Bacteria 16123
1294 Ga0496119_0000213 3300048922 Bacteria 82822
1295 Ga0496121_0000089 3300048924 Bacteria 219007
1296 Ga0496121_0001937 3300048924 Bacteria 33021
1297 Ga0496121_0029822 3300048924 Bacteria 5028
1298 Ga0496121_0050156 3300048924 Bacteria 3529
1299 Ga0496121_0055079 3300048924 Bacteria 3316
1300 Ga0496122_0001063 3300048925 Bacteria 47771
1301 Ga0496123_0000246 3300048926 Bacteria 109397
1302 Ga0496123_0062416 3300048926 Bacteria 2388
1303 Ga0496125_0018144 3300048928 Bacteria 6688
1304 Ga0496126_0003551 3300048929 Bacteria 19610
1305 Ga0495678_000060 3300049459 Bacteria 142851
1306 Ga0495678_000266 3300049459 Bacteria 57869
1307 Ga0495678_039730 3300049459 Bacteria 1896
1308 Ga0495678_039877 3300049459 Bacteria 1891
1309 Ga0495682_0000035 3300049460 Bacteria 126349
1310 Ga0501300_004779 3300049523 Bacteria 2003
1311 Ga0501031_0001824 3300049568 Bacteria 13399
1312 Ga0501031_0239964 3300049568 Bacteria 1178
1313 Ga0501034_0020044 3300049571 Bacteria 6830
1314 Ga0501034_0056570 3300049571 Bacteria 3946
1315 Ga0501034_0064115 3300049571 Bacteria 3688
1316 Ga0501034_0274409 3300049571 Bacteria 1626
1317 Ga0501036_0005963 3300049572 Bacteria 9878
1318 Ga0501036_0105368 3300049572 Bacteria 2385
1319 Ga0501037_0164638 3300049573 Bacteria 1579
1320 Ga0501038_0012969 3300049574 Bacteria 7603
1321 Ga0501038_0023790 3300049574 Bacteria 5473
1322 Ga0501039_0010395 3300049575 Bacteria 7094
1323 Ga0501041_0021938 3300049577 Bacteria 3824
1324 Ga0501042_0056056 3300049578 Bacteria 2812
1325 Ga0501043_0000058 3300049579 Bacteria 102030
1326 Ga0501043_0000643 3300049579 Bacteria 30832
1327 Ga0501043_0021150 3300049579 Bacteria 5100
1328 Ga0501043_0292325 3300049579 Bacteria 1247
1329 Ga0501046_0000051 3300049580 Bacteria 133545
1330 Ga0501046_0002679 3300049580 Bacteria 16603
1331 Ga0501046_0094302 3300049580 Bacteria 2300
1332 Ga0501046_0182877 3300049580 Bacteria 1566
1333 Ga0501047_0000003 3300049581 Bacteria 508375
1334 Ga0501047_0004563 3300049581 Bacteria 13023
1335 Ga0501047_0005052 3300049581 Bacteria 12383
1336 Ga0501047_0101760 3300049581 Bacteria 2752
1337 Ga0501047_0229176 3300049581 Bacteria 1712
1338 Ga0501048_0008908 3300049582 Bacteria 7554
1339 Ga0501048_0010868 3300049582 Bacteria 6788
1340 Ga0501048_0042759 3300049582 Bacteria 3243
1341 Ga0501067_0014886 3300049583 Bacteria 4305
1342 Ga0501070_0006327 3300049586 Bacteria 10076
1343 Ga0501071_0035366 3300049587 Bacteria 3558
1344 Ga0501072_0005493 3300049588 Bacteria 9652
1345 Ga0501072_0076284 3300049588 Bacteria 2652
1346 Ga0501073_0003296 3300049589 Bacteria 12128
1347 Ga0501073_0032616 3300049589 Bacteria 3713
1348 Ga0501075_0000410 3300049591 Bacteria 24998
1349 Ga0501076_0001765 3300049592 Bacteria 14630
1350 Ga0501076_0157259 3300049592 Bacteria 1851
1351 Ga0501077_0013599 3300049593 Bacteria 5102
1352 Ga0501223_021408 3300049663 Bacteria 1264
1353 Ga0501225_0008344 3300049705 Bacteria 2974
1354 Ga0501229_000131 3300049706 Bacteria 7802
1355 Ga0501079_0193788 3300049741 Bacteria 1586
1356 Ga0501080_0012936 3300049742 Bacteria 7660
1357 Ga0501081_0005625 3300049743 Bacteria 8100
1358 Ga0501083_0048123 3300049744 Bacteria 2879
1359 Ga0501262_000404 3300049759 Bacteria 5207
1360 Ga0501035_0002048 3300049822 Bacteria 20096
1361 Ga0501035_0024668 3300049822 Bacteria 5513
1362 Ga0501035_0124667 3300049822 Bacteria 2249
1363 Ga0501044_0000515 3300049823 Bacteria 47051
1364 Ga0501044_0007899 3300049823 Bacteria 11699
1365 Ga0501044_0011617 3300049823 Bacteria 9542
1366 Ga0501044_0046836 3300049823 Bacteria 4475
1367 Ga0501044_0047853 3300049823 Bacteria 4422
1368 Ga0501044_0049233 3300049823 Bacteria 4350
1369 Ga0501044_0538433 3300049823 Bacteria 1066
1370 Ga0501045_0001820 3300049824 Bacteria 14399
1371 Ga0501045_0007439 3300049824 Bacteria 7607
1372 Ga0501045_0037446 3300049824 Bacteria 3526
1373 nmdc:mga03683_94541_c1 3300050489 Bacteria 1307
1374 nmdc:mga0k408_15138_c1 3300050493 Bacteria 4263
1375 nmdc:mga0k408_206_c1 3300050493 Bacteria 31456
1376 nmdc:mga0k408_221_c1 3300050493 Bacteria 30239
1377 nmdc:mga0k408_54843_c1 3300050493 Bacteria 2310
1378 nmdc:mga0k408_5529_c1 3300050493 Bacteria 6728
1379 nmdc:mga0k408_62462_c1 3300050493 Bacteria 2166
1380 nmdc:mga0k408_641_c2 3300050493 Bacteria 18568
1381 nmdc:mga06z11_3267_c1 3300050494 Bacteria 6268
1382 nmdc:mga07m45_138909_c1 3300050496 Bacteria 1407
1383 nmdc:mga07m45_18057_c2 3300050496 Bacteria 3141
1384 nmdc:mga07m45_19775_c1 3300050496 Bacteria 3651
1385 nmdc:mga05p37_52613_c1 3300050507 Bacteria 5006
1386 nmdc:mga0qj67_18883_c1 3300050509 Bacteria 5260
1387 nmdc:mga08y16_181892_c1 3300050511 Bacteria 2183
1388 nmdc:mga0n895_200805_c1 3300050512 Bacteria 2025
1389 nmdc:mga0rr50_419562_c1 3300050513 Bacteria 1132
1390 Ga0495612_0083098 3300053078 Bacteria 1347
1391 Ga0500643_007434 3300053087 Bacteria 4419
1392 Ga0500651_0000087 3300053093 Bacteria 59423
1393 Ga0500651_0164338 3300053093 Bacteria 1326
1394 Ga0500571_000055 3300053110 Bacteria 35434
1395 Ga0500593_000250 3300053117 Bacteria 22072
1396 Ga0500595_011037 3300053119 Bacteria 3558
1397 Ga0500652_000452 3300053131 Bacteria 14586
1398 Ga0500568_0001338 3300053139 Bacteria 16133
1399 Ga0500568_0009819 3300053139 Bacteria 4521
1400 Ga0500586_000197 3300053145 Bacteria 11679
1401 Ga0500622_0001145 3300053156 Bacteria 22070
1402 Ga0500622_0036726 3300053156 Bacteria 2560
1403 Ga0500634_0001009 3300053161 Bacteria 10269
1404 Ga0500645_054278 3300053730 Bacteria 1166
1405 Ga0501084_0115626 3300054114 Bacteria 2255
1406 Ga0587077_015555 3300059493 Bacteria 1268
1407 Ga0501082_0004526 3300060353 Bacteria 12138
1408 Ga0501082_0169444 3300060353 Bacteria 1898
1409 Ga0530510_0007623 3300061734 Bacteria 7537

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0013599 Ga0501077_0013599_16_930 301
2 3300009093 Ga0105240_10003856 Ga0105240_100038568 320
3 3300048924 Ga0496121_0001937 Ga0496121_0001937_28631_29668 320
4 3300041494 Ga0451837_1009537 Ga0451837_1009537_348_1376 326
5 3300006847 Ga0075431_100422198 Ga0075431_1004221981 328
6 3300048909 Ga0496106_0000002 Ga0496106_0000002_69639_70700 329
7 3300048924 Ga0496121_0050156 Ga0496121_0050156_712_1773 329
8 3300013308 Ga0157375_10247396 Ga0157375_102473962 330
9 3300053139 Ga0500568_0001338 Ga0500568_0001338_10981_11976 330
10 iso_pu_bacteria 2919051321 2919054995 335
11 3300005437 Ga0070710_10087640 Ga0070710_100876401 336
12 3300045049 Ga0466959_0066363 Ga0466959_0066363_803_1816 336
13 3300046459 Ga0495629_0098817 Ga0495629_0098817_13_1026 336
14 iso_pu_bacteria 2511231003 2511248354 336
15 iso_pu_bacteria 2511231026 2511383472 336
16 iso_pu_bacteria 2513237165 2514042723 336
17 iso_pu_bacteria 2574179768 2574433010 336
18 iso_pu_bacteria 2643221631 2644179092 336
19 iso_pu_bacteria 2765235838 2765568378 336
20 iso_pu_bacteria 2784132148 2784585781 336
21 iso_pu_bacteria 2808606384 2808968877 336
22 iso_pu_bacteria 2808606390 2809003708 336
23 iso_pu_bacteria 2808606391 2809010985 336
24 iso_pu_bacteria 2808606448 2809229270 336
25 iso_pu_bacteria 2811994917 2812479647 336
26 iso_pu_bacteria 2838074704 2838079085 336
27 iso_pu_bacteria 2857564685 2857567035 336
28 iso_pu_bacteria 2885270888 2885277846 336
29 iso_pu_bacteria 2896384573 2896385781 336
30 iso_pu_bacteria 2904541872 2904546023 336
31 iso_pu_bacteria 2905926851 2905929602 336
32 iso_pu_bacteria 2920760137 2920766452 336
33 iso_pu_bacteria 2929160207 2929161225 336
34 iso_pu_bacteria 2954691527 2954692632 336
35 iso_pu_bacteria 2954701450 2954707705 336
36 iso_pu_bacteria 2954711539 2954712291 336
37 iso_pu_bacteria 2954721474 2954722237 336
38 iso_pu_bacteria 2954731030 2954739613 336
39 iso_pu_bacteria 2954740390 2954741125 336
40 iso_pu_bacteria 2954749733 2954758439 336
41 iso_pu_bacteria 2954759201 2954760136 336
42 iso_pu_bacteria 2966598605 2966599288 336
43 iso_pu_bacteria 2974302888 2974305400 336
44 iso_pu_bacteria 639633007 639787697 336
45 iso_pu_bacteria 8003314358 8003317753 336
46 iso_pu_bacteria 8048127548 8048136899 336
47 3300005329 Ga0070683_100049447 Ga0070683_1000494473 337
48 3300005364 Ga0070673_100130251 Ga0070673_1001302512 337
49 3300005457 Ga0070662_100016857 Ga0070662_1000168574 337
50 3300005471 Ga0070698_100081425 Ga0070698_1000814252 337
51 3300005518 Ga0070699_100200393 Ga0070699_1002003932 337
52 3300005539 Ga0068853_100104878 Ga0068853_1001048783 337
53 3300005564 Ga0070664_100057585 Ga0070664_1000575854 337
54 3300005842 Ga0068858_100212532 Ga0068858_1002125322 337
55 3300025933 Ga0207706_10296846 Ga0207706_102968462 337
56 3300025934 Ga0207686_10245493 Ga0207686_102454931 337
57 3300025941 Ga0207711_10016290 Ga0207711_100162907 337
58 3300025960 Ga0207651_10080125 Ga0207651_100801252 337
59 3300026035 Ga0207703_10314255 Ga0207703_103142552 337
60 3300026078 Ga0207702_10183129 Ga0207702_101831292 337
61 3300035692 Ga0373935_0097648 Ga0373935_0097648_497_1513 337
62 3300046473 Ga0495582_0003052 Ga0495582_0003052_346_1362 337
63 3300046535 Ga0495586_0002965 Ga0495586_0002965_7870_8886 337
64 3300046535 Ga0495586_0045669 Ga0495586_0045669_1264_2280 337
65 iso_pu_bacteria 2501025502 2501080491 337
66 iso_pu_bacteria 2510917013 2511092624 337
67 iso_pu_bacteria 2511231002 2511243186 337
68 iso_pu_bacteria 2511231003 2511249744 337
69 iso_pu_bacteria 2515154122 2515682116 337
70 iso_pu_bacteria 2515154189 2516021416 337
71 iso_pu_bacteria 2562617112 2563064037 337
72 iso_pu_bacteria 2599185214 2599624803 337
73 iso_pu_bacteria 2599185226 2599672815 337
74 iso_pu_bacteria 2599185227 2599682735 337
75 iso_pu_bacteria 2599185229 2599694424 337
76 iso_pu_bacteria 2643221544 2643746370 337
77 iso_pu_bacteria 2643221639 2644222256 337
78 iso_pu_bacteria 2643221646 2644258141 337
79 iso_pu_bacteria 2643221658 2644329137 337
80 iso_pu_bacteria 2711768613 2713472311 337
81 iso_pu_bacteria 2721755523 2722883080 337
82 iso_pu_bacteria 2738541277 2738721062 337
83 iso_pu_bacteria 2738541296 2738821398 337
84 iso_pu_bacteria 2738541298 2738833881 337
85 iso_pu_bacteria 2738541306 2738875084 337
86 iso_pu_bacteria 2738541307 2738885748 337
87 iso_pu_bacteria 2738541337 2739053718 337
88 iso_pu_bacteria 2738543002 2739187038 337
89 iso_pu_bacteria 2738543008 2739221682 337
90 iso_pu_bacteria 2738543013 2739249156 337
91 iso_pu_bacteria 2738543019 2739280261 337
92 iso_pu_bacteria 2744054900 2746091603 337
93 iso_pu_bacteria 2744054901 2746099242 337
94 iso_pu_bacteria 2791355137 2792840869 337
95 iso_pu_bacteria 2831265667 2831265862 337
96 iso_pu_bacteria 2831864461 2831867798 337
97 iso_pu_bacteria 2842718218 2842719403 337
98 iso_pu_bacteria 2881101125 2881105151 337
99 iso_pu_bacteria 2883087390 2883095792 337
100 iso_pu_bacteria 2884811622 2884812427 337
101 iso_pu_bacteria 2884836552 2884840384 337
102 iso_pu_bacteria 2884852848 2884855640 337
103 iso_pu_bacteria 2885198086 2885203513 337
104 iso_pu_bacteria 2885211737 2885217137 337
105 iso_pu_bacteria 2885270888 2885274406 337
106 iso_pu_bacteria 2886848708 2886849060 337
107 iso_pu_bacteria 2886848708 2886850892 337
108 iso_pu_bacteria 2894023352 2894026830 337
109 iso_pu_bacteria 2896154374 2896157434 337
110 iso_pu_bacteria 2902682994 2902685527 337
111 iso_pu_bacteria 2904479285 2904482827 337
112 iso_pu_bacteria 2928070936 2928074844 337
113 iso_pu_bacteria 2928084124 2928088992 337
114 iso_pu_bacteria 2939631187 2939632355 337
115 iso_pu_bacteria 2945945610 2945948455 337
116 iso_pu_bacteria 642555112 642595002 337
117 iso_pu_bacteria 8006926726 8006930741 337
118 3300005435 Ga0070714_100058748 Ga0070714_1000587484 338
119 3300005436 Ga0070713_100062064 Ga0070713_1000620644 338
120 3300005437 Ga0070710_10055704 Ga0070710_100557042 338
121 3300005439 Ga0070711_100256708 Ga0070711_1002567082 338
122 3300005458 Ga0070681_10007525 Ga0070681_1000752510 338
123 3300005536 Ga0070697_100025578 Ga0070697_1000255784 338
124 3300005536 Ga0070697_100235223 Ga0070697_1002352232 338
125 3300005985 Ga0081539_10006668 Ga0081539_100066685 338
126 3300006028 Ga0070717_10090988 Ga0070717_100909881 338
127 3300006173 Ga0070716_100039217 Ga0070716_1000392172 338
128 3300025912 Ga0207707_10006120 Ga0207707_1000612010 338
129 3300025915 Ga0207693_10002285 Ga0207693_100022858 338
130 3300025928 Ga0207700_10299117 Ga0207700_102991172 338
131 3300025929 Ga0207664_10156051 Ga0207664_101560512 338
132 3300025939 Ga0207665_10096410 Ga0207665_100964102 338
