F494346

General Info

Members Datasets Scaffolds Average Seq Length
1492 620 1380 131

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0005702|Ga0466965_0005702_2905_3354
Length 149
Sequence MPGAPPGNRDEEGHEPDMTMTDPIADMLTRLRNANSAHHDTVSMPSSKLKLHIAEILQAEGFIAGHKVEDARVGKTLTITLKYGPNRERALSGIRRVSKPGLRKYAKSTELPKVLGGLGVAILSTSSGLLTDRQAQAKGVGGEVLAYVW

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221549 Agromyces sp. Root1464 Isolate Unclassified
5 2643221553 Microbacterium sp. Root553 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
8 2643221572 Leifsonia sp. Root60 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221613 Oerskovia sp. Root22 Isolate Unclassified
11 2643221616 Leifsonia sp. Root227 Isolate Unclassified
12 2643221619 Agromyces sp. Root81 Isolate Unclassified
13 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
14 2643221630 Microbacterium sp. Root322 Isolate Unclassified
15 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
16 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
17 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
18 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
19 2643221721 Oerskovia sp. Root918 Isolate Unclassified
20 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
21 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
22 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
23 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
24 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
25 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
26 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
27 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
28 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
29 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
30 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
31 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
32 2773857759 Microbacterium sp. 1294 Isolate Unclassified
33 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
34 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
35 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
36 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
37 2808606372 Agromyces sp. 23-23 Isolate Unclassified
38 2808606394 Promicromonospora sp. C35 Isolate Unclassified
39 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
40 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
41 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
42 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
43 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
44 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
45 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
46 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
47 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
48 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
49 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
50 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
51 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
52 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
53 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
54 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
55 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
56 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
57 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
58 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
59 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
60 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
61 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
62 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
63 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
64 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
65 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
66 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
67 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
68 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
69 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
70 2919069694 Microbacterium sp. 1154 Isolate Unclassified
71 2919395869 Microbacterium resistens 2980 Isolate Unclassified
72 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
73 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
74 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
75 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
76 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
77 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
78 2928153084 Leifsonia sp. 563 Isolate Unclassified
79 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
80 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
81 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
82 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
83 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
84 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
85 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
86 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
87 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
88 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
89 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
90 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
91 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
92 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
93 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
94 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
95 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
96 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
97 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
98 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
99 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
100 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
101 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
102 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
103 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
104 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
105 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
106 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
107 3300003284 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_16 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
108 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
109 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
110 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
111 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
112 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
113 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
114 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
115 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
116 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
117 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
118 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
119 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
120 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
121 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
122 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
125 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
126 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
127 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
128 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
129 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
130 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
131 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
132 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
133 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
134 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
135 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
136 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
137 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
138 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
141 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
142 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
143 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
146 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
147 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
148 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
149 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
150 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
153 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
154 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
155 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
156 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
159 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
160 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
161 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
162 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
163 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
164 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
165 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
166 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
167 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
168 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
169 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
170 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
171 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
172 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
173 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
174 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
175 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
176 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
177 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
178 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
179 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
180 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
181 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
183 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
184 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
185 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
186 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
187 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
188 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
199 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
202 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
203 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
204 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
205 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
206 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
207 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
208 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
210 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
211 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
212 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
213 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
214 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
220 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
221 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
222 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
223 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
224 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
225 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
229 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
233 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
234 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
235 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
236 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
241 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
243 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
246 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
296 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
298 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
302 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
303 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
304 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
305 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
306 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
307 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
308 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
309 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
310 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
311 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
312 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
313 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
314 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
315 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
316 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
317 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
318 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
319 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
320 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
321 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
322 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
323 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
324 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
325 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
327 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
328 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
329 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
332 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
333 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
334 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
