F494448

General Info

Members Datasets Scaffolds Average Seq Length
1507 523 1488 175

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0000729|Ga0496102_0000729_31568_32206
Length 212
Sequence MHAVPTTKRRKRKALPDVAALRHRNPNLKRQWPRGARAVADRPYNVLFLCTGNSARSIIAEAILNKIGSGRFRAWSAGSQPKGRVNPRTLTLLRGLGFDTSGFRSKSWNEFAKPGAPALDFVFTVCDNAAGEACPVWPGKPITAHWGISDPAEATGTEAQIGQAFSDAYRMLNQRIGLFTSLPIASLDKLTLQNRLREIGRSQGATAKADAQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
7 2643221558 Rhizobium sp. Root149 Isolate Unclassified
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221629 Devosia sp. Root105 Isolate Unclassified
11 2643221662 Devosia sp. Root413D1 Isolate Unclassified
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
14 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
15 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
16 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
17 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
18 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
19 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
20 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
21 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
22 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
23 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
26 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
31 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
32 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
33 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
34 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
35 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
36 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
37 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
38 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
39 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
40 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
45 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
64 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
77 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
92 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
149 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
150 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
151 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
167 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
168 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
169 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
170 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
171 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
172 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
173 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
174 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
175 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
176 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
177 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
178 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
179 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
180 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
188 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
189 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
259 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
265 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
266 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
267 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
268 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
269 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
270 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
271 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
272 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
273 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
276 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
277 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
284 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
285 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
286 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
287 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
288 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
289 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
290 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
291 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
292 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
293 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
294 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
295 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
296 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
297 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
298 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
299 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
300 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
301 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
302 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
304 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
305 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
306 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
307 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
308 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
309 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
310 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
311 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
312 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
313 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
314 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
315 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
316 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
317 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
318 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
319 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
320 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
321 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
323 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
324 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
325 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
326 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
329 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
330 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
331 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
332 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
333 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
334 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
335 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
336 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
337 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
338 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
339 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
340 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
341 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
342 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
343 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
344 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
345 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
346 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
347 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
348 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
349 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
352 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
355 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
356 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
357 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
358 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
359 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
362 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
363 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
368 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
369 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
370 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
371 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
374 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
375 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
376 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
377 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
378 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
379 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
382 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
383 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
384 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
385 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
386 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
387 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
388 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
389 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
390 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
394 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
395 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
396 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
397 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
398 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
399 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
400 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
401 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
404 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
405 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
406 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
407 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
408 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
409 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
410 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
411 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
412 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
413 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
414 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
415 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
416 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
417 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
418 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
419 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
420 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
421 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
422 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
423 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
434 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
435 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
438 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
439 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
440 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
441 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
442 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
443 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
444 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
460 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
461 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
462 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
463 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
464 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
465 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
466 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
467 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
468 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
469 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
470 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
471 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
472 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
473 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
474 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
475 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
476 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
477 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
481 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
482 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
483 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
484 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
485 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
486 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
487 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
488 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
489 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
490 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
491 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
492 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
493 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
494 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
495 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
496 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
497 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
498 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
499 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
500 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
501 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
502 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
503 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
504 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
505 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
506 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
507 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
508 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
509 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
510 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
511 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
512 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
513 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
514 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
515 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
516 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
517 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
518 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
521 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
522 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
523 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0.13
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0.27
Rhizoplane 6.1
Rhizosphere 87.39
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_99721 2162886007 Bacteria 940
2 MBSR1b_contig_2331715 2162886012 Bacteria 1490
3 2214772973 2209111006 Bacteria 13664
4 ARSoilYngRDRAFT_c00546 3300000042 Bacteria 4213
5 ARcpr5yngRDRAFT_c000768 3300000043 Bacteria 3923
6 ARcpr5yngRDRAFT_c000953 3300000043 Bacteria 3346
7 ARSoilOldRDRAFT_c000548 3300000044 Bacteria 4174
8 ARCol0yngRDRAFT_1000173 3300000652 Bacteria 11015
9 ARCol0yngRDRAFT_1000586 3300000652 Bacteria 3980
10 JGI24736J21556_1020899 3300001904 Bacteria 1027
11 JGI24752J21851_1006044 3300001976 Bacteria 1580
12 JGI24746J21847_1000017 3300001977 Bacteria 16011
13 JGI24737J22298_10000400 3300001990 Bacteria 14807
14 JGI24737J22298_10002941 3300001990 Bacteria 6039
15 JGI24743J22301_10000915 3300001991 Bacteria 3790
16 JGI24735J21928_10057537 3300002067 Bacteria 1119
17 JGI24750J21931_1000217 3300002070 Bacteria 9762
18 JGI24745J21846_1000376 3300002073 Bacteria 3905
19 JGI24748J21848_1001902 3300002074 Bacteria 2319
20 JGI24738J21930_10000277 3300002075 Bacteria 14047
21 JGI24744J21845_10002948 3300002077 Bacteria 3482
22 JGI24744J21845_10015756 3300002077 Bacteria 1508
23 JGI24035J26624_1000371 3300002126 Bacteria 4243
24 JGI24033J26618_1000845 3300002155 Bacteria 2945
25 JGI24034J26672_10000434 3300002239 Bacteria 5430
26 JGI24034J26672_10005759 3300002239 Bacteria 1780
27 JGI24742J22300_10000062 3300002244 Bacteria 15707
28 JGI24751J29686_10007332 3300002459 Bacteria 2253
29 JGI24751J29686_10024523 3300002459 Bacteria 1251
30 JGI25406J46586_10000096 3300003203 Bacteria 39663
31 JGI25153J46596_10006269 3300003215 Bacteria 6078
32 rootH2_10090225 3300003320 Bacteria 2453
33 JGI25405J52794_10089779 3300003911 Bacteria 680
34 Ga0065717_1002521 3300005276 Bacteria 1872
35 Ga0065716_1003161 3300005277 Bacteria 1328
36 Ga0065704_10089333 3300005289 Bacteria 2867
37 Ga0065712_10028520 3300005290 Bacteria 1403
38 Ga0065712_10116669 3300005290 Bacteria 1732
39 Ga0065715_10001161 3300005293 Bacteria 10533
40 Ga0065715_10001277 3300005293 Bacteria 11971
41 Ga0065707_10114580 3300005295 Bacteria 2293
42 Ga0070658_10038491 3300005327 Bacteria 3856
43 Ga0070658_10056229 3300005327 Bacteria 3197
44 Ga0070658_10098358 3300005327 Bacteria 2417
45 Ga0070658_10745904 3300005327 Bacteria 850
46 Ga0070676_10000813 3300005328 Bacteria 15426
47 Ga0070676_10026242 3300005328 Bacteria 3298
48 Ga0070676_10129218 3300005328 Bacteria 1595
49 Ga0070676_10714330 3300005328 Bacteria 733
50 Ga0070683_100000240 3300005329 Bacteria 37588
51 Ga0070683_100914453 3300005329 Bacteria 842
52 Ga0070683_100953940 3300005329 Bacteria 823
53 Ga0070690_100000428 3300005330 Bacteria 21329
54 Ga0070690_100024004 3300005330 Bacteria 3747
55 Ga0070690_100359434 3300005330 Bacteria 1059
56 Ga0070690_100364605 3300005330 Bacteria 1052
57 Ga0070670_100005838 3300005331 Bacteria 10408
58 Ga0070670_100088515 3300005331 Bacteria 2662
59 Ga0070670_100173451 3300005331 Bacteria 1871
60 Ga0070670_100212700 3300005331 Bacteria 1681
61 Ga0070677_10000294 3300005333 Bacteria 17512
62 Ga0068869_100000595 3300005334 Bacteria 20312
63 Ga0068869_100148413 3300005334 Bacteria 1816
64 Ga0068869_100428207 3300005334 Bacteria 1093
65 Ga0068869_100573995 3300005334 Bacteria 950
66 Ga0068869_100576944 3300005334 Bacteria 948
67 Ga0068869_101380103 3300005334 Bacteria 623
68 Ga0070666_10003384 3300005335 Bacteria 9660
69 Ga0070666_10309104 3300005335 Bacteria 1126
70 Ga0070680_100002839 3300005336 Bacteria 12874
71 Ga0070680_100029144 3300005336 Bacteria 4433
72 Ga0070680_100089806 3300005336 Bacteria 2542
73 Ga0070680_100300092 3300005336 Bacteria 1362
74 Ga0070682_100000202 3300005337 Bacteria 44018
75 Ga0070682_100041381 3300005337 Bacteria 2840
76 Ga0070682_100122890 3300005337 Bacteria 1745
77 Ga0068868_100000614 3300005338 Bacteria 23959
78 Ga0068868_100009330 3300005338 Bacteria 7054
79 Ga0068868_100689469 3300005338 Bacteria 913
80 Ga0068868_101069036 3300005338 Bacteria 741
81 Ga0070660_100000223 3300005339 Bacteria 37464
82 Ga0070660_100040659 3300005339 Bacteria 3540
83 Ga0070689_100000187 3300005340 Bacteria 37473
84 Ga0070689_100017860 3300005340 Bacteria 5215
85 Ga0070689_100590181 3300005340 Bacteria 961
86 Ga0070691_10034527 3300005341 Bacteria 2381
87 Ga0070691_10044288 3300005341 Bacteria 2110
88 Ga0070691_10080006 3300005341 Bacteria 1598
89 Ga0070687_100000200 3300005343 Bacteria 20836
90 Ga0070661_100000298 3300005344 Bacteria 40083
91 Ga0070661_100689237 3300005344 Bacteria 832
92 Ga0070692_10000016 3300005345 Bacteria 34456
93 Ga0070692_10007543 3300005345 Bacteria 4797
94 Ga0070692_10072584 3300005345 Bacteria 1837
95 Ga0070668_100001007 3300005347 Bacteria 19753
96 Ga0070668_100057388 3300005347 Bacteria 3008
97 Ga0070668_101295331 3300005347 Bacteria 662
98 Ga0070669_100001525 3300005353 Bacteria 16755
99 Ga0070669_100039149 3300005353 Bacteria 3443
100 Ga0070669_100040493 3300005353 Bacteria 3387
101 Ga0070669_100060875 3300005353 Bacteria 2774
102 Ga0070669_100091046 3300005353 Bacteria 2287
103 Ga0070669_100093430 3300005353 Bacteria 2259
104 Ga0070675_100000215 3300005354 Bacteria 37364
105 Ga0070675_100032642 3300005354 Bacteria 4214
106 Ga0070675_100069540 3300005354 Bacteria 2917
107 Ga0070675_100074917 3300005354 Bacteria 2813
108 Ga0070675_101118653 3300005354 Bacteria 724
109 Ga0070671_100000259 3300005355 Bacteria 35442
110 Ga0070671_100000402 3300005355 Bacteria 29873
111 Ga0070671_100082939 3300005355 Bacteria 2681
112 Ga0070671_100147320 3300005355 Bacteria 1987
113 Ga0070671_100198375 3300005355 Bacteria 1702
114 Ga0070671_100371374 3300005355 Bacteria 1222
115 Ga0070671_100704049 3300005355 Bacteria 876
116 Ga0070674_100000511 3300005356 Bacteria 19453
117 Ga0070674_100001182 3300005356 Bacteria 13709
118 Ga0070674_100050330 3300005356 Bacteria 2868
119 Ga0070674_100252764 3300005356 Bacteria 1385
120 Ga0070674_100612749 3300005356 Bacteria 921
121 Ga0070674_101195189 3300005356 Bacteria 675
122 Ga0070673_100000035 3300005364 Bacteria 57163
123 Ga0070673_100013648 3300005364 Bacteria 5629
124 Ga0070673_100588476 3300005364 Bacteria 1014
125 Ga0070688_100000130 3300005365 Bacteria 40342
126 Ga0070659_100003979 3300005366 Bacteria 10519
127 Ga0070659_100037376 3300005366 Bacteria 3785
128 Ga0070659_100065201 3300005366 Bacteria 2884
129 Ga0070659_100271250 3300005366 Bacteria 1410
130 Ga0070659_100318038 3300005366 Bacteria 1301
131 Ga0070667_100000712 3300005367 Bacteria 32083
132 Ga0070667_100046109 3300005367 Bacteria 3666
133 Ga0070667_100256159 3300005367 Bacteria 1566
134 Ga0070703_10006883 3300005406 Bacteria 3191
135 Ga0070703_10110662 3300005406 Bacteria 982
136 Ga0070709_10132577 3300005434 Bacteria 1703
137 Ga0070714_100305694 3300005435 Bacteria 1483
138 Ga0070713_100033718 3300005436 Bacteria 4105
139 Ga0070713_100322226 3300005436 Bacteria 1428
140 Ga0070713_100520464 3300005436 Bacteria 1124
141 Ga0070701_10000081 3300005438 Bacteria 26416
142 Ga0070701_10024994 3300005438 Bacteria 2895
143 Ga0070711_100261613 3300005439 Bacteria 1361
144 Ga0070711_101040605 3300005439 Bacteria 704
145 Ga0070705_100002491 3300005440 Bacteria 9254
146 Ga0070705_100216758 3300005440 Bacteria 1323
147 Ga0070700_100001353 3300005441 Bacteria 12190
148 Ga0070700_100037901 3300005441 Bacteria 2934
149 Ga0070700_100322470 3300005441 Bacteria 1135
150 Ga0070694_100000129 3300005444 Bacteria 37699
151 Ga0070694_100144058 3300005444 Bacteria 1734
152 Ga0070694_100327115 3300005444 Bacteria 1181
153 Ga0070708_100007439 3300005445 Bacteria 8766
154 Ga0070708_100229454 3300005445 Bacteria 1742
155 Ga0070708_100402271 3300005445 Bacteria 1291
156 Ga0070708_101086596 3300005445 Bacteria 749
157 Ga0070663_100001786 3300005455 Bacteria 11966
158 Ga0070663_100020557 3300005455 Bacteria 4372
159 Ga0070663_100029377 3300005455 Bacteria 3756
160 Ga0070663_100041474 3300005455 Bacteria 3228