133 3300046492 Ga0495585_0015337 Ga0495585_0015337_1697_2731 338
134 3300046523 Ga0495644_0007875 Ga0495644_0007875_2709_3728 338
135 3300046530 Ga0495654_0110646 Ga0495654_0110646_173_1192 338
136 3300046538 Ga0495609_0019622 Ga0495609_0019622_1104_2138 338
137 3300046539 Ga0495621_0000113 Ga0495621_0000113_13064_14083 338
138 3300046542 Ga0495597_0021496 Ga0495597_0021496_526_1560 338
139 3300046558 Ga0495633_0064321 Ga0495633_0064321_406_1425 338
140 3300046692 Ga0495671_0038435 Ga0495671_0038435_669_1688 338
141 3300047470 Ga0495681_0009513 Ga0495681_0009513_4585_5604 338
142 3300047470 Ga0495681_0045847 Ga0495681_0045847_192_1226 338
143 3300048090 Ga0495615_0033952 Ga0495615_0033952_43_1062 338
144 3300048091 Ga0495626_0045637 Ga0495626_0045637_35_1069 338
145 3300048918 Ga0496115_0018095 Ga0496115_0018095_1804_2838 338
146 3300054114 Ga0501084_0115626 Ga0501084_0115626_591_1610 338
147 3300003203 JGI25406J46586_10000250 JGI25406J46586_1000025020 339
148 3300005985 Ga0081539_10001407 Ga0081539_1000140741 339
149 3300006042 Ga0075368_10039532 Ga0075368_100395321 339
150 3300006178 Ga0075367_10020407 Ga0075367_100204073 339
151 3300006186 Ga0075369_10034115 Ga0075369_100341151 339
152 3300006195 Ga0075366_10071982 Ga0075366_100719822 339
153 3300013102 Ga0157371_10000013 Ga0157371_10000013315 339
154 3300013297 Ga0157378_10232360 Ga0157378_102323602 339
155 3300025904 Ga0207647_10085467 Ga0207647_100854673 339
156 3300026078 Ga0207702_10101639 Ga0207702_101016391 339
157 3300028794 Ga0307515_10049556 Ga0307515_100495562 339
158 3300037466 Ga0395898_0051091 Ga0395898_0051091_1539_2576 339
159 3300042001 Ga0439441_000337 Ga0439441_000337_927_1955 339
160 3300042436 Ga0439435_0000689 Ga0439435_0000689_757_1785 339
161 3300042461 Ga0439460_0027648 Ga0439460_0027648_224_1252 339
162 3300048904 Ga0496101_0213994 Ga0496101_0213994_378_1403 339
163 3300048909 Ga0496106_0033439 Ga0496106_0033439_2367_3392 339
164 3300048910 Ga0496107_0003143 Ga0496107_0003143_1706_2731 339
165 3300048915 Ga0496112_0017735 Ga0496112_0017735_42_1091 339
166 3300048916 Ga0496113_0122522 Ga0496113_0122522_70_1119 339
167 3300048916 Ga0496113_0202699 Ga0496113_0202699_232_1257 339
168 3300048917 Ga0496114_0028792 Ga0496114_0028792_2195_3220 339
169 3300049571 Ga0501034_0056570 Ga0501034_0056570_1653_2678 339
170 3300049574 Ga0501038_0012969 Ga0501038_0012969_6100_7125 339
171 3300049575 Ga0501039_0010395 Ga0501039_0010395_4187_5215 339
172 3300049577 Ga0501041_0021938 Ga0501041_0021938_2438_3466 339
173 3300049582 Ga0501048_0010868 Ga0501048_0010868_14_1042 339
174 3300049587 Ga0501071_0035366 Ga0501071_0035366_1255_2283 339
175 3300049588 Ga0501072_0005493 Ga0501072_0005493_5419_6447 339
176 3300049588 Ga0501072_0076284 Ga0501072_0076284_120_1151 339
177 3300049591 Ga0501075_0000410 Ga0501075_0000410_7616_8644 339
178 3300049592 Ga0501076_0001765 Ga0501076_0001765_5174_6202 339
179 3300049592 Ga0501076_0157259 Ga0501076_0157259_702_1730 339
180 3300049741 Ga0501079_0193788 Ga0501079_0193788_222_1250 339
181 3300049743 Ga0501081_0005625 Ga0501081_0005625_3981_5009 339
182 3300049822 Ga0501035_0124667 Ga0501035_0124667_273_1298 339
183 3300049824 Ga0501045_0007439 Ga0501045_0007439_4863_5891 339
184 3300050489 nmdc:mga03683_94541_c1 nmdc:mga03683_94541_c1_17_1093 339
185 3300050493 nmdc:mga0k408_54843_c1 nmdc:mga0k408_54843_c1_399_1475 339
186 3300050494 nmdc:mga06z11_3267_c1 nmdc:mga06z11_3267_c1_5175_6251 339
187 3300053119 Ga0500595_011037 Ga0500595_011037_553_1590 339
188 3300053131 Ga0500652_000452 Ga0500652_000452_10377_11414 339
189 3300053730 Ga0500645_054278 Ga0500645_054278_22_1098 339
190 3300060353 Ga0501082_0004526 Ga0501082_0004526_678_1706 339
191 3300060353 Ga0501082_0169444 Ga0501082_0169444_263_1291 339
192 3300061734 Ga0530510_0007623 Ga0530510_0007623_1498_2526 339
193 iso_pu_bacteria 2547132374 2548500321 339
194 iso_pu_bacteria 2643221570 2643864643 339
195 iso_pu_bacteria 2643221596 2643992742 339
196 iso_pu_bacteria 2643221609 2644058343 339
197 iso_pu_bacteria 2643221611 2644073395 339
198 iso_pu_bacteria 2643221652 2644296439 339
199 iso_pu_bacteria 2643221717 2644647130 339
200 iso_pu_bacteria 2738543012 2739244315 339
201 iso_pu_bacteria 2816332133 2816469746 339
202 iso_pu_bacteria 2919704043 2919705023 339
203 iso_pu_bacteria 2990710928 2990715225 339
204 3300003187 JGI25151J46595_10000545 JGI25151J46595_1000054514 340
205 3300003751 Ga0055538_1000010 Ga0055538_1000010270 340
206 3300003752 Ga0055539_1000015 Ga0055539_1000015270 340
207 3300003756 Ga0055533_1000018 Ga0055533_1000018270 340
208 3300003759 Ga0055525_1000020 Ga0055525_1000020270 340
209 3300003771 Ga0055526_1000336 Ga0055526_100033615 340
210 3300003771 Ga0055526_1004371 Ga0055526_10043715 340
211 3300003773 Ga0055537_1000060 Ga0055537_10000604 340
212 3300003773 Ga0055537_1001197 Ga0055537_10011974 340
213 3300003775 Ga0055524_1001147 Ga0055524_10011477 340
214 3300003775 Ga0055524_1001729 Ga0055524_10017295 340
215 3300003775 Ga0055524_1005063 Ga0055524_10050632 340
216 3300003784 Ga0055534_1000009 Ga0055534_100000943 340
217 3300003784 Ga0055534_1000341 Ga0055534_100034114 340
218 3300003784 Ga0055534_1000777 Ga0055534_100077711 340
219 3300003790 Ga0055528_1000012 Ga0055528_1000012136 340
220 3300003791 Ga0055530_10003376 Ga0055530_100033763 340
221 3300003792 Ga0055540_1000016 Ga0055540_100001685 340
222 3300003841 Ga0055541_1000011 Ga0055541_1000011270 340
223 3300005295 Ga0065707_10084750 Ga0065707_100847507 340
224 3300005329 Ga0070683_100065312 Ga0070683_1000653122 340
225 3300005336 Ga0070680_100011410 Ga0070680_1000114105 340
226 3300005337 Ga0070682_100000252 Ga0070682_10000025212 340
227 3300005338 Ga0068868_100140159 Ga0068868_1001401592 340
228 3300005338 Ga0068868_100172909 Ga0068868_1001729092 340
229 3300005353 Ga0070669_100049967 Ga0070669_1000499673 340
230 3300005354 Ga0070675_100250598 Ga0070675_1002505982 340
231 3300005364 Ga0070673_100086512 Ga0070673_1000865123 340
232 3300005367 Ga0070667_100038773 Ga0070667_1000387733 340
233 3300005441 Ga0070700_100122036 Ga0070700_1001220362 340
234 3300005455 Ga0070663_100137140 Ga0070663_1001371402 340
235 3300005455 Ga0070663_100148612 Ga0070663_1001486122 340
236 3300005456 Ga0070678_100109558 Ga0070678_1001095582 340
237 3300005459 Ga0068867_100001563 Ga0068867_1000015638 340
238 3300005459 Ga0068867_100212036 Ga0068867_1002120362 340
239 3300005530 Ga0070679_100000180 Ga0070679_10000018022 340
240 3300005539 Ga0068853_100145864 Ga0068853_1001458642 340
241 3300005543 Ga0070672_100014528 Ga0070672_1000145284 340
242 3300005543 Ga0070672_100109350 Ga0070672_1001093502 340
243 3300005548 Ga0070665_100094448 Ga0070665_1000944485 340
244 3300005548 Ga0070665_100218435 Ga0070665_1002184352 340
245 3300005577 Ga0068857_100005085 Ga0068857_1000050859 340
246 3300005578 Ga0068854_100036656 Ga0068854_1000366562 340
247 3300005614 Ga0068856_100501402 Ga0068856_1005014022 340
248 3300005617 Ga0068859_100033265 Ga0068859_1000332653 340
249 3300005617 Ga0068859_100126907 Ga0068859_1001269073 340
250 3300005718 Ga0068866_10160338 Ga0068866_101603381 340
251 3300005719 Ga0068861_100000654 Ga0068861_1000006547 340
252 3300005719 Ga0068861_100180278 Ga0068861_1001802782 340
253 3300005841 Ga0068863_100206010 Ga0068863_1002060103 340
254 3300005842 Ga0068858_100269925 Ga0068858_1002699252 340
255 3300005843 Ga0068860_100000602 Ga0068860_10000060237 340
256 3300005844 Ga0068862_100004504 Ga0068862_1000045047 340
257 3300005844 Ga0068862_100032137 Ga0068862_1000321372 340
258 3300005844 Ga0068862_100057123 Ga0068862_1000571233 340
259 3300006195 Ga0075366_10002354 Ga0075366_100023549 340
260 3300006195 Ga0075366_10020394 Ga0075366_100203942 340
261 3300006195 Ga0075366_10056364 Ga0075366_100563642 340
262 3300006195 Ga0075366_10060174 Ga0075366_100601743 340
263 3300006358 Ga0068871_100019604 Ga0068871_1000196044 340
264 3300006881 Ga0068865_100002296 Ga0068865_10000229610 340
265 3300006881 Ga0068865_100118490 Ga0068865_1001184902 340
266 3300006931 Ga0097620_100033265 Ga0097620_1000332653 340
267 3300006931 Ga0097620_100126910 Ga0097620_1001269103 340
268 3300009093 Ga0105240_10001549 Ga0105240_1000154910 340
269 3300009093 Ga0105240_10205200 Ga0105240_102052002 340
270 3300009098 Ga0105245_10000304 Ga0105245_1000030417 340
271 3300009545 Ga0105237_10003670 Ga0105237_100036706 340
272 3300009545 Ga0105237_10003738 Ga0105237_100037389 340
273 3300009551 Ga0105238_10004877 Ga0105238_100048778 340
274 3300009551 Ga0105238_10017238 Ga0105238_100172386 340
275 3300009551 Ga0105238_10071110 Ga0105238_100711103 340
276 3300009551 Ga0105238_10209044 Ga0105238_102090442 340
277 3300010375 Ga0105239_10005317 Ga0105239_100053176 340
278 3300010375 Ga0105239_10060721 Ga0105239_100607212 340
279 3300010375 Ga0105239_10345655 Ga0105239_103456552 340
280 3300011119 Ga0105246_10128394 Ga0105246_101283942 340
281 3300013296 Ga0157374_10370200 Ga0157374_103702002 340
282 3300013297 Ga0157378_10001074 Ga0157378_100010749 340
283 3300013297 Ga0157378_10005793 Ga0157378_100057932 340
284 3300013307 Ga0157372_10299267 Ga0157372_102992672 340
285 3300014326 Ga0157380_10184998 Ga0157380_101849982 340
286 3300014326 Ga0157380_10188195 Ga0157380_101881952 340
287 3300014745 Ga0157377_10169970 Ga0157377_101699702 340
288 3300014968 Ga0157379_10029133 Ga0157379_100291334 340
289 3300015261 Ga0182006_1000802 Ga0182006_100080213 340
290 3300021361 Ga0213872_10000547 Ga0213872_1000054717 340
291 3300021361 Ga0213872_10007605 Ga0213872_100076053 340
292 3300021361 Ga0213872_10036381 Ga0213872_100363812 340
293 3300025224 Ga0209784_100025 Ga0209784_100025267 340
294 3300025225 Ga0209566_100025 Ga0209566_100025267 340
295 3300025226 Ga0209674_100042 Ga0209674_100042267 340
296 3300025230 Ga0209563_100046 Ga0209563_100046267 340
297 3300025253 Ga0209677_100027 Ga0209677_100027267 340
298 3300025253 Ga0209677_100280 Ga0209677_10028012 340
299 3300025261 Ga0209233_1002090 Ga0209233_10020905 340
300 3300025263 Ga0209565_1000015 Ga0209565_1000015319 340
301 3300025263 Ga0209565_1000086 Ga0209565_1000086110 340
302 3300025263 Ga0209565_1007495 Ga0209565_10074952 340
303 3300025272 Ga0209455_1001166 Ga0209455_100116611 340
304 3300025273 Ga0209673_1000017 Ga0209673_1000017210 340
305 3300025291 Ga0209675_1000012 Ga0209675_1000012163 340
306 3300025291 Ga0209675_1000510 Ga0209675_100051013 340
307 3300025291 Ga0209675_1001661 Ga0209675_10016612 340
308 3300025291 Ga0209675_1001762 Ga0209675_10017628 340
309 3300025294 Ga0209025_1000059 Ga0209025_1000059177 340
310 3300025294 Ga0209025_1000380 Ga0209025_100038011 340
311 3300025294 Ga0209025_1000550 Ga0209025_100055046 340
312 3300025295 Ga0209564_1000016 Ga0209564_1000016276 340
313 3300025295 Ga0209564_1000814 Ga0209564_100081424 340
314 3300025295 Ga0209564_1001766 Ga0209564_10017665 340
315 3300025295 Ga0209564_1002095 Ga0209564_10020954 340
316 3300025298 Ga0209050_1000082 Ga0209050_1000082120 340
317 3300025298 Ga0209050_1004407 Ga0209050_10044078 340
318 3300025299 Ga0209256_1000045 Ga0209256_100004567 340
319 3300025299 Ga0209256_1000086 Ga0209256_1000086102 340
320 3300025299 Ga0209256_1000314 Ga0209256_100031440 340
321 3300025299 Ga0209256_1003909 Ga0209256_10039093 340
322 3300025303 Ga0209051_1000029 Ga0209051_1000029120 340
323 3300025304 Ga0209257_1000030 Ga0209257_1000030113 340
324 3300025907 Ga0207645_10218132 Ga0207645_102181322 340
325 3300025913 Ga0207695_10037106 Ga0207695_100371062 340
326 3300025921 Ga0207652_10009390 Ga0207652_100093906 340
327 3300025923 Ga0207681_10082670 Ga0207681_100826702 340
328 3300025924 Ga0207694_10004641 Ga0207694_100046414 340
329 3300025924 Ga0207694_10091014 Ga0207694_100910142 340
330 3300025925 Ga0207650_10056708 Ga0207650_100567083 340
331 3300025926 Ga0207659_10216757 Ga0207659_102167572 340
332 3300025927 Ga0207687_10006397 Ga0207687_100063977 340
333 3300025935 Ga0207709_10089506 Ga0207709_100895063 340
334 3300025940 Ga0207691_10012884 Ga0207691_100128842 340
335 3300025940 Ga0207691_10028712 Ga0207691_100287122 340
336 3300025942 Ga0207689_10075235 Ga0207689_100752352 340
337 3300025949 Ga0207667_10009983 Ga0207667_100099835 340
338 3300025949 Ga0207667_10218116 Ga0207667_102181162 340
339 3300025981 Ga0207640_10059297 Ga0207640_100592972 340
340 3300026035 Ga0207703_10165759 Ga0207703_101657592 340