161 Ga0070663_100285522 3300005455 Bacteria 1316
162 Ga0070663_100560391 3300005455 Bacteria 956
163 Ga0070678_100002263 3300005456 Bacteria 10481
164 Ga0070678_100036683 3300005456 Bacteria 3434
165 Ga0070678_100072494 3300005456 Bacteria 2582
166 Ga0070678_100107075 3300005456 Bacteria 2180
167 Ga0070678_100300403 3300005456 Bacteria 1364
168 Ga0070662_100000933 3300005457 Bacteria 17890
169 Ga0070662_100019254 3300005457 Bacteria 4632
170 Ga0070662_100059615 3300005457 Bacteria 2781
171 Ga0070662_100061679 3300005457 Bacteria 2738
172 Ga0070662_100118944 3300005457 Bacteria 2023
173 Ga0070662_100131859 3300005457 Bacteria 1928
174 Ga0070662_100217336 3300005457 Bacteria 1523
175 Ga0070662_100359326 3300005457 Bacteria 1195
176 Ga0070681_10069552 3300005458 Bacteria 3486
177 Ga0070681_10084449 3300005458 Bacteria 3127
178 Ga0070681_10108495 3300005458 Bacteria 2716
179 Ga0070681_10191641 3300005458 Bacteria 1964
180 Ga0070681_10325579 3300005458 Bacteria 1446
181 Ga0070681_10456787 3300005458 Bacteria 1190
182 Ga0068867_100000369 3300005459 Bacteria 29980
183 Ga0068867_100045194 3300005459 Bacteria 3229
184 Ga0068867_100167659 3300005459 Bacteria 1737
185 Ga0068867_100568277 3300005459 Bacteria 985
186 Ga0070685_10001791 3300005466 Bacteria 11233
187 Ga0070685_10016136 3300005466 Bacteria 3974
188 Ga0070698_100987169 3300005471 Bacteria 789
189 Ga0070699_100306043 3300005518 Bacteria 1426
190 Ga0070699_100434585 3300005518 Bacteria 1189
191 Ga0070699_100748322 3300005518 Bacteria 894
192 Ga0070679_100000553 3300005530 Bacteria 31683
193 Ga0070679_100013763 3300005530 Bacteria 7751
194 Ga0070679_100064208 3300005530 Bacteria 3659
195 Ga0070679_100160951 3300005530 Bacteria 2219
196 Ga0070679_100561978 3300005530 Bacteria 1084
197 Ga0070679_100602604 3300005530 Bacteria 1042
198 Ga0070679_100978567 3300005530 Bacteria 790
199 Ga0070684_100000246 3300005535 Bacteria 37600
200 Ga0070684_100120562 3300005535 Bacteria 2360
201 Ga0070684_100303966 3300005535 Bacteria 1464
202 Ga0070684_101514373 3300005535 Bacteria 632
203 Ga0070697_100076061 3300005536 Bacteria 2761
204 Ga0068853_100002121 3300005539 Bacteria 14740
205 Ga0068853_100074542 3300005539 Bacteria 2960
206 Ga0068853_100096300 3300005539 Bacteria 2611
207 Ga0068853_100217202 3300005539 Bacteria 1745
208 Ga0068853_100321348 3300005539 Bacteria 1435
209 Ga0070672_100000157 3300005543 Bacteria 37598
210 Ga0070672_100011446 3300005543 Bacteria 6188
211 Ga0070672_100071390 3300005543 Bacteria 2762
212 Ga0070672_100397303 3300005543 Bacteria 1181
213 Ga0070686_100000260 3300005544 Bacteria 36083
214 Ga0070686_100013967 3300005544 Bacteria 4614
215 Ga0070686_100031720 3300005544 Bacteria 3233
216 Ga0070686_100832394 3300005544 Bacteria 746
217 Ga0070695_100009157 3300005545 Bacteria 5888
218 Ga0070695_100161264 3300005545 Bacteria 1574
219 Ga0070695_100302605 3300005545 Bacteria 1182
220 Ga0070696_100006359 3300005546 Bacteria 7905
221 Ga0070696_100054595 3300005546 Bacteria 2784
222 Ga0070696_100095372 3300005546 Bacteria 2124
223 Ga0070696_100160586 3300005546 Bacteria 1655
224 Ga0070693_100008853 3300005547 Bacteria 4989
225 Ga0070693_100009423 3300005547 Bacteria 4854
226 Ga0070693_100035002 3300005547 Bacteria 2782
227 Ga0070665_100000136 3300005548 Bacteria 138094
228 Ga0070665_100011558 3300005548 Bacteria 8925
229 Ga0070665_100353289 3300005548 Bacteria 1475
230 Ga0070704_100000171 3300005549 Bacteria 25774
231 Ga0070704_100548790 3300005549 Bacteria 1009
232 Ga0068855_100005012 3300005563 Bacteria 16165
233 Ga0068855_100150911 3300005563 Bacteria 2643
234 Ga0068855_100173426 3300005563 Bacteria 2441
235 Ga0070664_100000269 3300005564 Bacteria 37475
236 Ga0070664_100023876 3300005564 Bacteria 5051
237 Ga0070664_100025882 3300005564 Bacteria 4865
238 Ga0070664_100073397 3300005564 Bacteria 2935
239 Ga0070664_100130044 3300005564 Bacteria 2211
240 Ga0068857_100000174 3300005577 Bacteria 40766
241 Ga0068857_100152834 3300005577 Bacteria 2092
242 Ga0068854_100000211 3300005578 Bacteria 39059
243 Ga0068854_100058495 3300005578 Bacteria 2783
244 Ga0068854_100215612 3300005578 Bacteria 1516
245 Ga0068856_100000600 3300005614 Bacteria 39415
246 Ga0068856_100042207 3300005614 Bacteria 4487
247 Ga0070702_100000312 3300005615 Bacteria 16802
248 Ga0070702_100017767 3300005615 Bacteria 3676
249 Ga0070702_100022253 3300005615 Bacteria 3347
250 Ga0068852_100003615 3300005616 Bacteria 10822
251 Ga0068852_100189044 3300005616 Bacteria 1942
252 Ga0068852_100355761 3300005616 Bacteria 1431
253 Ga0068859_100000894 3300005617 Bacteria 30361
254 Ga0068859_100138390 3300005617 Bacteria 2508
255 Ga0068859_100753489 3300005617 Bacteria 1063
256 Ga0068859_100997020 3300005617 Bacteria 920
257 Ga0068859_101245535 3300005617 Bacteria 819
258 Ga0068864_100000329 3300005618 Bacteria 41801
259 Ga0068864_100012776 3300005618 Bacteria 6941
260 Ga0068864_100014489 3300005618 Bacteria 6548
261 Ga0068864_100017181 3300005618 Bacteria 6034
262 Ga0068864_100603056 3300005618 Bacteria 1066
263 Ga0068864_100668761 3300005618 Bacteria 1012
264 Ga0068866_10001636 3300005718 Bacteria 9448
265 Ga0068861_100002125 3300005719 Bacteria 12825
266 Ga0068861_100004532 3300005719 Bacteria 9329
267 Ga0068861_100707094 3300005719 Bacteria 937
268 Ga0068870_10000056 3300005840 Bacteria 36039
269 Ga0068870_10006351 3300005840 Bacteria 5204
270 Ga0068870_10253793 3300005840 Bacteria 1091
271 Ga0068870_10389223 3300005840 Bacteria 904
272 Ga0068863_100000278 3300005841 Bacteria 53024
273 Ga0068863_100054664 3300005841 Bacteria 3782
274 Ga0068863_100201520 3300005841 Bacteria 1915
275 Ga0068863_100286819 3300005841 Bacteria 1595
276 Ga0068863_100300050 3300005841 Bacteria 1558
277 Ga0068863_100585871 3300005841 Bacteria 1103
278 Ga0068858_100006617 3300005842 Bacteria 11276
279 Ga0068858_100007088 3300005842 Bacteria 10883
280 Ga0068858_100037757 3300005842 Bacteria 4480
281 Ga0068858_100078707 3300005842 Bacteria 3063
282 Ga0068858_101199219 3300005842 Bacteria 746
283 Ga0068860_100000985 3300005843 Bacteria 31478
284 Ga0068860_100016941 3300005843 Bacteria 7102
285 Ga0068860_100024963 3300005843 Bacteria 5770
286 Ga0068862_100000593 3300005844 Bacteria 37703
287 Ga0068862_100048568 3300005844 Bacteria 3623
288 Ga0068862_100079950 3300005844 Bacteria 2834
289 Ga0068862_100122722 3300005844 Bacteria 2291
290 Ga0068862_101609261 3300005844 Bacteria 657
291 Ga0081455_10001659 3300005937 Bacteria 26976
292 Ga0081455_10002130 3300005937 Bacteria 23594
293 Ga0081455_10020366 3300005937 Bacteria 6248
294 Ga0081539_10000051 3300005985 Bacteria 268337
295 Ga0075365_10002570 3300006038 Bacteria 8963
296 Ga0075365_10064444 3300006038 Bacteria 2455
297 Ga0075365_10464187 3300006038 Bacteria 894
298 Ga0075368_10000190 3300006042 Bacteria 16846
299 Ga0075363_100000005 3300006048 Bacteria 56964
300 Ga0075364_10000003 3300006051 Bacteria 111353
301 Ga0075432_10012796 3300006058 Bacteria 2851
302 Ga0070715_10098219 3300006163 Bacteria 1361
303 Ga0070715_10109286 3300006163 Unclassified 1302
304 Ga0070716_100199412 3300006173 Bacteria 1329
305 Ga0075362_10000118 3300006177 Bacteria 22058
306 Ga0075362_10001186 3300006177 Bacteria 8176
307 Ga0075362_10029882 3300006177 Bacteria 2351
308 Ga0075362_10125424 3300006177 Bacteria 1218
309 Ga0075367_10014566 3300006178 Bacteria 4258
310 Ga0075367_10050122 3300006178 Bacteria 2464
311 Ga0075367_10194698 3300006178 Bacteria 1265
312 Ga0075367_10196065 3300006178 Bacteria 1261
313 Ga0075367_10266784 3300006178 Bacteria 1075
314 Ga0075367_10667253 3300006178 Bacteria 661
315 Ga0075369_10002521 3300006186 Bacteria 6549
316 Ga0075369_10085299 3300006186 Bacteria 1404
317 Ga0075369_10299803 3300006186 Bacteria 750
318 Ga0075427_10001142 3300006194 Bacteria 3360
319 Ga0075366_10190068 3300006195 Bacteria 1248
320 Ga0075366_10317359 3300006195 Bacteria 954
321 Ga0075366_10356183 3300006195 Bacteria 898
322 Ga0075366_10373916 3300006195 Bacteria 876
323 Ga0097621_100002386 3300006237 Bacteria 12874
324 Ga0097621_100024031 3300006237 Bacteria 4753
325 Ga0097621_100096048 3300006237 Bacteria 2487
326 Ga0097621_100289412 3300006237 Bacteria 1444
327 Ga0075370_10000006 3300006353 Bacteria 110712
328 Ga0075370_10066406 3300006353 Bacteria 2058
329 Ga0068871_100001030 3300006358 Bacteria 18651
330 Ga0068871_100007695 3300006358 Bacteria 7708
331 Ga0068871_100065584 3300006358 Bacteria 2974
332 Ga0068871_100171191 3300006358 Bacteria 1862
333 Ga0068871_100227088 3300006358 Bacteria 1619
334 Ga0068871_100330695 3300006358 Bacteria 1344
335 Ga0075428_100044577 3300006844 Bacteria 4873
336 Ga0075428_100090413 3300006844 Bacteria 3339
337 Ga0075428_100092621 3300006844 Bacteria 3295
338 Ga0075428_100130966 3300006844 Bacteria 2728
339 Ga0075430_100009755 3300006846 Bacteria 8118
340 Ga0075430_100011585 3300006846 Bacteria 7499
341 Ga0075430_100186447 3300006846 Bacteria 1725
342 Ga0075431_100001682 3300006847 Bacteria 20734
343 Ga0075431_100081591 3300006847 Bacteria 3339
344 Ga0075433_10004805 3300006852 Bacteria 10546
345 Ga0075433_10014240 3300006852 Bacteria 6494
346 Ga0075433_10042296 3300006852 Bacteria 3953
347 Ga0075433_10351488 3300006852 Bacteria 1303
348 Ga0075434_100000244 3300006871 Bacteria 38039
349 Ga0075434_100001712 3300006871 Bacteria 18787
350 Ga0075434_100110126 3300006871 Bacteria 2765
351 Ga0075429_100004087 3300006880 Bacteria 12510
352 Ga0075429_100023807 3300006880 Bacteria 5313
353 Ga0068865_100005678 3300006881 Bacteria 7578
354 Ga0068865_100035370 3300006881 Bacteria 3358
355 Ga0068865_100216270 3300006881 Bacteria 1496
356 Ga0068865_100680795 3300006881 Bacteria 877
357 Ga0075436_100124486 3300006914 Bacteria 1805
358 Ga0075436_100149543 3300006914 Bacteria 1643
359 Ga0075436_100341361 3300006914 Bacteria 1078
360 Ga0075436_100959362 3300006914 Bacteria 641
361 Ga0097620_100000894 3300006931 Bacteria 30361
362 Ga0097620_100138394 3300006931 Bacteria 2508
363 Ga0097620_100753524 3300006931 Bacteria 1063
364 Ga0097620_100996998 3300006931 Bacteria 920
365 Ga0097620_101245580 3300006931 Bacteria 819
366 Ga0075435_100010234 3300007076 Bacteria 6852
367 Ga0099794_10430054 3300007265 Bacteria 691
368 Ga0105251_10404735 3300009011 Bacteria 628
369 Ga0105244_10064168 3300009036 Bacteria 1843
370 Ga0105244_10084405 3300009036 Bacteria 1568
371 Ga0105250_10033696 3300009092 Bacteria 2057
372 Ga0105240_10016606 3300009093 Bacteria 9959
373 Ga0105240_10025923 3300009093 Bacteria 7699
374 Ga0105240_10773615 3300009093 Bacteria 1042
375 Ga0105240_10895337 3300009093 Bacteria 955
376 Ga0111539_10000851 3300009094 Bacteria 39783
377 Ga0111539_10001076 3300009094 Bacteria 36048
378 Ga0111539_10012295 3300009094 Bacteria 10730
379 Ga0111539_10024554 3300009094 Bacteria 7393
380 Ga0111539_10170937 3300009094 Bacteria 2539
381 Ga0111539_10621722 3300009094 Bacteria 1258
382 Ga0111539_11674507 3300009094 Bacteria 738
383 Ga0105245_10000451 3300009098 Bacteria 37705
384 Ga0105245_10073692 3300009098 Bacteria 3105
385 Ga0105247_10001016 3300009101 Bacteria 21159
386 Ga0105247_10015382 3300009101 Bacteria 4583
387 Ga0114129_10000199 3300009147 Bacteria 66704
388 Ga0114129_10011621 3300009147 Bacteria 12534
389 Ga0114129_10022264 3300009147 Bacteria 8997
390 Ga0114129_10042445 3300009147 Bacteria 6405
391 Ga0114129_10212182 3300009147 Bacteria 2616
392 Ga0105243_10002173 3300009148 Bacteria 16567
393 Ga0105243_10045733 3300009148 Bacteria 3441
394 Ga0105243_10062536 3300009148 Bacteria 2980
395 Ga0105243_10073809 3300009148 Bacteria 2765
396 Ga0105241_10001549 3300009174 Bacteria 17620
397 Ga0105241_10114664 3300009174 Bacteria 2162
398 Ga0105241_10989952 3300009174 Bacteria 786
399 Ga0105242_10000947 3300009176 Bacteria 22652
400 Ga0105242_10073958 3300009176 Bacteria 2834
401 Ga0105242_10092287 3300009176 Bacteria 2551
402 Ga0105242_10394316 3300009176 Bacteria 1290
403 Ga0105248_10000837 3300009177 Bacteria 34570
404 Ga0105248_10128580 3300009177 Bacteria 2858
405 Ga0105248_10225919 3300009177 Bacteria 2107
406 Ga0105248_10238787 3300009177 Bacteria 2046
407 Ga0105248_10347681 3300009177 Bacteria 1669
408 Ga0105248_10827034 3300009177 Bacteria 1045
409 Ga0105237_10001591 3300009545 Bacteria 29555
410 Ga0105237_10021349 3300009545 Bacteria 6657
411 Ga0105237_10022344 3300009545 Bacteria 6492
412 Ga0105237_10034852 3300009545 Bacteria 5093
413 Ga0105237_10043927 3300009545 Bacteria 4500
414 Ga0105237_10239970 3300009545 Bacteria 1814
415 Ga0105237_10315579 3300009545 Bacteria 1566
416 Ga0105237_10346014 3300009545 Bacteria 1491
417 Ga0105238_10026691 3300009551 Bacteria 5888
418 Ga0105238_10038387 3300009551 Bacteria 4864
419 Ga0105238_10039907 3300009551 Bacteria 4758
420 Ga0105238_10425633 3300009551 Bacteria 1323
421 Ga0105249_10000976 3300009553 Bacteria 25338
422 Ga0105249_10173026 3300009553 Bacteria 2095
423 Ga0105249_10425176 3300009553 Bacteria 1363
424 Ga0105239_10005959 3300010375 Bacteria 14185
425 Ga0105239_10011496 3300010375 Bacteria 9873
426 Ga0105239_10035136 3300010375 Bacteria 5505
427 Ga0105239_10076395 3300010375 Bacteria 3684
428 Ga0105239_10777506 3300010375 Bacteria 1096
429 Ga0105239_11635740 3300010375 Bacteria 745
430 Ga0105239_12148422 3300010375 Bacteria 649
431 Ga0105246_10000100 3300011119 Bacteria 37689
432 Ga0105246_10038764 3300011119 Bacteria 3206
433 Ga0105246_10067085 3300011119 Bacteria 2514
434 Ga0157328_1000980 3300012478 Bacteria 1148
435 Ga0157342_1002859 3300012507 Bacteria 1440
436 Ga0157373_10002941 3300013100 Bacteria 12905
437 Ga0157371_10001676 3300013102 Bacteria 22625
438 Ga0157371_10172267 3300013102 Bacteria 1547
439 Ga0157371_10248990 3300013102 Bacteria 1279
440 Ga0157370_10013533 3300013104 Bacteria 8400
441 Ga0157370_10104183 3300013104 Bacteria 2655
442 Ga0157370_11088440 3300013104 Bacteria 722
443 Ga0157369_10076826 3300013105 Bacteria 3580
444 Ga0157374_10000956 3300013296 Bacteria 25071
445 Ga0157374_10354102 3300013296 Bacteria 1459
446 Ga0157374_10418800 3300013296 Bacteria 1338
447 Ga0157374_10463362 3300013296 Bacteria 1269
448 Ga0157378_10062092 3300013297 Bacteria 3336
449 Ga0157378_10131326 3300013297 Bacteria 2318
450 Ga0157378_10208180 3300013297 Bacteria 1853
451 Ga0157378_10594986 3300013297 Bacteria 1117
452 Ga0157378_10947998 3300013297 Bacteria 893
453 Ga0157378_12313611 3300013297 Bacteria 589
454 Ga0163162_10004679 3300013306 Bacteria 13194
455 Ga0163162_10007555 3300013306 Bacteria 10587
456 Ga0163162_10131768 3300013306 Bacteria 2609
457 Ga0163162_10144540 3300013306 Bacteria 2493
458 Ga0163162_10294669 3300013306 Bacteria 1754
459 Ga0157372_10026270 3300013307 Bacteria 6335
460 Ga0157372_10368308 3300013307 Bacteria 1674
461 Ga0157372_10430112 3300013307 Bacteria 1538
462 Ga0157375_10000464 3300013308 Bacteria 36915
463 Ga0157375_10009224 3300013308 Bacteria 8655
464 Ga0157375_10180032 3300013308 Bacteria 2265
465 Ga0157375_10206381 3300013308 Bacteria 2121
466 Ga0163163_10002301 3300014325 Bacteria 16120
467 Ga0163163_10038044 3300014325 Bacteria 4685
468 Ga0163163_10087313 3300014325 Bacteria 3129
469 Ga0163163_10145008 3300014325 Bacteria 2418
470 Ga0163163_10214256 3300014325 Bacteria 1975
471 Ga0163163_10463493 3300014325 Bacteria 1328
472 Ga0157380_10000145 3300014326 Bacteria 40211
473 Ga0157380_10050758 3300014326 Bacteria 3278
474 Ga0157380_10107525 3300014326 Bacteria 2336
475 Ga0157380_10108189 3300014326 Bacteria 2330
476 Ga0157380_10195523 3300014326 Bacteria 1790
477 Ga0157377_10000179 3300014745 Bacteria 36682
478 Ga0157379_10000067 3300014968 Bacteria 66051
479 Ga0157379_10027154 3300014968 Bacteria 5096
480 Ga0157379_10078722 3300014968 Bacteria 2953
481 Ga0157379_10080253 3300014968 Bacteria 2923
482 Ga0157376_10003254 3300014969 Bacteria 11179
483 Ga0157376_10027833 3300014969 Bacteria 4486
484 Ga0157376_10058961 3300014969 Bacteria 3217
485 Ga0157376_10101181 3300014969 Bacteria 2518
486 Ga0157376_10458317 3300014969 Bacteria 1245
487 Ga0157376_10980684 3300014969 Bacteria 867
488 Ga0163161_10001462 3300017792 Bacteria 17455
489 Ga0163161_10237947 3300017792 Bacteria 1415
490 Ga0163161_10426710 3300017792 Bacteria 1068
491 Ga0206356_11666881 3300020070 Bacteria 1168
492 Ga0206353_10538368 3300020082 Bacteria 3235
493 Ga0207672_1005253 3300025223 Bacteria 736
494 Ga0207666_1000002 3300025271 Bacteria 62717
495 Ga0207666_1001220 3300025271 Bacteria 3024
496 Ga0207673_1000015 3300025290 Bacteria 13527
497 Ga0209758_1000746 3300025297 Bacteria 47342
498 Ga0209758_1047482 3300025297 Bacteria 1535
499 Ga0207697_10000113 3300025315 Bacteria 37772
500 Ga0207697_10029415 3300025315 Bacteria 2248
501 Ga0207653_10001463 3300025885 Bacteria 7662
502 Ga0207682_10000094 3300025893 Bacteria 41188
503 Ga0207682_10002919 3300025893 Bacteria 7539
504 Ga0207692_10083632 3300025898 Bacteria 1713
505 Ga0207692_10118294 3300025898 Bacteria 1480
506 Ga0207642_10000337 3300025899 Bacteria 14044
507 Ga0207710_10000795 3300025900 Bacteria 17144
508 Ga0207688_10000074 3300025901 Bacteria 37681
509 Ga0207688_10022635 3300025901 Bacteria 3440
510 Ga0207688_10044743 3300025901 Bacteria 2467
511 Ga0207680_10016185 3300025903 Bacteria 3909
512 Ga0207680_10099999 3300025903 Bacteria 1861
513 Ga0207647_10000218 3300025904 Bacteria 46963
514 Ga0207647_10003322 3300025904 Bacteria 12085
515 Ga0207647_10243685 3300025904 Bacteria 1032
516 Ga0207645_10000247 3300025907 Bacteria 44983
517 Ga0207645_10013731 3300025907 Bacteria 5440
518 Ga0207645_10052669 3300025907 Bacteria 2601
519 Ga0207645_10063226 3300025907 Bacteria 2365
520 Ga0207643_10000004 3300025908 Bacteria 187006
521 Ga0207643_10008573 3300025908 Bacteria 5484
522 Ga0207705_10105850 3300025909 Bacteria 2074
523 Ga0207654_10000627 3300025911 Bacteria 19909
524 Ga0207654_10085670 3300025911 Bacteria 1908
525 Ga0207707_10000618 3300025912 Bacteria 35350
526 Ga0207707_10038599 3300025912 Bacteria 4173
527 Ga0207707_10083749 3300025912 Bacteria 2785
528 Ga0207707_10097675 3300025912 Bacteria 2567
529 Ga0207707_10160380 3300025912 Bacteria 1966
530 Ga0207707_10230751 3300025912 Bacteria 1610
531 Ga0207707_10236246 3300025912 Bacteria 1590
532 Ga0207695_10030828 3300025913 Bacteria 5899
533 Ga0207695_10074815 3300025913 Bacteria 3447
534 Ga0207695_10078150 3300025913 Bacteria 3358
535 Ga0207671_10000733 3300025914 Bacteria 41619
536 Ga0207671_10011571 3300025914 Bacteria 7165
537 Ga0207671_10469454 3300025914 Bacteria 1003
538 Ga0207693_10000620 3300025915 Bacteria 31753
539 Ga0207693_10313872 3300025915 Bacteria 1227
540 Ga0207663_10028439 3300025916 Bacteria 3272
541 Ga0207663_10158105 3300025916 Bacteria 1597
542 Ga0207663_10486232 3300025916 Bacteria 957
543 Ga0207660_10000741 3300025917 Bacteria 21651
544 Ga0207660_10059336 3300025917 Bacteria 2746
545 Ga0207660_10075939 3300025917 Bacteria 2456
546 Ga0207660_10092752 3300025917 Bacteria 2242
547 Ga0207660_10095629 3300025917 Bacteria 2210
548 Ga0207662_10000119 3300025918 Bacteria 37770
549 Ga0207662_10019216 3300025918 Bacteria 3884
550 Ga0207662_10080383 3300025918 Bacteria 1988
551 Ga0207657_10000316 3300025919 Bacteria 51145
552 Ga0207657_10006041 3300025919 Bacteria 12591
553 Ga0207657_10010882 3300025919 Bacteria 9053
554 Ga0207657_10033148 3300025919 Bacteria 4659
555 Ga0207649_10000090 3300025920 Bacteria 75387
556 Ga0207649_11126477 3300025920 Bacteria 619
557 Ga0207652_10000847 3300025921 Bacteria 29115
558 Ga0207652_10014370 3300025921 Bacteria 6413
559 Ga0207652_10090474 3300025921 Bacteria 2689
560 Ga0207652_10142128 3300025921 Bacteria 2147
561 Ga0207652_10236934 3300025921 Bacteria 1645
562 Ga0207681_10000370 3300025923 Bacteria 31836
563 Ga0207681_10046837 3300025923 Bacteria 2909
564 Ga0207681_10067375 3300025923 Bacteria 2482
565 Ga0207681_10092946 3300025923 Bacteria 2158
566 Ga0207681_10238276 3300025923 Bacteria 1415
567 Ga0207681_10471060 3300025923 Bacteria 1024
568 Ga0207681_10503528 3300025923 Bacteria 992
569 Ga0207694_10202515 3300025924 Bacteria 1615
570 Ga0207694_10504182 3300025924 Bacteria 1013
571 Ga0207650_10008243 3300025925 Bacteria 7114
572 Ga0207650_10075730 3300025925 Bacteria 2541
573 Ga0207650_10177751 3300025925 Bacteria 1695
574 Ga0207650_10720481 3300025925 Bacteria 843
575 Ga0207659_10000038 3300025926 Bacteria 93848
576 Ga0207659_10032035 3300025926 Bacteria 3604
577 Ga0207659_10037409 3300025926 Bacteria 3370
578 Ga0207659_10050758 3300025926 Bacteria 2948
579 Ga0207659_10111117 3300025926 Bacteria 2084
580 Ga0207659_10373695 3300025926 Bacteria 1187
581 Ga0207659_10748996 3300025926 Bacteria 838
582 Ga0207687_10000784 3300025927 Bacteria 21392
583 Ga0207687_10045202 3300025927 Bacteria 3043
584 Ga0207687_10851051 3300025927 Bacteria 779
585 Ga0207700_10023407 3300025928 Bacteria 4258
586 Ga0207700_10025920 3300025928 Bacteria 4080
587 Ga0207700_10191022 3300025928 Bacteria 1721
588 Ga0207700_10307506 3300025928 Unclassified 1370
589 Ga0207700_10488415 3300025928 Bacteria 1089
590 Ga0207664_10221093 3300025929 Bacteria 1642
591 Ga0207644_10001053 3300025931 Bacteria 17640
592 Ga0207644_10084086 3300025931 Bacteria 2358
593 Ga0207644_10128525 3300025931 Bacteria 1937
594 Ga0207644_10348793 3300025931 Bacteria 1201
595 Ga0207644_10355621 3300025931 Bacteria 1190
596 Ga0207690_10000239 3300025932 Bacteria 39850
597 Ga0207690_10100971 3300025932 Bacteria 2060
598 Ga0207690_10127677 3300025932 Bacteria 1856
599 Ga0207690_10155497 3300025932 Bacteria 1699
600 Ga0207690_10173942 3300025932 Bacteria 1615
601 Ga0207690_10797520 3300025932 Bacteria 780
602 Ga0207706_10000424 3300025933 Bacteria 45410
603 Ga0207706_10006317 3300025933 Bacteria 11008
604 Ga0207706_10063556 3300025933 Bacteria 3250
605 Ga0207706_10127457 3300025933 Bacteria 2238
606 Ga0207706_10403953 3300025933 Bacteria 1184
607 Ga0207686_10001203 3300025934 Bacteria 15007
608 Ga0207686_10347891 3300025934 Bacteria 1115
609 Ga0207709_10000379 3300025935 Bacteria 44189
610 Ga0207709_10026246 3300025935 Bacteria 3344
611 Ga0207709_10039214 3300025935 Bacteria 2828
612 Ga0207709_10164001 3300025935 Bacteria 1553
613 Ga0207670_10000176 3300025936 Bacteria 42483
614 Ga0207670_10008187 3300025936 Bacteria 5883
615 Ga0207670_10056417 3300025936 Bacteria 2659
616 Ga0207670_10491230 3300025936 Bacteria 995
617 Ga0207669_10000165 3300025937 Bacteria 31741
618 Ga0207669_10000503 3300025937 Bacteria 17079
619 Ga0207669_10111886 3300025937 Bacteria 1832
620 Ga0207669_10134122 3300025937 Bacteria 1707
621 Ga0207669_10141123 3300025937 Bacteria 1672
622 Ga0207669_10751363 3300025937 Bacteria 805
623 Ga0207704_10006804 3300025938 Bacteria 5355
624 Ga0207704_10169875 3300025938 Bacteria 1563
625 Ga0207704_10982161 3300025938 Bacteria 713
626 Ga0207704_11530167 3300025938 Bacteria 573
627 Ga0207665_10006896 3300025939 Bacteria 7518
628 Ga0207665_10800103 3300025939 Bacteria 745
629 Ga0207691_10000358 3300025940 Bacteria 46095
630 Ga0207691_10003934 3300025940 Bacteria 14432
631 Ga0207691_10009787 3300025940 Bacteria 9202
632 Ga0207691_10041676 3300025940 Bacteria 4238
633 Ga0207691_10474061 3300025940 Bacteria 1064
634 Ga0207711_10000780 3300025941 Bacteria 31295
635 Ga0207711_10080904 3300025941 Bacteria 2838
636 Ga0207711_10157710 3300025941 Bacteria 2052
637 Ga0207711_10221303 3300025941 Bacteria 1731
638 Ga0207711_10301903 3300025941 Bacteria 1477
639 Ga0207711_10335360 3300025941 Bacteria 1399
640 Ga0207689_10000479 3300025942 Bacteria 37696
641 Ga0207689_10019815 3300025942 Bacteria 5666
642 Ga0207689_10021746 3300025942 Bacteria 5394
643 Ga0207689_10225499 3300025942 Bacteria 1549
644 Ga0207689_10347484 3300025942 Bacteria 1233
645 Ga0207661_10000604 3300025944 Bacteria 22956
646 Ga0207679_10000139 3300025945 Bacteria 59804
647 Ga0207679_10010875 3300025945 Bacteria 5868
648 Ga0207679_10220849 3300025945 Bacteria 1594
649 Ga0207667_10023803 3300025949 Bacteria 6740
650 Ga0207667_10048182 3300025949 Bacteria 4506
651 Ga0207667_10072019 3300025949 Bacteria 3592
652 Ga0207667_10077776 3300025949 Bacteria 3439
653 Ga0207667_10329081 3300025949 Bacteria 1560
654 Ga0207667_10450442 3300025949 Bacteria 1308
655 Ga0207667_10750860 3300025949 Bacteria 975
656 Ga0207667_10757239 3300025949 Bacteria 970
657 Ga0207651_10000072 3300025960 Bacteria 46009
658 Ga0207651_10018879 3300025960 Bacteria 4117
659 Ga0207651_10049604 3300025960 Bacteria 2845
660 Ga0207651_10273682 3300025960 Bacteria 1392
661 Ga0207712_10000588 3300025961 Bacteria 29188
662 Ga0207712_10072261 3300025961 Bacteria 2484
663 Ga0207712_10197380 3300025961 Bacteria 1593
664 Ga0207668_10000168 3300025972 Bacteria 45205
665 Ga0207668_10024716 3300025972 Bacteria 3881
666 Ga0207668_10063344 3300025972 Bacteria 2608
667 Ga0207668_10265654 3300025972 Bacteria 1400
668 Ga0207668_10516160 3300025972 Bacteria 1030
669 Ga0207668_11145320 3300025972 Bacteria 698
670 Ga0207640_10000242 3300025981 Bacteria 37007
671 Ga0207640_10870076 3300025981 Bacteria 785
672 Ga0207658_10000551 3300025986 Bacteria 33984
673 Ga0207658_10000667 3300025986 Bacteria 29975
674 Ga0207658_10089292 3300025986 Bacteria 2385
675 Ga0207658_10279522 3300025986 Bacteria 1430
676 Ga0207658_10394614 3300025986 Bacteria 1215
677 Ga0207658_10928498 3300025986 Bacteria 793
678 Ga0207658_11081976 3300025986 Bacteria 732
679 Ga0207677_10010368 3300026023 Bacteria 5270
680 Ga0207677_10281154 3300026023 Bacteria 1366
681 Ga0207703_10000463 3300026035 Bacteria 42725
682 Ga0207703_10026304 3300026035 Bacteria 4578
683 Ga0207703_10096833 3300026035 Bacteria 2492
684 Ga0207703_10116701 3300026035 Bacteria 2286
685 Ga0207703_10825227 3300026035 Bacteria 886
686 Ga0207703_10977148 3300026035 Bacteria 812
687 Ga0207639_10002404 3300026041 Bacteria 12567
688 Ga0207639_10238346 3300026041 Bacteria 1580
689 Ga0207678_10000447 3300026067 Bacteria 37597
690 Ga0207678_10005483 3300026067 Bacteria 11344
691 Ga0207678_10010779 3300026067 Bacteria 8031
692 Ga0207678_10025630 3300026067 Bacteria 5147
693 Ga0207678_10061333 3300026067 Bacteria 3234
694 Ga0207708_10000293 3300026075 Bacteria 39298
695 Ga0207708_10011723 3300026075 Bacteria 6534
696 Ga0207708_10088911 3300026075 Bacteria 2380
697 Ga0207702_10007213 3300026078 Bacteria 9510
698 Ga0207702_10066021 3300026078 Bacteria 3100
699 Ga0207702_10106481 3300026078 Bacteria 2485
700 Ga0207702_10288182 3300026078 Bacteria 1555
701 Ga0207641_10000024 3300026088 Bacteria 250751
702 Ga0207641_10000724 3300026088 Bacteria 35413
703 Ga0207641_10085911 3300026088 Bacteria 2742
704 Ga0207641_10168229 3300026088 Bacteria 1998
705 Ga0207641_10297567 3300026088 Bacteria 1523
706 Ga0207641_10343068 3300026088 Bacteria 1422
707 Ga0207648_10000223 3300026089 Bacteria 61064
708 Ga0207648_10050414 3300026089 Bacteria 3640
709 Ga0207648_10050996 3300026089 Bacteria 3617
710 Ga0207648_10076977 3300026089 Bacteria 2908
711 Ga0207676_10000392 3300026095 Bacteria 37207
712 Ga0207676_10012153 3300026095 Bacteria 6163
713 Ga0207676_10015307 3300026095 Bacteria 5531
714 Ga0207676_10160787 3300026095 Bacteria 1945
715 Ga0207674_10000955 3300026116 Bacteria 37769
716 Ga0207674_10083576 3300026116 Bacteria 3192
717 Ga0207675_100000364 3300026118 Bacteria 43420
718 Ga0207675_100012644 3300026118 Bacteria 7887
719 Ga0207675_100056416 3300026118 Bacteria 3664
720 Ga0207675_100955060 3300026118 Bacteria 875
721 Ga0207683_10000397 3300026121 Bacteria 39911
722 Ga0207683_10003372 3300026121 Bacteria 13927
723 Ga0207683_10092022 3300026121 Bacteria 2702
724 Ga0207683_10237091 3300026121 Bacteria 1664
725 Ga0207683_10359865 3300026121 Bacteria 1336
726 Ga0207698_10003705 3300026142 Bacteria 9239
727 Ga0207698_10280383 3300026142 Bacteria 1541
728 Ga0207698_10707730 3300026142 Bacteria 1003
729 Ga0209973_1038301 3300027252 Bacteria 696
730 Ga0209968_1016505 3300027526 Bacteria 1173
731 Ga0210002_1002444 3300027617 Bacteria 2678
732 Ga0209971_1008566 3300027682 Bacteria 2427
733 Ga0209971_1034000 3300027682 Bacteria 1225
734 Ga0209966_1000561 3300027695 Bacteria 9270
735 Ga0209966_1006051 3300027695 Bacteria 2091
736 Ga0209966_1058605 3300027695 Bacteria 829
737 Ga0209998_10000337 3300027717 Bacteria 13862
738 Ga0209998_10003051 3300027717 Bacteria 3718
739 Ga0209998_10006206 3300027717 Bacteria 2483
740 Ga0209813_10000022 3300027866 Bacteria 72813
741 Ga0209974_10001544 3300027876 Bacteria 8360
742 Ga0209974_10052047 3300027876 Bacteria 1378
743 Ga0207428_10000188 3300027907 Bacteria 85820
744 Ga0207428_10000439 3300027907 Bacteria 50911
745 Ga0207428_10000617 3300027907 Bacteria 42011
746 Ga0207428_10051026 3300027907 Bacteria 3307
747 Ga0207428_10070210 3300027907 Bacteria 2753
748 Ga0268266_10000003 3300028379 Bacteria 1701703
749 Ga0268266_10001473 3300028379 Bacteria 27941
750 Ga0268265_10002666 3300028380 Bacteria 13234
751 Ga0268265_10117116 3300028380 Bacteria 2187
752 Ga0268264_10000890 3300028381 Bacteria 31465
753 Ga0268264_10014717 3300028381 Bacteria 6428
754 Ga0268264_10015771 3300028381 Bacteria 6187
755 Ga0268264_10169587 3300028381 Bacteria 1973
756 Ga0268264_10192887 3300028381 Bacteria 1858
757 Ga0268264_10264664 3300028381 Bacteria 1604
758 Ga0265338_10003995 3300028800 Bacteria 20275
759 Ga0265338_10019635 3300028800 Bacteria 7154
760 Ga0265338_10079617 3300028800 Bacteria 2757
761 Ga0265338_10162353 3300028800 Bacteria 1724
762 Ga0265338_10712501 3300028800 Bacteria 692
763 Ga0265330_10046448 3300031235 Bacteria 1913
764 Ga0265330_10054365 3300031235 Bacteria 1750
765 Ga0265332_10028036 3300031238 Bacteria 2466
766 Ga0265320_10029158 3300031240 Bacteria 2858
767 Ga0265320_10073021 3300031240 Bacteria 1613
768 Ga0265325_10000053 3300031241 Bacteria 77918
769 Ga0265325_10002884 3300031241 Bacteria 11462
770 Ga0265325_10033795 3300031241 Bacteria 2725
771 Ga0265325_10042845 3300031241 Bacteria 2364
772 Ga0265325_10055668 3300031241 Bacteria 2021
773 Ga0265325_10265099 3300031241 Bacteria 774
774 Ga0265340_10004910 3300031247 Bacteria 7437
775 Ga0265340_10008636 3300031247 Bacteria 5491
776 Ga0265340_10014538 3300031247 Bacteria 4108
777 Ga0265340_10024558 3300031247 Bacteria 3060
778 Ga0265340_10044626 3300031247 Bacteria 2168
779 Ga0265340_10229863 3300031247 Bacteria 829
780 Ga0265339_10000038 3300031249 Bacteria 121961
781 Ga0265339_10004385 3300031249 Bacteria 9621
782 Ga0265339_10007935 3300031249 Bacteria 6809
783 Ga0265339_10447040 3300031249 Bacteria 600
784 Ga0265331_10014754 3300031250 Bacteria 4149
785 Ga0265331_10025253 3300031250 Bacteria 3001
786 Ga0265331_10302686 3300031250 Bacteria 716
787 Ga0265316_10005544 3300031344 Bacteria 12244
788 Ga0265316_10028534 3300031344 Bacteria 4603
789 Ga0265316_10095708 3300031344 Bacteria 2261
790 Ga0265316_10360448 3300031344 Bacteria 1051
791 Ga0307509_10020537 3300031507 Bacteria 7489
792 Ga0307408_101525205 3300031548 Bacteria 633
793 Ga0265313_10000034 3300031595 Bacteria 126370
794 Ga0265313_10000216 3300031595 Bacteria 62003
795 Ga0265313_10003192 3300031595 Bacteria 13508
796 Ga0265313_10005099 3300031595 Bacteria 9781
797 Ga0265313_10026728 3300031595 Bacteria 3034
798 Ga0265313_10028250 3300031595 Bacteria 2919
799 Ga0265313_10067348 3300031595 Bacteria 1657
800 Ga0265313_10089728 3300031595 Bacteria 1382
801 Ga0265314_10008446 3300031711 Bacteria 8824
802 Ga0265314_10011358 3300031711 Bacteria 7359
803 Ga0265314_10013349 3300031711 Bacteria 6640
804 Ga0265314_10068145 3300031711 Bacteria 2393
805 Ga0265314_10078327 3300031711 Bacteria 2189
806 Ga0265342_10004574 3300031712 Bacteria 10812
807 Ga0265342_10012660 3300031712 Bacteria 5706
808 Ga0265342_10036432 3300031712 Bacteria 3005
809 Ga0265342_10047199 3300031712 Bacteria 2586
810 Ga0265342_10463264 3300031712 Bacteria 649
811 Ga0307413_10052686 3300031824 Bacteria 2459
812 Ga0307413_10108059 3300031824 Bacteria 1856
813 Ga0307410_10057903 3300031852 Bacteria 2640
814 Ga0307406_10361853 3300031901 Bacteria 1138
815 Ga0307406_10572620 3300031901 Bacteria 927
816 Ga0307407_10197145 3300031903 Bacteria 1346
817 Ga0307412_10308783 3300031911 Bacteria 1253
818 Ga0307409_100098193 3300031995 Bacteria 2421
819 Ga0307416_100002023 3300032002 Bacteria 11401
820 Ga0307416_101572014 3300032002 Bacteria 763
821 Ga0307414_10055254 3300032004 Bacteria 2779
822 Ga0307414_10329241 3300032004 Bacteria 1303
823 Ga0307411_10038623 3300032005 Bacteria 3013
824 Ga0307411_10061243 3300032005 Bacteria 2504
825 Ga0307411_10062033 3300032005 Bacteria 2492
826 Ga0307415_100009260 3300032126 Bacteria 5506
827 Ga0307415_100362530 3300032126 Bacteria 1224
828 Ga0373930_0000783 3300034816 Bacteria 4522
829 Ga0373948_0000589 3300034817 Bacteria 4652
830 Ga0373950_0055599 3300034818 Bacteria 785
831 Ga0373958_0000380 3300034819 Bacteria 5375
832 Ga0373958_0004594 3300034819 Bacteria 2051
833 Ga0373959_0001298 3300034820 Bacteria 4007
834 Ga0373938_0000446 3300034957 Bacteria 6730
835 Ga0373938_0025044 3300034957 Bacteria 1238
836 Ga0373928_0000205 3300035084 Bacteria 11403
837 Ga0373929_0005397 3300035085 Bacteria 2298
838 Ga0373929_0006936 3300035085 Bacteria 2059
839 Ga0373934_0013989 3300035086 Bacteria 3038
840 Ga0373940_0001074 3300035088 Bacteria 4733
841 Ga0373944_0040747 3300035089 Bacteria 1435
842 Ga0373949_0001679 3300035090 Bacteria 6169
843 Ga0373951_0002137 3300035091 Bacteria 5047
844 Ga0373951_0002622 3300035091 Bacteria 4510
845 Ga0373952_0077547 3300035092 Bacteria 842
846 Ga0373923_0029733 3300035111 Bacteria 2193
847 Ga0373923_0113194 3300035111 Bacteria 1207
848 Ga0373923_0207552 3300035111 Bacteria 907
849 Ga0373932_0000746 3300035112 Bacteria 9717
850 Ga0373932_0000843 3300035112 Bacteria 9035
851 Ga0373932_0008462 3300035112 Bacteria 2460
852 Ga0373932_0047863 3300035112 Bacteria 1258
853 Ga0373939_0000671 3300035114 Bacteria 8492
854 Ga0373939_0001887 3300035114 Bacteria 5013
855 Ga0373939_0242229 3300035114 Bacteria 698
856 Ga0373941_0000313 3300035115 Bacteria 9424
857 Ga0373941_0000789 3300035115 Bacteria 6499
858 Ga0373941_0048933 3300035115 Bacteria 1336
859 Ga0373954_0055239 3300035118 Bacteria 1868
860 Ga0373956_0017665 3300035119 Bacteria 3011
861 Ga0373956_0215011 3300035119 Bacteria 912
862 Ga0373960_0001070 3300035121 Bacteria 5904
863 Ga0373960_0007456 3300035121 Bacteria 2592
864 Ga0373960_0075926 3300035121 Bacteria 1048
865 Ga0373943_0004169 3300035170 Bacteria 6558
866 Ga0373943_0190412 3300035170 Bacteria 1131
867 Ga0373943_0441405 3300035170 Bacteria 755
868 Ga0373946_0049436 3300035171 Bacteria 1753
869 Ga0373946_0111353 3300035171 Bacteria 1239
870 Ga0373955_0015281 3300035172 Bacteria 3754
871 Ga0373955_0102898 3300035172 Bacteria 1642
872 Ga0373955_0124892 3300035172 Bacteria 1498
873 Ga0373955_0204258 3300035172 Bacteria 1177
874 Ga0373942_0000880 3300035207 Bacteria 8248
875 Ga0373942_0079001 3300035207 Bacteria 973
876 Ga0373942_0183163 3300035207 Bacteria 687
877 Ga0373961_0001890 3300035241 Bacteria 5706
878 Ga0373961_0002053 3300035241 Bacteria 5378
879 Ga0373961_0054891 3300035241 Bacteria 1192
880 Ga0373962_0001390 3300035242 Bacteria 5708
881 Ga0373962_0001576 3300035242 Bacteria 5408
882 Ga0373924_0079053 3300035410 Bacteria 1397
883 Ga0373924_0159125 3300035410 Bacteria 990
884 Ga0373931_0000089 3300035691 Bacteria 42136
885 Ga0373931_0157759 3300035691 Bacteria 1327
886 Ga0373935_0035621 3300035692 Bacteria 3106
887 Ga0373935_0036251 3300035692 Bacteria 3083
888 Ga0373935_0039009 3300035692 Bacteria 2976
889 Ga0373935_0117704 3300035692 Bacteria 1771
890 Ga0373927_0000831 3300035695 Bacteria 23649
891 Ga0373927_0012257 3300035695 Bacteria 5704
892 Ga0373927_0060652 3300035695 Bacteria 2448
893 Ga0373927_0108486 3300035695 Bacteria 1808
894 Ga0373927_0472411 3300035695 Bacteria 829
895 Ga0373933_0052140 3300035724 Bacteria 2447
896 Ga0373933_0132276 3300035724 Bacteria 1570
897 Ga0373933_0182357 3300035724 Bacteria 1339
898 Ga0373933_0226279 3300035724 Bacteria 1201
899 Ga0373947_0027105 3300035725 Bacteria 3352
900 Ga0373947_0105255 3300035725 Bacteria 1777
901 Ga0373947_0325679 3300035725 Bacteria 1028
902 Ga0373947_0432066 3300035725 Bacteria 891
903 Ga0373947_0453661 3300035725 Bacteria 868
904 Ga0373947_0589481 3300035725 Bacteria 757
905 Ga0373937_0033958 3300036401 Bacteria 4637
906 Ga0373937_0073546 3300036401 Bacteria 3153
907 Ga0373937_0110857 3300036401 Bacteria 2552
908 Ga0373937_0161426 3300036401 Bacteria 2101
909 Ga0373937_0186248 3300036401 Bacteria 1950
910 Ga0373937_0267902 3300036401 Bacteria 1612
911 Ga0373925_0001906 3300037068 Bacteria 17311
912 Ga0373925_0005716 3300037068 Bacteria 9245
913 Ga0373925_0010339 3300037068 Bacteria 6771
914 Ga0373925_0041686 3300037068 Bacteria 3404
915 Ga0373925_0174081 3300037068 Bacteria 1700
916 Ga0373925_0845352 3300037068 Bacteria 754
917 Ga0395899_0000091 3300037312 Bacteria 154780
918 Ga0395899_0021221 3300037312 Bacteria 4926
919 Ga0395899_0120435 3300037312 Bacteria 1880
920 Ga0395899_0174791 3300037312 Bacteria 1511
921 Ga0395900_0000008 3300037418 Bacteria 480459
922 Ga0395900_0004620 3300037418 Bacteria 14529
923 Ga0395900_0018770 3300037418 Bacteria 7052
924 Ga0395900_0096702 3300037418 Bacteria 3034
925 Ga0395900_0401895 3300037418 Bacteria 1334
926 Ga0395900_0463018 3300037418 Bacteria 1222
927 Ga0395900_0806536 3300037418 Bacteria 866
928 Ga0395898_0020960 3300037466 Bacteria 6632
929 Ga0395898_0023858 3300037466 Bacteria 6175
930 Ga0395898_0051029 3300037466 Bacteria 4046
931 Ga0395898_0157574 3300037466 Bacteria 2171
932 Ga0395898_0489496 3300037466 Bacteria 1170
933 Ga0395898_0613727 3300037466 Bacteria 1030
934 Ga0395898_1241054 3300037466 Bacteria 676
935 Ga0395905_0024759 3300037471 Bacteria 5664
936 Ga0395905_0139472 3300037471 Bacteria 2281
937 Ga0395905_0196645 3300037471 Bacteria 1891
938 Ga0395901_0000008 3300038443 Bacteria 495962
939 Ga0395901_0003268 3300038443 Bacteria 16314
940 Ga0395901_0009450 3300038443 Bacteria 9893
941 Ga0395901_0043653 3300038443 Bacteria 4649
942 Ga0395901_0082951 3300038443 Bacteria 3350
943 Ga0395901_0641501 3300038443 Bacteria 1066
944 Ga0400488_50919 3300038741 Bacteria 4090
945 Ga0242420_003132 3300038996 Bacteria 2429
946 Ga0400483_254821 3300039062 Bacteria 1015
947 Ga0400483_280669 3300039062 Bacteria 6443
948 Ga0400487_13291 3300039110 Bacteria 2023
949 Ga0400487_45896 3300039110 Bacteria 1230
950 Ga0436365_1030951 3300039437 Bacteria 1707
951 Ga0436365_1635885 3300039437 Bacteria 813
952 Ga0451791_1510351 3300041451 Bacteria 1386
953 Ga0451807_1344637 3300041486 Bacteria 1030
954 Ga0451833_0367787 3300041491 Bacteria 770
955 Ga0439445_0046765 3300042004 Bacteria 1161
956 Ga0439450_007457 3300042008 Bacteria 2005
957 Ga0439455_0036417 3300042012 Bacteria 1245
958 Ga0439446_0179377 3300042156 Bacteria 707
959 Ga0439458_0001539 3300042157 Bacteria 5768
960 Ga0439459_0030428 3300042438 Bacteria 1095
961 Ga0439464_0002701 3300042439 Bacteria 4398
962 Ga0439460_0004764 3300042461 Bacteria 3310
963 Ga0453684_0703876 3300044712 Bacteria 1097
964 Ga0466971_0035626 3300044719 Bacteria 2232
965 Ga0466968_0356038 3300044735 Bacteria 712
966 Ga0466970_0301636 3300044765 Bacteria 903
967 Ga0466957_0318211 3300044842 Bacteria 1049
968 Ga0451576_0000053 3300045051 Bacteria 308708
969 Ga0451576_0046866 3300045051 Bacteria 4549
970 Ga0495592_0024672 3300046454 Bacteria 4571
971 Ga0495592_0083439 3300046454 Bacteria 2307
972 Ga0495603_0025386 3300046455 Bacteria 3583
973 Ga0495603_0078206 3300046455 Bacteria 1940
974 Ga0495603_0390972 3300046455 Bacteria 797
975 Ga0495629_0016583 3300046459 Bacteria 5288
976 Ga0495629_0196403 3300046459 Bacteria 1395
977 Ga0495629_0219946 3300046459 Bacteria 1310
978 Ga0495638_0163993 3300046460 Bacteria 1280
979 Ga0495641_0076153 3300046461 Bacteria 1504
980 Ga0495641_0118939 3300046461 Bacteria 1178
981 Ga0495651_0108915 3300046462 Bacteria 2051
982 Ga0495651_0161534 3300046462 Bacteria 1604
983 Ga0495651_0167887 3300046462 Bacteria 1566
984 Ga0495653_0004747 3300046463 Bacteria 11002
985 Ga0495653_0134105 3300046463 Bacteria 1749
986 Ga0495653_0152393 3300046463 Bacteria 1614
987 Ga0495650_0000862 3300046471 Bacteria 36369
988 Ga0495580_0569732 3300046472 Bacteria 750
989 Ga0495582_0037796 3300046473 Bacteria 2656
990 Ga0495639_0020277 3300046475 Bacteria 2904
991 Ga0495662_0041216 3300046476 Bacteria 2229
992 Ga0495662_0232480 3300046476 Bacteria 909
993 Ga0495662_0320630 3300046476 Bacteria 762
994 Ga0495664_0008207 3300046477 Bacteria 5814
995 Ga0495664_0015820 3300046477 Bacteria 4292
996 Ga0495664_0143191 3300046477 Bacteria 1449
997 Ga0495585_0173779 3300046492 Bacteria 1111
998 Ga0495594_0007555 3300046499 Bacteria 5593
999 Ga0495594_0010719 3300046499 Unclassified 4756
1000 Ga0495594_0068893 3300046499 Bacteria 1965
1001 Ga0495596_0050744 3300046500 Bacteria 1626
1002 Ga0495607_0004284 3300046501 Bacteria 10541
1003 Ga0495607_0128568 3300046501 Bacteria 1321
1004 Ga0495608_0010468 3300046511 Bacteria 6472
1005 Ga0495608_0043232 3300046511 Bacteria 3011
1006 Ga0495616_0067833 3300046513 Bacteria 1733
1007 Ga0495618_0011951 3300046514 Bacteria 5268
1008 Ga0495618_0020087 3300046514 Bacteria 4112
1009 Ga0495618_0174650 3300046514 Bacteria 1366
1010 Ga0495618_0182163 3300046514 Bacteria 1334
1011 Ga0495628_0064442 3300046516 Bacteria 2869
1012 Ga0495628_0133209 3300046516 Bacteria 1900
1013 Ga0495628_0258800 3300046516 Bacteria 1297
1014 Ga0495628_0317292 3300046516 Bacteria 1150
1015 Ga0495630_0037202 3300046517 Bacteria 3639
1016 Ga0495631_0106146 3300046518 Bacteria 1208
1017 Ga0495644_0036426 3300046523 Bacteria 1856
1018 Ga0495663_0085684 3300046525 Bacteria 1021
1019 Ga0495666_0058889 3300046526 Bacteria 1837
1020 Ga0495666_0060763 3300046526 Bacteria 1806
1021 Ga0495642_0073339 3300046528 Bacteria 1434
1022 Ga0495642_0077143 3300046528 Bacteria 1399
1023 Ga0495652_0009353 3300046529 Bacteria 8906
1024 Ga0495652_0045135 3300046529 Bacteria 3792
1025 Ga0495652_0081128 3300046529 Bacteria 2677
1026 Ga0495640_0020328 3300046533 Unclassified 4889
1027 Ga0495640_0048245 3300046533 Bacteria 2944
1028 Ga0495640_0135115 3300046533 Bacteria 1593
1029 Ga0495640_0144154 3300046533 Bacteria 1533
1030 Ga0495586_0015563 3300046535 Bacteria 4048
1031 Ga0495586_0236261 3300046535 Bacteria 1041
1032 Ga0495587_0001962 3300046536 Bacteria 13708
1033 Ga0495587_0037236 3300046536 Bacteria 2922
1034 Ga0495587_0071037 3300046536 Bacteria 2025
1035 Ga0495587_0434075 3300046536 Bacteria 728
1036 Ga0495598_0002055 3300046537 Bacteria 4100
1037 Ga0495609_0066967 3300046538 Bacteria 1582
1038 Ga0495609_0341704 3300046538 Bacteria 605
1039 Ga0495621_0022372 3300046539 Bacteria 2094
1040 Ga0495645_0007103 3300046543 Bacteria 7795
1041 Ga0495645_0012676 3300046543 Bacteria 5945
1042 Ga0495645_0320493 3300046543 Bacteria 1006
1043 Ga0495645_0331986 3300046543 Bacteria 984
1044 Ga0495645_0373970 3300046543 Bacteria 913
1045 Ga0495645_0632034 3300046543 Bacteria 656
1046 Ga0495633_0199127 3300046558 Bacteria 920
1047 Ga0495667_0017883 3300046559 Bacteria 4789
1048 Ga0495667_0083362 3300046559 Bacteria 2076
1049 Ga0495667_0289698 3300046559 Bacteria 1038
1050 Ga0495656_0026244 3300046615 Bacteria 2318
1051 Ga0495668_0006091 3300046616 Bacteria 7985
1052 Ga0495668_0470005 3300046616 Bacteria 692
1053 Ga0495634_0027895 3300046642 Bacteria 3924
1054 Ga0495634_0103516 3300046642 Bacteria 1837
1055 Ga0495634_0138718 3300046642 Bacteria 1545
1056 Ga0495611_0414425 3300046648 Bacteria 615
1057 Ga0495625_0111236 3300046660 Bacteria 1872
1058 Ga0495625_0317097 3300046660 Bacteria 993
1059 Ga0495625_0414025 3300046660 Bacteria 840
1060 Ga0495635_0013994 3300046663 Bacteria 5613
1061 Ga0495635_0261880 3300046663 Bacteria 1164
1062 Ga0495659_0031123 3300046664 Bacteria 1860
1063 Ga0495661_0340419 3300046665 Bacteria 741
1064 Ga0495588_0373968 3300046674 Bacteria 748
1065 Ga0495657_0006791 3300046675 Bacteria 8914
1066 Ga0495657_0042843 3300046675 Bacteria 3088
1067 Ga0495657_0353046 3300046675 Bacteria 870
1068 Ga0495599_0038248 3300046678 Bacteria 3015
1069 Ga0495599_0141356 3300046678 Bacteria 1493
1070 Ga0495623_0041979 3300046679 Bacteria 2916
1071 Ga0495623_0042371 3300046679 Bacteria 2899
1072 Ga0495623_0051910 3300046679 Bacteria 2593
1073 Ga0495646_0040972 3300046680 Bacteria 2848
1074 Ga0495646_0052580 3300046680 Bacteria 2460
1075 Ga0495646_0102029 3300046680 Bacteria 1644
1076 Ga0495647_0007874 3300046681 Bacteria 3578
1077 Ga0495647_0102506 3300046681 Bacteria 1186
1078 Ga0495647_0201655 3300046681 Bacteria 872
1079 Ga0495658_0172949 3300046683 Bacteria 1337
1080 Ga0495658_0304342 3300046683 Bacteria 1009
1081 Ga0495669_0000427 3300046684 Bacteria 20038
1082 Ga0495669_0187555 3300046684 Bacteria 987
1083 Ga0495624_0076804 3300046690 Bacteria 2072
1084 Ga0495624_0115329 3300046690 Bacteria 1651
1085 Ga0495624_0139127 3300046690 Bacteria 1488
1086 Ga0495670_0100348 3300046691 Bacteria 1490
1087 Ga0495670_0406210 3300046691 Bacteria 736
1088 Ga0495649_0093725 3300046694 Bacteria 1599
1089 Ga0495589_0158671 3300046794 Bacteria 1078
1090 Ga0495600_0001643 3300046809 Bacteria 12464
1091 Ga0495600_0036873 3300046809 Bacteria 3178
1092 Ga0495600_0517243 3300046809 Bacteria 732
1093 Ga0495581_0015496 3300047315 Unclassified 4425
1094 Ga0495581_0153967 3300047315 Bacteria 1343
1095 Ga0495604_0014975 3300047317 Bacteria 6186
1096 Ga0495604_0083292 3300047317 Bacteria 2391
1097 Ga0495604_0142048 3300047317 Bacteria 1714
1098 Ga0495674_0033351 3300047319 Bacteria 4665
1099 Ga0495674_0066473 3300047319 Bacteria 3127
1100 Ga0495674_0130122 3300047319 Bacteria 2121
1101 Ga0495676_0017048 3300047321 Bacteria 6426