341 3300026067 Ga0207678_10351679 Ga0207678_103516792 340
342 3300026089 Ga0207648_10000582 Ga0207648_1000058230 340
343 3300026089 Ga0207648_10109504 Ga0207648_101095043 340
344 3300026116 Ga0207674_10002404 Ga0207674_100024044 340
345 3300026118 Ga0207675_100000601 Ga0207675_10000060128 340
346 3300026118 Ga0207675_100087055 Ga0207675_1000870553 340
347 3300026121 Ga0207683_10071593 Ga0207683_100715933 340
348 3300026142 Ga0207698_10112555 Ga0207698_101125553 340
349 3300027552 Ga0209982_1004484 Ga0209982_10044843 340
350 3300028379 Ga0268266_10216977 Ga0268266_102169772 340
351 3300028379 Ga0268266_10329639 Ga0268266_103296392 340
352 3300028380 Ga0268265_10003246 Ga0268265_100032468 340
353 3300028380 Ga0268265_10210613 Ga0268265_102106132 340
354 3300028381 Ga0268264_10001438 Ga0268264_1000143815 340
355 3300028556 Ga0265337_1001439 Ga0265337_10014394 340
356 3300028558 Ga0265326_10001380 Ga0265326_100013803 340
357 3300028563 Ga0265319_1002798 Ga0265319_10027989 340
358 3300028573 Ga0265334_10005260 Ga0265334_100052605 340
359 3300028577 Ga0265318_10003474 Ga0265318_100034747 340
360 3300028653 Ga0265323_10000992 Ga0265323_100009923 340
361 3300028654 Ga0265322_10002589 Ga0265322_100025893 340
362 3300028666 Ga0265336_10000063 Ga0265336_1000006377 340
363 3300028786 Ga0307517_10095068 Ga0307517_100950682 340
364 3300028800 Ga0265338_10000087 Ga0265338_10000087143 340
365 3300028800 Ga0265338_10000154 Ga0265338_1000015417 340
366 3300028800 Ga0265338_10003118 Ga0265338_1000311824 340
367 3300029957 Ga0265324_10001590 Ga0265324_1000159011 340
368 3300030521 Ga0307511_10076742 Ga0307511_100767422 340
369 3300031247 Ga0265340_10032584 Ga0265340_100325842 340
370 3300031507 Ga0307509_10009946 Ga0307509_100099466 340
371 3300031616 Ga0307508_10011607 Ga0307508_100116073 340
372 3300031730 Ga0307516_10083114 Ga0307516_100831142 340
373 3300031730 Ga0307516_10176584 Ga0307516_101765841 340
374 3300031838 Ga0307518_10038656 Ga0307518_100386563 340
375 3300032133 Ga0316583_10002590 Ga0316583_100025903 340
376 3300033180 Ga0307510_10025998 Ga0307510_100259984 340
377 3300033180 Ga0307510_10052888 Ga0307510_100528883 340
378 3300035695 Ga0373927_0088386 Ga0373927_0088386_651_1682 340
379 3300036401 Ga0373937_0323570 Ga0373937_0323570_324_1349 340
380 3300036712 Ga0316584_0002088 Ga0316584_0002088_6311_7348 340
381 3300037068 Ga0373925_0004343 Ga0373925_0004343_4958_5983 340
382 3300037471 Ga0395905_0002007 Ga0395905_0002007_2604_3650 340
383 3300039437 Ga0436365_0082862 Ga0436365_0082862_434_1459 340
384 3300039437 Ga0436365_1221318 Ga0436365_1221318_148_1173 340
385 3300039447 Ga0436361_0527730 Ga0436361_0527730_24272_25309 340
386 3300039447 Ga0436361_0632584 Ga0436361_0632584_2183_3208 340
387 3300039447 Ga0436361_0761768 Ga0436361_0761768_4771_5808 340
388 3300042007 Ga0439449_0005387 Ga0439449_0005387_3631_4668 340
389 3300042876 Ga0451577_0000271 Ga0451577_0000271_20550_21575 340
390 3300044684 Ga0466966_0009768 Ga0466966_0009768_2588_3625 340
391 3300044694 Ga0466963_0000320 Ga0466963_0000320_7658_8686 340
392 3300044712 Ga0453684_0000005 Ga0453684_0000005_97027_98052 340
393 3300044712 Ga0453684_0000583 Ga0453684_0000583_130675_131700 340
394 3300044712 Ga0453684_0000702 Ga0453684_0000702_22925_24145 340
395 3300044712 Ga0453684_0006332 Ga0453684_0006332_3925_4950 340
396 3300044735 Ga0466968_0002656 Ga0466968_0002656_5080_6105 340
397 3300044842 Ga0466957_0036330 Ga0466957_0036330_22_1065 340
398 3300045051 Ga0451576_0000137 Ga0451576_0000137_4241_5266 340
399 3300045051 Ga0451576_0000259 Ga0451576_0000259_37792_38817 340
400 3300045976 Ga0466967_0236995 Ga0466967_0236995_463_1491 340
401 3300046453 Ga0495627_000007 Ga0495627_000007_358045_359082 340
402 3300046457 Ga0495590_0000008 Ga0495590_0000008_28252_29295 340
403 3300046458 Ga0495591_000043 Ga0495591_000043_98096_99127 340
404 3300046463 Ga0495653_0000002 Ga0495653_0000002_301091_302116 340
405 3300046463 Ga0495653_0012104 Ga0495653_0012104_2471_3508 340
406 3300046474 Ga0495605_0008667 Ga0495605_0008667_1063_2100 340
407 3300046491 Ga0495584_0000025 Ga0495584_0000025_29489_30520 340
408 3300046491 Ga0495584_0000173 Ga0495584_0000173_6252_7289 340
409 3300046492 Ga0495585_0004296 Ga0495585_0004296_2006_3043 340
410 3300046492 Ga0495585_0055384 Ga0495585_0055384_610_1641 340
411 3300046499 Ga0495594_0038315 Ga0495594_0038315_970_1995 340
412 3300046500 Ga0495596_0000604 Ga0495596_0000604_15551_16588 340
413 3300046500 Ga0495596_0004602 Ga0495596_0004602_3872_4909 340
414 3300046500 Ga0495596_0019695 Ga0495596_0019695_1148_2179 340
415 3300046501 Ga0495607_0014372 Ga0495607_0014372_1164_2201 340
416 3300046506 Ga0495583_0000011 Ga0495583_0000011_173428_174465 340
417 3300046506 Ga0495583_0000512 Ga0495583_0000512_25597_26628 340
418 3300046506 Ga0495583_0036138 Ga0495583_0036138_1057_2094 340
419 3300046512 Ga0495610_0002865 Ga0495610_0002865_7733_8764 340
420 3300046512 Ga0495610_0012368 Ga0495610_0012368_2199_3236 340
421 3300046513 Ga0495616_0000643 Ga0495616_0000643_22981_24018 340
422 3300046513 Ga0495616_0034632 Ga0495616_0034632_366_1403 340
423 3300046518 Ga0495631_0000337 Ga0495631_0000337_3814_4851 340
424 3300046518 Ga0495631_0018893 Ga0495631_0018893_841_1884 340
425 3300046518 Ga0495631_0023463 Ga0495631_0023463_975_2006 340
426 3300046519 Ga0495632_0017507 Ga0495632_0017507_1128_2165 340
427 3300046520 Ga0495637_0000009 Ga0495637_0000009_311047_312078 340
428 3300046522 Ga0495643_0000028 Ga0495643_0000028_259353_260390 340
429 3300046522 Ga0495643_0092054 Ga0495643_0092054_301_1326 340
430 3300046523 Ga0495644_0000119 Ga0495644_0000119_10058_11095 340
431 3300046523 Ga0495644_0023099 Ga0495644_0023099_700_1737 340
432 3300046523 Ga0495644_0074202 Ga0495644_0074202_140_1171 340
433 3300046524 Ga0495648_0062334 Ga0495648_0062334_1047_2084 340
434 3300046528 Ga0495642_0011402 Ga0495642_0011402_2197_3234 340
435 3300046538 Ga0495609_0000647 Ga0495609_0000647_22442_23479 340
436 3300046542 Ga0495597_0000762 Ga0495597_0000762_2057_3094 340
437 3300046542 Ga0495597_0000911 Ga0495597_0000911_76_1113 340
438 3300046557 Ga0495622_0000092 Ga0495622_0000092_7079_8116 340
439 3300046558 Ga0495633_0000181 Ga0495633_0000181_50943_51980 340
440 3300046558 Ga0495633_0000742 Ga0495633_0000742_888_1925 340
441 3300046558 Ga0495633_0004718 Ga0495633_0004718_561_1598 340
442 3300046616 Ga0495668_0000018 Ga0495668_0000018_170644_171681 340
443 3300046616 Ga0495668_0000028 Ga0495668_0000028_96207_97244 340
444 3300046616 Ga0495668_0042735 Ga0495668_0042735_20_1057 340
445 3300046648 Ga0495611_0000361 Ga0495611_0000361_1075_2106 340
446 3300046648 Ga0495611_0001188 Ga0495611_0001188_2011_3048 340
447 3300046648 Ga0495611_0006888 Ga0495611_0006888_331_1368 340
448 3300046648 Ga0495611_0013006 Ga0495611_0013006_1129_2166 340
449 3300046660 Ga0495625_0077111 Ga0495625_0077111_556_1581 340
450 3300046665 Ga0495661_0003126 Ga0495661_0003126_6771_7808 340
451 3300046665 Ga0495661_0007978 Ga0495661_0007978_707_1744 340
452 3300046665 Ga0495661_0034022 Ga0495661_0034022_757_1794 340
453 3300046665 Ga0495661_0178883 Ga0495661_0178883_38_1069 340
454 3300046681 Ga0495647_0001791 Ga0495647_0001791_4904_5929 340
455 3300046684 Ga0495669_0007195 Ga0495669_0007195_2669_3706 340
456 3300046691 Ga0495670_0000053 Ga0495670_0000053_27548_28585 340
457 3300046691 Ga0495670_0012551 Ga0495670_0012551_2449_3486 340
458 3300046694 Ga0495649_0000028 Ga0495649_0000028_112506_113537 340
459 3300046694 Ga0495649_0032021 Ga0495649_0032021_1707_2732 340
460 3300046794 Ga0495589_0018666 Ga0495589_0018666_1422_2447 340
461 3300046810 Ga0495660_0020740 Ga0495660_0020740_1509_2534 340
462 3300046810 Ga0495660_0085207 Ga0495660_0085207_478_1503 340
463 3300047318 Ga0495636_0004208 Ga0495636_0004208_1206_2231 340
464 3300047320 Ga0495672_0000055 Ga0495672_0000055_98048_99079 340
465 3300047320 Ga0495672_0003194 Ga0495672_0003194_6985_8022 340
466 3300047320 Ga0495672_0019403 Ga0495672_0019403_3180_4205 340
467 3300047323 Ga0495683_0000047 Ga0495683_0000047_95164_96195 340
468 3300047443 Ga0495687_003723 Ga0495687_003723_1917_2954 340
469 3300047443 Ga0495687_010481 Ga0495687_010481_2974_3999 340
470 3300047443 Ga0495687_011218 Ga0495687_011218_2004_3029 340
471 3300047445 Ga0495677_0000986 Ga0495677_0000986_9991_11028 340
472 3300047445 Ga0495677_0007612 Ga0495677_0007612_2841_3878 340
473 3300047445 Ga0495677_0011525 Ga0495677_0011525_2182_3219 340
474 3300047445 Ga0495677_0025374 Ga0495677_0025374_549_1586 340
475 3300047446 Ga0495679_010120 Ga0495679_010120_2143_3174 340
476 3300047469 Ga0495673_0000008 Ga0495673_0000008_429396_430433 340
477 3300047470 Ga0495681_0006008 Ga0495681_0006008_3846_4883 340
478 3300047470 Ga0495681_0011106 Ga0495681_0011106_212_1249 340
479 3300048088 Ga0495602_0307882 Ga0495602_0307882_45_1094 340
480 3300048091 Ga0495626_0007108 Ga0495626_0007108_2278_3315 340
481 3300048091 Ga0495626_0007741 Ga0495626_0007741_1892_2929 340
482 3300048091 Ga0495626_0030425 Ga0495626_0030425_163_1200 340
483 3300048903 Ga0496100_0000929 Ga0496100_0000929_4659_5684 340
484 3300048904 Ga0496101_0005022 Ga0496101_0005022_852_1877 340
485 3300048905 Ga0496102_0014718 Ga0496102_0014718_3379_4404 340
486 3300048905 Ga0496102_0199474 Ga0496102_0199474_602_1627 340
487 3300048906 Ga0496103_0016204 Ga0496103_0016204_2287_3312 340
488 3300048907 Ga0496104_0002648 Ga0496104_0002648_6476_7501 340
489 3300048907 Ga0496104_0150125 Ga0496104_0150125_719_1744 340
490 3300048909 Ga0496106_0004659 Ga0496106_0004659_4280_5305 340
491 3300048910 Ga0496107_0025568 Ga0496107_0025568_2440_3465 340
492 3300048911 Ga0496108_0008379 Ga0496108_0008379_5123_6148 340
493 3300048911 Ga0496108_0077250 Ga0496108_0077250_847_1872 340
494 3300048912 Ga0496109_0022002 Ga0496109_0022002_1526_2551 340
495 3300048913 Ga0496110_0000729 Ga0496110_0000729_13547_14572 340
496 3300048913 Ga0496110_0008923 Ga0496110_0008923_4985_6010 340
497 3300048914 Ga0496111_0004705 Ga0496111_0004705_597_1622 340
498 3300048914 Ga0496111_0069535 Ga0496111_0069535_1380_2405 340
499 3300048915 Ga0496112_0005808 Ga0496112_0005808_3072_4097 340
500 3300048916 Ga0496113_0016931 Ga0496113_0016931_3170_4195 340
501 3300048916 Ga0496113_0042675 Ga0496113_0042675_1584_2609 340
502 3300048918 Ga0496115_0007693 Ga0496115_0007693_2443_3468 340
503 3300048919 Ga0496116_0064205 Ga0496116_0064205_460_1491 340
504 3300048924 Ga0496121_0055079 Ga0496121_0055079_404_1429 340
505 3300049459 Ga0495678_000060 Ga0495678_000060_112567_113604 340
506 3300049459 Ga0495678_000266 Ga0495678_000266_36022_37059 340
507 3300049459 Ga0495678_039730 Ga0495678_039730_577_1623 340
508 3300049459 Ga0495678_039877 Ga0495678_039877_459_1496 340
509 3300049460 Ga0495682_0000035 Ga0495682_0000035_64185_65222 340
510 3300049568 Ga0501031_0239964 Ga0501031_0239964_22_1050 340
511 3300049571 Ga0501034_0274409 Ga0501034_0274409_478_1506 340
512 3300049572 Ga0501036_0105368 Ga0501036_0105368_1210_2238 340
513 3300049573 Ga0501037_0164638 Ga0501037_0164638_292_1320 340
514 3300049574 Ga0501038_0023790 Ga0501038_0023790_2977_4002 340
515 3300049578 Ga0501042_0056056 Ga0501042_0056056_1693_2721 340
516 3300049579 Ga0501043_0021150 Ga0501043_0021150_3965_4993 340
517 3300049579 Ga0501043_0292325 Ga0501043_0292325_60_1088 340
518 3300049580 Ga0501046_0094302 Ga0501046_0094302_241_1269 340
519 3300049580 Ga0501046_0182877 Ga0501046_0182877_228_1256 340
520 3300049581 Ga0501047_0004563 Ga0501047_0004563_7173_8201 340
521 3300049581 Ga0501047_0101760 Ga0501047_0101760_946_1974 340
522 3300049582 Ga0501048_0008908 Ga0501048_0008908_101_1129 340
523 3300049582 Ga0501048_0042759 Ga0501048_0042759_1265_2293 340
524 3300049822 Ga0501035_0024668 Ga0501035_0024668_4364_5392 340
525 3300049823 Ga0501044_0011617 Ga0501044_0011617_7320_8345 340
526 3300049823 Ga0501044_0046836 Ga0501044_0046836_124_1152 340
527 3300049823 Ga0501044_0047853 Ga0501044_0047853_1857_2885 340
528 3300049823 Ga0501044_0049233 Ga0501044_0049233_2075_3103 340
529 3300049824 Ga0501045_0037446 Ga0501045_0037446_160_1185 340
530 3300050493 nmdc:mga0k408_221_c1 nmdc:mga0k408_221_c1_12552_13577 340
531 3300050493 nmdc:mga0k408_62462_c1 nmdc:mga0k408_62462_c1_101_1126 340
532 3300053117 Ga0500593_000250 Ga0500593_000250_13946_14977 340
533 3300053145 Ga0500586_000197 Ga0500586_000197_10549_11586 340
534 3300053161 Ga0500634_0001009 Ga0500634_0001009_2441_3466 340
535 iso_pu_bacteria 2765235838 2765570804 340
536 iso_pu_bacteria 2808606386 2808984141 340
537 iso_pu_bacteria 2808606415 2809131945 340
538 iso_pu_bacteria 2808606418 2809146995 340
539 iso_pu_bacteria 2808606419 2809151568 340
540 iso_pu_bacteria 2842711865 2842715392 340
541 iso_pu_bacteria 2852618963 2852622973 340
542 iso_pu_bacteria 2857553236 2857554544 340
543 iso_pu_bacteria 2904439833 2904440011 340
544 iso_pu_bacteria 2904530477 2904531041 340
545 iso_pu_bacteria 2904584206 2904587314 340
546 iso_pu_bacteria 2904589729 2904592651 340
547 iso_pu_bacteria 2904601388 2904604567 340
548 iso_pu_bacteria 2919046199 2919050339 340
549 iso_pu_bacteria 2919079590 2919082388 340
550 3300001991 JGI24743J22301_10000797 JGI24743J22301_100007972 341
551 3300002073 JGI24745J21846_1009742 JGI24745J21846_10097421 341
552 3300002244 JGI24742J22300_10009999 JGI24742J22300_100099992 341
553 3300002773 JGI25152J39213_1004123 JGI25152J39213_10041233 341
554 3300002987 JGI25159J45721_1007113 JGI25159J45721_10071133 341
555 3300003187 JGI25151J46595_10003021 JGI25151J46595_100030218 341
556 3300003203 JGI25406J46586_10004727 JGI25406J46586_100047277 341
557 3300003203 JGI25406J46586_10007846 JGI25406J46586_100078464 341
558 3300003215 JGI25153J46596_10000540 JGI25153J46596_1000054014 341
559 3300003215 JGI25153J46596_10002993 JGI25153J46596_100029938 341
560 3300003354 JGI25160J50197_1020348 JGI25160J50197_10203482 341
561 3300003771 Ga0055526_1005207 Ga0055526_10052077 341
562 3300003775 Ga0055524_1000157 Ga0055524_100015722 341
563 3300003781 Ga0055536_1003357 Ga0055536_10033573 341
564 3300003781 Ga0055536_1004808 Ga0055536_10048084 341
565 3300003784 Ga0055534_1000858 Ga0055534_100085810 341
566 3300003784 Ga0055534_1001653 Ga0055534_10016534 341
567 3300003791 Ga0055530_10000311 Ga0055530_1000031111 341
568 3300003792 Ga0055540_1001497 Ga0055540_10014974 341
569 3300003792 Ga0055540_1001826 Ga0055540_100182613 341
570 3300003792 Ga0055540_1005932 Ga0055540_10059325 341
571 3300003792 Ga0055540_1025950 Ga0055540_10259502 341
572 3300003794 Ga0055531_10000103 Ga0055531_1000010333 341
573 3300003794 Ga0055531_10001224 Ga0055531_1000122415 341
574 3300003794 Ga0055531_10001302 Ga0055531_100013024 341
575 3300003794 Ga0055531_10001335 Ga0055531_100013359 341
576 3300003794 Ga0055531_10002563 Ga0055531_1000256313 341
577 3300005262 Ga0065165_1000834 Ga0065165_10008346 341
578 3300005262 Ga0065165_1002832 Ga0065165_10028323 341
579 3300005288 Ga0065714_10092228 Ga0065714_100922281 341
580 3300005290 Ga0065712_10080409 Ga0065712_100804092 341
581 3300005290 Ga0065712_10106004 Ga0065712_101060043 341
582 3300005293 Ga0065715_10118502 Ga0065715_101185023 341
583 3300005327 Ga0070658_10000534 Ga0070658_1000053424 341
584 3300005327 Ga0070658_10229495 Ga0070658_102294952 341
585 3300005328 Ga0070676_10002014 Ga0070676_100020149 341
586 3300005328 Ga0070676_10012319 Ga0070676_100123193 341
587 3300005328 Ga0070676_10026321 Ga0070676_100263214 341
588 3300005329 Ga0070683_100024091 Ga0070683_1000240916 341
589 3300005329 Ga0070683_100024988 Ga0070683_1000249882 341
590 3300005329 Ga0070683_100246277 Ga0070683_1002462772 341
591 3300005330 Ga0070690_100007036 Ga0070690_1000070363 341
592 3300005330 Ga0070690_100009057 Ga0070690_1000090572 341
593 3300005330 Ga0070690_100016117 Ga0070690_1000161174 341
594 3300005330 Ga0070690_100029571 Ga0070690_1000295712 341
595 3300005330 Ga0070690_100069749 Ga0070690_1000697493 341
596 3300005331 Ga0070670_100000863 Ga0070670_10000086316 341
597 3300005331 Ga0070670_100001673 Ga0070670_1000016734 341
598 3300005331 Ga0070670_100017556 Ga0070670_1000175562 341
599 3300005331 Ga0070670_100018340 Ga0070670_1000183404 341
600 3300005331 Ga0070670_100070670 Ga0070670_1000706702 341
601 3300005333 Ga0070677_10002127 Ga0070677_100021274 341
602 3300005334 Ga0068869_100004158 Ga0068869_1000041584 341
603 3300005334 Ga0068869_100038646 Ga0068869_1000386463 341
604 3300005334 Ga0068869_100053280 Ga0068869_1000532803 341
605 3300005334 Ga0068869_100099685 Ga0068869_1000996852 341
606 3300005334 Ga0068869_100168305 Ga0068869_1001683052 341
607 3300005335 Ga0070666_10001432 Ga0070666_100014322 341
608 3300005335 Ga0070666_10006463 Ga0070666_100064633 341
609 3300005335 Ga0070666_10204678 Ga0070666_102046781 341
610 3300005338 Ga0068868_100007971 Ga0068868_1000079715 341
611 3300005338 Ga0068868_100012306 Ga0068868_1000123065 341
612 3300005338 Ga0068868_100018460 Ga0068868_1000184605 341
613 3300005338 Ga0068868_100045303 Ga0068868_1000453033 341
614 3300005338 Ga0068868_100206984 Ga0068868_1002069842 341
615 3300005338 Ga0068868_100237010 Ga0068868_1002370101 341
616 3300005339 Ga0070660_100004251 Ga0070660_1000042517 341
617 3300005339 Ga0070660_100148018 Ga0070660_1001480182 341
618 3300005339 Ga0070660_100236251 Ga0070660_1002362512 341
619 3300005340 Ga0070689_100002998 Ga0070689_1000029984 341
620 3300005340 Ga0070689_100008431 Ga0070689_1000084312 341
621 3300005340 Ga0070689_100010538 Ga0070689_1000105382 341
622 3300005340 Ga0070689_100019686 Ga0070689_1000196865 341
623 3300005340 Ga0070689_100027445 Ga0070689_1000274453 341
624 3300005340 Ga0070689_100405937 Ga0070689_1004059371 341
625 3300005343 Ga0070687_100100407 Ga0070687_1001004071 341
626 3300005343 Ga0070687_100126658 Ga0070687_1001266582 341
627 3300005344 Ga0070661_100035765 Ga0070661_1000357653 341
628 3300005344 Ga0070661_100064928 Ga0070661_1000649282 341
629 3300005344 Ga0070661_100091323 Ga0070661_1000913232 341
630 3300005344 Ga0070661_100181651 Ga0070661_1001816512 341
631 3300005345 Ga0070692_10017952 Ga0070692_100179521 341
632 3300005345 Ga0070692_10034767 Ga0070692_100347672 341
633 3300005345 Ga0070692_10071600 Ga0070692_100716002 341
634 3300005347 Ga0070668_100005618 Ga0070668_1000056186 341
635 3300005347 Ga0070668_100085408 Ga0070668_1000854082 341
636 3300005353 Ga0070669_100003725 Ga0070669_1000037259 341
637 3300005353 Ga0070669_100111702 Ga0070669_1001117021 341
638 3300005353 Ga0070669_100192789 Ga0070669_1001927892 341
639 3300005354 Ga0070675_100000605 Ga0070675_10000060517 341
640 3300005354 Ga0070675_100011272 Ga0070675_1000112724 341
641 3300005354 Ga0070675_100041359 Ga0070675_1000413593 341
642 3300005354 Ga0070675_100049771 Ga0070675_1000497712 341
643 3300005354 Ga0070675_100060864 Ga0070675_1000608642 341
644 3300005354 Ga0070675_100091225 Ga0070675_1000912252 341
645 3300005354 Ga0070675_100098724 Ga0070675_1000987242 341
646 3300005355 Ga0070671_100010636 Ga0070671_1000106364 341
647 3300005355 Ga0070671_100033086 Ga0070671_1000330863 341
648 3300005355 Ga0070671_100043588 Ga0070671_1000435882 341
649 3300005355 Ga0070671_100064323 Ga0070671_1000643233 341
650 3300005355 Ga0070671_100216519 Ga0070671_1002165191 341
651 3300005355 Ga0070671_100223975 Ga0070671_1002239752 341
652 3300005356 Ga0070674_100005518 Ga0070674_1000055185 341
653 3300005356 Ga0070674_100008774 Ga0070674_1000087744 341
654 3300005356 Ga0070674_100011027 Ga0070674_1000110274 341
655 3300005356 Ga0070674_100012896 Ga0070674_1000128962 341
656 3300005356 Ga0070674_100088011 Ga0070674_1000880112 341
657 3300005364 Ga0070673_100000416 Ga0070673_1000004166 341
658 3300005364 Ga0070673_100004008 Ga0070673_1000040087 341
659 3300005364 Ga0070673_100027949 Ga0070673_1000279494 341
660 3300005364 Ga0070673_100031352 Ga0070673_1000313522 341
661 3300005364 Ga0070673_100037138 Ga0070673_1000371383 341
662 3300005364 Ga0070673_100048421 Ga0070673_1000484213 341
663 3300005364 Ga0070673_100106692 Ga0070673_1001066922 341
664 3300005365 Ga0070688_100004155 Ga0070688_1000041556 341
665 3300005365 Ga0070688_100004763 Ga0070688_1000047635 341
666 3300005366 Ga0070659_100007556 Ga0070659_1000075566 341
667 3300005366 Ga0070659_100261485 Ga0070659_1002614852 341
668 3300005367 Ga0070667_100004143 Ga0070667_1000041434 341
669 3300005367 Ga0070667_100006265 Ga0070667_1000062654 341
670 3300005367 Ga0070667_100017248 Ga0070667_1000172481 341
671 3300005367 Ga0070667_100039343 Ga0070667_1000393433 341
672 3300005367 Ga0070667_100062521 Ga0070667_1000625212 341
673 3300005367 Ga0070667_100067596 Ga0070667_1000675962 341
674 3300005367 Ga0070667_100291399 Ga0070667_1002913992 341
675 3300005434 Ga0070709_10000424 Ga0070709_1000042415 341
676 3300005434 Ga0070709_10003057 Ga0070709_100030577 341
677 3300005435 Ga0070714_100003678 Ga0070714_10000367810 341
678 3300005435 Ga0070714_100005399 Ga0070714_1000053992 341
679 3300005436 Ga0070713_100000019 Ga0070713_10000001929 341
680 3300005436 Ga0070713_100015895 Ga0070713_1000158954 341
681 3300005436 Ga0070713_100048177 Ga0070713_1000481772 341
682 3300005436 Ga0070713_100519499 Ga0070713_1005194991 341
683 3300005437 Ga0070710_10001915 Ga0070710_100019157 341
684 3300005438 Ga0070701_10004081 Ga0070701_100040814 341
685 3300005438 Ga0070701_10009235 Ga0070701_100092353 341
686 3300005439 Ga0070711_100001539 Ga0070711_10000153910 341
687 3300005439 Ga0070711_100002750 Ga0070711_10000275012 341
688 3300005439 Ga0070711_100120904 Ga0070711_1001209042 341
689 3300005439 Ga0070711_100256866 Ga0070711_1002568662 341
690 3300005441 Ga0070700_100004241 Ga0070700_1000042415 341
691 3300005445 Ga0070708_100000889 Ga0070708_10000088916 341
692 3300005455 Ga0070663_100008820 Ga0070663_1000088206 341
693 3300005455 Ga0070663_100052002 Ga0070663_1000520023 341
694 3300005456 Ga0070678_100002173 Ga0070678_1000021736 341
695 3300005456 Ga0070678_100007462 Ga0070678_1000074623 341
696 3300005456 Ga0070678_100104983 Ga0070678_1001049833 341
697 3300005456 Ga0070678_100106303 Ga0070678_1001063032 341
698 3300005456 Ga0070678_100153245 Ga0070678_1001532452 341
699 3300005457 Ga0070662_100000546 Ga0070662_10000054621 341
700 3300005457 Ga0070662_100109421 Ga0070662_1001094212 341
701 3300005458 Ga0070681_10002422 Ga0070681_1000242210 341
702 3300005458 Ga0070681_10156558 Ga0070681_101565581 341
703 3300005459 Ga0068867_100000041 Ga0068867_10000004139 341
704 3300005459 Ga0068867_100001878 Ga0068867_10000187810 341
705 3300005459 Ga0068867_100005891 Ga0068867_1000058915 341
706 3300005459 Ga0068867_100007968 Ga0068867_1000079683 341
707 3300005459 Ga0068867_100044748 Ga0068867_1000447481 341
708 3300005459 Ga0068867_100129629 Ga0068867_1001296292 341
709 3300005459 Ga0068867_100158557 Ga0068867_1001585571 341
710 3300005466 Ga0070685_10013969 Ga0070685_100139692 341
711 3300005466 Ga0070685_10016951 Ga0070685_100169515 341
712 3300005466 Ga0070685_10024895 Ga0070685_100248953 341
713 3300005466 Ga0070685_10084117 Ga0070685_100841172 341
714 3300005467 Ga0070706_100003229 Ga0070706_10000322913 341
715 3300005467 Ga0070706_100270019 Ga0070706_1002700191 341
716 3300005468 Ga0070707_100023650 Ga0070707_1000236503 341
717 3300005468 Ga0070707_100243072 Ga0070707_1002430722 341
718 3300005471 Ga0070698_100269772 Ga0070698_1002697722 341
719 3300005530 Ga0070679_100079119 Ga0070679_1000791192 341
720 3300005530 Ga0070679_100217475 Ga0070679_1002174752 341
721 3300005530 Ga0070679_100220439 Ga0070679_1002204392 341
722 3300005535 Ga0070684_100000578 Ga0070684_1000005787 341
723 3300005535 Ga0070684_100004669 Ga0070684_1000046697 341
724 3300005535 Ga0070684_100020163 Ga0070684_1000201633 341
725 3300005535 Ga0070684_100077838 Ga0070684_1000778383 341
726 3300005539 Ga0068853_100005895 Ga0068853_1000058953 341
727 3300005539 Ga0068853_100021596 Ga0068853_1000215966 341
728 3300005539 Ga0068853_100034801 Ga0068853_1000348015 341
729 3300005539 Ga0068853_100061464 Ga0068853_1000614644 341
730 3300005539 Ga0068853_100108685 Ga0068853_1001086852 341
731 3300005539 Ga0068853_100123705 Ga0068853_1001237052 341
732 3300005543 Ga0070672_100000414 Ga0070672_1000004144 341
733 3300005543 Ga0070672_100008479 Ga0070672_1000084797 341
734 3300005543 Ga0070672_100008902 Ga0070672_10000890210 341
735 3300005543 Ga0070672_100011272 Ga0070672_1000112724 341
736 3300005543 Ga0070672_100045698 Ga0070672_1000456982 341
737 3300005543 Ga0070672_100071345 Ga0070672_1000713452 341
738 3300005543 Ga0070672_100148133 Ga0070672_1001481332 341
739 3300005543 Ga0070672_100255976 Ga0070672_1002559762 341
740 3300005543 Ga0070672_100262709 Ga0070672_1002627092 341
741 3300005543 Ga0070672_100451935 Ga0070672_1004519351 341
742 3300005544 Ga0070686_100009212 Ga0070686_1000092124 341