1102 Ga0495676_0155001 3300047321 Bacteria 1626
1103 Ga0495680_0006434 3300047322 Bacteria 10915
1104 Ga0495680_0009794 3300047322 Bacteria 8594
1105 Ga0495680_0037575 3300047322 Bacteria 3877
1106 Ga0495680_0099190 3300047322 Bacteria 2172
1107 Ga0495675_0001359 3300047444 Bacteria 14808
1108 Ga0495677_0068222 3300047445 Bacteria 1324
1109 Ga0495681_0129251 3300047470 Bacteria 1077
1110 Ga0495684_0036975 3300047471 Bacteria 3743
1111 Ga0495684_0133514 3300047471 Bacteria 1863
1112 Ga0495684_0134903 3300047471 Bacteria 1853
1113 Ga0495684_0356851 3300047471 Bacteria 1036
1114 Ga0495593_0073192 3300047673 Bacteria 1778
1115 Ga0495593_0171911 3300047673 Bacteria 1092
1116 Ga0495602_0027761 3300048088 Bacteria 5432
1117 Ga0495602_0260333 3300048088 Bacteria 1287
1118 Ga0495614_0058107 3300048089 Bacteria 1661
1119 Ga0495615_0010480 3300048090 Bacteria 1854
1120 Ga0495615_0179806 3300048090 Bacteria 644
1121 Ga0495626_0037084 3300048091 Bacteria 2319
1122 Ga0496100_0000200 3300048903 Bacteria 32909
1123 Ga0496100_0083141 3300048903 Bacteria 2166
1124 Ga0496100_0273753 3300048903 Bacteria 1256
1125 Ga0496100_0437083 3300048903 Bacteria 1001
1126 Ga0496100_0937557 3300048903 Bacteria 680
1127 Ga0496101_0000339 3300048904 Bacteria 31619
1128 Ga0496101_0024098 3300048904 Bacteria 4209
1129 Ga0496101_0044562 3300048904 Bacteria 3175
1130 Ga0496101_0141799 3300048904 Bacteria 1832
1131 Ga0496101_0182747 3300048904 Bacteria 1615
1132 Ga0496101_0197826 3300048904 Bacteria 1553
1133 Ga0496101_0216240 3300048904 Bacteria 1486
1134 Ga0496101_0369854 3300048904 Bacteria 1127
1135 Ga0496102_0000729 3300048905 Bacteria 32340
1136 Ga0496102_0015623 3300048905 Bacteria 6613
1137 Ga0496102_0077802 3300048905 Bacteria 3053
1138 Ga0496102_0130656 3300048905 Bacteria 2350
1139 Ga0496103_0001639 3300048906 Bacteria 14682
1140 Ga0496103_0018740 3300048906 Bacteria 4153
1141 Ga0496103_0133778 3300048906 Bacteria 1584
1142 Ga0496103_0137031 3300048906 Bacteria 1564
1143 Ga0496103_0562432 3300048906 Bacteria 728
1144 Ga0496104_0000955 3300048907 Bacteria 24869
1145 Ga0496104_0109519 3300048907 Bacteria 2647
1146 Ga0496104_0157341 3300048907 Bacteria 2180
1147 Ga0496104_0213971 3300048907 Bacteria 1839
1148 Ga0496104_0297856 3300048907 Bacteria 1525
1149 Ga0496104_0303886 3300048907 Bacteria 1508
1150 Ga0496104_0521165 3300048907 Bacteria 1100
1151 Ga0496104_0610431 3300048907 Bacteria 1001
1152 Ga0496105_0001292 3300048908 Bacteria 17514
1153 Ga0496105_0006648 3300048908 Bacteria 8901
1154 Ga0496105_0025818 3300048908 Bacteria 4785
1155 Ga0496105_0245718 3300048908 Bacteria 1451
1156 Ga0496106_0000202 3300048909 Bacteria 41819
1157 Ga0496106_0018636 3300048909 Bacteria 5137
1158 Ga0496106_0087756 3300048909 Bacteria 2397
1159 Ga0496106_0121899 3300048909 Bacteria 2038
1160 Ga0496106_0187488 3300048909 Bacteria 1643
1161 Ga0496106_0323434 3300048909 Bacteria 1238
1162 Ga0496106_0401861 3300048909 Bacteria 1101
1163 Ga0496107_0000066 3300048910 Bacteria 52207
1164 Ga0496107_0007453 3300048910 Bacteria 7543
1165 Ga0496107_0018036 3300048910 Bacteria 4966
1166 Ga0496107_0077449 3300048910 Bacteria 2422
1167 Ga0496107_0115073 3300048910 Bacteria 1979
1168 Ga0496107_0154550 3300048910 Bacteria 1698
1169 Ga0496108_0016063 3300048911 Bacteria 6104
1170 Ga0496108_0035988 3300048911 Bacteria 4117
1171 Ga0496108_0381633 3300048911 Bacteria 1230
1172 Ga0496109_0000595 3300048912 Bacteria 30262
1173 Ga0496109_0016670 3300048912 Bacteria 6427
1174 Ga0496109_0016772 3300048912 Bacteria 6409
1175 Ga0496109_0257302 3300048912 Bacteria 1644
1176 Ga0496110_0026354 3300048913 Bacteria 4973
1177 Ga0496110_0070671 3300048913 Bacteria 3094
1178 Ga0496110_0127660 3300048913 Bacteria 2295
1179 Ga0496110_0214205 3300048913 Bacteria 1751
1180 Ga0496110_0236378 3300048913 Bacteria 1662
1181 Ga0496110_0467670 3300048913 Bacteria 1149
1182 Ga0496110_0748750 3300048913 Bacteria 880
1183 Ga0496111_0089239 3300048914 Bacteria 2258
1184 Ga0496111_0095564 3300048914 Bacteria 2180
1185 Ga0496111_0177688 3300048914 Bacteria 1582
1186 Ga0496112_0012515 3300048915 Bacteria 7794
1187 Ga0496112_0029333 3300048915 Bacteria 5320
1188 Ga0496112_0157012 3300048915 Bacteria 2242
1189 Ga0496112_0340796 3300048915 Bacteria 1442
1190 Ga0496112_0412439 3300048915 Bacteria 1290
1191 Ga0496113_0012395 3300048916 Bacteria 5728
1192 Ga0496113_0019760 3300048916 Bacteria 4720
1193 Ga0496113_0100490 3300048916 Bacteria 2241
1194 Ga0496113_0210480 3300048916 Bacteria 1548
1195 Ga0496114_0003763 3300048917 Bacteria 11696
1196 Ga0496114_0065107 3300048917 Bacteria 3053
1197 Ga0496114_0108933 3300048917 Bacteria 2371
1198 Ga0496114_0294606 3300048917 Bacteria 1432
1199 Ga0496114_0319253 3300048917 Bacteria 1372
1200 Ga0496114_0530817 3300048917 Bacteria 1040
1201 Ga0496114_0581582 3300048917 Bacteria 988
1202 Ga0496115_0009981 3300048918 Bacteria 7074
1203 Ga0496115_0037278 3300048918 Bacteria 3852
1204 Ga0496115_0040604 3300048918 Bacteria 3700
1205 Ga0496115_0052137 3300048918 Bacteria 3281
1206 Ga0496115_0063251 3300048918 Bacteria 2985
1207 Ga0496115_0085250 3300048918 Bacteria 2576
1208 Ga0496115_0091326 3300048918 Bacteria 2488
1209 Ga0496115_0100140 3300048918 Bacteria 2375
1210 Ga0496115_0542034 3300048918 Bacteria 931
1211 Ga0496117_0027352 3300048920 Bacteria 4446
1212 Ga0496118_0005711 3300048921 Bacteria 14007
1213 Ga0496125_0004268 3300048928 Bacteria 16627
1214 Ga0496126_0177471 3300048929 Bacteria 1811
1215 Ga0496126_0242883 3300048929 Bacteria 1503
1216 Ga0496126_0264466 3300048929 Bacteria 1429
1217 Ga0496126_0695656 3300048929 Bacteria 791
1218 Ga0466983_0036236 3300048986 Bacteria 4103
1219 Ga0501300_003933 3300049523 Bacteria 2211
1220 Ga0501031_0000009 3300049568 Bacteria 155116
1221 Ga0501031_0003273 3300049568 Bacteria 10406
1222 Ga0501031_0041973 3300049568 Bacteria 2987
1223 Ga0501031_0058631 3300049568 Bacteria 2509
1224 Ga0501031_0146765 3300049568 Bacteria 1541
1225 Ga0501031_0208457 3300049568 Bacteria 1274
1226 Ga0501032_0000017 3300049569 Bacteria 158303
1227 Ga0501032_0011971 3300049569 Bacteria 6213
1228 Ga0501032_0057305 3300049569 Bacteria 2618
1229 Ga0501032_0117340 3300049569 Bacteria 1759
1230 Ga0501032_0551338 3300049569 Bacteria 735
1231 Ga0501033_0000029 3300049570 Bacteria 158294
1232 Ga0501033_0000322 3300049570 Bacteria 45487
1233 Ga0501033_0001893 3300049570 Bacteria 18205
1234 Ga0501033_0019416 3300049570 Bacteria 5140
1235 Ga0501033_0022931 3300049570 Bacteria 4706
1236 Ga0501033_0029586 3300049570 Bacteria 4116
1237 Ga0501033_0061164 3300049570 Bacteria 2776
1238 Ga0501033_0130597 3300049570 Bacteria 1820
1239 Ga0501033_0269336 3300049570 Bacteria 1204
1240 Ga0501033_0419798 3300049570 Bacteria 931
1241 Ga0501034_0000102 3300049571 Bacteria 158302
1242 Ga0501034_0001379 3300049571 Bacteria 32672
1243 Ga0501034_0004543 3300049571 Bacteria 15419
1244 Ga0501034_0011046 3300049571 Bacteria 9377
1245 Ga0501034_0070000 3300049571 Bacteria 3519
1246 Ga0501034_0197779 3300049571 Bacteria 1969
1247 Ga0501034_0224172 3300049571 Bacteria 1831
1248 Ga0501034_0245091 3300049571 Bacteria 1737
1249 Ga0501034_0398981 3300049571 Bacteria 1298
1250 Ga0501034_0663929 3300049571 Bacteria 943
1251 Ga0501034_0907192 3300049571 Bacteria 769
1252 Ga0501036_0000011 3300049572 Bacteria 158302
1253 Ga0501036_0000083 3300049572 Bacteria 58665
1254 Ga0501036_0001395 3300049572 Bacteria 18570
1255 Ga0501036_0061162 3300049572 Bacteria 3190
1256 Ga0501036_0100365 3300049572 Bacteria 2448
1257 Ga0501036_0193450 3300049572 Bacteria 1711
1258 Ga0501036_0285611 3300049572 Bacteria 1381
1259 Ga0501037_0000015 3300049573 Bacteria 161311
1260 Ga0501037_0027456 3300049573 Bacteria 4205
1261 Ga0501037_0081194 3300049573 Bacteria 2351
1262 Ga0501037_0082618 3300049573 Bacteria 2327
1263 Ga0501037_0161634 3300049573 Bacteria 1596
1264 Ga0501037_0654500 3300049573 Bacteria 702
1265 Ga0501038_0000016 3300049574 Bacteria 159150
1266 Ga0501038_0001623 3300049574 Bacteria 20923
1267 Ga0501038_0007719 3300049574 Bacteria 9919
1268 Ga0501038_0017312 3300049574 Bacteria 6515
1269 Ga0501038_0024416 3300049574 Bacteria 5394
1270 Ga0501038_0081419 3300049574 Bacteria 2727
1271 Ga0501038_0122861 3300049574 Bacteria 2139
1272 Ga0501038_0122898 3300049574 Bacteria 2139
1273 Ga0501039_0000023 3300049575 Bacteria 158026
1274 Ga0501039_0001680 3300049575 Bacteria 16316
1275 Ga0501039_0138112 3300049575 Bacteria 1914
1276 Ga0501039_0197993 3300049575 Bacteria 1579
1277 Ga0501039_0217490 3300049575 Bacteria 1502
1278 Ga0501039_0304325 3300049575 Bacteria 1253
1279 Ga0501040_0000834 3300049576 Bacteria 19287
1280 Ga0501040_0834488 3300049576 Bacteria 667
1281 Ga0501041_0000497 3300049577 Bacteria 20183
1282 Ga0501042_0048847 3300049578 Bacteria 3017
1283 Ga0501043_0000423 3300049579 Bacteria 38075
1284 Ga0501043_0000466 3300049579 Bacteria 36144
1285 Ga0501043_0024324 3300049579 Bacteria 4753
1286 Ga0501043_0163222 3300049579 Bacteria 1740
1287 Ga0501043_0736193 3300049579 Bacteria 718
1288 Ga0501046_0035352 3300049580 Bacteria 4027
1289 Ga0501046_0088862 3300049580 Bacteria 2379
1290 Ga0501046_0243306 3300049580 Bacteria 1326
1291 Ga0501046_0561647 3300049580 Bacteria 813
1292 Ga0501047_0001360 3300049581 Bacteria 24002
1293 Ga0501047_0002865 3300049581 Bacteria 16363
1294 Ga0501047_0079784 3300049581 Bacteria 3146
1295 Ga0501047_0118617 3300049581 Bacteria 2528
1296 Ga0501047_0123627 3300049581 Bacteria 2468
1297 Ga0501047_0184807 3300049581 Bacteria 1950
1298 Ga0501047_0244225 3300049581 Bacteria 1645
1299 Ga0501047_0288608 3300049581 Bacteria 1484
1300 Ga0501047_0369711 3300049581 Bacteria 1269
1301 Ga0501047_0374677 3300049581 Bacteria 1258
1302 Ga0501047_0414845 3300049581 Bacteria 1178
1303 Ga0501047_0422928 3300049581 Bacteria 1163
1304 Ga0501047_0641406 3300049581 Bacteria 882
1305 Ga0501048_0015065 3300049582 Bacteria 5715
1306 Ga0501048_0116647 3300049582 Bacteria 1886
1307 Ga0501048_0190497 3300049582 Bacteria 1453
1308 Ga0501048_0233337 3300049582 Bacteria 1306
1309 Ga0501048_0309318 3300049582 Bacteria 1125
1310 Ga0501048_0681130 3300049582 Bacteria 738
1311 Ga0501067_0073856 3300049583 Bacteria 1889
1312 Ga0501067_0131580 3300049583 Bacteria 1392
1313 Ga0501067_0284798 3300049583 Bacteria 920
1314 Ga0501068_0157237 3300049584 Bacteria 1432
1315 Ga0501068_0282680 3300049584 Bacteria 1060
1316 Ga0501069_0064471 3300049585 Bacteria 2048
1317 Ga0501069_0117731 3300049585 Bacteria 1516
1318 Ga0501070_0006221 3300049586 Bacteria 10161
1319 Ga0501070_0055191 3300049586 Bacteria 3293
1320 Ga0501070_0093738 3300049586 Bacteria 2484
1321 Ga0501070_0107673 3300049586 Bacteria 2303
1322 Ga0501070_0241219 3300049586 Bacteria 1479
1323 Ga0501070_0436523 3300049586 Bacteria 1057
1324 Ga0501070_0516748 3300049586 Bacteria 958
1325 Ga0501071_0000766 3300049587 Bacteria 17047
1326 Ga0501072_0039560 3300049588 Bacteria 3702
1327 Ga0501072_0761144 3300049588 Bacteria 759
1328 Ga0501072_1239815 3300049588 Bacteria 579
1329 Ga0501073_0218841 3300049589 Bacteria 1315
1330 Ga0501073_0310324 3300049589 Bacteria 1088
1331 Ga0501074_0040557 3300049590 Bacteria 3371
1332 Ga0501074_0086675 3300049590 Bacteria 2243
1333 Ga0501074_0171916 3300049590 Bacteria 1546
1334 Ga0501076_0008456 3300049592 Bacteria 7545
1335 Ga0501076_0037511 3300049592 Bacteria 3801
1336 Ga0501076_0818296 3300049592 Bacteria 768
1337 Ga0501077_0274037 3300049593 Bacteria 1074
1338 Ga0501198_009720 3300049649 Bacteria 1415
1339 Ga0501223_028277 3300049663 Bacteria 1092
1340 Ga0501224_005686 3300049664 Bacteria 1795
1341 Ga0501249_000588 3300049679 Bacteria 8509
1342 Ga0501079_0032410 3300049741 Bacteria 4017
1343 Ga0501079_0094090 3300049741 Bacteria 2322
1344 Ga0501079_0325916 3300049741 Bacteria 1202
1345 Ga0501079_0371815 3300049741 Bacteria 1121
1346 Ga0501080_0009661 3300049742 Bacteria 8809
1347 Ga0501080_0043910 3300049742 Bacteria 4161
1348 Ga0501080_0120728 3300049742 Bacteria 2429
1349 Ga0501080_0159068 3300049742 Bacteria 2086
1350 Ga0501080_0310568 3300049742 Bacteria 1429
1351 Ga0501080_0477106 3300049742 Bacteria 1116
1352 Ga0501080_0674498 3300049742 Bacteria 913
1353 Ga0501080_0791048 3300049742 Bacteria 832
1354 Ga0501081_0003581 3300049743 Bacteria 9933
1355 Ga0501081_0009863 3300049743 Bacteria 6221
1356 Ga0501083_0069816 3300049744 Bacteria 2338
1357 Ga0501083_0125954 3300049744 Bacteria 1679
1358 Ga0501083_0241354 3300049744 Bacteria 1176
1359 Ga0501083_0298656 3300049744 Bacteria 1047
1360 Ga0501083_0372620 3300049744 Bacteria 928
1361 Ga0501035_0000038 3300049822 Bacteria 158818
1362 Ga0501035_0000277 3300049822 Bacteria 60737
1363 Ga0501035_0001496 3300049822 Bacteria 23919
1364 Ga0501035_0003133 3300049822 Bacteria 15887
1365 Ga0501035_0027284 3300049822 Bacteria 5219
1366 Ga0501035_0126231 3300049822 Bacteria 2233
1367 Ga0501035_0145119 3300049822 Bacteria 2062
1368 Ga0501035_0156061 3300049822 Bacteria 1978
1369 Ga0501035_0177023 3300049822 Bacteria 1839
1370 Ga0501035_0405040 3300049822 Bacteria 1134
1371 Ga0501044_0000046 3300049823 Bacteria 146812
1372 Ga0501044_0000453 3300049823 Bacteria 49990
1373 Ga0501044_0001296 3300049823 Bacteria 29547
1374 Ga0501044_0002258 3300049823 Bacteria 22013
1375 Ga0501044_0003443 3300049823 Bacteria 17832
1376 Ga0501044_0026701 3300049823 Bacteria 6111
1377 Ga0501044_0030103 3300049823 Bacteria 5721
1378 Ga0501044_0038958 3300049823 Bacteria 4962
1379 Ga0501044_0079091 3300049823 Bacteria 3332
1380 Ga0501044_0091786 3300049823 Bacteria 3063
1381 Ga0501044_0145412 3300049823 Bacteria 2357
1382 Ga0501044_0340055 3300049823 Bacteria 1422
1383 Ga0501044_0571420 3300049823 Bacteria 1026
1384 Ga0501044_0732203 3300049823 Bacteria 872
1385 Ga0501044_1041849 3300049823 Bacteria 689
1386 Ga0501045_0002138 3300049824 Bacteria 13383
1387 Ga0501204_007371 3300049850 Bacteria 1237
1388 nmdc:mga03683_5304_c1 3300050489 Bacteria 4347
1389 nmdc:mga03683_7_c1 3300050489 Bacteria 138410
1390 nmdc:mga03n38_150873_c1 3300050490 Bacteria 1169
1391 nmdc:mga03n38_68_c1 3300050490 Bacteria 21917
1392 nmdc:mga00v17_9_c1 3300050491 Bacteria 138453
1393 nmdc:mga0yw44_230977_c1 3300050492 Bacteria 1228
1394 nmdc:mga0yw44_36490_c1 3300050492 Bacteria 2897
1395 nmdc:mga0yw44_392056_c1 3300050492 Bacteria 938
1396 nmdc:mga0yw44_567_c1 3300050492 Bacteria 13324
1397 nmdc:mga0yw44_71616_c1 3300050492 Bacteria 2153
1398 nmdc:mga0k408_349119_c1 3300050493 Bacteria 882
1399 nmdc:mga0k408_415_c1 3300050493 Bacteria 23295
1400 nmdc:mga06z11_163282_c1 3300050494 Bacteria 1274
1401 nmdc:mga06z11_3_c1 3300050494 Bacteria 138457
1402 nmdc:mga06z11_47715_c1 3300050494 Bacteria 2176
1403 nmdc:mga06z11_500279_c1 3300050494 Bacteria 736
1404 nmdc:mga06z11_96614_c1 3300050494 Bacteria 1614
1405 nmdc:mga04h51_5_c1 3300050495 Bacteria 138278
1406 nmdc:mga07m45_18_c1 3300050496 Bacteria 138462
1407 nmdc:mga07m45_87848_c1 3300050496 Bacteria 1779
1408 nmdc:mga05p37_101883_c1 3300050507 Bacteria 3536
1409 nmdc:mga05p37_223_c1 3300050507 Bacteria 57418
1410 nmdc:mga05p37_241526_c1 3300050507 Bacteria 2171
1411 nmdc:mga05p37_580491_c1 3300050507 Bacteria 1269
1412 nmdc:mga05p37_59407_c1 3300050507 Bacteria 4708
1413 nmdc:mga09592_147916_c1 3300050508 Bacteria 2026
1414 nmdc:mga0qj67_20531_c1 3300050509 Bacteria 5059
1415 nmdc:mga0qj67_276240_c1 3300050509 Bacteria 1362
1416 nmdc:mga06r32_1338379_c1 3300050510 Bacteria 659
1417 nmdc:mga06r32_13463_c1 3300050510 Bacteria 7410
1418 nmdc:mga06r32_1449_c1 3300050510 Bacteria 21429
1419 nmdc:mga08y16_1085693_c1 3300050511 Bacteria 776
1420 nmdc:mga08y16_13690_c1 3300050511 Bacteria 8540
1421 nmdc:mga08y16_21947_c1 3300050511 Bacteria 6740
1422 nmdc:mga08y16_3164_c1 3300050511 Bacteria 17060
1423 nmdc:mga08y16_439665_c1 3300050511 Bacteria 1331
1424 nmdc:mga08y16_877047_c1 3300050511 Bacteria 885
1425 nmdc:mga0n895_129897_c1 3300050512 Bacteria 2544
1426 nmdc:mga0n895_133889_c1 3300050512 Bacteria 2504
1427 nmdc:mga0n895_381_c1 3300050512 Bacteria 30014
1428 nmdc:mga0n895_420748_c1 3300050512 Bacteria 1350
1429 nmdc:mga0n895_449976_c1 3300050512 Bacteria 1300
1430 nmdc:mga0n895_940507_c1 3300050512 Bacteria 848
1431 nmdc:mga0rr50_725796_c1 3300050513 Bacteria 848
1432 nmdc:mga08x19_91152_c1 3300050514 Bacteria 2012
1433 nmdc:mga0a205_14653_c1 3300050515 Bacteria 7316
1434 nmdc:mga0a205_64448_c1 3300050515 Bacteria 3539
1435 nmdc:mga0a205_95359_c1 3300050515 Bacteria 2873
1436 nmdc:mga0sz30_27231_c1 3300050516 Bacteria 2347
1437 nmdc:mga0sz30_341369_c1 3300050516 Bacteria 669
1438 nmdc:mga0sz30_397_c1 3300050516 Bacteria 16569
1439 Ga0495601_0000233 3300053077 Bacteria 29812
1440 Ga0495601_0000315 3300053077 Bacteria 25650
1441 Ga0495601_0018022 3300053077 Unclassified 4292
1442 Ga0495601_0041050 3300053077 Bacteria 2899
1443 Ga0495601_0193956 3300053077 Bacteria 1327
1444 Ga0495601_0265143 3300053077 Bacteria 1121
1445 Ga0495601_0271380 3300053077 Bacteria 1106
1446 Ga0495601_0682779 3300053077 Bacteria 656
1447 Ga0495612_0009255 3300053078 Bacteria 3996
1448 Ga0495612_0041597 3300053078 Bacteria 1874
1449 Ga0495655_0034346 3300053083 Bacteria 1254
1450 Ga0495595_0002608 3300053084 Bacteria 7064
1451 Ga0495595_0020042 3300053084 Bacteria 2907
1452 Ga0495595_0053465 3300053084 Bacteria 1876
1453 Ga0495595_0054746 3300053084 Bacteria 1855
1454 Ga0495619_0002269 3300053085 Bacteria 12699
1455 Ga0495619_0005627 3300053085 Bacteria 7950
1456 Ga0495619_0015668 3300053085 Bacteria 4798
1457 Ga0495619_0038922 3300053085 Bacteria 3103
1458 Ga0495619_0370423 3300053085 Bacteria 990
1459 Ga0500643_037641 3300053087 Bacteria 1439
1460 Ga0500644_0000531 3300053088 Bacteria 15833
1461 Ga0500651_0011683 3300053093 Bacteria 5304
1462 Ga0500566_0104727 3300053094 Bacteria 1546
1463 Ga0500641_0009608 3300053096 Bacteria 3479
1464 Ga0500641_0010726 3300053096 Bacteria 3318
1465 Ga0500572_000054 3300053111 Bacteria 34397
1466 Ga0500572_042061 3300053111 Bacteria 1330
1467 Ga0500593_000213 3300053117 Bacteria 23897
1468 Ga0500559_0000738 3300053136 Bacteria 21443
1469 Ga0500577_0272375 3300053142 Bacteria 737
1470 Ga0500616_0000006 3300053153 Bacteria 944738
1471 Ga0500639_041972 3300053163 Bacteria 2403
1472 Ga0500636_0119384 3300053177 Bacteria 1480
1473 Ga0500576_165201 3300053725 Bacteria 805
1474 Ga0500645_000143 3300053730 Bacteria 56081
1475 Ga0500596_002082 3300053735 Bacteria 3982
1476 Ga0501084_0018211 3300054114 Bacteria 5848
1477 Ga0501084_0165351 3300054114 Bacteria 1867
1478 Ga0501084_0211499 3300054114 Bacteria 1636
1479 Ga0501084_0684753 3300054114 Bacteria 865
1480 Ga0501084_0877246 3300054114 Bacteria 755
1481 Ga0501082_0008406 3300060353 Bacteria 8905
1482 Ga0501082_0015613 3300060353 Bacteria 6537
1483 Ga0501082_0193281 3300060353 Bacteria 1770
1484 Ga0501082_0339274 3300060353 Bacteria 1309
1485 Ga0501082_0422521 3300060353 Bacteria 1164
1486 Ga0501082_0427231 3300060353 Bacteria 1157
1487 Ga0501082_1009115 3300060353 Bacteria 728
1488 Ga0466962_0103722 3300061719 Bacteria 1366

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0196645 Ga0395905_0196645_307_831 146
2 3300038443 Ga0395901_0003268 Ga0395901_0003268_4443_4967 146
3 3300037312 Ga0395899_0021221 Ga0395899_0021221_2655_3242 152
4 3300037418 Ga0395900_0018770 Ga0395900_0018770_651_1238 152
5 3300037466 Ga0395898_0020960 Ga0395898_0020960_380_967 152
6 3300035725 Ga0373947_0589481 Ga0373947_0589481_29_499 153
7 3300005334 Ga0068869_100428207 Ga0068869_1004282072 162
8 3300025942 Ga0207689_10225499 Ga0207689_102254992 162
9 3300046528 Ga0495642_0073339 Ga0495642_0073339_607_1101 162
10 3300035112 Ga0373932_0008462 Ga0373932_0008462_1797_2342 163
11 3300025898 Ga0207692_10083632 Ga0207692_100836322 164
12 3300025915 Ga0207693_10000620 Ga0207693_1000062023 164
13 3300042438 Ga0439459_0030428 Ga0439459_0030428_461_991 164
14 3300028800 Ga0265338_10019635 Ga0265338_100196352 165
15 3300031247 Ga0265340_10024558 Ga0265340_100245582 165
16 3300031250 Ga0265331_10025253 Ga0265331_100252532 165
17 3300049568 Ga0501031_0003273 Ga0501031_0003273_3632_4147 167
18 3300049569 Ga0501032_0011971 Ga0501032_0011971_58_573 167
19 3300049572 Ga0501036_0001395 Ga0501036_0001395_15458_15973 167
20 3300049573 Ga0501037_0027456 Ga0501037_0027456_2190_2705 167
21 3300049574 Ga0501038_0122861 Ga0501038_0122861_1068_1583 167
22 3300049575 Ga0501039_0001680 Ga0501039_0001680_3956_4471 167
23 3300049577 Ga0501041_0000497 Ga0501041_0000497_12925_13440 167
24 3300049578 Ga0501042_0048847 Ga0501042_0048847_1282_1797 167
25 3300049580 Ga0501046_0088862 Ga0501046_0088862_1232_1747 167
26 3300049582 Ga0501048_0015065 Ga0501048_0015065_3671_4186 167
27 3300049585 Ga0501069_0117731 Ga0501069_0117731_571_1086 167
28 3300049587 Ga0501071_0000766 Ga0501071_0000766_127_642 167
29 3300049588 Ga0501072_0039560 Ga0501072_0039560_1381_1896 167
30 3300049590 Ga0501074_0086675 Ga0501074_0086675_1261_1776 167
31 3300049592 Ga0501076_0008456 Ga0501076_0008456_1398_1913 167
32 3300049741 Ga0501079_0094090 Ga0501079_0094090_1642_2157 167
33 3300049742 Ga0501080_0791048 Ga0501080_0791048_164_679 167
34 3300049743 Ga0501081_0009863 Ga0501081_0009863_2629_3144 167
35 3300049822 Ga0501035_0003133 Ga0501035_0003133_1522_2037 167
36 3300049824 Ga0501045_0002138 Ga0501045_0002138_9194_9709 167
37 3300054114 Ga0501084_0165351 Ga0501084_0165351_575_1090 167
38 3300060353 Ga0501082_0015613 Ga0501082_0015613_5572_6087 167
39 3300009545 Ga0105237_10021349 Ga0105237_100213494 168
40 3300009551 Ga0105238_10026691 Ga0105238_100266916 168
41 3300049570 Ga0501033_0269336 Ga0501033_0269336_146_658 168
42 3300049571 Ga0501034_0398981 Ga0501034_0398981_564_1076 168
43 3300049823 Ga0501044_0571420 Ga0501044_0571420_206_721 168
44 3300005329 Ga0070683_100914453 Ga0070683_1009144532 169
45 3300005457 Ga0070662_100118944 Ga0070662_1001189443 169
46 3300005457 Ga0070662_100359326 Ga0070662_1003593262 169
47 3300005564 Ga0070664_100025882 Ga0070664_1000258824 169
48 3300005614 Ga0068856_100042207 Ga0068856_1000422074 169
49 3300005618 Ga0068864_100603056 Ga0068864_1006030562 169
50 3300005719 Ga0068861_100002125 Ga0068861_1000021255 169
51 3300009545 Ga0105237_10239970 Ga0105237_102399702 169
52 3300009545 Ga0105237_10315579 Ga0105237_103155792 169
53 3300009551 Ga0105238_10039907 Ga0105238_100399073 169
54 3300011119 Ga0105246_10038764 Ga0105246_100387643 169
55 3300025913 Ga0207695_10074815 Ga0207695_100748152 169
56 3300025933 Ga0207706_10403953 Ga0207706_104039532 169
57 3300025949 Ga0207667_10072019 Ga0207667_100720193 169
58 3300026078 Ga0207702_10288182 Ga0207702_102881822 169
59 3300032002 Ga0307416_101572014 Ga0307416_1015720142 169
60 3300035724 Ga0373933_0132276 Ga0373933_0132276_918_1454 169
61 3300036401 Ga0373937_0267902 Ga0373937_0267902_993_1529 169
62 3300037068 Ga0373925_0010339 Ga0373925_0010339_5626_6162 169
63 3300037312 Ga0395899_0000091 Ga0395899_0000091_68091_68606 169
64 3300037418 Ga0395900_0000008 Ga0395900_0000008_393770_394285 169
65 3300037466 Ga0395898_0157574 Ga0395898_0157574_399_914 169
66 3300037466 Ga0395898_1241054 Ga0395898_1241054_45_557 169
67 3300037471 Ga0395905_0024759 Ga0395905_0024759_4751_5266 169
68 3300038443 Ga0395901_0000008 Ga0395901_0000008_86175_86690 169
69 3300049581 Ga0501047_0184807 Ga0501047_0184807_149_673 169
70 3300049744 Ga0501083_0298656 Ga0501083_0298656_241_765 169
71 3300060353 Ga0501082_0427231 Ga0501082_0427231_425_937 169
72 iso_pu_bacteria 2643221563 2643832606 169
73 iso_pu_bacteria 2643221608 2644053599 169
74 iso_pu_bacteria 2852653556 2852656981 169
75 iso_pu_bacteria 2852680915 2852681246 169
76 3300005331 Ga0070670_100173451 Ga0070670_1001734512 170
77 3300005334 Ga0068869_100573995 Ga0068869_1005739952 170
78 3300005337 Ga0070682_100041381 Ga0070682_1000413813 170
79 3300005355 Ga0070671_100000259 Ga0070671_10000025932 170
80 3300005355 Ga0070671_100082939 Ga0070671_1000829393 170
81 3300005355 Ga0070671_100371374 Ga0070671_1003713742 170
82 3300005355 Ga0070671_100704049 Ga0070671_1007040491 170
83 3300005436 Ga0070713_100033718 Ga0070713_1000337183 170
84 3300005455 Ga0070663_100020557 Ga0070663_1000205577 170
85 3300005455 Ga0070663_100560391 Ga0070663_1005603911 170
86 3300005457 Ga0070662_100059615 Ga0070662_1000596155 170
87 3300005535 Ga0070684_101514373 Ga0070684_1015143731 170
88 3300005564 Ga0070664_100023876 Ga0070664_10002387612 170
89 3300005617 Ga0068859_101245535 Ga0068859_1012455351 170
90 3300005618 Ga0068864_100012776 Ga0068864_1000127764 170
91 3300005719 Ga0068861_100707094 Ga0068861_1007070942 170
92 3300005841 Ga0068863_100054664 Ga0068863_1000546642 170
93 3300005842 Ga0068858_100007088 Ga0068858_1000070889 170
94 3300005842 Ga0068858_101199219 Ga0068858_1011992191 170
95 3300005843 Ga0068860_100024963 Ga0068860_1000249632 170
96 3300005844 Ga0068862_100079950 Ga0068862_1000799502 170
97 3300006358 Ga0068871_100007695 Ga0068871_1000076958 170
98 3300006881 Ga0068865_100680795 Ga0068865_1006807951 170
99 3300006931 Ga0097620_101245580 Ga0097620_1012455801 170
100 3300007265 Ga0099794_10430054 Ga0099794_104300541 170
101 3300013104 Ga0157370_10013533 Ga0157370_100135336 170
102 3300014326 Ga0157380_10107525 Ga0157380_101075252 170
103 3300014969 Ga0157376_10980684 Ga0157376_109806842 170
104 3300025916 Ga0207663_10028439 Ga0207663_100284392 170
105 3300025916 Ga0207663_10486232 Ga0207663_104862322 170
106 3300025925 Ga0207650_10075730 Ga0207650_100757305 170
107 3300025926 Ga0207659_10037409 Ga0207659_100374092 170
108 3300025928 Ga0207700_10023407 Ga0207700_100234074 170
109 3300025928 Ga0207700_10025920 Ga0207700_100259205 170
110 3300025928 Ga0207700_10488415 Ga0207700_104884152 170
111 3300025932 Ga0207690_10797520 Ga0207690_107975202 170
112 3300025933 Ga0207706_10127457 Ga0207706_101274574 170
113 3300025935 Ga0207709_10164001 Ga0207709_101640013 170
114 3300025938 Ga0207704_10982161 Ga0207704_109821612 170
115 3300025938 Ga0207704_11530167 Ga0207704_115301671 170
116 3300025939 Ga0207665_10800103 Ga0207665_108001032 170
117 3300025941 Ga0207711_10221303 Ga0207711_102213032 170
118 3300025942 Ga0207689_10021746 Ga0207689_100217462 170
119 3300025945 Ga0207679_10010875 Ga0207679_1001087511 170
120 3300025949 Ga0207667_10329081 Ga0207667_103290812 170
121 3300025961 Ga0207712_10072261 Ga0207712_100722612 170
122 3300025972 Ga0207668_10516160 Ga0207668_105161602 170
123 3300025986 Ga0207658_10000551 Ga0207658_100005517 170
124 3300025986 Ga0207658_10279522 Ga0207658_102795221 170
125 3300025986 Ga0207658_10928498 Ga0207658_109284982 170
126 3300026035 Ga0207703_10026304 Ga0207703_100263042 170
127 3300026067 Ga0207678_10010779 Ga0207678_100107794 170
128 3300026088 Ga0207641_10000024 Ga0207641_1000002471 170
129 3300026088 Ga0207641_10168229 Ga0207641_101682292 170
130 3300026095 Ga0207676_10012153 Ga0207676_1001215311 170
131 3300026118 Ga0207675_100955060 Ga0207675_1009550602 170
132 3300026142 Ga0207698_10707730 Ga0207698_107077302 170
133 3300028381 Ga0268264_10014717 Ga0268264_100147178 170
134 3300028381 Ga0268264_10015771 Ga0268264_100157715 170
135 3300028800 Ga0265338_10003995 Ga0265338_1000399512 170
136 3300031711 Ga0265314_10068145 Ga0265314_100681453 170
137 3300031911 Ga0307412_10308783 Ga0307412_103087832 170
138 3300032005 Ga0307411_10062033 Ga0307411_100620334 170
139 3300032126 Ga0307415_100362530 Ga0307415_1003625302 170
140 3300035111 Ga0373923_0113194 Ga0373923_0113194_110_622 170
141 3300035115 Ga0373941_0000789 Ga0373941_0000789_4470_4982 170
142 3300035410 Ga0373924_0079053 Ga0373924_0079053_522_1034 170
143 3300035724 Ga0373933_0182357 Ga0373933_0182357_125_637 170
144 3300035725 Ga0373947_0325679 Ga0373947_0325679_110_622 170
145 3300041486 Ga0451807_1344637 Ga0451807_1344637_290_802 170
146 3300042004 Ga0439445_0046765 Ga0439445_0046765_307_819 170
147 3300044712 Ga0453684_0703876 Ga0453684_0703876_414_941 170
148 3300046454 Ga0495592_0083439 Ga0495592_0083439_277_789 170
149 3300046459 Ga0495629_0219946 Ga0495629_0219946_548_1060 170
150 3300046462 Ga0495651_0161534 Ga0495651_0161534_261_773 170
151 3300046476 Ga0495662_0232480 Ga0495662_0232480_162_674 170
152 3300046514 Ga0495618_0182163 Ga0495618_0182163_749_1261 170
153 3300046516 Ga0495628_0258800 Ga0495628_0258800_454_966 170
154 3300046528 Ga0495642_0077143 Ga0495642_0077143_85_606 170
155 3300046559 Ga0495667_0017883 Ga0495667_0017883_3387_3899 170
156 3300046678 Ga0495599_0038248 Ga0495599_0038248_340_852 170
157 3300046679 Ga0495623_0051910 Ga0495623_0051910_960_1472 170
158 3300046680 Ga0495646_0102029 Ga0495646_0102029_467_979 170
159 3300046683 Ga0495658_0304342 Ga0495658_0304342_477_989 170
160 3300046690 Ga0495624_0139127 Ga0495624_0139127_537_1049 170
161 3300046809 Ga0495600_0517243 Ga0495600_0517243_97_609 170
162 3300047317 Ga0495604_0142048 Ga0495604_0142048_1157_1669 170
163 3300047319 Ga0495674_0130122 Ga0495674_0130122_286_798 170
164 3300047471 Ga0495684_0133514 Ga0495684_0133514_1278_1790 170
165 3300047471 Ga0495684_0134903 Ga0495684_0134903_1274_1786 170
166 3300048907 Ga0496104_0610431 Ga0496104_0610431_165_686 170
167 3300048908 Ga0496105_0006648 Ga0496105_0006648_2469_2984 170
168 3300048908 Ga0496105_0245718 Ga0496105_0245718_665_1177 170
169 3300048910 Ga0496107_0154550 Ga0496107_0154550_1142_1657 170
170 3300048915 Ga0496112_0157012 Ga0496112_0157012_540_1052 170
171 3300048917 Ga0496114_0065107 Ga0496114_0065107_1740_2255 170
172 3300048918 Ga0496115_0037278 Ga0496115_0037278_2160_2675 170
173 3300048918 Ga0496115_0040604 Ga0496115_0040604_606_1127 170
174 3300049568 Ga0501031_0146765 Ga0501031_0146765_586_1098 170
175 3300049569 Ga0501032_0117340 Ga0501032_0117340_587_1099 170
176 3300049570 Ga0501033_0419798 Ga0501033_0419798_223_735 170
177 3300049572 Ga0501036_0100365 Ga0501036_0100365_1123_1635 170
178 3300049573 Ga0501037_0082618 Ga0501037_0082618_680_1192 170
179 3300049573 Ga0501037_0654500 Ga0501037_0654500_31_552 170
180 3300049574 Ga0501038_0081419 Ga0501038_0081419_797_1309 170
181 3300049574 Ga0501038_0122898 Ga0501038_0122898_1325_1846 170
182 3300049575 Ga0501039_0197993 Ga0501039_0197993_810_1322 170
183 3300049579 Ga0501043_0163222 Ga0501043_0163222_896_1408 170
184 3300049579 Ga0501043_0736193 Ga0501043_0736193_85_606 170
185 3300049581 Ga0501047_0288608 Ga0501047_0288608_469_981 170
186 3300049581 Ga0501047_0369711 Ga0501047_0369711_243_764 170
187 3300049581 Ga0501047_0374677 Ga0501047_0374677_584_1102 170
188 3300049582 Ga0501048_0116647 Ga0501048_0116647_88_600 170
189 3300049583 Ga0501067_0073856 Ga0501067_0073856_963_1475 170
190 3300049584 Ga0501068_0282680 Ga0501068_0282680_192_704 170
191 3300049585 Ga0501069_0064471 Ga0501069_0064471_715_1227 170
192 3300049586 Ga0501070_0107673 Ga0501070_0107673_1558_2070 170
193 3300049588 Ga0501072_0761144 Ga0501072_0761144_176_688 170
194 3300049589 Ga0501073_0218841 Ga0501073_0218841_373_885 170
195 3300049590 Ga0501074_0040557 Ga0501074_0040557_846_1358 170
196 3300049741 Ga0501079_0325916 Ga0501079_0325916_324_836 170
197 3300049742 Ga0501080_0043910 Ga0501080_0043910_688_1200 170
198 3300049744 Ga0501083_0069816 Ga0501083_0069816_47_559 170
199 3300049822 Ga0501035_0126231 Ga0501035_0126231_969_1481 170
200 3300049823 Ga0501044_0079091 Ga0501044_0079091_660_1172 170
201 3300053077 Ga0495601_0041050 Ga0495601_0041050_634_1146 170
202 3300053077 Ga0495601_0271380 Ga0495601_0271380_467_979 170
203 3300053077 Ga0495601_0682779 Ga0495601_0682779_58_573 170
204 3300053084 Ga0495595_0020042 Ga0495595_0020042_2288_2800 170
205 3300054114 Ga0501084_0684753 Ga0501084_0684753_255_767 170
206 iso_pu_bacteria 2643221558 2643810214 170
207 3300005330 Ga0070690_100359434 Ga0070690_1003594342 171
208 3300005334 Ga0068869_100576944 Ga0068869_1005769441 171
209 3300005336 Ga0070680_100300092 Ga0070680_1003000922 171
210 3300005344 Ga0070661_100689237 Ga0070661_1006892371 171
211 3300005353 Ga0070669_100040493 Ga0070669_1000404933 171
212 3300005353 Ga0070669_100091046 Ga0070669_1000910463 171
213 3300005354 Ga0070675_100069540 Ga0070675_1000695403 171
214 3300005356 Ga0070674_100050330 Ga0070674_1000503304 171
215 3300005444 Ga0070694_100327115 Ga0070694_1003271152 171
216 3300005518 Ga0070699_100748322 Ga0070699_1007483222 171
217 3300005530 Ga0070679_100602604 Ga0070679_1006026042 171
218 3300005543 Ga0070672_100397303 Ga0070672_1003973032 171
219 3300005546 Ga0070696_100160586 Ga0070696_1001605862 171
220 3300005548 Ga0070665_100011558 Ga0070665_1000115587 171
221 3300005617 Ga0068859_100753489 Ga0068859_1007534892 171
222 3300005617 Ga0068859_100997020 Ga0068859_1009970202 171
223 3300005618 Ga0068864_100668761 Ga0068864_1006687612 171
224 3300005844 Ga0068862_101609261 Ga0068862_1016092612 171
225 3300006038 Ga0075365_10464187 Ga0075365_104641871 171
226 3300006163 Ga0070715_10109286 Ga0070715_101092863 171
227 3300006177 Ga0075362_10125424 Ga0075362_101254242 171
228 3300006914 Ga0075436_100959362 Ga0075436_1009593621 171
229 3300006931 Ga0097620_100753524 Ga0097620_1007535242 171
230 3300006931 Ga0097620_100996998 Ga0097620_1009969982 171
231 3300009093 Ga0105240_10773615 Ga0105240_107736152 171
232 3300009094 Ga0111539_10621722 Ga0111539_106217222 171
233 3300009177 Ga0105248_10128580 Ga0105248_101285802 171
234 3300009177 Ga0105248_10347681 Ga0105248_103476813 171
235 3300009553 Ga0105249_10425176 Ga0105249_104251762 171
236 3300010375 Ga0105239_11635740 Ga0105239_116357401 171
237 3300014325 Ga0163163_10002301 Ga0163163_100023014 171
238 3300014968 Ga0157379_10078722 Ga0157379_100787222 171
239 3300025917 Ga0207660_10092752 Ga0207660_100927522 171
240 3300025921 Ga0207652_10236934 Ga0207652_102369344 171
241 3300025923 Ga0207681_10046837 Ga0207681_100468373 171
242 3300025923 Ga0207681_10067375 Ga0207681_100673752 171
243 3300025923 Ga0207681_10503528 Ga0207681_105035282 171
244 3300025926 Ga0207659_10373695 Ga0207659_103736952 171
245 3300025928 Ga0207700_10307506 Ga0207700_103075062 171
246 3300025937 Ga0207669_10111886 Ga0207669_101118863 171
247 3300025940 Ga0207691_10474061 Ga0207691_104740612 171
248 3300025941 Ga0207711_10080904 Ga0207711_100809042 171
249 3300025941 Ga0207711_10335360 Ga0207711_103353602 171
250 3300025972 Ga0207668_10063344 Ga0207668_100633442 171
251 3300027252 Ga0209973_1038301 Ga0209973_10383012 171
252 3300027682 Ga0209971_1034000 Ga0209971_10340002 171
253 3300027695 Ga0209966_1006051 Ga0209966_10060512 171
254 3300027717 Ga0209998_10006206 Ga0209998_100062063 171
255 3300027876 Ga0209974_10052047 Ga0209974_100520472 171
256 3300031241 Ga0265325_10055668 Ga0265325_100556682 171
257 3300031507 Ga0307509_10020537 Ga0307509_100205377 171
258 3300031711 Ga0265314_10008446 Ga0265314_100084463 171
259 3300042008 Ga0439450_007457 Ga0439450_007457_1247_1762 171
260 3300042012 Ga0439455_0036417 Ga0439455_0036417_667_1182 171
261 3300042156 Ga0439446_0179377 Ga0439446_0179377_66_581 171
262 3300042439 Ga0439464_0002701 Ga0439464_0002701_1386_1901 171
263 3300042461 Ga0439460_0004764 Ga0439460_0004764_1230_1745 171
264 3300046471 Ga0495650_0000862 Ga0495650_0000862_9343_9858 171
265 3300048903 Ga0496100_0437083 Ga0496100_0437083_464_979 171
266 3300048904 Ga0496101_0141799 Ga0496101_0141799_781_1296 171
267 3300048904 Ga0496101_0197826 Ga0496101_0197826_534_1049 171
268 3300048907 Ga0496104_0297856 Ga0496104_0297856_986_1501 171
269 3300048907 Ga0496104_0303886 Ga0496104_0303886_600_1115 171
270 3300048909 Ga0496106_0401861 Ga0496106_0401861_464_979 171
271 3300048910 Ga0496107_0077449 Ga0496107_0077449_550_1065 171
272 3300048911 Ga0496108_0016063 Ga0496108_0016063_4401_4916 171
273 3300048912 Ga0496109_0016670 Ga0496109_0016670_124_639 171
274 3300048913 Ga0496110_0070671 Ga0496110_0070671_1809_2324 171
275 3300048913 Ga0496110_0127660 Ga0496110_0127660_399_914 171
276 3300048915 Ga0496112_0029333 Ga0496112_0029333_4423_4938 171
277 3300048915 Ga0496112_0412439 Ga0496112_0412439_511_1026 171
278 3300048916 Ga0496113_0019760 Ga0496113_0019760_512_1027 171
279 3300048929 Ga0496126_0242883 Ga0496126_0242883_101_616 171
280 3300049570 Ga0501033_0061164 Ga0501033_0061164_1251_1766 171
281 3300049586 Ga0501070_0093738 Ga0501070_0093738_422_937 171
282 3300049822 Ga0501035_0405040 Ga0501035_0405040_206_721 171
283 3300049823 Ga0501044_0002258 Ga0501044_0002258_16353_16868 171
284 3300049823 Ga0501044_0038958 Ga0501044_0038958_3106_3678 171
285 3300050492 nmdc:mga0yw44_230977_c1 nmdc:mga0yw44_230977_c1_544_1059 171
286 3300050492 nmdc:mga0yw44_392056_c1 nmdc:mga0yw44_392056_c1_321_836 171
287 3300050511 nmdc:mga08y16_439665_c1 nmdc:mga08y16_439665_c1_91_606 171
288 3300053085 Ga0495619_0370423 Ga0495619_0370423_378_920 171
289 3300053096 Ga0500641_0009608 Ga0500641_0009608_924_1439 171
290 3300060353 Ga0501082_1009115 Ga0501082_1009115_167_682 171
291 iso_pu_bacteria 2513237098 2513672511 171
292 iso_pu_bacteria 2523231067 2523470328 171
293 iso_pu_bacteria 2643221547 2643758527 171
294 iso_pu_bacteria 2667528175 2671117982 171
295 iso_pu_bacteria 2808606401 2809064536 171
296 iso_pu_bacteria 2808606404 2809080553 171
297 iso_pu_bacteria 2808606405 2809084917 171
298 iso_pu_bacteria 2919450847 2919451475 171
299 iso_pu_bacteria 643348564 643603307 171
300 iso_pu_bacteria 643348564 643603340 171
301 iso_pu_bacteria 8056673599 8056674690 171
302 3300005327 Ga0070658_10056229 Ga0070658_100562292 172
303 3300005338 Ga0068868_100689469 Ga0068868_1006894691 172
304 3300005339 Ga0070660_100040659 Ga0070660_1000406595 172
305 3300005367 Ga0070667_100046109 Ga0070667_1000461093 172
306 3300005456 Ga0070678_100072494 Ga0070678_1000724943 172
307 3300005548 Ga0070665_100000136 Ga0070665_10000013624 172
308 3300005564 Ga0070664_100130044 Ga0070664_1001300444 172
309 3300005618 Ga0068864_100014489 Ga0068864_1000144899 172
310 3300005841 Ga0068863_100201520 Ga0068863_1002015202 172
311 3300006237 Ga0097621_100096048 Ga0097621_1000960485 172
312 3300009551 Ga0105238_10038387 Ga0105238_100383875 172
313 3300013296 Ga0157374_10463362 Ga0157374_104633622 172
314 3300013306 Ga0163162_10131768 Ga0163162_101317683 172
315 3300013308 Ga0157375_10009224 Ga0157375_100092242 172
316 3300014325 Ga0163163_10145008 Ga0163163_101450083 172
317 3300025919 Ga0207657_10010882 Ga0207657_100108827 172
318 3300025924 Ga0207694_10202515 Ga0207694_102025152 172
319 3300025931 Ga0207644_10348793 Ga0207644_103487933 172
320 3300025986 Ga0207658_10089292 Ga0207658_100892921 172
321 3300026088 Ga0207641_10085911 Ga0207641_100859112 172
322 3300026095 Ga0207676_10160787 Ga0207676_101607872 172
323 3300026121 Ga0207683_10237091 Ga0207683_102370912 172
324 3300028379 Ga0268266_10000003 Ga0268266_10000003628 172
325 3300031824 Ga0307413_10052686 Ga0307413_100526864 172
326 3300031824 Ga0307413_10108059 Ga0307413_101080592 172
327 3300031852 Ga0307410_10057903 Ga0307410_100579032 172
328 3300031901 Ga0307406_10572620 Ga0307406_105726201 172
329 3300031903 Ga0307407_10197145 Ga0307407_101971452 172
330 3300031995 Ga0307409_100098193 Ga0307409_1000981933 172
331 3300032002 Ga0307416_100002023 Ga0307416_10000202320 172
332 3300032004 Ga0307414_10329241 Ga0307414_103292412 172
333 3300032005 Ga0307411_10038623 Ga0307411_100386234 172
334 3300032005 Ga0307411_10061243 Ga0307411_100612433 172
335 3300032126 Ga0307415_100009260 Ga0307415_1000092605 172
336 3300037466 Ga0395898_0489496 Ga0395898_0489496_577_1104 172
337 3300037471 Ga0395905_0139472 Ga0395905_0139472_1631_2158 172
338 3300038443 Ga0395901_0641501 Ga0395901_0641501_44_571 172
339 3300039062 Ga0400483_280669 Ga0400483_280669_3691_4209 172
340 3300039437 Ga0436365_1635885 Ga0436365_1635885_163_681 172
341 3300044719 Ga0466971_0035626 Ga0466971_0035626_1666_2187 172
342 3300044765 Ga0466970_0301636 Ga0466970_0301636_43_564 172
343 3300044842 Ga0466957_0318211 Ga0466957_0318211_165_686 172
344 3300046616 Ga0495668_0006091 Ga0495668_0006091_2199_2717 172
345 3300046660 Ga0495625_0414025 Ga0495625_0414025_232_750 172
346 3300046684 Ga0495669_0187555 Ga0495669_0187555_78_596 172
347 3300048904 Ga0496101_0216240 Ga0496101_0216240_384_929 172
348 3300048905 Ga0496102_0077802 Ga0496102_0077802_1804_2349 172
349 3300048910 Ga0496107_0007453 Ga0496107_0007453_1647_2192 172
350 3300048912 Ga0496109_0016772 Ga0496109_0016772_514_1059 172
351 3300048913 Ga0496110_0748750 Ga0496110_0748750_201_746 172
352 3300048915 Ga0496112_0340796 Ga0496112_0340796_604_1149 172
353 3300048918 Ga0496115_0009981 Ga0496115_0009981_779_1306 172
354 3300048986 Ga0466983_0036236 Ga0466983_0036236_1869_2390 172
355 3300049571 Ga0501034_0197779 Ga0501034_0197779_729_1247 172
356 3300049571 Ga0501034_0907192 Ga0501034_0907192_111_629 172
357 3300049572 Ga0501036_0285611 Ga0501036_0285611_173_691 172
358 3300049581 Ga0501047_0414845 Ga0501047_0414845_472_990 172
359 3300049581 Ga0501047_0422928 Ga0501047_0422928_408_926 172
360 3300049583 Ga0501067_0131580 Ga0501067_0131580_120_638 172
361 3300049583 Ga0501067_0284798 Ga0501067_0284798_49_567 172
362 3300049584 Ga0501068_0157237 Ga0501068_0157237_738_1256 172
363 3300049590 Ga0501074_0171916 Ga0501074_0171916_836_1354 172
364 3300049592 Ga0501076_0818296 Ga0501076_0818296_120_638 172
365 3300049741 Ga0501079_0371815 Ga0501079_0371815_247_765 172
366 3300049742 Ga0501080_0009661 Ga0501080_0009661_1694_2212 172
367 3300049742 Ga0501080_0310568 Ga0501080_0310568_142_660 172
368 3300049744 Ga0501083_0372620 Ga0501083_0372620_361_879 172
369 3300049823 Ga0501044_0091786 Ga0501044_0091786_1230_1748 172
370 3300054114 Ga0501084_0211499 Ga0501084_0211499_723_1241 172
371 3300060353 Ga0501082_0339274 Ga0501082_0339274_368_886 172
372 3300061719 Ga0466962_0103722 Ga0466962_0103722_150_671 172
373 iso_pu_bacteria 2643221629 2644168562 172
374 iso_pu_bacteria 2643221662 2644350088 172
375 3300003911 JGI25405J52794_10089779 JGI25405J52794_100897791 173
376 3300005328 Ga0070676_10026242 Ga0070676_100262424 173
377 3300005328 Ga0070676_10129218 Ga0070676_101292182 173
378 3300005329 Ga0070683_100953940 Ga0070683_1009539401 173
379 3300005330 Ga0070690_100364605 Ga0070690_1003646052 173
380 3300005337 Ga0070682_100122890 Ga0070682_1001228903 173
381 3300005341 Ga0070691_10080006 Ga0070691_100800062 173
382 3300005347 Ga0070668_101295331 Ga0070668_1012953311 173
383 3300005353 Ga0070669_100093430 Ga0070669_1000934302 173
384 3300005355 Ga0070671_100147320 Ga0070671_1001473202 173
385 3300005356 Ga0070674_100001182 Ga0070674_10000118215 173
386 3300005356 Ga0070674_100252764 Ga0070674_1002527642 173
387 3300005364 Ga0070673_100013648 Ga0070673_1000136483 173
388 3300005364 Ga0070673_100588476 Ga0070673_1005884762 173
389 3300005366 Ga0070659_100037376 Ga0070659_1000373762 173
390 3300005436 Ga0070713_100322226 Ga0070713_1003222262 173
391 3300005439 Ga0070711_101040605 Ga0070711_1010406051 173
392 3300005445 Ga0070708_100402271 Ga0070708_1004022711 173
393 3300005445 Ga0070708_101086596 Ga0070708_1010865962 173
394 3300005455 Ga0070663_100029377 Ga0070663_1000293774 173
395 3300005456 Ga0070678_100036683 Ga0070678_1000366834 173
396 3300005457 Ga0070662_100131859 Ga0070662_1001318593 173
397 3300005458 Ga0070681_10069552 Ga0070681_100695524 173
398 3300005459 Ga0068867_100045194 Ga0068867_1000451944 173
399 3300005518 Ga0070699_100434585 Ga0070699_1004345852 173
400 3300005530 Ga0070679_100064208 Ga0070679_1000642085 173
401 3300005539 Ga0068853_100096300 Ga0068853_1000963002 173
402 3300005543 Ga0070672_100011446 Ga0070672_1000114467 173
403 3300005545 Ga0070695_100161264 Ga0070695_1001612643 173
404 3300005546 Ga0070696_100095372 Ga0070696_1000953723 173
405 3300005547 Ga0070693_100008853 Ga0070693_1000088535 173
406 3300005615 Ga0070702_100017767 Ga0070702_1000177674 173
407 3300005841 Ga0068863_100585871 Ga0068863_1005858712 173
408 3300005937 Ga0081455_10001659 Ga0081455_100016594 173
409 3300005937 Ga0081455_10002130 Ga0081455_100021308 173
410 3300006038 Ga0075365_10002570 Ga0075365_1000257011 173
411 3300006042 Ga0075368_10000190 Ga0075368_1000019015 173
412 3300006048 Ga0075363_100000005 Ga0075363_10000000555 173
413 3300006051 Ga0075364_10000003 Ga0075364_1000000382 173
414 3300006177 Ga0075362_10000118 Ga0075362_100001183 173
415 3300006177 Ga0075362_10029882 Ga0075362_100298824 173
416 3300006178 Ga0075367_10014566 Ga0075367_100145666 173
417 3300006178 Ga0075367_10266784 Ga0075367_102667843 173
418 3300006186 Ga0075369_10002521 Ga0075369_100025215 173
419 3300006194 Ga0075427_10001142 Ga0075427_100011425 173
420 3300006195 Ga0075366_10373916 Ga0075366_103739162 173
421 3300006237 Ga0097621_100289412 Ga0097621_1002894122 173
422 3300006353 Ga0075370_10000006 Ga0075370_10000006111 173
423 3300006358 Ga0068871_100171191 Ga0068871_1001711913 173
424 3300006358 Ga0068871_100330695 Ga0068871_1003306952 173
425 3300006844 Ga0075428_100090413 Ga0075428_1000904133 173
426 3300006844 Ga0075428_100130966 Ga0075428_1001309662 173
427 3300006846 Ga0075430_100009755 Ga0075430_10000975516 173
428 3300006846 Ga0075430_100186447 Ga0075430_1001864472 173
429 3300006847 Ga0075431_100081591 Ga0075431_1000815914 173
430 3300006852 Ga0075433_10004805 Ga0075433_100048057 173
431 3300006871 Ga0075434_100001712 Ga0075434_10000171212 173
432 3300006880 Ga0075429_100004087 Ga0075429_10000408712 173
433 3300006881 Ga0068865_100216270 Ga0068865_1002162702 173
434 3300007076 Ga0075435_100010234 Ga0075435_1000102345 173
435 3300009094 Ga0111539_10024554 Ga0111539_100245545 173
436 3300009098 Ga0105245_10073692 Ga0105245_100736924 173
437 3300009147 Ga0114129_10011621 Ga0114129_100116219 173