743 3300005544 Ga0070686_100017437 Ga0070686_1000174373 341
744 3300005547 Ga0070693_100070874 Ga0070693_1000708742 341
745 3300005548 Ga0070665_100002566 Ga0070665_10000256616 341
746 3300005548 Ga0070665_100010851 Ga0070665_10001085110 341
747 3300005548 Ga0070665_100017168 Ga0070665_1000171685 341
748 3300005548 Ga0070665_100080934 Ga0070665_1000809342 341
749 3300005548 Ga0070665_100093316 Ga0070665_1000933163 341
750 3300005548 Ga0070665_100174660 Ga0070665_1001746603 341
751 3300005549 Ga0070704_100050726 Ga0070704_1000507262 341
752 3300005549 Ga0070704_100085978 Ga0070704_1000859782 341
753 3300005563 Ga0068855_100001533 Ga0068855_10000153311 341
754 3300005563 Ga0068855_100008719 Ga0068855_1000087193 341
755 3300005563 Ga0068855_100016734 Ga0068855_1000167345 341
756 3300005563 Ga0068855_100051277 Ga0068855_1000512774 341
757 3300005563 Ga0068855_100132479 Ga0068855_1001324792 341
758 3300005563 Ga0068855_100332842 Ga0068855_1003328421 341
759 3300005563 Ga0068855_100462796 Ga0068855_1004627962 341
760 3300005564 Ga0070664_100001978 Ga0070664_1000019789 341
761 3300005564 Ga0070664_100021313 Ga0070664_1000213133 341
762 3300005564 Ga0070664_100111346 Ga0070664_1001113462 341
763 3300005564 Ga0070664_100343365 Ga0070664_1003433652 341
764 3300005564 Ga0070664_100440653 Ga0070664_1004406532 341
765 3300005577 Ga0068857_100012412 Ga0068857_1000124124 341
766 3300005577 Ga0068857_100020815 Ga0068857_1000208153 341
767 3300005577 Ga0068857_100029733 Ga0068857_1000297332 341
768 3300005577 Ga0068857_100233400 Ga0068857_1002334002 341
769 3300005578 Ga0068854_100051600 Ga0068854_1000516003 341
770 3300005614 Ga0068856_100000409 Ga0068856_1000004097 341
771 3300005614 Ga0068856_100000762 Ga0068856_10000076231 341
772 3300005614 Ga0068856_100026700 Ga0068856_1000267003 341
773 3300005614 Ga0068856_100093824 Ga0068856_1000938242 341
774 3300005614 Ga0068856_100150706 Ga0068856_1001507062 341
775 3300005615 Ga0070702_100058566 Ga0070702_1000585662 341
776 3300005616 Ga0068852_100003141 Ga0068852_10000314111 341
777 3300005616 Ga0068852_100069880 Ga0068852_1000698802 341
778 3300005616 Ga0068852_100070212 Ga0068852_1000702122 341
779 3300005616 Ga0068852_100169402 Ga0068852_1001694022 341
780 3300005617 Ga0068859_100001521 Ga0068859_1000015213 341
781 3300005617 Ga0068859_100005041 Ga0068859_1000050413 341
782 3300005617 Ga0068859_100023535 Ga0068859_1000235356 341
783 3300005617 Ga0068859_100027160 Ga0068859_1000271604 341
784 3300005617 Ga0068859_100128172 Ga0068859_1001281722 341
785 3300005618 Ga0068864_100000365 Ga0068864_1000003652 341
786 3300005618 Ga0068864_100005574 Ga0068864_1000055747 341
787 3300005618 Ga0068864_100033367 Ga0068864_1000333674 341
788 3300005618 Ga0068864_100034309 Ga0068864_1000343094 341
789 3300005718 Ga0068866_10018183 Ga0068866_100181832 341
790 3300005719 Ga0068861_100004095 Ga0068861_1000040958 341
791 3300005719 Ga0068861_100072427 Ga0068861_1000724272 341
792 3300005719 Ga0068861_100109272 Ga0068861_1001092723 341
793 3300005834 Ga0068851_10001795 Ga0068851_100017959 341
794 3300005834 Ga0068851_10017743 Ga0068851_100177434 341
795 3300005840 Ga0068870_10009255 Ga0068870_100092553 341
796 3300005841 Ga0068863_100011694 Ga0068863_1000116948 341
797 3300005841 Ga0068863_100014739 Ga0068863_1000147394 341
798 3300005841 Ga0068863_100027447 Ga0068863_1000274472 341
799 3300005841 Ga0068863_100037388 Ga0068863_1000373886 341
800 3300005841 Ga0068863_100047519 Ga0068863_1000475196 341
801 3300005842 Ga0068858_100000738 Ga0068858_10000073834 341
802 3300005842 Ga0068858_100016017 Ga0068858_1000160177 341
803 3300005842 Ga0068858_100038510 Ga0068858_1000385103 341
804 3300005842 Ga0068858_100038617 Ga0068858_1000386172 341
805 3300005842 Ga0068858_100042577 Ga0068858_1000425775 341
806 3300005842 Ga0068858_100110531 Ga0068858_1001105311 341
807 3300005842 Ga0068858_100135674 Ga0068858_1001356742 341
808 3300005843 Ga0068860_100000101 Ga0068860_10000010169 341
809 3300005843 Ga0068860_100018313 Ga0068860_1000183134 341
810 3300005843 Ga0068860_100071506 Ga0068860_1000715063 341
811 3300005843 Ga0068860_100105526 Ga0068860_1001055263 341
812 3300005843 Ga0068860_100169807 Ga0068860_1001698072 341
813 3300005843 Ga0068860_100275266 Ga0068860_1002752662 341
814 3300005844 Ga0068862_100021693 Ga0068862_1000216935 341
815 3300005844 Ga0068862_100028032 Ga0068862_1000280325 341
816 3300005844 Ga0068862_100110564 Ga0068862_1001105642 341
817 3300005937 Ga0081455_10008730 Ga0081455_100087304 341
818 3300005937 Ga0081455_10027965 Ga0081455_100279653 341
819 3300005983 Ga0081540_1003649 Ga0081540_10036499 341
820 3300005983 Ga0081540_1008233 Ga0081540_10082337 341
821 3300005985 Ga0081539_10000220 Ga0081539_100002208 341
822 3300005985 Ga0081539_10045408 Ga0081539_100454082 341
823 3300006163 Ga0070715_10034825 Ga0070715_100348254 341
824 3300006173 Ga0070716_100008627 Ga0070716_1000086273 341
825 3300006175 Ga0070712_100012323 Ga0070712_1000123233 341
826 3300006175 Ga0070712_100044445 Ga0070712_1000444453 341
827 3300006177 Ga0075362_10016232 Ga0075362_100162325 341
828 3300006195 Ga0075366_10045457 Ga0075366_100454573 341
829 3300006195 Ga0075366_10079395 Ga0075366_100793952 341
830 3300006195 Ga0075366_10085256 Ga0075366_100852562 341
831 3300006237 Ga0097621_100001636 Ga0097621_1000016363 341
832 3300006237 Ga0097621_100022241 Ga0097621_1000222417 341
833 3300006237 Ga0097621_100025888 Ga0097621_1000258885 341
834 3300006237 Ga0097621_100039233 Ga0097621_1000392334 341
835 3300006237 Ga0097621_100083635 Ga0097621_1000836352 341
836 3300006237 Ga0097621_100221579 Ga0097621_1002215792 341
837 3300006237 Ga0097621_100276649 Ga0097621_1002766492 341
838 3300006237 Ga0097621_100290580 Ga0097621_1002905802 341
839 3300006353 Ga0075370_10003026 Ga0075370_100030265 341
840 3300006353 Ga0075370_10022952 Ga0075370_100229522 341
841 3300006353 Ga0075370_10041483 Ga0075370_100414833 341
842 3300006358 Ga0068871_100047818 Ga0068871_1000478184 341
843 3300006358 Ga0068871_100051822 Ga0068871_1000518222 341
844 3300006358 Ga0068871_100061257 Ga0068871_1000612572 341
845 3300006358 Ga0068871_100067090 Ga0068871_1000670904 341
846 3300006358 Ga0068871_100161611 Ga0068871_1001616112 341
847 3300006844 Ga0075428_100195429 Ga0075428_1001954293 341
848 3300006846 Ga0075430_100017933 Ga0075430_1000179333 341
849 3300006871 Ga0075434_100014097 Ga0075434_1000140979 341
850 3300006871 Ga0075434_100183202 Ga0075434_1001832022 341
851 3300006871 Ga0075434_100422475 Ga0075434_1004224752 341
852 3300006881 Ga0068865_100130634 Ga0068865_1001306342 341
853 3300006931 Ga0097620_100001521 Ga0097620_10000152125 341
854 3300006931 Ga0097620_100005041 Ga0097620_1000050413 341
855 3300006931 Ga0097620_100023534 Ga0097620_1000235346 341
856 3300006931 Ga0097620_100027159 Ga0097620_1000271594 341
857 3300006931 Ga0097620_100128181 Ga0097620_1001281812 341
858 3300006946 Ga0079104_1000724 Ga0079104_10007245 341
859 3300009092 Ga0105250_10014017 Ga0105250_100140173 341
860 3300009092 Ga0105250_10024702 Ga0105250_100247022 341
861 3300009093 Ga0105240_10000369 Ga0105240_1000036956 341
862 3300009093 Ga0105240_10017113 Ga0105240_100171137 341
863 3300009093 Ga0105240_10028585 Ga0105240_100285856 341
864 3300009093 Ga0105240_10274468 Ga0105240_102744682 341
865 3300009098 Ga0105245_10007246 Ga0105245_100072465 341
866 3300009101 Ga0105247_10012839 Ga0105247_100128393 341
867 3300009101 Ga0105247_10014160 Ga0105247_100141604 341
868 3300009101 Ga0105247_10136194 Ga0105247_101361942 341
869 3300009147 Ga0114129_10008622 Ga0114129_100086229 341
870 3300009147 Ga0114129_10693764 Ga0114129_106937642 341
871 3300009148 Ga0105243_10001818 Ga0105243_100018183 341
872 3300009148 Ga0105243_10004635 Ga0105243_100046358 341
873 3300009148 Ga0105243_10015365 Ga0105243_100153654 341
874 3300009174 Ga0105241_10213251 Ga0105241_102132512 341
875 3300009174 Ga0105241_10273242 Ga0105241_102732421 341
876 3300009176 Ga0105242_10014388 Ga0105242_100143886 341
877 3300009177 Ga0105248_10003092 Ga0105248_100030925 341
878 3300009177 Ga0105248_10016194 Ga0105248_100161945 341
879 3300009177 Ga0105248_10020577 Ga0105248_100205778 341
880 3300009177 Ga0105248_10126259 Ga0105248_101262592 341
881 3300009177 Ga0105248_10217614 Ga0105248_102176142 341
882 3300009545 Ga0105237_10000102 Ga0105237_1000010289 341
883 3300009545 Ga0105237_10006549 Ga0105237_1000654910 341
884 3300009545 Ga0105237_10082720 Ga0105237_100827204 341
885 3300009545 Ga0105237_10122526 Ga0105237_101225263 341
886 3300009551 Ga0105238_10005947 Ga0105238_1000594710 341
887 3300009551 Ga0105238_10008650 Ga0105238_100086503 341
888 3300009551 Ga0105238_10224467 Ga0105238_102244672 341
889 3300009553 Ga0105249_10079548 Ga0105249_100795484 341
890 3300009553 Ga0105249_10340160 Ga0105249_103401601 341
891 3300009553 Ga0105249_10508969 Ga0105249_105089692 341
892 3300010375 Ga0105239_10004222 Ga0105239_1000422213 341
893 3300010375 Ga0105239_10023690 Ga0105239_100236906 341
894 3300010375 Ga0105239_10072813 Ga0105239_100728132 341
895 3300010375 Ga0105239_10233481 Ga0105239_102334812 341
896 3300010375 Ga0105239_10243732 Ga0105239_102437322 341
897 3300011119 Ga0105246_10149026 Ga0105246_101490262 341
898 3300012497 Ga0157319_1000005 Ga0157319_1000005213 341
899 3300013100 Ga0157373_10038570 Ga0157373_100385702 341
900 3300013100 Ga0157373_10046395 Ga0157373_100463951 341
901 3300013102 Ga0157371_10001396 Ga0157371_1000139623 341
902 3300013104 Ga0157370_10003812 Ga0157370_1000381213 341
903 3300013104 Ga0157370_10077047 Ga0157370_100770472 341
904 3300013104 Ga0157370_10077682 Ga0157370_100776822 341
905 3300013104 Ga0157370_10102792 Ga0157370_101027923 341
906 3300013104 Ga0157370_10133981 Ga0157370_101339811 341
907 3300013104 Ga0157370_10205156 Ga0157370_102051562 341
908 3300013105 Ga0157369_10015817 Ga0157369_100158176 341
909 3300013105 Ga0157369_10062589 Ga0157369_100625893 341
910 3300013105 Ga0157369_10120918 Ga0157369_101209182 341
911 3300013296 Ga0157374_10030166 Ga0157374_100301662 341
912 3300013296 Ga0157374_10037518 Ga0157374_100375184 341
913 3300013296 Ga0157374_10214331 Ga0157374_102143311 341
914 3300013296 Ga0157374_10281971 Ga0157374_102819712 341
915 3300013296 Ga0157374_10456079 Ga0157374_104560791 341
916 3300013297 Ga0157378_10039983 Ga0157378_100399834 341
917 3300013306 Ga0163162_10000673 Ga0163162_1000067318 341
918 3300013306 Ga0163162_10027327 Ga0163162_100273276 341
919 3300013306 Ga0163162_10028459 Ga0163162_100284592 341
920 3300013306 Ga0163162_10166561 Ga0163162_101665612 341
921 3300013306 Ga0163162_10403665 Ga0163162_104036652 341
922 3300013307 Ga0157372_10002169 Ga0157372_1000216918 341
923 3300013307 Ga0157372_10003163 Ga0157372_1000316311 341
924 3300013307 Ga0157372_10065457 Ga0157372_100654575 341
925 3300013307 Ga0157372_10073975 Ga0157372_100739753 341
926 3300013307 Ga0157372_10110633 Ga0157372_101106333 341
927 3300013307 Ga0157372_10195141 Ga0157372_101951412 341
928 3300013307 Ga0157372_10238262 Ga0157372_102382622 341
929 3300013307 Ga0157372_10604190 Ga0157372_106041901 341
930 3300013308 Ga0157375_10000903 Ga0157375_1000090317 341
931 3300013308 Ga0157375_10025478 Ga0157375_100254786 341
932 3300013308 Ga0157375_10034886 Ga0157375_100348864 341
933 3300013308 Ga0157375_10058213 Ga0157375_100582133 341
934 3300013308 Ga0157375_10064446 Ga0157375_100644464 341
935 3300013308 Ga0157375_10109092 Ga0157375_101090922 341
936 3300013308 Ga0157375_10136678 Ga0157375_101366783 341
937 3300014325 Ga0163163_10021170 Ga0163163_100211702 341
938 3300014325 Ga0163163_10112854 Ga0163163_101128542 341
939 3300014325 Ga0163163_10194059 Ga0163163_101940593 341
940 3300014325 Ga0163163_10230312 Ga0163163_102303122 341
941 3300014326 Ga0157380_10028852 Ga0157380_100288523 341
942 3300014745 Ga0157377_10000020 Ga0157377_1000002076 341
943 3300014745 Ga0157377_10001422 Ga0157377_100014227 341
944 3300014968 Ga0157379_10001219 Ga0157379_100012198 341
945 3300014968 Ga0157379_10010297 Ga0157379_100102976 341
946 3300014968 Ga0157379_10020285 Ga0157379_100202852 341
947 3300014968 Ga0157379_10066515 Ga0157379_100665152 341
948 3300014968 Ga0157379_10314292 Ga0157379_103142922 341
949 3300014968 Ga0157379_10355302 Ga0157379_103553021 341
950 3300014969 Ga0157376_10015296 Ga0157376_100152963 341