438 3300009147 Ga0114129_10042445 Ga0114129_100424452 173
439 3300009148 Ga0105243_10073809 Ga0105243_100738092 173
440 3300009174 Ga0105241_10114664 Ga0105241_101146643 173
441 3300009174 Ga0105241_10989952 Ga0105241_109899522 173
442 3300009176 Ga0105242_10394316 Ga0105242_103943163 173
443 3300009177 Ga0105248_10827034 Ga0105248_108270341 173
444 3300009545 Ga0105237_10346014 Ga0105237_103460142 173
445 3300010375 Ga0105239_10076395 Ga0105239_100763955 173
446 3300013296 Ga0157374_10354102 Ga0157374_103541022 173
447 3300013297 Ga0157378_10062092 Ga0157378_100620925 173
448 3300013297 Ga0157378_10131326 Ga0157378_101313263 173
449 3300013297 Ga0157378_10594986 Ga0157378_105949862 173
450 3300013297 Ga0157378_12313611 Ga0157378_123136111 173
451 3300013306 Ga0163162_10144540 Ga0163162_101445404 173
452 3300013308 Ga0157375_10206381 Ga0157375_102063812 173
453 3300014326 Ga0157380_10108189 Ga0157380_101081893 173
454 3300014326 Ga0157380_10195523 Ga0157380_101955233 173
455 3300014969 Ga0157376_10027833 Ga0157376_100278335 173
456 3300014969 Ga0157376_10101181 Ga0157376_101011814 173
457 3300014969 Ga0157376_10458317 Ga0157376_104583172 173
458 3300017792 Ga0163161_10426710 Ga0163161_104267102 173
459 3300025893 Ga0207682_10002919 Ga0207682_100029192 173
460 3300025898 Ga0207692_10118294 Ga0207692_101182942 173
461 3300025904 Ga0207647_10243685 Ga0207647_102436851 173
462 3300025907 Ga0207645_10052669 Ga0207645_100526692 173
463 3300025911 Ga0207654_10085670 Ga0207654_100856703 173
464 3300025912 Ga0207707_10038599 Ga0207707_100385994 173
465 3300025917 Ga0207660_10095629 Ga0207660_100956293 173
466 3300025921 Ga0207652_10142128 Ga0207652_101421283 173
467 3300025923 Ga0207681_10238276 Ga0207681_102382762 173
468 3300025926 Ga0207659_10032035 Ga0207659_100320354 173
469 3300025927 Ga0207687_10045202 Ga0207687_100452024 173
470 3300025927 Ga0207687_10851051 Ga0207687_108510511 173
471 3300025931 Ga0207644_10128525 Ga0207644_101285253 173
472 3300025931 Ga0207644_10355621 Ga0207644_103556212 173
473 3300025932 Ga0207690_10127677 Ga0207690_101276773 173
474 3300025934 Ga0207686_10347891 Ga0207686_103478912 173
475 3300025935 Ga0207709_10039214 Ga0207709_100392144 173
476 3300025937 Ga0207669_10000503 Ga0207669_1000050316 173
477 3300025937 Ga0207669_10134122 Ga0207669_101341223 173
478 3300025937 Ga0207669_10751363 Ga0207669_107513632 173
479 3300025940 Ga0207691_10003934 Ga0207691_1000393413 173
480 3300025941 Ga0207711_10301903 Ga0207711_103019032 173
481 3300025942 Ga0207689_10347484 Ga0207689_103474841 173
482 3300025960 Ga0207651_10018879 Ga0207651_100188793 173
483 3300025972 Ga0207668_11145320 Ga0207668_111453202 173
484 3300025986 Ga0207658_10394614 Ga0207658_103946143 173
485 3300026035 Ga0207703_10825227 Ga0207703_108252272 173
486 3300026067 Ga0207678_10005483 Ga0207678_1000548315 173
487 3300026088 Ga0207641_10343068 Ga0207641_103430682 173
488 3300026089 Ga0207648_10076977 Ga0207648_100769772 173
489 3300026121 Ga0207683_10003372 Ga0207683_1000337210 173
490 3300027866 Ga0209813_10000022 Ga0209813_1000002261 173
491 3300027907 Ga0207428_10000188 Ga0207428_1000018885 173
492 3300028381 Ga0268264_10169587 Ga0268264_101695872 173
493 3300028800 Ga0265338_10712501 Ga0265338_107125011 173
494 3300031235 Ga0265330_10054365 Ga0265330_100543652 173
495 3300031241 Ga0265325_10002884 Ga0265325_100028844 173
496 3300031247 Ga0265340_10004910 Ga0265340_100049106 173
497 3300031249 Ga0265339_10007935 Ga0265339_100079352 173
498 3300031344 Ga0265316_10028534 Ga0265316_100285342 173
499 3300031344 Ga0265316_10095708 Ga0265316_100957083 173
500 3300031595 Ga0265313_10000216 Ga0265313_1000021634 173
501 3300031595 Ga0265313_10003192 Ga0265313_100031929 173
502 3300031595 Ga0265313_10005099 Ga0265313_100050992 173
503 3300031711 Ga0265314_10011358 Ga0265314_100113584 173
504 3300031711 Ga0265314_10013349 Ga0265314_1001334910 173
505 3300031712 Ga0265342_10036432 Ga0265342_100364323 173
506 3300032004 Ga0307414_10055254 Ga0307414_100552544 173
507 3300035086 Ga0373934_0013989 Ga0373934_0013989_1813_2334 173
508 3300035089 Ga0373944_0040747 Ga0373944_0040747_35_556 173
509 3300035092 Ga0373952_0077547 Ga0373952_0077547_119_661 173
510 3300035111 Ga0373923_0207552 Ga0373923_0207552_376_897 173
511 3300035112 Ga0373932_0047863 Ga0373932_0047863_182_703 173
512 3300035118 Ga0373954_0055239 Ga0373954_0055239_900_1421 173
513 3300035119 Ga0373956_0017665 Ga0373956_0017665_51_572 173
514 3300035170 Ga0373943_0190412 Ga0373943_0190412_379_918 173
515 3300035171 Ga0373946_0111353 Ga0373946_0111353_248_769 173
516 3300035172 Ga0373955_0124892 Ga0373955_0124892_94_615 173
517 3300035207 Ga0373942_0183163 Ga0373942_0183163_20_541 173
518 3300035410 Ga0373924_0159125 Ga0373924_0159125_20_541 173
519 3300035692 Ga0373935_0035621 Ga0373935_0035621_2498_3019 173
520 3300035692 Ga0373935_0117704 Ga0373935_0117704_115_636 173
521 3300035695 Ga0373927_0000831 Ga0373927_0000831_903_1442 173
522 3300035695 Ga0373927_0108486 Ga0373927_0108486_1155_1676 173
523 3300035695 Ga0373927_0472411 Ga0373927_0472411_27_548 173
524 3300035725 Ga0373947_0105255 Ga0373947_0105255_1146_1667 173
525 3300035725 Ga0373947_0453661 Ga0373947_0453661_237_758 173
526 3300036401 Ga0373937_0033958 Ga0373937_0033958_3674_4195 173
527 3300036401 Ga0373937_0186248 Ga0373937_0186248_98_637 173
528 3300037068 Ga0373925_0001906 Ga0373925_0001906_4532_5071 173
529 3300037068 Ga0373925_0174081 Ga0373925_0174081_109_630 173
530 3300037418 Ga0395900_0463018 Ga0395900_0463018_129_650 173
531 3300037466 Ga0395898_0613727 Ga0395898_0613727_130_651 173
532 3300041451 Ga0451791_1510351 Ga0451791_1510351_522_1043 173
533 3300045051 Ga0451576_0000053 Ga0451576_0000053_137785_138306 173
534 3300046455 Ga0495603_0078206 Ga0495603_0078206_15_536 173
535 3300046459 Ga0495629_0196403 Ga0495629_0196403_564_1085 173
536 3300046460 Ga0495638_0163993 Ga0495638_0163993_633_1154 173
537 3300046461 Ga0495641_0076153 Ga0495641_0076153_409_930 173
538 3300046463 Ga0495653_0004747 Ga0495653_0004747_7922_8443 173
539 3300046463 Ga0495653_0134105 Ga0495653_0134105_577_1098 173
540 3300046477 Ga0495664_0008207 Ga0495664_0008207_4977_5498 173
541 3300046477 Ga0495664_0015820 Ga0495664_0015820_1233_1754 173
542 3300046499 Ga0495594_0007555 Ga0495594_0007555_849_1370 173
543 3300046499 Ga0495594_0068893 Ga0495594_0068893_681_1202 173
544 3300046511 Ga0495608_0010468 Ga0495608_0010468_3577_4098 173
545 3300046514 Ga0495618_0011951 Ga0495618_0011951_74_595 173
546 3300046514 Ga0495618_0174650 Ga0495618_0174650_578_1099 173
547 3300046516 Ga0495628_0317292 Ga0495628_0317292_514_1035 173
548 3300046525 Ga0495663_0085684 Ga0495663_0085684_83_604 173
549 3300046526 Ga0495666_0060763 Ga0495666_0060763_918_1439 173
550 3300046529 Ga0495652_0009353 Ga0495652_0009353_8181_8702 173
551 3300046533 Ga0495640_0135115 Ga0495640_0135115_120_641 173
552 3300046533 Ga0495640_0144154 Ga0495640_0144154_133_654 173
553 3300046535 Ga0495586_0015563 Ga0495586_0015563_1326_1847 173
554 3300046536 Ga0495587_0001962 Ga0495587_0001962_10860_11381 173
555 3300046538 Ga0495609_0341704 Ga0495609_0341704_70_591 173
556 3300046539 Ga0495621_0022372 Ga0495621_0022372_142_663 173
557 3300046543 Ga0495645_0012676 Ga0495645_0012676_1596_2117 173
558 3300046543 Ga0495645_0320493 Ga0495645_0320493_450_971 173
559 3300046559 Ga0495667_0083362 Ga0495667_0083362_1517_2038 173
560 3300046642 Ga0495634_0103516 Ga0495634_0103516_800_1321 173
561 3300046642 Ga0495634_0138718 Ga0495634_0138718_902_1423 173
562 3300046663 Ga0495635_0013994 Ga0495635_0013994_2177_2698 173
563 3300046674 Ga0495588_0373968 Ga0495588_0373968_71_592 173
564 3300046675 Ga0495657_0006791 Ga0495657_0006791_2177_2698 173
565 3300046679 Ga0495623_0042371 Ga0495623_0042371_1796_2317 173
566 3300046680 Ga0495646_0040972 Ga0495646_0040972_1805_2326 173
567 3300046681 Ga0495647_0102506 Ga0495647_0102506_559_1080 173
568 3300046681 Ga0495647_0201655 Ga0495647_0201655_110_631 173
569 3300046683 Ga0495658_0172949 Ga0495658_0172949_51_572 173
570 3300046690 Ga0495624_0076804 Ga0495624_0076804_1026_1547 173
571 3300046809 Ga0495600_0001643 Ga0495600_0001643_1795_2316 173
572 3300047315 Ga0495581_0153967 Ga0495581_0153967_249_770 173
573 3300047317 Ga0495604_0014975 Ga0495604_0014975_875_1396 173
574 3300047319 Ga0495674_0033351 Ga0495674_0033351_364_885 173
575 3300047321 Ga0495676_0155001 Ga0495676_0155001_782_1303 173
576 3300047322 Ga0495680_0009794 Ga0495680_0009794_4501_5022 173
577 3300047322 Ga0495680_0037575 Ga0495680_0037575_2989_3510 173
578 3300047444 Ga0495675_0001359 Ga0495675_0001359_763_1284 173
579 3300047471 Ga0495684_0036975 Ga0495684_0036975_1609_2130 173
580 3300047471 Ga0495684_0356851 Ga0495684_0356851_265_786 173
581 3300047673 Ga0495593_0073192 Ga0495593_0073192_104_625 173
582 3300047673 Ga0495593_0171911 Ga0495593_0171911_23_544 173
583 3300048088 Ga0495602_0027761 Ga0495602_0027761_4037_4558 173
584 3300048090 Ga0495615_0010480 Ga0495615_0010480_51_572 173
585 3300048903 Ga0496100_0273753 Ga0496100_0273753_711_1232 173
586 3300048904 Ga0496101_0182747 Ga0496101_0182747_233_754 173
587 3300048904 Ga0496101_0369854 Ga0496101_0369854_440_961 173
588 3300048906 Ga0496103_0137031 Ga0496103_0137031_572_1093 173
589 3300048906 Ga0496103_0562432 Ga0496103_0562432_10_531 173
590 3300048907 Ga0496104_0213971 Ga0496104_0213971_940_1461 173
591 3300048909 Ga0496106_0187488 Ga0496106_0187488_719_1240 173
592 3300048909 Ga0496106_0323434 Ga0496106_0323434_156_677 173
593 3300048910 Ga0496107_0018036 Ga0496107_0018036_3578_4099 173
594 3300048917 Ga0496114_0319253 Ga0496114_0319253_784_1305 173
595 3300048918 Ga0496115_0085250 Ga0496115_0085250_844_1365 173
596 3300048918 Ga0496115_0091326 Ga0496115_0091326_1089_1610 173
597 3300048920 Ga0496117_0027352 Ga0496117_0027352_1814_2335 173
598 3300048921 Ga0496118_0005711 Ga0496118_0005711_4217_4738 173
599 3300048929 Ga0496126_0177471 Ga0496126_0177471_1195_1716 173
600 3300049568 Ga0501031_0000009 Ga0501031_0000009_82033_82554 173
601 3300049569 Ga0501032_0000017 Ga0501032_0000017_82034_82555 173
602 3300049570 Ga0501033_0000029 Ga0501033_0000029_82025_82546 173
603 3300049570 Ga0501033_0130597 Ga0501033_0130597_42_575 173
604 3300049571 Ga0501034_0000102 Ga0501034_0000102_82033_82554 173
605 3300049571 Ga0501034_0004543 Ga0501034_0004543_889_1410 173
606 3300049572 Ga0501036_0000011 Ga0501036_0000011_75749_76270 173
607 3300049572 Ga0501036_0061162 Ga0501036_0061162_1820_2341 173
608 3300049573 Ga0501037_0000015 Ga0501037_0000015_78758_79279 173
609 3300049573 Ga0501037_0161634 Ga0501037_0161634_167_688 173
610 3300049574 Ga0501038_0000016 Ga0501038_0000016_82033_82554 173
611 3300049574 Ga0501038_0017312 Ga0501038_0017312_5152_5673 173
612 3300049575 Ga0501039_0000023 Ga0501039_0000023_82033_82554 173
613 3300049576 Ga0501040_0000834 Ga0501040_0000834_7846_8367 173
614 3300049579 Ga0501043_0000423 Ga0501043_0000423_26512_27033 173
615 3300049581 Ga0501047_0002865 Ga0501047_0002865_11222_11743 173
616 3300049581 Ga0501047_0118617 Ga0501047_0118617_1122_1643 173
617 3300049582 Ga0501048_0309318 Ga0501048_0309318_156_677 173
618 3300049586 Ga0501070_0006221 Ga0501070_0006221_3505_4026 173
619 3300049586 Ga0501070_0055191 Ga0501070_0055191_889_1410 173
620 3300049588 Ga0501072_1239815 Ga0501072_1239815_37_558 173
621 3300049593 Ga0501077_0274037 Ga0501077_0274037_25_546 173
622 3300049744 Ga0501083_0125954 Ga0501083_0125954_1114_1635 173
623 3300049822 Ga0501035_0000038 Ga0501035_0000038_76265_76786 173
624 3300049822 Ga0501035_0156061 Ga0501035_0156061_372_893 173
625 3300049823 Ga0501044_0000046 Ga0501044_0000046_64259_64780 173
626 3300049823 Ga0501044_0000453 Ga0501044_0000453_17697_18218 173
627 3300049823 Ga0501044_0030103 Ga0501044_0030103_914_1435 173
628 3300049823 Ga0501044_1041849 Ga0501044_1041849_40_564 173
629 3300050489 nmdc:mga03683_7_c1 nmdc:mga03683_7_c1_73436_73957 173
630 3300050490 nmdc:mga03n38_68_c1 nmdc:mga03n38_68_c1_11483_12004 173
631 3300050491 nmdc:mga00v17_9_c1 nmdc:mga00v17_9_c1_19938_20459 173
632 3300050492 nmdc:mga0yw44_567_c1 nmdc:mga0yw44_567_c1_5165_5686 173
633 3300050493 nmdc:mga0k408_415_c1 nmdc:mga0k408_415_c1_15551_16072 173
634 3300050494 nmdc:mga06z11_3_c1 nmdc:mga06z11_3_c1_71984_72505 173
635 3300050494 nmdc:mga06z11_500279_c1 nmdc:mga06z11_500279_c1_192_713 173
636 3300050495 nmdc:mga04h51_5_c1 nmdc:mga04h51_5_c1_122242_122763 173
637 3300050496 nmdc:mga07m45_18_c1 nmdc:mga07m45_18_c1_19947_20468 173
638 3300050507 nmdc:mga05p37_59407_c1 nmdc:mga05p37_59407_c1_1481_2002 173
639 3300050509 nmdc:mga0qj67_276240_c1 nmdc:mga0qj67_276240_c1_536_1057 173
640 3300050511 nmdc:mga08y16_1085693_c1 nmdc:mga08y16_1085693_c1_101_622 173
641 3300050512 nmdc:mga0n895_449976_c1 nmdc:mga0n895_449976_c1_20_541 173
642 3300050516 nmdc:mga0sz30_397_c1 nmdc:mga0sz30_397_c1_13668_14189 173
643 3300053077 Ga0495601_0000315 Ga0495601_0000315_24714_25235 173
644 3300053077 Ga0495601_0193956 Ga0495601_0193956_712_1233 173
645 3300053077 Ga0495601_0265143 Ga0495601_0265143_531_1052 173
646 3300053078 Ga0495612_0009255 Ga0495612_0009255_3001_3522 173
647 3300053078 Ga0495612_0041597 Ga0495612_0041597_443_964 173
648 3300053084 Ga0495595_0054746 Ga0495595_0054746_349_870 173
649 3300053085 Ga0495619_0005627 Ga0495619_0005627_911_1432 173
650 3300053085 Ga0495619_0015668 Ga0495619_0015668_3753_4274 173
651 3300053093 Ga0500651_0011683 Ga0500651_0011683_2083_2604 173
652 3300053117 Ga0500593_000213 Ga0500593_000213_629_1159 173
653 3300053153 Ga0500616_0000006 Ga0500616_0000006_232229_232750 173
654 3300060353 Ga0501082_0422521 Ga0501082_0422521_38_559 173
655 2162886012 MBSR1b_contig_2331715 MBSR1b_0477.00006870 174
656 3300001904 JGI24736J21556_1020899 JGI24736J21556_10208992 174
657 3300001976 JGI24752J21851_1006044 JGI24752J21851_10060442 174
658 3300001977 JGI24746J21847_1000017 JGI24746J21847_10000173 174
659 3300001990 JGI24737J22298_10000400 JGI24737J22298_100004004 174
660 3300001991 JGI24743J22301_10000915 JGI24743J22301_100009152 174
661 3300002067 JGI24735J21928_10057537 JGI24735J21928_100575372 174
662 3300002070 JGI24750J21931_1000217 JGI24750J21931_10002172 174
663 3300002073 JGI24745J21846_1000376 JGI24745J21846_10003763 174
664 3300002074 JGI24748J21848_1001902 JGI24748J21848_10019023 174
665 3300002075 JGI24738J21930_10000277 JGI24738J21930_100002773 174
666 3300002077 JGI24744J21845_10002948 JGI24744J21845_100029483 174
667 3300002077 JGI24744J21845_10015756 JGI24744J21845_100157562 174
668 3300002126 JGI24035J26624_1000371 JGI24035J26624_10003714 174
669 3300002239 JGI24034J26672_10000434 JGI24034J26672_100004343 174
670 3300002239 JGI24034J26672_10005759 JGI24034J26672_100057593 174
671 3300002244 JGI24742J22300_10000062 JGI24742J22300_100000623 174
672 3300002459 JGI24751J29686_10007332 JGI24751J29686_100073322 174
673 3300003203 JGI25406J46586_10000096 JGI25406J46586_1000009643 174
674 3300003215 JGI25153J46596_10006269 JGI25153J46596_100062695 174
675 3300005290 Ga0065712_10116669 Ga0065712_101166692 174
676 3300005293 Ga0065715_10001161 Ga0065715_100011612 174
677 3300005327 Ga0070658_10038491 Ga0070658_100384912 174
678 3300005327 Ga0070658_10098358 Ga0070658_100983584 174
679 3300005327 Ga0070658_10745904 Ga0070658_107459042 174
680 3300005328 Ga0070676_10000813 Ga0070676_100008137 174
681 3300005329 Ga0070683_100000240 Ga0070683_1000002407 174
682 3300005330 Ga0070690_100000428 Ga0070690_10000042814 174
683 3300005331 Ga0070670_100005838 Ga0070670_1000058385 174
684 3300005331 Ga0070670_100088515 Ga0070670_1000885154 174
685 3300005333 Ga0070677_10000294 Ga0070677_1000029417 174
686 3300005334 Ga0068869_100000595 Ga0068869_1000005957 174
687 3300005334 Ga0068869_100148413 Ga0068869_1001484132 174
688 3300005334 Ga0068869_101380103 Ga0068869_1013801031 174
689 3300005335 Ga0070666_10003384 Ga0070666_100033845 174
690 3300005336 Ga0070680_100002839 Ga0070680_1000028399 174
691 3300005336 Ga0070680_100029144 Ga0070680_1000291443 174
692 3300005337 Ga0070682_100000202 Ga0070682_10000020215 174
693 3300005338 Ga0068868_100000614 Ga0068868_1000006145 174
694 3300005338 Ga0068868_100009330 Ga0068868_1000093307 174
695 3300005338 Ga0068868_101069036 Ga0068868_1010690361 174
696 3300005339 Ga0070660_100000223 Ga0070660_1000002237 174
697 3300005340 Ga0070689_100000187 Ga0070689_1000001877 174
698 3300005340 Ga0070689_100017860 Ga0070689_1000178605 174
699 3300005340 Ga0070689_100590181 Ga0070689_1005901812 174
700 3300005341 Ga0070691_10034527 Ga0070691_100345274 174
701 3300005343 Ga0070687_100000200 Ga0070687_10000020019 174
702 3300005344 Ga0070661_100000298 Ga0070661_10000029836 174
703 3300005345 Ga0070692_10000016 Ga0070692_100000167 174
704 3300005345 Ga0070692_10072584 Ga0070692_100725842 174
705 3300005347 Ga0070668_100001007 Ga0070668_10000100717 174
706 3300005353 Ga0070669_100001525 Ga0070669_1000015257 174
707 3300005353 Ga0070669_100039149 Ga0070669_1000391495 174
708 3300005354 Ga0070675_100000215 Ga0070675_10000021535 174
709 3300005354 Ga0070675_100032642 Ga0070675_1000326423 174
710 3300005355 Ga0070671_100000402 Ga0070671_10000040226 174
711 3300005355 Ga0070671_100198375 Ga0070671_1001983752 174
712 3300005356 Ga0070674_100000511 Ga0070674_10000051117 174
713 3300005364 Ga0070673_100000035 Ga0070673_10000003552 174
714 3300005365 Ga0070688_100000130 Ga0070688_1000001309 174
715 3300005366 Ga0070659_100003979 Ga0070659_1000039798 174
716 3300005366 Ga0070659_100065201 Ga0070659_1000652015 174
717 3300005367 Ga0070667_100000712 Ga0070667_1000007124 174
718 3300005406 Ga0070703_10006883 Ga0070703_100068833 174
719 3300005436 Ga0070713_100520464 Ga0070713_1005204642 174
720 3300005438 Ga0070701_10000081 Ga0070701_100000812 174
721 3300005440 Ga0070705_100002491 Ga0070705_1000024913 174
722 3300005441 Ga0070700_100001353 Ga0070700_1000013537 174
723 3300005441 Ga0070700_100037901 Ga0070700_1000379012 174
724 3300005444 Ga0070694_100000129 Ga0070694_10000012936 174
725 3300005444 Ga0070694_100144058 Ga0070694_1001440582 174
726 3300005445 Ga0070708_100007439 Ga0070708_1000074398 174
727 3300005455 Ga0070663_100001786 Ga0070663_1000017867 174
728 3300005455 Ga0070663_100285522 Ga0070663_1002855222 174
729 3300005456 Ga0070678_100002263 Ga0070678_1000022636 174
730 3300005456 Ga0070678_100107075 Ga0070678_1001070752 174
731 3300005457 Ga0070662_100000933 Ga0070662_10000093315 174
732 3300005457 Ga0070662_100019254 Ga0070662_1000192545 174
733 3300005458 Ga0070681_10108495 Ga0070681_101084952 174
734 3300005458 Ga0070681_10191641 Ga0070681_101916413 174
735 3300005458 Ga0070681_10325579 Ga0070681_103255791 174
736 3300005458 Ga0070681_10456787 Ga0070681_104567872 174
737 3300005459 Ga0068867_100000369 Ga0068867_10000036918 174
738 3300005459 Ga0068867_100167659 Ga0068867_1001676592 174
739 3300005466 Ga0070685_10001791 Ga0070685_1000179110 174
740 3300005466 Ga0070685_10016136 Ga0070685_100161363 174
741 3300005518 Ga0070699_100306043 Ga0070699_1003060432 174
742 3300005530 Ga0070679_100000553 Ga0070679_1000005536 174
743 3300005530 Ga0070679_100160951 Ga0070679_1001609512 174
744 3300005530 Ga0070679_100561978 Ga0070679_1005619782 174
745 3300005530 Ga0070679_100978567 Ga0070679_1009785671 174
746 3300005535 Ga0070684_100000246 Ga0070684_1000002467 174
747 3300005535 Ga0070684_100120562 Ga0070684_1001205625 174
748 3300005536 Ga0070697_100076061 Ga0070697_1000760612 174
749 3300005539 Ga0068853_100002121 Ga0068853_1000021218 174
750 3300005539 Ga0068853_100074542 Ga0068853_1000745423 174
751 3300005539 Ga0068853_100217202 Ga0068853_1002172023 174
752 3300005543 Ga0070672_100000157 Ga0070672_1000001577 174
753 3300005543 Ga0070672_100071390 Ga0070672_1000713902 174
754 3300005544 Ga0070686_100000260 Ga0070686_1000002609 174
755 3300005544 Ga0070686_100013967 Ga0070686_1000139676 174
756 3300005544 Ga0070686_100832394 Ga0070686_1008323942 174
757 3300005545 Ga0070695_100009157 Ga0070695_1000091572 174
758 3300005546 Ga0070696_100006359 Ga0070696_1000063592 174
759 3300005547 Ga0070693_100009423 Ga0070693_1000094237 174
760 3300005548 Ga0070665_100353289 Ga0070665_1003532893 174
761 3300005549 Ga0070704_100000171 Ga0070704_10000017128 174
762 3300005549 Ga0070704_100548790 Ga0070704_1005487902 174
763 3300005563 Ga0068855_100005012 Ga0068855_1000050125 174
764 3300005563 Ga0068855_100173426 Ga0068855_1001734262 174
765 3300005564 Ga0070664_100000269 Ga0070664_1000002697 174
766 3300005564 Ga0070664_100073397 Ga0070664_1000733974 174
767 3300005577 Ga0068857_100000174 Ga0068857_1000001748 174
768 3300005578 Ga0068854_100000211 Ga0068854_10000021137 174
769 3300005578 Ga0068854_100058495 Ga0068854_1000584953 174
770 3300005614 Ga0068856_100000600 Ga0068856_10000060010 174
771 3300005615 Ga0070702_100000312 Ga0070702_10000031211 174
772 3300005615 Ga0070702_100022253 Ga0070702_1000222534 174
773 3300005616 Ga0068852_100003615 Ga0068852_1000036155 174
774 3300005616 Ga0068852_100189044 Ga0068852_1001890443 174
775 3300005616 Ga0068852_100355761 Ga0068852_1003557612 174
776 3300005617 Ga0068859_100000894 Ga0068859_1000008949 174
777 3300005618 Ga0068864_100000329 Ga0068864_10000032916 174
778 3300005618 Ga0068864_100017181 Ga0068864_1000171813 174
779 3300005718 Ga0068866_10001636 Ga0068866_100016365 174
780 3300005719 Ga0068861_100004532 Ga0068861_1000045325 174
781 3300005840 Ga0068870_10000056 Ga0068870_100000569 174
782 3300005840 Ga0068870_10006351 Ga0068870_100063513 174
783 3300005840 Ga0068870_10389223 Ga0068870_103892232 174
784 3300005841 Ga0068863_100000278 Ga0068863_10000027826 174
785 3300005841 Ga0068863_100286819 Ga0068863_1002868192 174
786 3300005841 Ga0068863_100300050 Ga0068863_1003000503 174
787 3300005842 Ga0068858_100006617 Ga0068858_1000066173 174
788 3300005842 Ga0068858_100078707 Ga0068858_1000787074 174
789 3300005843 Ga0068860_100000985 Ga0068860_10000098528 174
790 3300005844 Ga0068862_100000593 Ga0068862_10000059338 174
791 3300005844 Ga0068862_100048568 Ga0068862_1000485684 174
792 3300005844 Ga0068862_100122722 Ga0068862_1001227223 174
793 3300005985 Ga0081539_10000051 Ga0081539_10000051260 174
794 3300006038 Ga0075365_10064444 Ga0075365_100644444 174
795 3300006163 Ga0070715_10098219 Ga0070715_100982192 174
796 3300006173 Ga0070716_100199412 Ga0070716_1001994122 174
797 3300006177 Ga0075362_10001186 Ga0075362_100011863 174
798 3300006178 Ga0075367_10050122 Ga0075367_100501224 174
799 3300006178 Ga0075367_10194698 Ga0075367_101946982 174
800 3300006178 Ga0075367_10196065 Ga0075367_101960651 174
801 3300006178 Ga0075367_10667253 Ga0075367_106672531 174
802 3300006186 Ga0075369_10085299 Ga0075369_100852992 174
803 3300006195 Ga0075366_10190068 Ga0075366_101900682 174
804 3300006237 Ga0097621_100002386 Ga0097621_1000023869 174
805 3300006237 Ga0097621_100024031 Ga0097621_1000240312 174
806 3300006358 Ga0068871_100001030 Ga0068871_10000103018 174
807 3300006358 Ga0068871_100065584 Ga0068871_1000655843 174
808 3300006358 Ga0068871_100227088 Ga0068871_1002270882 174
809 3300006844 Ga0075428_100044577 Ga0075428_1000445774 174
810 3300006852 Ga0075433_10014240 Ga0075433_100142405 174
811 3300006852 Ga0075433_10351488 Ga0075433_103514882 174
812 3300006871 Ga0075434_100000244 Ga0075434_10000024438 174
813 3300006881 Ga0068865_100005678 Ga0068865_1000056785 174
814 3300006881 Ga0068865_100035370 Ga0068865_1000353704 174
815 3300006914 Ga0075436_100124486 Ga0075436_1001244862 174
816 3300006914 Ga0075436_100149543 Ga0075436_1001495432 174
817 3300006914 Ga0075436_100341361 Ga0075436_1003413612 174
818 3300006931 Ga0097620_100000894 Ga0097620_10000089426 174
819 3300009011 Ga0105251_10404735 Ga0105251_104047351 174
820 3300009036 Ga0105244_10064168 Ga0105244_100641682 174
821 3300009036 Ga0105244_10084405 Ga0105244_100844052 174
822 3300009092 Ga0105250_10033696 Ga0105250_100336963 174
823 3300009093 Ga0105240_10016606 Ga0105240_100166065 174
824 3300009093 Ga0105240_10025923 Ga0105240_100259235 174
825 3300009094 Ga0111539_10001076 Ga0111539_1000107637 174
826 3300009094 Ga0111539_10170937 Ga0111539_101709373 174
827 3300009098 Ga0105245_10000451 Ga0105245_1000045137 174
828 3300009101 Ga0105247_10001016 Ga0105247_100010169 174
829 3300009101 Ga0105247_10015382 Ga0105247_100153822 174
830 3300009147 Ga0114129_10022264 Ga0114129_100222644 174
831 3300009147 Ga0114129_10212182 Ga0114129_102121823 174
832 3300009148 Ga0105243_10002173 Ga0105243_100021739 174
833 3300009148 Ga0105243_10062536 Ga0105243_100625365 174
834 3300009174 Ga0105241_10001549 Ga0105241_100015499 174
835 3300009176 Ga0105242_10000947 Ga0105242_100009477 174
836 3300009176 Ga0105242_10073958 Ga0105242_100739582 174
837 3300009177 Ga0105248_10000837 Ga0105248_1000083737 174
838 3300009177 Ga0105248_10225919 Ga0105248_102259192 174
839 3300009545 Ga0105237_10022344 Ga0105237_100223448 174
840 3300009545 Ga0105237_10034852 Ga0105237_100348523 174
841 3300009551 Ga0105238_10425633 Ga0105238_104256332 174
842 3300009553 Ga0105249_10000976 Ga0105249_1000097620 174
843 3300009553 Ga0105249_10173026 Ga0105249_101730262 174
844 3300010375 Ga0105239_10005959 Ga0105239_100059595 174
845 3300010375 Ga0105239_10777506 Ga0105239_107775062 174
846 3300010375 Ga0105239_12148422 Ga0105239_121484221 174
847 3300011119 Ga0105246_10000100 Ga0105246_1000010037 174
848 3300013100 Ga0157373_10002941 Ga0157373_1000294110 174
849 3300013102 Ga0157371_10001676 Ga0157371_1000167623 174
850 3300013102 Ga0157371_10248990 Ga0157371_102489902 174
851 3300013104 Ga0157370_10104183 Ga0157370_101041832 174
852 3300013105 Ga0157369_10076826 Ga0157369_100768263 174
853 3300013296 Ga0157374_10000956 Ga0157374_1000095620 174
854 3300013296 Ga0157374_10418800 Ga0157374_104188002 174
855 3300013297 Ga0157378_10208180 Ga0157378_102081802 174
856 3300013306 Ga0163162_10004679 Ga0163162_100046799 174
857 3300013306 Ga0163162_10294669 Ga0163162_102946692 174
858 3300013307 Ga0157372_10026270 Ga0157372_100262708 174
859 3300013308 Ga0157375_10000464 Ga0157375_1000046445 174
860 3300013308 Ga0157375_10180032 Ga0157375_101800322 174
861 3300014325 Ga0163163_10087313 Ga0163163_100873133 174
862 3300014325 Ga0163163_10214256 Ga0163163_102142562 174
863 3300014326 Ga0157380_10000145 Ga0157380_100001458 174
864 3300014326 Ga0157380_10050758 Ga0157380_100507582 174
865 3300014745 Ga0157377_10000179 Ga0157377_100001795 174
866 3300014968 Ga0157379_10000067 Ga0157379_1000006718 174
867 3300014968 Ga0157379_10027154 Ga0157379_100271545 174
868 3300014969 Ga0157376_10003254 Ga0157376_100032545 174
869 3300014969 Ga0157376_10058961 Ga0157376_100589612 174
870 3300017792 Ga0163161_10001462 Ga0163161_1000146219 174
871 3300017792 Ga0163161_10237947 Ga0163161_102379472 174
872 3300020070 Ga0206356_11666881 Ga0206356_116668811 174
873 3300020082 Ga0206353_10538368 Ga0206353_105383683 174
874 3300025223 Ga0207672_1005253 Ga0207672_10052532 174
875 3300025271 Ga0207666_1000002 Ga0207666_100000252 174
876 3300025290 Ga0207673_1000015 Ga0207673_100001510 174
877 3300025297 Ga0209758_1000746 Ga0209758_100074635 174
878 3300025297 Ga0209758_1047482 Ga0209758_10474822 174
879 3300025315 Ga0207697_10000113 Ga0207697_100001138 174
880 3300025885 Ga0207653_10001463 Ga0207653_100014636 174
881 3300025893 Ga0207682_10000094 Ga0207682_1000009437 174
882 3300025899 Ga0207642_10000337 Ga0207642_100003379 174
883 3300025900 Ga0207710_10000795 Ga0207710_100007959 174
884 3300025901 Ga0207688_10000074 Ga0207688_1000007436 174
885 3300025901 Ga0207688_10022635 Ga0207688_100226355 174
886 3300025903 Ga0207680_10016185 Ga0207680_100161855 174
887 3300025904 Ga0207647_10000218 Ga0207647_1000021820 174
888 3300025907 Ga0207645_10000247 Ga0207645_1000024746 174
889 3300025907 Ga0207645_10013731 Ga0207645_100137312 174
890 3300025908 Ga0207643_10000004 Ga0207643_10000004193 174
891 3300025908 Ga0207643_10008573 Ga0207643_100085735 174
892 3300025909 Ga0207705_10105850 Ga0207705_101058502 174
893 3300025911 Ga0207654_10000627 Ga0207654_1000062710 174
894 3300025912 Ga0207707_10000618 Ga0207707_1000061831 174
895 3300025912 Ga0207707_10097675 Ga0207707_100976752 174
896 3300025912 Ga0207707_10230751 Ga0207707_102307512 174
897 3300025912 Ga0207707_10236246 Ga0207707_102362463 174
898 3300025913 Ga0207695_10030828 Ga0207695_100308282 174
899 3300025913 Ga0207695_10078150 Ga0207695_100781503 174
900 3300025914 Ga0207671_10011571 Ga0207671_100115718 174
901 3300025914 Ga0207671_10469454 Ga0207671_104694541 174
902 3300025916 Ga0207663_10158105 Ga0207663_101581052 174
903 3300025917 Ga0207660_10000741 Ga0207660_100007417 174
904 3300025917 Ga0207660_10059336 Ga0207660_100593362 174
905 3300025918 Ga0207662_10000119 Ga0207662_100001197 174
906 3300025918 Ga0207662_10080383 Ga0207662_100803832 174
907 3300025919 Ga0207657_10000316 Ga0207657_1000031651 174
908 3300025920 Ga0207649_10000090 Ga0207649_1000009070 174
909 3300025921 Ga0207652_10000847 Ga0207652_1000084719 174
910 3300025921 Ga0207652_10090474 Ga0207652_100904742 174
911 3300025923 Ga0207681_10000370 Ga0207681_100003703 174
912 3300025923 Ga0207681_10092946 Ga0207681_100929461 174
913 3300025924 Ga0207694_10504182 Ga0207694_105041822 174
914 3300025925 Ga0207650_10008243 Ga0207650_100082439 174
915 3300025925 Ga0207650_10720481 Ga0207650_107204811 174
916 3300025926 Ga0207659_10000038 Ga0207659_100000382 174
917 3300025926 Ga0207659_10050758 Ga0207659_100507581 174
918 3300025927 Ga0207687_10000784 Ga0207687_1000078415 174
919 3300025931 Ga0207644_10001053 Ga0207644_1000105315 174
920 3300025931 Ga0207644_10084086 Ga0207644_100840862 174
921 3300025932 Ga0207690_10000239 Ga0207690_1000023931 174
922 3300025932 Ga0207690_10173942 Ga0207690_101739422 174
923 3300025933 Ga0207706_10000424 Ga0207706_1000042445 174
924 3300025933 Ga0207706_10063556 Ga0207706_100635562 174
925 3300025934 Ga0207686_10001203 Ga0207686_100012037 174
926 3300025935 Ga0207709_10000379 Ga0207709_1000037918 174
927 3300025935 Ga0207709_10026246 Ga0207709_100262462 174
928 3300025936 Ga0207670_10000176 Ga0207670_1000017640 174
929 3300025936 Ga0207670_10008187 Ga0207670_100081877 174
930 3300025936 Ga0207670_10491230 Ga0207670_104912302 174
931 3300025937 Ga0207669_10000165 Ga0207669_100001653 174
932 3300025937 Ga0207669_10141123 Ga0207669_101411232 174
933 3300025938 Ga0207704_10006804 Ga0207704_100068043 174
934 3300025939 Ga0207665_10006896 Ga0207665_100068965 174
935 3300025940 Ga0207691_10000358 Ga0207691_1000035837 174
936 3300025940 Ga0207691_10041676 Ga0207691_100416762 174
937 3300025941 Ga0207711_10000780 Ga0207711_1000078018 174
938 3300025941 Ga0207711_10157710 Ga0207711_101577102 174
939 3300025942 Ga0207689_10000479 Ga0207689_100004798 174
940 3300025942 Ga0207689_10019815 Ga0207689_100198152 174
941 3300025944 Ga0207661_10000604 Ga0207661_1000060417 174
942 3300025945 Ga0207679_10000139 Ga0207679_1000013940 174
943 3300025945 Ga0207679_10220849 Ga0207679_102208492 174
944 3300025949 Ga0207667_10023803 Ga0207667_100238035 174
945 3300025949 Ga0207667_10048182 Ga0207667_100481823 174
946 3300025949 Ga0207667_10077776 Ga0207667_100777763 174
947 3300025949 Ga0207667_10450442 Ga0207667_104504423 174
948 3300025949 Ga0207667_10750860 Ga0207667_107508601 174
949 3300025960 Ga0207651_10000072 Ga0207651_1000007216 174
950 3300025960 Ga0207651_10049604 Ga0207651_100496044 174
951 3300025961 Ga0207712_10000588 Ga0207712_1000058817 174
952 3300025961 Ga0207712_10197380 Ga0207712_101973802 174
953 3300025972 Ga0207668_10000168 Ga0207668_1000016818 174
954 3300025972 Ga0207668_10265654 Ga0207668_102656542 174
955 3300025981 Ga0207640_10000242 Ga0207640_1000024236 174
956 3300025981 Ga0207640_10870076 Ga0207640_108700761 174
957 3300025986 Ga0207658_10000667 Ga0207658_100006677 174
958 3300026023 Ga0207677_10010368 Ga0207677_100103686 174
959 3300026023 Ga0207677_10281154 Ga0207677_102811542 174
960 3300026035 Ga0207703_10000463 Ga0207703_1000046318 174
961 3300026035 Ga0207703_10116701 Ga0207703_101167012 174
962 3300026035 Ga0207703_10977148 Ga0207703_109771481 174
963 3300026041 Ga0207639_10002404 Ga0207639_100024048 174
964 3300026041 Ga0207639_10238346 Ga0207639_102383462 174
965 3300026067 Ga0207678_10000447 Ga0207678_100004477 174
966 3300026067 Ga0207678_10025630 Ga0207678_100256304 174
967 3300026075 Ga0207708_10000293 Ga0207708_1000029336 174
968 3300026075 Ga0207708_10011723 Ga0207708_100117232 174
969 3300026078 Ga0207702_10007213 Ga0207702_1000721311 174
970 3300026078 Ga0207702_10066021 Ga0207702_100660215 174
971 3300026078 Ga0207702_10106481 Ga0207702_101064812 174
972 3300026088 Ga0207641_10000724 Ga0207641_1000072431 174
973 3300026088 Ga0207641_10297567 Ga0207641_102975672 174
974 3300026089 Ga0207648_10000223 Ga0207648_1000022324 174
975 3300026089 Ga0207648_10050996 Ga0207648_100509962 174
976 3300026095 Ga0207676_10000392 Ga0207676_100003925 174
977 3300026095 Ga0207676_10015307 Ga0207676_100153075 174
978 3300026116 Ga0207674_10000955 Ga0207674_100009558 174
979 3300026118 Ga0207675_100000364 Ga0207675_10000036416 174
980 3300026118 Ga0207675_100012644 Ga0207675_1000126442 174
981 3300026121 Ga0207683_10000397 Ga0207683_1000039737 174
982 3300026121 Ga0207683_10092022 Ga0207683_100920224 174
983 3300026142 Ga0207698_10003705 Ga0207698_100037052 174
984 3300026142 Ga0207698_10280383 Ga0207698_102803832 174
985 3300027617 Ga0210002_1002444 Ga0210002_10024442 174
986 3300027695 Ga0209966_1058605 Ga0209966_10586052 174
987 3300027717 Ga0209998_10003051 Ga0209998_100030512 174
988 3300027876 Ga0209974_10001544 Ga0209974_100015446 174
989 3300027907 Ga0207428_10000439 Ga0207428_100004397 174
990 3300027907 Ga0207428_10070210 Ga0207428_100702104 174
991 3300028380 Ga0268265_10002666 Ga0268265_100026667 174
992 3300028381 Ga0268264_10000890 Ga0268264_1000089020 174
993 3300028381 Ga0268264_10264664 Ga0268264_102646642 174
994 3300031235 Ga0265330_10046448 Ga0265330_100464482 174
995 3300031240 Ga0265320_10073021 Ga0265320_100730212 174
996 3300031241 Ga0265325_10033795 Ga0265325_100337953 174
997 3300031241 Ga0265325_10042845 Ga0265325_100428452 174
998 3300031247 Ga0265340_10014538 Ga0265340_100145385 174
999 3300031250 Ga0265331_10014754 Ga0265331_100147542 174
1000 3300031250 Ga0265331_10302686 Ga0265331_103026862 174
1001 3300031344 Ga0265316_10360448 Ga0265316_103604482 174
1002 3300031548 Ga0307408_101525205 Ga0307408_1015252051 174
1003 3300031595 Ga0265313_10067348 Ga0265313_100673482 174
1004 3300031712 Ga0265342_10463264 Ga0265342_104632641 174
1005 3300034819 Ga0373958_0004594 Ga0373958_0004594_1351_1875 174
1006 3300034957 Ga0373938_0000446 Ga0373938_0000446_795_1319 174
1007 3300035085 Ga0373929_0006936 Ga0373929_0006936_899_1423 174
1008 3300035091 Ga0373951_0002137 Ga0373951_0002137_1223_1747 174
1009 3300035112 Ga0373932_0000843 Ga0373932_0000843_5102_5626 174
1010 3300035114 Ga0373939_0000671 Ga0373939_0000671_1016_1540 174
1011 3300035115 Ga0373941_0048933 Ga0373941_0048933_86_610 174
1012 3300035119 Ga0373956_0215011 Ga0373956_0215011_58_585 174
1013 3300035121 Ga0373960_0007456 Ga0373960_0007456_867_1391 174
1014 3300035121 Ga0373960_0075926 Ga0373960_0075926_158_694 174
1015 3300035170 Ga0373943_0441405 Ga0373943_0441405_24_548 174
1016 3300035172 Ga0373955_0102898 Ga0373955_0102898_561_1088 174
1017 3300035172 Ga0373955_0204258 Ga0373955_0204258_187_714 174
1018 3300035207 Ga0373942_0079001 Ga0373942_0079001_433_957 174
1019 3300035241 Ga0373961_0001890 Ga0373961_0001890_2805_3329 174
1020 3300035241 Ga0373961_0054891 Ga0373961_0054891_72_608 174
1021 3300035242 Ga0373962_0001390 Ga0373962_0001390_87_611 174
1022 3300035691 Ga0373931_0000089 Ga0373931_0000089_26551_27075 174
1023 3300036401 Ga0373937_0073546 Ga0373937_0073546_2412_2939 174
1024 3300036401 Ga0373937_0161426 Ga0373937_0161426_248_775 174
1025 3300037068 Ga0373925_0041686 Ga0373925_0041686_451_975 174
1026 3300037068 Ga0373925_0845352 Ga0373925_0845352_203_739 174
1027 3300038741 Ga0400488_50919 Ga0400488_50919_328_852 174
1028 3300039110 Ga0400487_13291 Ga0400487_13291_685_1209 174
1029 3300039437 Ga0436365_1030951 Ga0436365_1030951_804_1328 174
1030 3300046492 Ga0495585_0173779 Ga0495585_0173779_283_807 174
1031 3300046500 Ga0495596_0050744 Ga0495596_0050744_68_592 174
1032 3300046501 Ga0495607_0128568 Ga0495607_0128568_364_888 174
1033 3300046516 Ga0495628_0064442 Ga0495628_0064442_1661_2191 174
1034 3300046523 Ga0495644_0036426 Ga0495644_0036426_648_1172 174
1035 3300046536 Ga0495587_0434075 Ga0495587_0434075_138_665 174
1036 3300046537 Ga0495598_0002055 Ga0495598_0002055_3079_3603 174
1037 3300046543 Ga0495645_0331986 Ga0495645_0331986_347_877 174
1038 3300046615 Ga0495656_0026244 Ga0495656_0026244_1700_2224 174
1039 3300046616 Ga0495668_0470005 Ga0495668_0470005_101_625 174
1040 3300046648 Ga0495611_0414425 Ga0495611_0414425_50_574 174
1041 3300046664 Ga0495659_0031123 Ga0495659_0031123_356_880 174
1042 3300046665 Ga0495661_0340419 Ga0495661_0340419_106_630 174
1043 3300046675 Ga0495657_0353046 Ga0495657_0353046_303_830 174
1044 3300046691 Ga0495670_0100348 Ga0495670_0100348_45_569 174
1045 3300046691 Ga0495670_0406210 Ga0495670_0406210_202_726 174
1046 3300046794 Ga0495589_0158671 Ga0495589_0158671_118_642 174
1047 3300047470 Ga0495681_0129251 Ga0495681_0129251_484_1008 174
1048 3300048090 Ga0495615_0179806 Ga0495615_0179806_52_576 174
1049 3300048903 Ga0496100_0000200 Ga0496100_0000200_25611_26135 174
1050 3300048903 Ga0496100_0083141 Ga0496100_0083141_737_1261 174
1051 3300048903 Ga0496100_0937557 Ga0496100_0937557_68_592 174
1052 3300048904 Ga0496101_0000339 Ga0496101_0000339_1461_1985 174
1053 3300048904 Ga0496101_0024098 Ga0496101_0024098_2165_2689 174
1054 3300048904 Ga0496101_0044562 Ga0496101_0044562_2277_2801 174
1055 3300048905 Ga0496102_0015623 Ga0496102_0015623_4813_5337 174
1056 3300048906 Ga0496103_0001639 Ga0496103_0001639_1589_2113 174
1057 3300048906 Ga0496103_0018740 Ga0496103_0018740_1521_2045 174
1058 3300048907 Ga0496104_0109519 Ga0496104_0109519_2063_2599 174
1059 3300048907 Ga0496104_0157341 Ga0496104_0157341_789_1313 174
1060 3300048907 Ga0496104_0521165 Ga0496104_0521165_150_674 174
1061 3300048908 Ga0496105_0025818 Ga0496105_0025818_464_988 174
1062 3300048909 Ga0496106_0000202 Ga0496106_0000202_14744_15268 174
1063 3300048909 Ga0496106_0087756 Ga0496106_0087756_1597_2121 174
1064 3300048909 Ga0496106_0121899 Ga0496106_0121899_978_1502 174
1065 3300048910 Ga0496107_0000066 Ga0496107_0000066_10237_10761 174
1066 3300048911 Ga0496108_0035988 Ga0496108_0035988_2704_3228 174
1067 3300048911 Ga0496108_0381633 Ga0496108_0381633_170_694 174
1068 3300048912 Ga0496109_0000595 Ga0496109_0000595_24638_25162 174
1069 3300048913 Ga0496110_0026354 Ga0496110_0026354_467_991 174
1070 3300048913 Ga0496110_0236378 Ga0496110_0236378_537_1061 174
1071 3300048913 Ga0496110_0467670 Ga0496110_0467670_84_608 174
1072 3300048914 Ga0496111_0089239 Ga0496111_0089239_485_1009 174
1073 3300048914 Ga0496111_0095564 Ga0496111_0095564_659_1183 174
1074 3300048915 Ga0496112_0012515 Ga0496112_0012515_1648_2172 174
1075 3300048916 Ga0496113_0012395 Ga0496113_0012395_2361_2885 174
1076 3300048916 Ga0496113_0100490 Ga0496113_0100490_910_1434 174
1077 3300048917 Ga0496114_0003763 Ga0496114_0003763_5338_5862 174
1078 3300048917 Ga0496114_0108933 Ga0496114_0108933_1220_1744 174
1079 3300048917 Ga0496114_0530817 Ga0496114_0530817_323_883 174
1080 3300048918 Ga0496115_0052137 Ga0496115_0052137_1310_1834 174
1081 3300048918 Ga0496115_0542034 Ga0496115_0542034_200_724 174
1082 3300049571 Ga0501034_0070000 Ga0501034_0070000_238_765 174
1083 3300050489 nmdc:mga03683_5304_c1 nmdc:mga03683_5304_c1_3516_4055 174
1084 3300050490 nmdc:mga03n38_150873_c1 nmdc:mga03n38_150873_c1_163_702 174
1085 3300050492 nmdc:mga0yw44_36490_c1 nmdc:mga0yw44_36490_c1_1452_1976 174
1086 3300050492 nmdc:mga0yw44_71616_c1 nmdc:mga0yw44_71616_c1_1141_1665 174
1087 3300050493 nmdc:mga0k408_349119_c1 nmdc:mga0k408_349119_c1_131_655 174
1088 3300050494 nmdc:mga06z11_163282_c1 nmdc:mga06z11_163282_c1_694_1218 174
1089 3300050494 nmdc:mga06z11_47715_c1 nmdc:mga06z11_47715_c1_846_1370 174
1090 3300050494 nmdc:mga06z11_96614_c1 nmdc:mga06z11_96614_c1_479_1003 174
1091 3300050507 nmdc:mga05p37_101883_c1 nmdc:mga05p37_101883_c1_2137_2661 174
1092 3300050507 nmdc:mga05p37_241526_c1 nmdc:mga05p37_241526_c1_1241_1768 174
1093 3300050507 nmdc:mga05p37_580491_c1 nmdc:mga05p37_580491_c1_498_1022 174
1094 3300050510 nmdc:mga06r32_1338379_c1 nmdc:mga06r32_1338379_c1_24_548 174
1095 3300050510 nmdc:mga06r32_13463_c1 nmdc:mga06r32_13463_c1_2194_2718 174
1096 3300050511 nmdc:mga08y16_3164_c1 nmdc:mga08y16_3164_c1_14076_14600 174
1097 3300050511 nmdc:mga08y16_877047_c1 nmdc:mga08y16_877047_c1_20_544 174
1098 3300050512 nmdc:mga0n895_129897_c1 nmdc:mga0n895_129897_c1_1111_1635 174
1099 3300050512 nmdc:mga0n895_381_c1 nmdc:mga0n895_381_c1_13728_14252 174
1100 3300050513 nmdc:mga0rr50_725796_c1 nmdc:mga0rr50_725796_c1_252_776 174
1101 3300050514 nmdc:mga08x19_91152_c1 nmdc:mga08x19_91152_c1_1103_1627 174
1102 3300050515 nmdc:mga0a205_14653_c1 nmdc:mga0a205_14653_c1_6582_7106 174
1103 3300050515 nmdc:mga0a205_95359_c1 nmdc:mga0a205_95359_c1_1852_2376 174
1104 3300050516 nmdc:mga0sz30_27231_c1 nmdc:mga0sz30_27231_c1_1207_1731 174
1105 3300053083 Ga0495655_0034346 Ga0495655_0034346_416_940 174
1106 3300053096 Ga0500641_0010726 Ga0500641_0010726_2618_3142 174
1107 3300003320 rootH2_10090225 rootH2_100902254 175
1108 3300005354 Ga0070675_101118653 Ga0070675_1011186531 175
1109 3300005356 Ga0070674_101195189 Ga0070674_1011951891 175
1110 3300005366 Ga0070659_100271250 Ga0070659_1002712501 175
1111 3300005366 Ga0070659_100318038 Ga0070659_1003180383 175
1112 3300005435 Ga0070714_100305694 Ga0070714_1003056943 175
1113 3300005458 Ga0070681_10084449 Ga0070681_100844492 175
1114 3300005530 Ga0070679_100013763 Ga0070679_1000137633 175
1115 3300005563 Ga0068855_100150911 Ga0068855_1001509113 175
1116 3300006186 Ga0075369_10299803 Ga0075369_102998031 175
1117 3300006195 Ga0075366_10317359 Ga0075366_103173592 175
1118 3300006195 Ga0075366_10356183 Ga0075366_103561832 175
1119 3300006353 Ga0075370_10066406 Ga0075370_100664064 175
1120 3300009093 Ga0105240_10895337 Ga0105240_108953372 175
1121 3300009094 Ga0111539_11674507 Ga0111539_116745072 175
1122 3300009545 Ga0105237_10001591 Ga0105237_1000159119 175
1123 3300010375 Ga0105239_10011496 Ga0105239_1001149610 175
1124 3300013104 Ga0157370_11088440 Ga0157370_110884401 175
1125 3300013307 Ga0157372_10430112 Ga0157372_104301123 175
1126 3300014325 Ga0163163_10038044 Ga0163163_100380446 175
1127 3300025912 Ga0207707_10083749 Ga0207707_100837492 175
1128 3300025914 Ga0207671_10000733 Ga0207671_1000073334 175
1129 3300025917 Ga0207660_10075939 Ga0207660_100759392 175
1130 3300025919 Ga0207657_10006041 Ga0207657_1000604113 175
1131 3300025920 Ga0207649_11126477 Ga0207649_111264771 175
1132 3300025921 Ga0207652_10014370 Ga0207652_100143706 175
1133 3300025926 Ga0207659_10748996 Ga0207659_107489962 175
1134 3300025928 Ga0207700_10191022 Ga0207700_101910222 175
1135 3300025929 Ga0207664_10221093 Ga0207664_102210933 175
1136 3300025932 Ga0207690_10100971 Ga0207690_101009712 175
1137 3300025949 Ga0207667_10757239 Ga0207667_107572392 175
1138 3300025986 Ga0207658_11081976 Ga0207658_110819761 175
1139 3300028379 Ga0268266_10001473 Ga0268266_1000147310 175
1140 3300028800 Ga0265338_10079617 Ga0265338_100796173 175
1141 3300028800 Ga0265338_10162353 Ga0265338_101623532 175
1142 3300031238 Ga0265332_10028036 Ga0265332_100280363 175
1143 3300031240 Ga0265320_10029158 Ga0265320_100291586 175
1144 3300031241 Ga0265325_10000053 Ga0265325_1000005313 175
1145 3300031241 Ga0265325_10265099 Ga0265325_102650991 175
1146 3300031247 Ga0265340_10008636 Ga0265340_100086363 175
1147 3300031247 Ga0265340_10044626 Ga0265340_100446263 175
1148 3300031247 Ga0265340_10229863 Ga0265340_102298632 175
1149 3300031249 Ga0265339_10000038 Ga0265339_1000003832 175
1150 3300031249 Ga0265339_10004385 Ga0265339_100043856 175
1151 3300031249 Ga0265339_10447040 Ga0265339_104470401 175
1152 3300031344 Ga0265316_10005544 Ga0265316_100055444 175
1153 3300031595 Ga0265313_10000034 Ga0265313_1000003488 175
1154 3300031595 Ga0265313_10026728 Ga0265313_100267282 175
1155 3300031595 Ga0265313_10028250 Ga0265313_100282504 175
1156 3300031711 Ga0265314_10078327 Ga0265314_100783273 175
1157 3300031712 Ga0265342_10004574 Ga0265342_1000457410 175
1158 3300031712 Ga0265342_10012660 Ga0265342_100126606 175
1159 3300031712 Ga0265342_10047199 Ga0265342_100471994 175
1160 3300031901 Ga0307406_10361853 Ga0307406_103618532 175
1161 3300034818 Ga0373950_0055599 Ga0373950_0055599_125_655 175
1162 3300035111 Ga0373923_0029733 Ga0373923_0029733_267_794 175
1163 3300035114 Ga0373939_0001887 Ga0373939_0001887_2143_2670 175
1164 3300035172 Ga0373955_0015281 Ga0373955_0015281_2034_2561 175
1165 3300035692 Ga0373935_0036251 Ga0373935_0036251_2104_2634 175
1166 3300035695 Ga0373927_0060652 Ga0373927_0060652_804_1334 175
1167 3300035724 Ga0373933_0226279 Ga0373933_0226279_466_993 175
1168 3300036401 Ga0373937_0110857 Ga0373937_0110857_1253_1780 175
1169 3300037312 Ga0395899_0120435 Ga0395899_0120435_166_693 175
1170 3300037312 Ga0395899_0174791 Ga0395899_0174791_272_799 175
1171 3300037418 Ga0395900_0004620 Ga0395900_0004620_6497_7024 175
1172 3300037418 Ga0395900_0401895 Ga0395900_0401895_443_970 175