951 3300014969 Ga0157376_10016372 Ga0157376_100163723 341
952 3300014969 Ga0157376_10027198 Ga0157376_100271983 341
953 3300014969 Ga0157376_10047085 Ga0157376_100470852 341
954 3300015262 Ga0182007_10005892 Ga0182007_100058923 341
955 3300015265 Ga0182005_1004230 Ga0182005_10042303 341
956 3300015683 Ga0183362_10002 Ga0183362_10002612 341
957 3300016635 Ga0183361_10005 Ga0183361_10005218 341
958 3300017792 Ga0163161_10029083 Ga0163161_100290833 341
959 3300017792 Ga0163161_10070546 Ga0163161_100705463 341
960 3300017792 Ga0163161_10088500 Ga0163161_100885002 341
961 3300021384 Ga0213876_10001330 Ga0213876_1000133013 341
962 3300021384 Ga0213876_10003361 Ga0213876_100033616 341
963 3300021384 Ga0213876_10003916 Ga0213876_100039161 341
964 3300021388 Ga0213875_10007526 Ga0213875_100075266 341
965 3300025228 Ga0209672_106442 Ga0209672_1064422 341
966 3300025242 Ga0209258_102632 Ga0209258_1026324 341
967 3300025245 Ga0207425_1001488 Ga0207425_10014887 341
968 3300025258 Ga0209129_1002187 Ga0209129_10021874 341
969 3300025258 Ga0209129_1015638 Ga0209129_10156382 341
970 3300025272 Ga0209455_1000337 Ga0209455_100033717 341
971 3300025284 Ga0209130_1001292 Ga0209130_100129215 341
972 3300025284 Ga0209130_1002441 Ga0209130_10024414 341
973 3300025290 Ga0207673_1003069 Ga0207673_10030693 341
974 3300025291 Ga0209675_1001682 Ga0209675_10016826 341
975 3300025291 Ga0209675_1002042 Ga0209675_10020429 341
976 3300025292 Ga0209676_1000004 Ga0209676_1000004751 341
977 3300025292 Ga0209676_1000026 Ga0209676_100002619 341
978 3300025292 Ga0209676_1000172 Ga0209676_100017216 341
979 3300025292 Ga0209676_1010011 Ga0209676_10100112 341
980 3300025294 Ga0209025_1005956 Ga0209025_10059564 341
981 3300025295 Ga0209564_1000021 Ga0209564_1000021164 341
982 3300025297 Ga0209758_1000122 Ga0209758_100012226 341
983 3300025297 Ga0209758_1004631 Ga0209758_10046314 341
984 3300025298 Ga0209050_1000002 Ga0209050_10000021261 341
985 3300025298 Ga0209050_1000509 Ga0209050_100050953 341
986 3300025298 Ga0209050_1005094 Ga0209050_10050947 341
987 3300025298 Ga0209050_1019763 Ga0209050_10197632 341
988 3300025299 Ga0209256_1000177 Ga0209256_100017742 341
989 3300025302 Ga0207426_1000264 Ga0207426_1000264103 341
990 3300025303 Ga0209051_1000002 Ga0209051_10000021031 341
991 3300025303 Ga0209051_1000055 Ga0209051_1000055249 341
992 3300025303 Ga0209051_1000074 Ga0209051_1000074179 341
993 3300025303 Ga0209051_1000096 Ga0209051_1000096154 341
994 3300025303 Ga0209051_1007768 Ga0209051_10077687 341
995 3300025303 Ga0209051_1027528 Ga0209051_10275282 341
996 3300025304 Ga0209257_1000002 Ga0209257_10000021172 341
997 3300025304 Ga0209257_1000072 Ga0209257_1000072180 341
998 3300025304 Ga0209257_1000101 Ga0209257_1000101223 341
999 3300025304 Ga0209257_1000131 Ga0209257_1000131162 341
1000 3300025304 Ga0209257_1000347 Ga0209257_100034752 341
1001 3300025304 Ga0209257_1008032 Ga0209257_10080325 341
1002 3300025315 Ga0207697_10003899 Ga0207697_100038996 341
1003 3300025321 Ga0207656_10008913 Ga0207656_100089134 341
1004 3300025321 Ga0207656_10013605 Ga0207656_100136053 341
1005 3300025321 Ga0207656_10063702 Ga0207656_100637022 341
1006 3300025711 Ga0207696_1016362 Ga0207696_10163622 341
1007 3300025893 Ga0207682_10000076 Ga0207682_1000007638 341
1008 3300025893 Ga0207682_10041995 Ga0207682_100419952 341
1009 3300025898 Ga0207692_10000738 Ga0207692_100007386 341
1010 3300025901 Ga0207688_10019333 Ga0207688_100193333 341
1011 3300025901 Ga0207688_10022933 Ga0207688_100229332 341
1012 3300025903 Ga0207680_10041485 Ga0207680_100414852 341
1013 3300025903 Ga0207680_10067513 Ga0207680_100675133 341
1014 3300025903 Ga0207680_10181731 Ga0207680_101817312 341
1015 3300025904 Ga0207647_10068431 Ga0207647_100684312 341
1016 3300025905 Ga0207685_10025834 Ga0207685_100258342 341
1017 3300025906 Ga0207699_10000465 Ga0207699_100004657 341
1018 3300025906 Ga0207699_10020690 Ga0207699_100206902 341
1019 3300025907 Ga0207645_10001421 Ga0207645_1000142114 341
1020 3300025907 Ga0207645_10003433 Ga0207645_100034337 341
1021 3300025907 Ga0207645_10011482 Ga0207645_100114826 341
1022 3300025907 Ga0207645_10028308 Ga0207645_100283083 341
1023 3300025907 Ga0207645_10179074 Ga0207645_101790741 341
1024 3300025908 Ga0207643_10000904 Ga0207643_1000090411 341
1025 3300025908 Ga0207643_10021409 Ga0207643_100214093 341
1026 3300025908 Ga0207643_10141620 Ga0207643_101416202 341
1027 3300025909 Ga0207705_10026384 Ga0207705_100263842 341
1028 3300025910 Ga0207684_10043697 Ga0207684_100436972 341
1029 3300025910 Ga0207684_10086433 Ga0207684_100864331 341
1030 3300025912 Ga0207707_10002364 Ga0207707_1000236410 341
1031 3300025912 Ga0207707_10223708 Ga0207707_102237082 341
1032 3300025912 Ga0207707_10381337 Ga0207707_103813371 341
1033 3300025913 Ga0207695_10000923 Ga0207695_1000092349 341
1034 3300025913 Ga0207695_10019147 Ga0207695_100191474 341
1035 3300025913 Ga0207695_10328926 Ga0207695_103289262 341
1036 3300025914 Ga0207671_10000201 Ga0207671_100002013 341
1037 3300025914 Ga0207671_10006455 Ga0207671_100064555 341
1038 3300025914 Ga0207671_10021491 Ga0207671_100214913 341
1039 3300025915 Ga0207693_10001447 Ga0207693_1000144719 341
1040 3300025915 Ga0207693_10003980 Ga0207693_100039802 341
1041 3300025915 Ga0207693_10016361 Ga0207693_100163613 341
1042 3300025916 Ga0207663_10004872 Ga0207663_100048725 341
1043 3300025916 Ga0207663_10014014 Ga0207663_100140143 341
1044 3300025916 Ga0207663_10096804 Ga0207663_100968042 341
1045 3300025916 Ga0207663_10137224 Ga0207663_101372241 341
1046 3300025916 Ga0207663_10154064 Ga0207663_101540642 341
1047 3300025918 Ga0207662_10000340 Ga0207662_100003404 341
1048 3300025918 Ga0207662_10076027 Ga0207662_100760271 341
1049 3300025919 Ga0207657_10001161 Ga0207657_1000116118 341
1050 3300025919 Ga0207657_10001611 Ga0207657_1000161117 341
1051 3300025920 Ga0207649_10019565 Ga0207649_100195653 341
1052 3300025920 Ga0207649_10028161 Ga0207649_100281612 341
1053 3300025921 Ga0207652_10032624 Ga0207652_100326242 341
1054 3300025921 Ga0207652_10043028 Ga0207652_100430283 341
1055 3300025921 Ga0207652_10226530 Ga0207652_102265302 341
1056 3300025921 Ga0207652_10294907 Ga0207652_102949072 341
1057 3300025922 Ga0207646_10046772 Ga0207646_100467722 341
1058 3300025923 Ga0207681_10002291 Ga0207681_1000229112 341
1059 3300025923 Ga0207681_10039259 Ga0207681_100392594 341
1060 3300025923 Ga0207681_10083909 Ga0207681_100839092 341
1061 3300025924 Ga0207694_10003707 Ga0207694_100037074 341
1062 3300025924 Ga0207694_10041991 Ga0207694_100419913 341
1063 3300025924 Ga0207694_10187123 Ga0207694_101871232 341
1064 3300025924 Ga0207694_10378800 Ga0207694_103788001 341
1065 3300025925 Ga0207650_10000326 Ga0207650_1000032616 341
1066 3300025925 Ga0207650_10022991 Ga0207650_100229911 341
1067 3300025925 Ga0207650_10024020 Ga0207650_100240202 341
1068 3300025925 Ga0207650_10051006 Ga0207650_100510062 341
1069 3300025925 Ga0207650_10096005 Ga0207650_100960052 341
1070 3300025926 Ga0207659_10000299 Ga0207659_1000029918 341
1071 3300025926 Ga0207659_10002670 Ga0207659_100026705 341
1072 3300025926 Ga0207659_10025069 Ga0207659_100250694 341
1073 3300025926 Ga0207659_10029291 Ga0207659_100292912 341
1074 3300025926 Ga0207659_10116489 Ga0207659_101164892 341
1075 3300025926 Ga0207659_10195984 Ga0207659_101959841 341
1076 3300025927 Ga0207687_10000963 Ga0207687_1000096321 341
1077 3300025928 Ga0207700_10000035 Ga0207700_1000003558 341
1078 3300025928 Ga0207700_10458174 Ga0207700_104581741 341
1079 3300025929 Ga0207664_10027742 Ga0207664_100277425 341
1080 3300025931 Ga0207644_10001354 Ga0207644_100013543 341
1081 3300025931 Ga0207644_10013170 Ga0207644_100131707 341
1082 3300025931 Ga0207644_10013287 Ga0207644_100132872 341
1083 3300025931 Ga0207644_10018325 Ga0207644_100183253 341
1084 3300025931 Ga0207644_10127407 Ga0207644_101274072 341
1085 3300025931 Ga0207644_10233436 Ga0207644_102334362 341
1086 3300025931 Ga0207644_10254365 Ga0207644_102543652 341
1087 3300025932 Ga0207690_10000957 Ga0207690_100009576 341
1088 3300025932 Ga0207690_10013743 Ga0207690_100137432 341
1089 3300025932 Ga0207690_10015013 Ga0207690_100150134 341
1090 3300025933 Ga0207706_10000267 Ga0207706_1000026746 341
1091 3300025933 Ga0207706_10052609 Ga0207706_100526093 341
1092 3300025933 Ga0207706_10091118 Ga0207706_100911183 341
1093 3300025933 Ga0207706_10139430 Ga0207706_101394302 341
1094 3300025933 Ga0207706_10188407 Ga0207706_101884072 341
1095 3300025934 Ga0207686_10050543 Ga0207686_100505433 341
1096 3300025935 Ga0207709_10000172 Ga0207709_100001728 341
1097 3300025935 Ga0207709_10003347 Ga0207709_100033477 341
1098 3300025935 Ga0207709_10085856 Ga0207709_100858562 341
1099 3300025936 Ga0207670_10000064 Ga0207670_1000006411 341
1100 3300025936 Ga0207670_10005667 Ga0207670_100056677 341
1101 3300025936 Ga0207670_10007685 Ga0207670_100076854 341
1102 3300025936 Ga0207670_10021513 Ga0207670_100215135 341
1103 3300025936 Ga0207670_10029379 Ga0207670_100293793 341
1104 3300025937 Ga0207669_10013588 Ga0207669_100135882 341
1105 3300025937 Ga0207669_10021010 Ga0207669_100210102 341
1106 3300025937 Ga0207669_10060872 Ga0207669_100608723 341
1107 3300025937 Ga0207669_10063459 Ga0207669_100634593 341
1108 3300025937 Ga0207669_10076252 Ga0207669_100762522 341
1109 3300025938 Ga0207704_10008488 Ga0207704_100084883 341
1110 3300025938 Ga0207704_10155721 Ga0207704_101557212 341
1111 3300025939 Ga0207665_10002891 Ga0207665_1000289111 341
1112 3300025939 Ga0207665_10025629 Ga0207665_100256293 341
1113 3300025940 Ga0207691_10000049 Ga0207691_1000004921 341
1114 3300025940 Ga0207691_10004263 Ga0207691_100042638 341
1115 3300025940 Ga0207691_10005602 Ga0207691_100056028 341
1116 3300025940 Ga0207691_10007985 Ga0207691_100079856 341
1117 3300025940 Ga0207691_10010067 Ga0207691_100100678 341
1118 3300025940 Ga0207691_10017331 Ga0207691_100173312 341
1119 3300025940 Ga0207691_10020338 Ga0207691_100203384 341
1120 3300025940 Ga0207691_10027190 Ga0207691_100271902 341
1121 3300025940 Ga0207691_10050504 Ga0207691_100505043 341
1122 3300025940 Ga0207691_10190681 Ga0207691_101906811 341
1123 3300025940 Ga0207691_10201265 Ga0207691_102012652 341
1124 3300025941 Ga0207711_10001803 Ga0207711_100018032 341
1125 3300025941 Ga0207711_10026718 Ga0207711_100267185 341
1126 3300025941 Ga0207711_10034266 Ga0207711_100342664 341
1127 3300025941 Ga0207711_10094747 Ga0207711_100947472 341
1128 3300025941 Ga0207711_10221904 Ga0207711_102219042 341
1129 3300025941 Ga0207711_10234553 Ga0207711_102345532 341
1130 3300025942 Ga0207689_10004241 Ga0207689_100042414 341
1131 3300025942 Ga0207689_10007394 Ga0207689_100073946 341
1132 3300025942 Ga0207689_10007729 Ga0207689_100077293 341
1133 3300025942 Ga0207689_10016503 Ga0207689_100165034 341
1134 3300025942 Ga0207689_10070339 Ga0207689_100703392 341
1135 3300025944 Ga0207661_10000444 Ga0207661_1000044417 341
1136 3300025944 Ga0207661_10003085 Ga0207661_100030855 341
1137 3300025944 Ga0207661_10213112 Ga0207661_102131122 341
1138 3300025945 Ga0207679_10007980 Ga0207679_100079804 341
1139 3300025945 Ga0207679_10050694 Ga0207679_100506941 341
1140 3300025945 Ga0207679_10120783 Ga0207679_101207832 341
1141 3300025945 Ga0207679_10234570 Ga0207679_102345702 341
1142 3300025949 Ga0207667_10003714 Ga0207667_1000371417 341
1143 3300025949 Ga0207667_10032865 Ga0207667_100328654 341
1144 3300025949 Ga0207667_10066981 Ga0207667_100669812 341
1145 3300025949 Ga0207667_10308933 Ga0207667_103089332 341
1146 3300025949 Ga0207667_10514076 Ga0207667_105140762 341
1147 3300025960 Ga0207651_10000587 Ga0207651_100005876 341
1148 3300025960 Ga0207651_10000834 Ga0207651_100008345 341
1149 3300025960 Ga0207651_10012045 Ga0207651_100120453 341
1150 3300025960 Ga0207651_10015130 Ga0207651_100151307 341
1151 3300025960 Ga0207651_10021090 Ga0207651_100210904 341
1152 3300025960 Ga0207651_10030616 Ga0207651_100306162 341
1153 3300025960 Ga0207651_10032496 Ga0207651_100324964 341
1154 3300025960 Ga0207651_10033171 Ga0207651_100331713 341
1155 3300025960 Ga0207651_10101855 Ga0207651_101018552 341
1156 3300025960 Ga0207651_10268474 Ga0207651_102684741 341
1157 3300025961 Ga0207712_10020569 Ga0207712_100205692 341
1158 3300025972 Ga0207668_10025834 Ga0207668_100258342 341
1159 3300025972 Ga0207668_10034750 Ga0207668_100347503 341
1160 3300025972 Ga0207668_10080871 Ga0207668_100808711 341
1161 3300025972 Ga0207668_10202939 Ga0207668_102029392 341
1162 3300025981 Ga0207640_10022288 Ga0207640_100222884 341
1163 3300025986 Ga0207658_10006530 Ga0207658_100065304 341
1164 3300025986 Ga0207658_10019879 Ga0207658_100198794 341
1165 3300025986 Ga0207658_10038169 Ga0207658_100381692 341
1166 3300025986 Ga0207658_10096999 Ga0207658_100969992 341
1167 3300025986 Ga0207658_10107171 Ga0207658_101071713 341
1168 3300025986 Ga0207658_10347280 Ga0207658_103472802 341
1169 3300026023 Ga0207677_10001996 Ga0207677_100019962 341
1170 3300026023 Ga0207677_10040842 Ga0207677_100408424 341
1171 3300026023 Ga0207677_10053078 Ga0207677_100530783 341
1172 3300026023 Ga0207677_10109729 Ga0207677_101097292 341
1173 3300026035 Ga0207703_10002691 Ga0207703_100026918 341
1174 3300026035 Ga0207703_10003961 Ga0207703_100039618 341
1175 3300026035 Ga0207703_10010840 Ga0207703_100108404 341
1176 3300026035 Ga0207703_10115956 Ga0207703_101159562 341
1177 3300026041 Ga0207639_10082656 Ga0207639_100826563 341
1178 3300026041 Ga0207639_10107994 Ga0207639_101079942 341
1179 3300026041 Ga0207639_10135950 Ga0207639_101359502 341
1180 3300026041 Ga0207639_10137019 Ga0207639_101370192 341
1181 3300026041 Ga0207639_10161416 Ga0207639_101614162 341
1182 3300026041 Ga0207639_10313384 Ga0207639_103133842 341
1183 3300026067 Ga0207678_10001480 Ga0207678_1000148016 341
1184 3300026067 Ga0207678_10009973 Ga0207678_100099734 341
1185 3300026075 Ga0207708_10002639 Ga0207708_1000263913 341
1186 3300026075 Ga0207708_10110506 Ga0207708_101105063 341
1187 3300026075 Ga0207708_10245971 Ga0207708_102459712 341
1188 3300026078 Ga0207702_10021218 Ga0207702_100212182 341
1189 3300026078 Ga0207702_10062188 Ga0207702_100621882 341
1190 3300026078 Ga0207702_10266940 Ga0207702_102669402 341
1191 3300026078 Ga0207702_10275424 Ga0207702_102754242 341
1192 3300026088 Ga0207641_10002409 Ga0207641_1000240913 341
1193 3300026088 Ga0207641_10011015 Ga0207641_100110151 341
1194 3300026088 Ga0207641_10112533 Ga0207641_101125332 341
1195 3300026088 Ga0207641_10166073 Ga0207641_101660733 341
1196 3300026088 Ga0207641_10363514 Ga0207641_103635142 341
1197 3300026089 Ga0207648_10000026 Ga0207648_1000002666 341
1198 3300026089 Ga0207648_10000984 Ga0207648_1000098428 341
1199 3300026089 Ga0207648_10002748 Ga0207648_100027489 341
1200 3300026089 Ga0207648_10006618 Ga0207648_1000661812 341
1201 3300026089 Ga0207648_10022764 Ga0207648_100227643 341
1202 3300026089 Ga0207648_10114654 Ga0207648_101146542 341
1203 3300026095 Ga0207676_10003531 Ga0207676_100035316 341
1204 3300026095 Ga0207676_10006625 Ga0207676_100066254 341
1205 3300026095 Ga0207676_10032058 Ga0207676_100320582 341
1206 3300026095 Ga0207676_10042277 Ga0207676_100422775 341
1207 3300026116 Ga0207674_10002741 Ga0207674_100027418 341
1208 3300026116 Ga0207674_10010615 Ga0207674_100106156 341
1209 3300026116 Ga0207674_10017659 Ga0207674_100176593 341
1210 3300026116 Ga0207674_10024563 Ga0207674_100245634 341
1211 3300026118 Ga0207675_100001389 Ga0207675_10000138911 341
1212 3300026118 Ga0207675_100023734 Ga0207675_1000237345 341
1213 3300026118 Ga0207675_100035627 Ga0207675_1000356272 341
1214 3300026118 Ga0207675_100043728 Ga0207675_1000437284 341
1215 3300026118 Ga0207675_100078131 Ga0207675_1000781313 341
1216 3300026121 Ga0207683_10001689 Ga0207683_100016894 341
1217 3300026121 Ga0207683_10006288 Ga0207683_100062886 341
1218 3300026121 Ga0207683_10007344 Ga0207683_100073448 341
1219 3300026121 Ga0207683_10016814 Ga0207683_100168143 341
1220 3300026121 Ga0207683_10044697 Ga0207683_100446974 341
1221 3300026121 Ga0207683_10109066 Ga0207683_101090662 341
1222 3300026121 Ga0207683_10319470 Ga0207683_103194702 341
1223 3300026142 Ga0207698_10010328 Ga0207698_100103285 341
1224 3300026142 Ga0207698_10164339 Ga0207698_101643392 341
1225 3300027111 Ga0209281_1000020 Ga0209281_1000020500 341
1226 3300027614 Ga0209970_1003020 Ga0209970_10030202 341
1227 3300027876 Ga0209974_10021098 Ga0209974_100210982 341
1228 3300027876 Ga0209974_10033674 Ga0209974_100336742 341
1229 3300027907 Ga0207428_10016435 Ga0207428_100164355 341
1230 3300028379 Ga0268266_10007672 Ga0268266_1000767211 341
1231 3300028379 Ga0268266_10013258 Ga0268266_100132585 341
1232 3300028379 Ga0268266_10018457 Ga0268266_100184574 341
1233 3300028379 Ga0268266_10077105 Ga0268266_100771052 341
1234 3300028380 Ga0268265_10052060 Ga0268265_100520602 341
1235 3300028380 Ga0268265_10075457 Ga0268265_100754573 341
1236 3300028381 Ga0268264_10000030 Ga0268264_10000030161 341
1237 3300028381 Ga0268264_10003226 Ga0268264_100032269 341
1238 3300028381 Ga0268264_10012760 Ga0268264_100127602 341
1239 3300028381 Ga0268264_10031545 Ga0268264_100315452 341
1240 3300028381 Ga0268264_10059458 Ga0268264_100594583 341
1241 3300028381 Ga0268264_10476689 Ga0268264_104766891 341
1242 3300028666 Ga0265336_10000003 Ga0265336_1000000346 341
1243 3300028786 Ga0307517_10001421 Ga0307517_1000142114 341
1244 3300028786 Ga0307517_10055873 Ga0307517_100558733 341
1245 3300028794 Ga0307515_10000160 Ga0307515_10000160135 341
1246 3300028794 Ga0307515_10000737 Ga0307515_1000073739 341
1247 3300028794 Ga0307515_10028520 Ga0307515_100285206 341
1248 3300028794 Ga0307515_10060791 Ga0307515_100607914 341
1249 3300028794 Ga0307515_10082200 Ga0307515_100822003 341
1250 3300029957 Ga0265324_10003293 Ga0265324_100032939 341
1251 3300030522 Ga0307512_10026765 Ga0307512_100267652 341
1252 3300031235 Ga0265330_10099631 Ga0265330_100996311 341
1253 3300031238 Ga0265332_10000083 Ga0265332_1000008314 341
1254 3300031238 Ga0265332_10007298 Ga0265332_100072982 341
1255 3300031241 Ga0265325_10002402 Ga0265325_100024028 341
1256 3300031247 Ga0265340_10005895 Ga0265340_100058957 341
1257 3300031249 Ga0265339_10001335 Ga0265339_100013357 341
1258 3300031249 Ga0265339_10112241 Ga0265339_101122412 341
1259 3300031251 Ga0265327_10001335 Ga0265327_1000133523 341
1260 3300031251 Ga0265327_10005550 Ga0265327_100055506 341
1261 3300031344 Ga0265316_10069195 Ga0265316_100691953 341
1262 3300031456 Ga0307513_10000006 Ga0307513_10000006239 341
1263 3300031456 Ga0307513_10009007 Ga0307513_1000900711 341
1264 3300031456 Ga0307513_10015012 Ga0307513_100150129 341
1265 3300031456 Ga0307513_10306852 Ga0307513_103068522 341
1266 3300031507 Ga0307509_10008423 Ga0307509_100084237 341
1267 3300031507 Ga0307509_10062217 Ga0307509_100622172 341
1268 3300031507 Ga0307509_10071416 Ga0307509_100714162 341
1269 3300031507 Ga0307509_10239462 Ga0307509_102394622 341
1270 3300031548 Ga0307408_100036322 Ga0307408_1000363223 341
1271 3300031595 Ga0265313_10004883 Ga0265313_100048835 341
1272 3300031595 Ga0265313_10122378 Ga0265313_101223781 341
1273 3300031616 Ga0307508_10000282 Ga0307508_1000028229 341
1274 3300031616 Ga0307508_10004767 Ga0307508_100047678 341
1275 3300031616 Ga0307508_10014131 Ga0307508_100141315 341
1276 3300031616 Ga0307508_10039482 Ga0307508_100394824 341
1277 3300031649 Ga0307514_10000408 Ga0307514_1000040820 341
1278 3300031649 Ga0307514_10017292 Ga0307514_100172923 341
1279 3300031665 Ga0316575_10048438 Ga0316575_100484382 341
1280 3300031712 Ga0265342_10023680 Ga0265342_100236803 341
1281 3300031730 Ga0307516_10001367 Ga0307516_100013675 341
1282 3300031730 Ga0307516_10002101 Ga0307516_100021017 341
1283 3300031730 Ga0307516_10039313 Ga0307516_100393132 341
1284 3300031730 Ga0307516_10052275 Ga0307516_100522752 341
1285 3300031730 Ga0307516_10065805 Ga0307516_100658052 341
1286 3300031730 Ga0307516_10204155 Ga0307516_102041552 341
1287 3300031730 Ga0307516_10206691 Ga0307516_102066912 341
1288 3300031731 Ga0307405_10062112 Ga0307405_100621123 341
1289 3300031731 Ga0307405_10276730 Ga0307405_102767301 341
1290 3300031824 Ga0307413_10002484 Ga0307413_100024842 341
1291 3300031901 Ga0307406_10073164 Ga0307406_100731643 341
1292 3300031911 Ga0307412_10035132 Ga0307412_100351323 341
1293 3300032002 Ga0307416_100023883 Ga0307416_1000238833 341
1294 3300033179 Ga0307507_10044588 Ga0307507_100445882 341
1295 3300033180 Ga0307510_10034714 Ga0307510_100347146 341
1296 3300033180 Ga0307510_10066040 Ga0307510_100660403 341
1297 3300035090 Ga0373949_0000342 Ga0373949_0000342_14059_15087 341
1298 3300035111 Ga0373923_0008265 Ga0373923_0008265_1207_2235 341
1299 3300035111 Ga0373923_0058329 Ga0373923_0058329_246_1271 341
1300 3300035114 Ga0373939_0000469 Ga0373939_0000469_2182_3210 341
1301 3300035117 Ga0373953_0000542 Ga0373953_0000542_6808_7836 341
1302 3300035117 Ga0373953_0052078 Ga0373953_0052078_356_1381 341
1303 3300035118 Ga0373954_0000323 Ga0373954_0000323_9021_10049 341
1304 3300035118 Ga0373954_0003173 Ga0373954_0003173_5067_6095 341
1305 3300035118 Ga0373954_0041561 Ga0373954_0041561_679_1707 341
1306 3300035119 Ga0373956_0003655 Ga0373956_0003655_1871_2899 341
1307 3300035119 Ga0373956_0009107 Ga0373956_0009107_1314_2342 341
1308 3300035171 Ga0373946_0043163 Ga0373946_0043163_512_1537 341
1309 3300035172 Ga0373955_0003057 Ga0373955_0003057_4761_5789 341
1310 3300035410 Ga0373924_0004824 Ga0373924_0004824_333_1367 341
1311 3300035410 Ga0373924_0014735 Ga0373924_0014735_1106_2134 341
1312 3300035691 Ga0373931_0047358 Ga0373931_0047358_664_1692 341
1313 3300035692 Ga0373935_0046730 Ga0373935_0046730_916_1941 341
1314 3300035692 Ga0373935_0106598 Ga0373935_0106598_570_1598 341
1315 3300035724 Ga0373933_0001324 Ga0373933_0001324_12207_13235 341
1316 3300035724 Ga0373933_0034647 Ga0373933_0034647_1365_2393 341
1317 3300035725 Ga0373947_0008307 Ga0373947_0008307_4886_5911 341
1318 3300035725 Ga0373947_0018126 Ga0373947_0018126_2693_3718 341
1319 3300035725 Ga0373947_0030133 Ga0373947_0030133_1801_2829 341
1320 3300036401 Ga0373937_0000847 Ga0373937_0000847_21635_22663 341
1321 3300036401 Ga0373937_0004472 Ga0373937_0004472_2526_3554 341
1322 3300036401 Ga0373937_0007329 Ga0373937_0007329_5827_6855 341
1323 3300036401 Ga0373937_0069648 Ga0373937_0069648_477_1502 341
1324 3300036401 Ga0373937_0158162 Ga0373937_0158162_445_1473 341
1325 3300037068 Ga0373925_0056541 Ga0373925_0056541_1072_2100 341
1326 3300037068 Ga0373925_0087711 Ga0373925_0087711_1256_2284 341
1327 3300037068 Ga0373925_0113055 Ga0373925_0113055_411_1436 341
1328 3300037068 Ga0373925_0124132 Ga0373925_0124132_84_1112 341
1329 3300037312 Ga0395899_0130710 Ga0395899_0130710_16_1050 341
1330 3300037418 Ga0395900_0016357 Ga0395900_0016357_5455_6489 341
1331 3300037418 Ga0395900_0083912 Ga0395900_0083912_149_1183 341
1332 3300037418 Ga0395900_0193333 Ga0395900_0193333_615_1649 341
1333 3300037466 Ga0395898_0042436 Ga0395898_0042436_585_1619 341
1334 3300037466 Ga0395898_0070969 Ga0395898_0070969_150_1184 341
1335 3300037466 Ga0395898_0323056 Ga0395898_0323056_324_1358 341
1336 3300037471 Ga0395905_0009530 Ga0395905_0009530_3012_4040 341
1337 3300037471 Ga0395905_0012101 Ga0395905_0012101_468_1496 341
1338 3300037471 Ga0395905_0013595 Ga0395905_0013595_6709_7737 341
1339 3300037471 Ga0395905_0021316 Ga0395905_0021316_2580_3614 341
1340 3300037471 Ga0395905_0045282 Ga0395905_0045282_549_1583 341
1341 3300037471 Ga0395905_0118549 Ga0395905_0118549_247_1281 341
1342 3300037471 Ga0395905_0180684 Ga0395905_0180684_45_1073 341
1343 3300037471 Ga0395905_0205964 Ga0395905_0205964_587_1621 341
1344 3300037853 Ga0436364_0513795 Ga0436364_0513795_3682_4710 341
1345 3300038443 Ga0395901_0093209 Ga0395901_0093209_677_1711 341
1346 3300038726 Ga0400490_26120 Ga0400490_26120_1028_2056 341
1347 3300038726 Ga0400490_31337 Ga0400490_31337_15236_16264 341
1348 3300038726 Ga0400490_35285 Ga0400490_35285_1299_2327 341
1349 3300038726 Ga0400490_43165 Ga0400490_43165_8823_9851 341
1350 3300038726 Ga0400490_43931 Ga0400490_43931_32425_33453 341
1351 3300038727 Ga0400491_00605 Ga0400491_00605_468_1496 341
1352 3300038741 Ga0400488_09907 Ga0400488_09907_1341_2369 341
1353 3300038741 Ga0400488_41347 Ga0400488_41347_258_1286 341
1354 3300038741 Ga0400488_53493 Ga0400488_53493_2063_3091 341
1355 3300039110 Ga0400487_23984 Ga0400487_23984_12479_13507 341
1356 3300039110 Ga0400487_34028 Ga0400487_34028_12454_13482 341
1357 3300039110 Ga0400487_37419 Ga0400487_37419_522_1550 341
1358 3300039110 Ga0400487_42799 Ga0400487_42799_21118_22146 341
1359 3300039110 Ga0400487_44343 Ga0400487_44343_1667_2695 341
1360 3300039437 Ga0436365_0894540 Ga0436365_0894540_20683_21711 341
1361 3300039437 Ga0436365_1549030 Ga0436365_1549030_3197_4225 341
1362 3300039438 Ga0436360_0275638 Ga0436360_0275638_113_1147 341