1173 3300037418 Ga0395900_0806536 Ga0395900_0806536_25_552 175
1174 3300037466 Ga0395898_0023858 Ga0395898_0023858_2255_2782 175
1175 3300037466 Ga0395898_0051029 Ga0395898_0051029_3476_4003 175
1176 3300038443 Ga0395901_0009450 Ga0395901_0009450_5877_6404 175
1177 3300038443 Ga0395901_0043653 Ga0395901_0043653_472_999 175
1178 3300039062 Ga0400483_254821 Ga0400483_254821_228_761 175
1179 3300039110 Ga0400487_45896 Ga0400487_45896_20_553 175
1180 3300041491 Ga0451833_0367787 Ga0451833_0367787_34_561 175
1181 3300044735 Ga0466968_0356038 Ga0466968_0356038_30_557 175
1182 3300046454 Ga0495592_0024672 Ga0495592_0024672_25_552 175
1183 3300046455 Ga0495603_0390972 Ga0495603_0390972_186_713 175
1184 3300046462 Ga0495651_0108915 Ga0495651_0108915_394_921 175
1185 3300046463 Ga0495653_0152393 Ga0495653_0152393_449_976 175
1186 3300046501 Ga0495607_0004284 Ga0495607_0004284_516_1046 175
1187 3300046511 Ga0495608_0043232 Ga0495608_0043232_278_805 175
1188 3300046513 Ga0495616_0067833 Ga0495616_0067833_153_680 175
1189 3300046518 Ga0495631_0106146 Ga0495631_0106146_358_885 175
1190 3300046529 Ga0495652_0081128 Ga0495652_0081128_897_1424 175
1191 3300046533 Ga0495640_0048245 Ga0495640_0048245_695_1225 175
1192 3300046536 Ga0495587_0071037 Ga0495587_0071037_1340_1867 175
1193 3300046538 Ga0495609_0066967 Ga0495609_0066967_823_1350 175
1194 3300046543 Ga0495645_0007103 Ga0495645_0007103_4684_5211 175
1195 3300046543 Ga0495645_0373970 Ga0495645_0373970_255_782 175
1196 3300046543 Ga0495645_0632034 Ga0495645_0632034_31_558 175
1197 3300046558 Ga0495633_0199127 Ga0495633_0199127_377_904 175
1198 3300046559 Ga0495667_0289698 Ga0495667_0289698_269_796 175
1199 3300046660 Ga0495625_0317097 Ga0495625_0317097_371_898 175
1200 3300046675 Ga0495657_0042843 Ga0495657_0042843_642_1169 175
1201 3300046678 Ga0495599_0141356 Ga0495599_0141356_190_717 175
1202 3300046679 Ga0495623_0041979 Ga0495623_0041979_1015_1542 175
1203 3300046809 Ga0495600_0036873 Ga0495600_0036873_1265_1792 175
1204 3300047317 Ga0495604_0083292 Ga0495604_0083292_1332_1859 175
1205 3300047322 Ga0495680_0006434 Ga0495680_0006434_579_1106 175
1206 3300047445 Ga0495677_0068222 Ga0495677_0068222_602_1129 175
1207 3300048088 Ga0495602_0260333 Ga0495602_0260333_602_1129 175
1208 3300048091 Ga0495626_0037084 Ga0495626_0037084_306_833 175
1209 3300048907 Ga0496104_0000955 Ga0496104_0000955_16594_17121 175
1210 3300048908 Ga0496105_0001292 Ga0496105_0001292_8850_9377 175
1211 3300048917 Ga0496114_0294606 Ga0496114_0294606_835_1362 175
1212 3300048917 Ga0496114_0581582 Ga0496114_0581582_43_570 175
1213 3300048918 Ga0496115_0063251 Ga0496115_0063251_2407_2943 175
1214 3300048928 Ga0496125_0004268 Ga0496125_0004268_2834_3361 175
1215 3300048929 Ga0496126_0264466 Ga0496126_0264466_636_1163 175
1216 3300048929 Ga0496126_0695656 Ga0496126_0695656_232_768 175
1217 3300049568 Ga0501031_0041973 Ga0501031_0041973_1084_1611 175
1218 3300049568 Ga0501031_0058631 Ga0501031_0058631_979_1506 175
1219 3300049568 Ga0501031_0208457 Ga0501031_0208457_376_903 175
1220 3300049569 Ga0501032_0057305 Ga0501032_0057305_727_1254 175
1221 3300049569 Ga0501032_0551338 Ga0501032_0551338_49_588 175
1222 3300049570 Ga0501033_0001893 Ga0501033_0001893_5967_6494 175
1223 3300049570 Ga0501033_0019416 Ga0501033_0019416_2849_3376 175
1224 3300049570 Ga0501033_0022931 Ga0501033_0022931_312_839 175
1225 3300049570 Ga0501033_0029586 Ga0501033_0029586_1146_1673 175
1226 3300049571 Ga0501034_0001379 Ga0501034_0001379_3752_4279 175
1227 3300049571 Ga0501034_0011046 Ga0501034_0011046_7046_7573 175
1228 3300049571 Ga0501034_0224172 Ga0501034_0224172_489_1016 175
1229 3300049571 Ga0501034_0245091 Ga0501034_0245091_285_812 175
1230 3300049571 Ga0501034_0663929 Ga0501034_0663929_355_885 175
1231 3300049572 Ga0501036_0193450 Ga0501036_0193450_738_1265 175
1232 3300049574 Ga0501038_0001623 Ga0501038_0001623_829_1356 175
1233 3300049574 Ga0501038_0007719 Ga0501038_0007719_3645_4172 175
1234 3300049574 Ga0501038_0024416 Ga0501038_0024416_2134_2661 175
1235 3300049575 Ga0501039_0217490 Ga0501039_0217490_472_999 175
1236 3300049575 Ga0501039_0304325 Ga0501039_0304325_694_1221 175
1237 3300049576 Ga0501040_0834488 Ga0501040_0834488_35_562 175
1238 3300049579 Ga0501043_0024324 Ga0501043_0024324_2488_3015 175
1239 3300049580 Ga0501046_0035352 Ga0501046_0035352_703_1230 175
1240 3300049580 Ga0501046_0243306 Ga0501046_0243306_745_1272 175
1241 3300049580 Ga0501046_0561647 Ga0501046_0561647_135_662 175
1242 3300049581 Ga0501047_0079784 Ga0501047_0079784_2450_2977 175
1243 3300049581 Ga0501047_0123627 Ga0501047_0123627_1658_2185 175
1244 3300049581 Ga0501047_0244225 Ga0501047_0244225_382_909 175
1245 3300049581 Ga0501047_0641406 Ga0501047_0641406_210_737 175
1246 3300049582 Ga0501048_0190497 Ga0501048_0190497_16_543 175
1247 3300049582 Ga0501048_0681130 Ga0501048_0681130_80_607 175
1248 3300049586 Ga0501070_0241219 Ga0501070_0241219_227_754 175
1249 3300049586 Ga0501070_0436523 Ga0501070_0436523_35_568 175
1250 3300049586 Ga0501070_0516748 Ga0501070_0516748_58_585 175
1251 3300049589 Ga0501073_0310324 Ga0501073_0310324_387_935 175
1252 3300049592 Ga0501076_0037511 Ga0501076_0037511_1722_2273 175
1253 3300049649 Ga0501198_009720 Ga0501198_009720_115_645 175
1254 3300049663 Ga0501223_028277 Ga0501223_028277_86_616 175
1255 3300049664 Ga0501224_005686 Ga0501224_005686_190_720 175
1256 3300049679 Ga0501249_000588 Ga0501249_000588_4360_4890 175
1257 3300049741 Ga0501079_0032410 Ga0501079_0032410_534_1085 175
1258 3300049742 Ga0501080_0159068 Ga0501080_0159068_761_1288 175
1259 3300049742 Ga0501080_0477106 Ga0501080_0477106_414_965 175
1260 3300049742 Ga0501080_0674498 Ga0501080_0674498_365_892 175
1261 3300049743 Ga0501081_0003581 Ga0501081_0003581_8212_8763 175
1262 3300049744 Ga0501083_0241354 Ga0501083_0241354_390_941 175
1263 3300049822 Ga0501035_0001496 Ga0501035_0001496_15100_15627 175
1264 3300049822 Ga0501035_0027284 Ga0501035_0027284_3825_4352 175
1265 3300049822 Ga0501035_0145119 Ga0501035_0145119_1029_1556 175
1266 3300049822 Ga0501035_0177023 Ga0501035_0177023_846_1373 175
1267 3300049823 Ga0501044_0001296 Ga0501044_0001296_17881_18408 175
1268 3300049823 Ga0501044_0003443 Ga0501044_0003443_6569_7096 175
1269 3300049823 Ga0501044_0026701 Ga0501044_0026701_2441_2968 175
1270 3300049823 Ga0501044_0145412 Ga0501044_0145412_989_1516 175
1271 3300049823 Ga0501044_0340055 Ga0501044_0340055_69_596 175
1272 3300049823 Ga0501044_0732203 Ga0501044_0732203_219_767 175
1273 3300049850 Ga0501204_007371 Ga0501204_007371_566_1096 175
1274 3300050496 nmdc:mga07m45_87848_c1 nmdc:mga07m45_87848_c1_1213_1743 175
1275 3300050512 nmdc:mga0n895_420748_c1 nmdc:mga0n895_420748_c1_248_775 175
1276 3300050512 nmdc:mga0n895_940507_c1 nmdc:mga0n895_940507_c1_201_728 175
1277 3300050516 nmdc:mga0sz30_341369_c1 nmdc:mga0sz30_341369_c1_12_542 175
1278 3300053077 Ga0495601_0000233 Ga0495601_0000233_20183_20710 175
1279 3300053084 Ga0495595_0002608 Ga0495595_0002608_2689_3216 175
1280 3300053085 Ga0495619_0002269 Ga0495619_0002269_1479_2006 175
1281 3300053087 Ga0500643_037641 Ga0500643_037641_261_788 175
1282 3300053111 Ga0500572_000054 Ga0500572_000054_14466_14993 175
1283 3300053111 Ga0500572_042061 Ga0500572_042061_426_953 175
1284 3300053136 Ga0500559_0000738 Ga0500559_0000738_1378_1905 175
1285 3300053142 Ga0500577_0272375 Ga0500577_0272375_118_645 175
1286 3300053163 Ga0500639_041972 Ga0500639_041972_281_808 175
1287 3300053177 Ga0500636_0119384 Ga0500636_0119384_714_1241 175
1288 3300053725 Ga0500576_165201 Ga0500576_165201_110_637 175
1289 3300053735 Ga0500596_002082 Ga0500596_002082_65_592 175
1290 3300054114 Ga0501084_0018211 Ga0501084_0018211_483_1034 175
1291 3300054114 Ga0501084_0877246 Ga0501084_0877246_91_618 175
1292 3300060353 Ga0501082_0008406 Ga0501082_0008406_3412_3963 175
1293 3300060353 Ga0501082_0193281 Ga0501082_0193281_1104_1631 175
1294 iso_pu_bacteria 2915650412 2915653981 175
1295 3300037418 Ga0395900_0096702 Ga0395900_0096702_1972_2508 176
1296 3300038443 Ga0395901_0082951 Ga0395901_0082951_2758_3294 176
1297 3300042157 Ga0439458_0001539 Ga0439458_0001539_3630_4172 176
1298 3300046660 Ga0495625_0111236 Ga0495625_0111236_273_818 176
1299 3300046684 Ga0495669_0000427 Ga0495669_0000427_4522_5067 176
1300 3300046694 Ga0495649_0093725 Ga0495649_0093725_702_1247 176
1301 3300006844 Ga0075428_100092621 Ga0075428_1000926213 177
1302 3300006846 Ga0075430_100011585 Ga0075430_1000115854 177
1303 3300006847 Ga0075431_100001682 Ga0075431_10000168217 177
1304 3300006880 Ga0075429_100023807 Ga0075429_1000238075 177
1305 3300009094 Ga0111539_10000851 Ga0111539_100008512 177
1306 3300009147 Ga0114129_10000199 Ga0114129_1000019961 177
1307 3300027907 Ga0207428_10051026 Ga0207428_100510261 177
1308 3300035170 Ga0373943_0004169 Ga0373943_0004169_2340_2879 177
1309 3300035171 Ga0373946_0049436 Ga0373946_0049436_188_727 177
1310 3300035692 Ga0373935_0039009 Ga0373935_0039009_1049_1588 177
1311 3300035695 Ga0373927_0012257 Ga0373927_0012257_1680_2219 177
1312 3300035724 Ga0373933_0052140 Ga0373933_0052140_1125_1664 177
1313 3300035725 Ga0373947_0027105 Ga0373947_0027105_1853_2392 177
1314 3300035725 Ga0373947_0432066 Ga0373947_0432066_281_832 177
1315 3300037068 Ga0373925_0005716 Ga0373925_0005716_4500_5039 177
1316 3300046455 Ga0495603_0025386 Ga0495603_0025386_1241_1780 177
1317 3300046459 Ga0495629_0016583 Ga0495629_0016583_2282_2821 177
1318 3300046461 Ga0495641_0118939 Ga0495641_0118939_399_938 177
1319 3300046462 Ga0495651_0167887 Ga0495651_0167887_805_1344 177
1320 3300046472 Ga0495580_0569732 Ga0495580_0569732_88_672 177
1321 3300046473 Ga0495582_0037796 Ga0495582_0037796_267_806 177
1322 3300046475 Ga0495639_0020277 Ga0495639_0020277_883_1422 177
1323 3300046476 Ga0495662_0041216 Ga0495662_0041216_1048_1587 177
1324 3300046477 Ga0495664_0143191 Ga0495664_0143191_131_670 177
1325 3300046499 Ga0495594_0010719 Ga0495594_0010719_3017_3556 177
1326 3300046514 Ga0495618_0020087 Ga0495618_0020087_1671_2210 177
1327 3300046516 Ga0495628_0133209 Ga0495628_0133209_317_856 177
1328 3300046517 Ga0495630_0037202 Ga0495630_0037202_1706_2245 177
1329 3300046526 Ga0495666_0058889 Ga0495666_0058889_29_568 177
1330 3300046529 Ga0495652_0045135 Ga0495652_0045135_1032_1571 177
1331 3300046533 Ga0495640_0020328 Ga0495640_0020328_2516_3055 177
1332 3300046535 Ga0495586_0236261 Ga0495586_0236261_465_1004 177
1333 3300046536 Ga0495587_0037236 Ga0495587_0037236_647_1186 177
1334 3300046642 Ga0495634_0027895 Ga0495634_0027895_1821_2360 177
1335 3300046663 Ga0495635_0261880 Ga0495635_0261880_490_1029 177
1336 3300046680 Ga0495646_0052580 Ga0495646_0052580_1079_1618 177
1337 3300046681 Ga0495647_0007874 Ga0495647_0007874_2207_2746 177
1338 3300046690 Ga0495624_0115329 Ga0495624_0115329_626_1165 177
1339 3300047315 Ga0495581_0015496 Ga0495581_0015496_1285_1824 177
1340 3300047319 Ga0495674_0066473 Ga0495674_0066473_1118_1657 177
1341 3300047321 Ga0495676_0017048 Ga0495676_0017048_4422_4961 177
1342 3300047322 Ga0495680_0099190 Ga0495680_0099190_694_1233 177
1343 3300048089 Ga0495614_0058107 Ga0495614_0058107_73_657 177
1344 3300049523 Ga0501300_003933 Ga0501300_003933_765_1310 177
1345 3300050507 nmdc:mga05p37_223_c1 nmdc:mga05p37_223_c1_50004_50546 177
1346 3300050508 nmdc:mga09592_147916_c1 nmdc:mga09592_147916_c1_136_678 177
1347 3300050509 nmdc:mga0qj67_20531_c1 nmdc:mga0qj67_20531_c1_1789_2331 177
1348 3300050510 nmdc:mga06r32_1449_c1 nmdc:mga06r32_1449_c1_15704_16246 177
1349 3300050511 nmdc:mga08y16_13690_c1 nmdc:mga08y16_13690_c1_6517_7059 177
1350 3300053077 Ga0495601_0018022 Ga0495601_0018022_2387_2926 177
1351 3300053084 Ga0495595_0053465 Ga0495595_0053465_147_686 177
1352 3300053085 Ga0495619_0038922 Ga0495619_0038922_400_939 177
1353 3300053088 Ga0500644_0000531 Ga0500644_0000531_8890_9471 177
1354 3300002155 JGI24033J26618_1000845 JGI24033J26618_10008452 178
1355 3300048905 Ga0496102_0000729 Ga0496102_0000729_31568_32206 178
1356 3300048918 Ga0496115_0100140 Ga0496115_0100140_1688_2326 178
1357 2162886007 SwRhRL2b_contig_99721 SwRhRL2b_0530.00005650 179
1358 2209111006 2214772973 2213792741 179
1359 3300000042 ARSoilYngRDRAFT_c00546 ARSoilYngRDRAFT_005462 179
1360 3300000043 ARcpr5yngRDRAFT_c000768 ARcpr5yngRDRAFT_0007682 179
1361 3300000043 ARcpr5yngRDRAFT_c000953 ARcpr5yngRDRAFT_0009534 179
1362 3300000044 ARSoilOldRDRAFT_c000548 ARSoilOldRDRAFT_0005482 179
1363 3300000652 ARCol0yngRDRAFT_1000173 ARCol0yngRDRAFT_10001736 179
1364 3300000652 ARCol0yngRDRAFT_1000586 ARCol0yngRDRAFT_10005862 179
1365 3300001990 JGI24737J22298_10002941 JGI24737J22298_100029413 179
1366 3300002459 JGI24751J29686_10024523 JGI24751J29686_100245232 179
1367 3300005276 Ga0065717_1002521 Ga0065717_10025213 179
1368 3300005277 Ga0065716_1003161 Ga0065716_10031612 179
1369 3300005289 Ga0065704_10089333 Ga0065704_100893334 179
1370 3300005290 Ga0065712_10028520 Ga0065712_100285203 179
1371 3300005293 Ga0065715_10001277 Ga0065715_100012772 179
1372 3300005295 Ga0065707_10114580 Ga0065707_101145803 179
1373 3300005328 Ga0070676_10714330 Ga0070676_107143301 179
1374 3300005330 Ga0070690_100024004 Ga0070690_1000240044 179
1375 3300005331 Ga0070670_100212700 Ga0070670_1002127002 179
1376 3300005335 Ga0070666_10309104 Ga0070666_103091042 179
1377 3300005336 Ga0070680_100089806 Ga0070680_1000898063 179
1378 3300005341 Ga0070691_10044288 Ga0070691_100442883 179
1379 3300005345 Ga0070692_10007543 Ga0070692_100075434 179
1380 3300005347 Ga0070668_100057388 Ga0070668_1000573883 179
1381 3300005353 Ga0070669_100060875 Ga0070669_1000608753 179
1382 3300005354 Ga0070675_100074917 Ga0070675_1000749174 179
1383 3300005356 Ga0070674_100612749 Ga0070674_1006127491 179
1384 3300005367 Ga0070667_100256159 Ga0070667_1002561592 179
1385 3300005406 Ga0070703_10110662 Ga0070703_101106622 179
1386 3300005434 Ga0070709_10132577 Ga0070709_101325772 179
1387 3300005438 Ga0070701_10024994 Ga0070701_100249944 179
1388 3300005439 Ga0070711_100261613 Ga0070711_1002616132 179
1389 3300005440 Ga0070705_100216758 Ga0070705_1002167583 179
1390 3300005441 Ga0070700_100322470 Ga0070700_1003224702 179
1391 3300005445 Ga0070708_100229454 Ga0070708_1002294542 179
1392 3300005455 Ga0070663_100041474 Ga0070663_1000414743 179
1393 3300005456 Ga0070678_100300403 Ga0070678_1003004032 179
1394 3300005457 Ga0070662_100061679 Ga0070662_1000616793 179
1395 3300005457 Ga0070662_100217336 Ga0070662_1002173362 179
1396 3300005459 Ga0068867_100568277 Ga0068867_1005682772 179
1397 3300005471 Ga0070698_100987169 Ga0070698_1009871692 179
1398 3300005535 Ga0070684_100303966 Ga0070684_1003039662 179
1399 3300005539 Ga0068853_100321348 Ga0068853_1003213483 179
1400 3300005544 Ga0070686_100031720 Ga0070686_1000317202 179
1401 3300005545 Ga0070695_100302605 Ga0070695_1003026053 179
1402 3300005546 Ga0070696_100054595 Ga0070696_1000545955 179
1403 3300005547 Ga0070693_100035002 Ga0070693_1000350022 179
1404 3300005577 Ga0068857_100152834 Ga0068857_1001528343 179
1405 3300005578 Ga0068854_100215612 Ga0068854_1002156123 179
1406 3300005617 Ga0068859_100138390 Ga0068859_1001383903 179
1407 3300005840 Ga0068870_10253793 Ga0068870_102537932 179
1408 3300005842 Ga0068858_100037757 Ga0068858_1000377578 179
1409 3300005843 Ga0068860_100016941 Ga0068860_1000169414 179
1410 3300005937 Ga0081455_10020366 Ga0081455_100203664 179
1411 3300006058 Ga0075432_10012796 Ga0075432_100127962 179
1412 3300006852 Ga0075433_10042296 Ga0075433_100422962 179
1413 3300006871 Ga0075434_100110126 Ga0075434_1001101263 179
1414 3300006931 Ga0097620_100138394 Ga0097620_1001383943 179
1415 3300009094 Ga0111539_10012295 Ga0111539_100122955 179
1416 3300009148 Ga0105243_10045733 Ga0105243_100457334 179
1417 3300009176 Ga0105242_10092287 Ga0105242_100922874 179
1418 3300009177 Ga0105248_10238787 Ga0105248_102387873 179
1419 3300009545 Ga0105237_10043927 Ga0105237_100439273 179
1420 3300010375 Ga0105239_10035136 Ga0105239_100351365 179
1421 3300011119 Ga0105246_10067085 Ga0105246_100670853 179
1422 3300012478 Ga0157328_1000980 Ga0157328_10009802 179
1423 3300012507 Ga0157342_1002859 Ga0157342_10028592 179
1424 3300013102 Ga0157371_10172267 Ga0157371_101722674 179
1425 3300013297 Ga0157378_10947998 Ga0157378_109479981 179
1426 3300013306 Ga0163162_10007555 Ga0163162_1000755513 179
1427 3300013307 Ga0157372_10368308 Ga0157372_103683082 179
1428 3300014325 Ga0163163_10463493 Ga0163163_104634932 179
1429 3300014968 Ga0157379_10080253 Ga0157379_100802533 179
1430 3300025271 Ga0207666_1001220 Ga0207666_10012204 179
1431 3300025315 Ga0207697_10029415 Ga0207697_100294153 179
1432 3300025901 Ga0207688_10044743 Ga0207688_100447434 179
1433 3300025903 Ga0207680_10099999 Ga0207680_100999993 179
1434 3300025904 Ga0207647_10003322 Ga0207647_1000332210 179
1435 3300025907 Ga0207645_10063226 Ga0207645_100632263 179
1436 3300025912 Ga0207707_10160380 Ga0207707_101603803 179
1437 3300025915 Ga0207693_10313872 Ga0207693_103138721 179
1438 3300025918 Ga0207662_10019216 Ga0207662_100192162 179
1439 3300025919 Ga0207657_10033148 Ga0207657_100331485 179
1440 3300025923 Ga0207681_10471060 Ga0207681_104710602 179
1441 3300025925 Ga0207650_10177751 Ga0207650_101777512 179
1442 3300025926 Ga0207659_10111117 Ga0207659_101111171 179
1443 3300025932 Ga0207690_10155497 Ga0207690_101554973 179
1444 3300025933 Ga0207706_10006317 Ga0207706_100063174 179
1445 3300025936 Ga0207670_10056417 Ga0207670_100564174 179
1446 3300025938 Ga0207704_10169875 Ga0207704_101698753 179
1447 3300025940 Ga0207691_10009787 Ga0207691_100097874 179
1448 3300025960 Ga0207651_10273682 Ga0207651_102736822 179
1449 3300025972 Ga0207668_10024716 Ga0207668_100247164 179
1450 3300026035 Ga0207703_10096833 Ga0207703_100968333 179
1451 3300026067 Ga0207678_10061333 Ga0207678_100613333 179
1452 3300026075 Ga0207708_10088911 Ga0207708_100889114 179
1453 3300026089 Ga0207648_10050414 Ga0207648_100504142 179
1454 3300026116 Ga0207674_10083576 Ga0207674_100835764 179
1455 3300026118 Ga0207675_100056416 Ga0207675_1000564164 179
1456 3300026121 Ga0207683_10359865 Ga0207683_103598652 179
1457 3300027526 Ga0209968_1016505 Ga0209968_10165053 179
1458 3300027682 Ga0209971_1008566 Ga0209971_10085662 179
1459 3300027695 Ga0209966_1000561 Ga0209966_10005614 179
1460 3300027717 Ga0209998_10000337 Ga0209998_1000033710 179
1461 3300027907 Ga0207428_10000617 Ga0207428_1000061719 179
1462 3300028380 Ga0268265_10117116 Ga0268265_101171164 179
1463 3300028381 Ga0268264_10192887 Ga0268264_101928872 179
1464 3300031595 Ga0265313_10089728 Ga0265313_100897282 179
1465 3300034816 Ga0373930_0000783 Ga0373930_0000783_2033_2572 179
1466 3300034817 Ga0373948_0000589 Ga0373948_0000589_1629_2168 179
1467 3300034819 Ga0373958_0000380 Ga0373958_0000380_1306_1845 179
1468 3300034820 Ga0373959_0001298 Ga0373959_0001298_2874_3413 179
1469 3300034957 Ga0373938_0025044 Ga0373938_0025044_125_664 179
1470 3300035084 Ga0373928_0000205 Ga0373928_0000205_1363_1902 179
1471 3300035085 Ga0373929_0005397 Ga0373929_0005397_617_1156 179
1472 3300035088 Ga0373940_0001074 Ga0373940_0001074_3713_4252 179
1473 3300035090 Ga0373949_0001679 Ga0373949_0001679_5515_6126 179
1474 3300035091 Ga0373951_0002622 Ga0373951_0002622_3368_3907 179
1475 3300035112 Ga0373932_0000746 Ga0373932_0000746_3664_4203 179
1476 3300035114 Ga0373939_0242229 Ga0373939_0242229_44_655 179
1477 3300035115 Ga0373941_0000313 Ga0373941_0000313_8520_9059 179
1478 3300035121 Ga0373960_0001070 Ga0373960_0001070_19_558 179
1479 3300035207 Ga0373942_0000880 Ga0373942_0000880_3035_3574 179
1480 3300035241 Ga0373961_0002053 Ga0373961_0002053_3918_4457 179
1481 3300035242 Ga0373962_0001576 Ga0373962_0001576_2304_2843 179
1482 3300035691 Ga0373931_0157759 Ga0373931_0157759_93_704 179
1483 3300038996 Ga0242420_003132 Ga0242420_003132_28_567 179
1484 3300045051 Ga0451576_0046866 Ga0451576_0046866_2737_3276 179
1485 3300046476 Ga0495662_0320630 Ga0495662_0320630_96_686 179
1486 3300048905 Ga0496102_0130656 Ga0496102_0130656_630_1169 179
1487 3300048906 Ga0496103_0133778 Ga0496103_0133778_892_1431 179
1488 3300048909 Ga0496106_0018636 Ga0496106_0018636_494_1033 179
1489 3300048910 Ga0496107_0115073 Ga0496107_0115073_742_1281 179
1490 3300048912 Ga0496109_0257302 Ga0496109_0257302_869_1408 179
1491 3300048913 Ga0496110_0214205 Ga0496110_0214205_504_1043 179
1492 3300048914 Ga0496111_0177688 Ga0496111_0177688_877_1416 179
1493 3300048916 Ga0496113_0210480 Ga0496113_0210480_255_794 179
1494 3300049570 Ga0501033_0000322 Ga0501033_0000322_19544_20095 179
1495 3300049572 Ga0501036_0000083 Ga0501036_0000083_29428_29979 179
1496 3300049573 Ga0501037_0081194 Ga0501037_0081194_1074_1625 179
1497 3300049575 Ga0501039_0138112 Ga0501039_0138112_683_1234 179
1498 3300049579 Ga0501043_0000466 Ga0501043_0000466_19544_20095 179
1499 3300049581 Ga0501047_0001360 Ga0501047_0001360_22826_23377 179
1500 3300049582 Ga0501048_0233337 Ga0501048_0233337_600_1151 179
1501 3300049742 Ga0501080_0120728 Ga0501080_0120728_704_1255 179
1502 3300049822 Ga0501035_0000277 Ga0501035_0000277_19544_20095 179
1503 3300050511 nmdc:mga08y16_21947_c1 nmdc:mga08y16_21947_c1_3293_3832 179
1504 3300050512 nmdc:mga0n895_133889_c1 nmdc:mga0n895_133889_c1_984_1523 179
1505 3300050515 nmdc:mga0a205_64448_c1 nmdc:mga0a205_64448_c1_425_964 179
1506 3300053094 Ga0500566_0104727 Ga0500566_0104727_159_770 179
1507 3300053730 Ga0500645_000143 Ga0500645_000143_44766_45359 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

46

179

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9561 9 148
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9513 9 147
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.942 9 148
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9229 9 147
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9183 9 148
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8862 10 146 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8668 11 147 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8617 11 146 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.85 10 146 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8311 11 147 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A353V0L3-F1-model_v4 deleted 0.9971 10 168
AF-A0A6G6WN77-F1-model_v4 Arsenate reductase ArsC 0.9967 9 167 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1X6ZFU8-F1-model_v4 Protein ArsC (EC 3.1.3.48) 0.9964 8 167 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A9D0N4-F1-model_v4 Protein-tyrosine-phosphatase 0.994 6 169 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A434U3P1-F1-model_v4 Arsenate reductase ArsC 0.9937 6 167 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
88.47 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map