1363 3300039447 Ga0436361_0193139 Ga0436361_0193139_4613_5641 341
1364 3300039453 Ga0436362_0663798 Ga0436362_0663798_41_1069 341
1365 3300041997 Ga0439431_0009589 Ga0439431_0009589_687_1715 341
1366 3300042127 Ga0450890_001687 Ga0450890_001687_1506_2534 341
1367 3300042129 Ga0450891_000178 Ga0450891_000178_1071_2099 341
1368 3300042130 Ga0450892_001312 Ga0450892_001312_475_1503 341
1369 3300042532 Ga0450893_0001010 Ga0450893_0001010_614_1642 341
1370 3300042876 Ga0451577_0106470 Ga0451577_0106470_1355_2383 341
1371 3300044712 Ga0453684_0000906 Ga0453684_0000906_65256_66308 341
1372 3300044712 Ga0453684_0152269 Ga0453684_0152269_1182_2210 341
1373 3300045051 Ga0451576_0118222 Ga0451576_0118222_438_1466 341
1374 3300046454 Ga0495592_0000519 Ga0495592_0000519_22311_23339 341
1375 3300046462 Ga0495651_0014174 Ga0495651_0014174_3958_4986 341
1376 3300046462 Ga0495651_0203056 Ga0495651_0203056_64_1092 341
1377 3300046471 Ga0495650_0001530 Ga0495650_0001530_11769_12797 341
1378 3300046471 Ga0495650_0001834 Ga0495650_0001834_4564_5592 341
1379 3300046471 Ga0495650_0015649 Ga0495650_0015649_2599_3624 341
1380 3300046500 Ga0495596_0017045 Ga0495596_0017045_601_1629 341
1381 3300046506 Ga0495583_0000306 Ga0495583_0000306_58402_59430 341
1382 3300046511 Ga0495608_0012098 Ga0495608_0012098_3795_4823 341
1383 3300046512 Ga0495610_0006324 Ga0495610_0006324_1338_2381 341
1384 3300046516 Ga0495628_0005737 Ga0495628_0005737_7910_8938 341
1385 3300046524 Ga0495648_0001735 Ga0495648_0001735_17696_18724 341
1386 3300046524 Ga0495648_0003308 Ga0495648_0003308_8058_9095 341
1387 3300046529 Ga0495652_0022690 Ga0495652_0022690_1276_2304 341
1388 3300046529 Ga0495652_0033439 Ga0495652_0033439_3266_4294 341
1389 3300046530 Ga0495654_0001482 Ga0495654_0001482_1340_2368 341
1390 3300046536 Ga0495587_0005573 Ga0495587_0005573_3394_4422 341
1391 3300046537 Ga0495598_0067512 Ga0495598_0067512_79_1107 341
1392 3300046539 Ga0495621_0001756 Ga0495621_0001756_4344_5372 341
1393 3300046543 Ga0495645_0095615 Ga0495645_0095615_790_1818 341
1394 3300046543 Ga0495645_0117138 Ga0495645_0117138_548_1573 341
1395 3300046559 Ga0495667_0058675 Ga0495667_0058675_1304_2332 341
1396 3300046615 Ga0495656_0000383 Ga0495656_0000383_11908_12936 341
1397 3300046660 Ga0495625_0001300 Ga0495625_0001300_10037_11065 341
1398 3300046660 Ga0495625_0005155 Ga0495625_0005155_2253_3281 341
1399 3300046660 Ga0495625_0029787 Ga0495625_0029787_981_2009 341
1400 3300046663 Ga0495635_0006348 Ga0495635_0006348_5476_6504 341
1401 3300046663 Ga0495635_0212429 Ga0495635_0212429_238_1266 341
1402 3300046665 Ga0495661_0019488 Ga0495661_0019488_2396_3424 341
1403 3300046675 Ga0495657_0015234 Ga0495657_0015234_4277_5305 341
1404 3300046678 Ga0495599_0004863 Ga0495599_0004863_1619_2647 341
1405 3300046679 Ga0495623_0002882 Ga0495623_0002882_3584_4612 341
1406 3300046679 Ga0495623_0005974 Ga0495623_0005974_2355_3383 341
1407 3300046679 Ga0495623_0139277 Ga0495623_0139277_107_1135 341
1408 3300046680 Ga0495646_0008308 Ga0495646_0008308_4199_5227 341
1409 3300046809 Ga0495600_0058069 Ga0495600_0058069_324_1352 341
1410 3300047317 Ga0495604_0000893 Ga0495604_0000893_14914_15942 341
1411 3300047317 Ga0495604_0082744 Ga0495604_0082744_196_1224 341
1412 3300047317 Ga0495604_0131342 Ga0495604_0131342_136_1164 341
1413 3300047318 Ga0495636_0003446 Ga0495636_0003446_3582_4637 341
1414 3300047319 Ga0495674_0073493 Ga0495674_0073493_1631_2659 341
1415 3300047322 Ga0495680_0036120 Ga0495680_0036120_1304_2332 341
1416 3300047322 Ga0495680_0117364 Ga0495680_0117364_909_1937 341
1417 3300047323 Ga0495683_0032671 Ga0495683_0032671_266_1294 341
1418 3300047443 Ga0495687_001812 Ga0495687_001812_6436_7464 341
1419 3300047444 Ga0495675_0003845 Ga0495675_0003845_6424_7452 341
1420 3300047444 Ga0495675_0020051 Ga0495675_0020051_678_1706 341
1421 3300047471 Ga0495684_0005498 Ga0495684_0005498_4390_5418 341
1422 3300047472 Ga0495686_0000603 Ga0495686_0000603_6840_7868 341
1423 3300047472 Ga0495686_0030707 Ga0495686_0030707_263_1291 341
1424 3300048088 Ga0495602_0001190 Ga0495602_0001190_19114_20142 341
1425 3300048088 Ga0495602_0021398 Ga0495602_0021398_3770_4798 341
1426 3300048088 Ga0495602_0023541 Ga0495602_0023541_1176_2204 341
1427 3300048089 Ga0495614_0003366 Ga0495614_0003366_952_1980 341
1428 3300048089 Ga0495614_0070629 Ga0495614_0070629_312_1340 341
1429 3300048903 Ga0496100_0069821 Ga0496100_0069821_201_1226 341
1430 3300048904 Ga0496101_0077873 Ga0496101_0077873_1148_2176 341
1431 3300048904 Ga0496101_0080354 Ga0496101_0080354_410_1435 341
1432 3300048904 Ga0496101_0114617 Ga0496101_0114617_903_1931 341
1433 3300048904 Ga0496101_0149669 Ga0496101_0149669_264_1292 341
1434 3300048905 Ga0496102_0154653 Ga0496102_0154653_783_1808 341
1435 3300048906 Ga0496103_0013140 Ga0496103_0013140_976_2016 341
1436 3300048907 Ga0496104_0008496 Ga0496104_0008496_1071_2099 341
1437 3300048907 Ga0496104_0011778 Ga0496104_0011778_5172_6197 341
1438 3300048907 Ga0496104_0049145 Ga0496104_0049145_140_1168 341
1439 3300048907 Ga0496104_0092955 Ga0496104_0092955_108_1136 341
1440 3300048907 Ga0496104_0240711 Ga0496104_0240711_589_1617 341
1441 3300048907 Ga0496104_0315020 Ga0496104_0315020_147_1175 341
1442 3300048908 Ga0496105_0000572 Ga0496105_0000572_6302_7330 341
1443 3300048908 Ga0496105_0002416 Ga0496105_0002416_11108_12136 341
1444 3300048908 Ga0496105_0015520 Ga0496105_0015520_915_1940 341
1445 3300048908 Ga0496105_0105424 Ga0496105_0105424_1169_2197 341
1446 3300048909 Ga0496106_0004513 Ga0496106_0004513_8641_9666 341
1447 3300048909 Ga0496106_0005567 Ga0496106_0005567_1744_2769 341
1448 3300048909 Ga0496106_0175493 Ga0496106_0175493_44_1069 341
1449 3300048909 Ga0496106_0297618 Ga0496106_0297618_242_1282 341
1450 3300048910 Ga0496107_0005458 Ga0496107_0005458_3176_4201 341
1451 3300048910 Ga0496107_0049325 Ga0496107_0049325_621_1649 341
1452 3300048911 Ga0496108_0005344 Ga0496108_0005344_8012_9037 341
1453 3300048912 Ga0496109_0004278 Ga0496109_0004278_4135_5160 341
1454 3300048912 Ga0496109_0276868 Ga0496109_0276868_407_1432 341
1455 3300048913 Ga0496110_0020100 Ga0496110_0020100_3119_4144 341
1456 3300048913 Ga0496110_0520382 Ga0496110_0520382_12_1037 341
1457 3300048917 Ga0496114_0000501 Ga0496114_0000501_21375_22403 341
1458 3300048917 Ga0496114_0007334 Ga0496114_0007334_1010_2038 341
1459 3300048917 Ga0496114_0016064 Ga0496114_0016064_34_1062 341
1460 3300048917 Ga0496114_0027394 Ga0496114_0027394_2112_3137 341
1461 3300048917 Ga0496114_0198475 Ga0496114_0198475_476_1504 341
1462 3300048918 Ga0496115_0041449 Ga0496115_0041449_1415_2443 341
1463 3300048918 Ga0496115_0053225 Ga0496115_0053225_1166_2194 341
1464 3300048919 Ga0496116_0005353 Ga0496116_0005353_3424_4452 341
1465 3300048920 Ga0496117_0022285 Ga0496117_0022285_943_1971 341
1466 3300048921 Ga0496118_0004640 Ga0496118_0004640_3936_4964 341
1467 3300048922 Ga0496119_0000213 Ga0496119_0000213_65567_66595 341
1468 3300048924 Ga0496121_0000089 Ga0496121_0000089_71619_72647 341
1469 3300048924 Ga0496121_0029822 Ga0496121_0029822_3364_4392 341
1470 3300048925 Ga0496122_0001063 Ga0496122_0001063_16150_17178 341
1471 3300048926 Ga0496123_0000246 Ga0496123_0000246_55771_56799 341
1472 3300048926 Ga0496123_0062416 Ga0496123_0062416_1212_2240 341
1473 3300048928 Ga0496125_0018144 Ga0496125_0018144_5399_6445 341
1474 3300048929 Ga0496126_0003551 Ga0496126_0003551_2831_3859 341
1475 3300049523 Ga0501300_004779 Ga0501300_004779_425_1453 341
1476 3300049568 Ga0501031_0001824 Ga0501031_0001824_2537_3574 341
1477 3300049571 Ga0501034_0020044 Ga0501034_0020044_5036_6079 341
1478 3300049571 Ga0501034_0064115 Ga0501034_0064115_2210_3253 341
1479 3300049572 Ga0501036_0005963 Ga0501036_0005963_880_1923 341
1480 3300049579 Ga0501043_0000058 Ga0501043_0000058_75870_76898 341
1481 3300049579 Ga0501043_0000643 Ga0501043_0000643_27897_28940 341
1482 3300049580 Ga0501046_0000051 Ga0501046_0000051_25180_26208 341
1483 3300049580 Ga0501046_0002679 Ga0501046_0002679_2599_3642 341
1484 3300049581 Ga0501047_0000003 Ga0501047_0000003_482196_483224 341
1485 3300049581 Ga0501047_0005052 Ga0501047_0005052_5162_6205 341
1486 3300049581 Ga0501047_0229176 Ga0501047_0229176_126_1154 341
1487 3300049583 Ga0501067_0014886 Ga0501067_0014886_982_2010 341
1488 3300049586 Ga0501070_0006327 Ga0501070_0006327_2585_3613 341
1489 3300049589 Ga0501073_0003296 Ga0501073_0003296_8349_9377 341
1490 3300049589 Ga0501073_0032616 Ga0501073_0032616_373_1401 341
1491 3300049663 Ga0501223_021408 Ga0501223_021408_144_1172 341
1492 3300049705 Ga0501225_0008344 Ga0501225_0008344_99_1127 341
1493 3300049706 Ga0501229_000131 Ga0501229_000131_5402_6430 341
1494 3300049742 Ga0501080_0012936 Ga0501080_0012936_1410_2438 341
1495 3300049744 Ga0501083_0048123 Ga0501083_0048123_1026_2054 341
1496 3300049759 Ga0501262_000404 Ga0501262_000404_3816_4844 341
1497 3300049822 Ga0501035_0002048 Ga0501035_0002048_5797_6840 341
1498 3300049823 Ga0501044_0000515 Ga0501044_0000515_43067_44110 341
1499 3300049823 Ga0501044_0007899 Ga0501044_0007899_3685_4728 341
1500 3300049823 Ga0501044_0538433 Ga0501044_0538433_14_1042 341
1501 3300049824 Ga0501045_0001820 Ga0501045_0001820_4970_5998 341
1502 3300050493 nmdc:mga0k408_15138_c1 nmdc:mga0k408_15138_c1_2322_3350 341
1503 3300050493 nmdc:mga0k408_206_c1 nmdc:mga0k408_206_c1_5272_6300 341
1504 3300050493 nmdc:mga0k408_5529_c1 nmdc:mga0k408_5529_c1_2643_3671 341
1505 3300050493 nmdc:mga0k408_641_c2 nmdc:mga0k408_641_c2_6752_7780 341
1506 3300050496 nmdc:mga07m45_138909_c1 nmdc:mga07m45_138909_c1_354_1388 341
1507 3300050496 nmdc:mga07m45_18057_c2 nmdc:mga07m45_18057_c2_609_1637 341
1508 3300050496 nmdc:mga07m45_19775_c1 nmdc:mga07m45_19775_c1_874_1902 341
1509 3300050507 nmdc:mga05p37_52613_c1 nmdc:mga05p37_52613_c1_549_1577 341
1510 3300050509 nmdc:mga0qj67_18883_c1 nmdc:mga0qj67_18883_c1_1626_2660 341
1511 3300050511 nmdc:mga08y16_181892_c1 nmdc:mga08y16_181892_c1_984_2084 341
1512 3300050512 nmdc:mga0n895_200805_c1 nmdc:mga0n895_200805_c1_248_1276 341
1513 3300050513 nmdc:mga0rr50_419562_c1 nmdc:mga0rr50_419562_c1_88_1116 341
1514 3300053078 Ga0495612_0083098 Ga0495612_0083098_269_1294 341
1515 3300053087 Ga0500643_007434 Ga0500643_007434_1927_2955 341
1516 3300053093 Ga0500651_0000087 Ga0500651_0000087_54117_55145 341
1517 3300053093 Ga0500651_0164338 Ga0500651_0164338_117_1151 341
1518 3300053110 Ga0500571_000055 Ga0500571_000055_4122_5150 341
1519 3300053139 Ga0500568_0009819 Ga0500568_0009819_166_1194 341
1520 3300053156 Ga0500622_0001145 Ga0500622_0001145_6139_7167 341
1521 3300053156 Ga0500622_0036726 Ga0500622_0036726_968_1996 341
1522 3300059493 Ga0587077_015555 Ga0587077_015555_204_1232 341
1523 iso_pu_bacteria 2928115317 2928117043 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

68

396

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gwg-assembly1.cif.gz_A crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66. 0.9918 1 340
2gwg-assembly1.cif.gz_B crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66. 0.9881 1 340
6dxq-assembly2.cif.gz_B crystal structure of the ligj hydratase product complex with 4-carboxy-4-hydroxy-2-oxoadipate 0.9851 1 341
6dxq-assembly1.cif.gz_C-2 crystal structure of the ligj hydratase product complex with 4-carboxy-4-hydroxy-2-oxoadipate 0.9831 1 341
6dwv-assembly1.cif.gz_C crystal structure of the ligj hydratase in the apo state 0.9817 1 341
ID Description Score Start End Superfamily
2gwgA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9908 2 340 3.20.20.140
2gwgA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9754 2 340 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7759 1 330 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7712 1 330 3.20.20.140
3nurA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7691 1 330 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A520GG91-F1-model_v4 Amidohydrolase 1.004 1 69 GO:0016787
AF-A0A7X5N713-F1-model_v4 Amidohydrolase family protein 1.003 50 119 GO:0016787
AF-A0A5C9CH14-F1-model_v4 4-oxalmesaconate hydratase 1.002 1 132 GO:0016787
AF-A0A358D635-F1-model_v4 4-oxalomesaconate hydratase 0.9964 254 341 GO:0016787
AF-A0A1Y1J2L3-F1-model_v4 4-oxalomesaconate hydratase (Predicted metal-dependent hydrolase of the TIM-barrel fold) 0.9954 1 341 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
95.14 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map