337 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
338 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
339 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
340 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
341 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
342 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
343 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
344 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
345 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
346 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
347 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
348 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
349 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
350 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
351 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
352 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
353 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
354 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
355 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
356 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
357 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
358 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
359 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
360 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
361 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
362 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
363 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
364 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
365 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
366 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
367 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
368 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
369 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
370 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
371 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
372 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
373 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
374 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
375 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
376 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
377 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
378 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
379 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
380 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
381 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
382 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
383 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
384 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
385 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
386 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
387 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
388 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
389 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
390 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
391 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
392 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
393 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
394 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
395 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
396 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
397 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
398 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
399 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
400 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
401 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
402 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
403 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
404 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
405 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
406 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
407 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
408 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
409 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
410 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
411 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
412 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
413 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
414 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
415 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
416 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
417 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
418 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
419 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
420 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
421 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
422 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
423 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
424 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
425 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
426 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
427 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
428 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
429 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
430 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
431 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
432 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
433 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
437 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
438 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
439 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
440 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
441 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
442 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
443 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
444 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
445 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
446 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
447 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
448 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
449 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
450 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
451 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
452 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
453 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
454 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
455 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
456 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
457 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
458 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
459 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
460 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
461 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
462 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
463 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
464 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
465 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
466 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
467 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
468 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
469 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
470 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
471 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
472 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
473 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
474 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
475 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
518 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
519 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
520 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
521 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
522 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
523 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
524 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
525 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
526 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
527 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
528 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
529 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
530 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
531 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
532 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
533 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
536 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
537 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
538 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
539 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
540 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
541 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
542 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
543 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
544 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
545 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
546 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
547 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
548 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
549 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
550 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
551 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
552 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
553 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
554 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
598 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
604 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
605 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
606 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
607 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
608 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
609 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
610 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
611 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
612 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
613 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
614 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
615 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
616 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
617 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
618 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
619 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
620 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.13
Metatranscriptomes 18.36
Isolates 7.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 4.56
Nodule 0
Rhizoplane 8.45
Rhizosphere 73.32
Stem 0
Stem Tuber 0.07
Unclassified 13.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1022643 3300001915 Bacteria 974
2 JGI24747J21853_1032885 3300001978 Bacteria 597
3 JGI24740J21852_10000460 3300001979 Bacteria 17440
4 JGI24740J21852_10016332 3300001979 Bacteria 2684
5 JGI24739J22299_10020519 3300001989 Bacteria 2360
6 JGI24739J22299_10024956 3300001989 Bacteria 2104
7 JGI24739J22299_10037100 3300001989 Bacteria 1643
8 JGI24735J21928_10006549 3300002067 Bacteria 3829
9 JGI24735J21928_10008244 3300002067 Bacteria 3377
10 JGI24735J21928_10076169 3300002067 Bacteria 961
11 JGI25154J39366_1001910 3300002738 Bacteria 6286
12 Ga0006779J45831_103484 3300003160 Bacteria 1532
13 Ga0006778J45830_1059030 3300003162 Bacteria 981
14 JGI25165J46597_1000061 3300003214 Bacteria 208362
15 Ga0006773J48901_13709 3300003284 Bacteria 904
16 Ga0007423J48922_100034 3300003285 Bacteria 2942
17 Ga0006770J48903_1038806 3300003305 Bacteria 930
18 Ga0007427J51700_104765 3300003559 Bacteria 2935
19 Ga0006554J51385_1034793 3300003567 Bacteria 1084
20 Ga0006781J51513_1008175 3300003568 Bacteria 2959
21 Ga0007410J51695_1083441 3300003574 Bacteria 1237
22 Ga0006562J51391_1016567 3300003578 Bacteria 6410
23 Ga0006562J51391_1016574 3300003578 Bacteria 3020
24 Ga0006780_1007001 3300003735 Bacteria 4772
25 Ga0055539_1016041 3300003752 Bacteria 909
26 Ga0055533_1000001 3300003756 Bacteria 1863437
27 Ga0055527_1000017 3300003760 Bacteria 242362
28 Ga0055542_1000044 3300003762 Bacteria 206982
29 Ga0055529_1000279 3300003763 Bacteria 60946
30 Ga0055529_1016596 3300003763 Bacteria 926
31 Ga0055541_1000889 3300003841 Bacteria 7205
32 Ga0058861_11949457 3300004800 Bacteria 1130
33 Ga0065714_10067377 3300005288 Bacteria 5585
34 Ga0070658_10034660 3300005327 Bacteria 4061
35 Ga0070658_10122166 3300005327 Bacteria 2164
36 Ga0070658_10363008 3300005327 Bacteria 1241
37 Ga0070658_10705701 3300005327 Bacteria 876
38 Ga0070683_100097167 3300005329 Bacteria 2770
39 Ga0070683_100186250 3300005329 Bacteria 1970
40 Ga0070670_100092850 3300005331 Bacteria 2595
41 Ga0070670_100475220 3300005331 Bacteria 1110
42 Ga0070682_100071596 3300005337 Bacteria 2219
43 Ga0070682_100086115 3300005337 Bacteria 2045
44 Ga0070682_100108095 3300005337 Bacteria 1849
45 Ga0070682_100190820 3300005337 Bacteria 1438
46 Ga0070682_100343921 3300005337 Bacteria 1110
47 Ga0070682_101152976 3300005337 Bacteria 652
48 Ga0068868_100427436 3300005338 Bacteria 1148
49 Ga0070660_100689724 3300005339 Bacteria 856
50 Ga0070660_100804503 3300005339 Bacteria 791
51 Ga0070689_101211672 3300005340 Bacteria 678
52 Ga0070687_100073840 3300005343 Bacteria 1840
53 Ga0070687_101170186 3300005343 Bacteria 566
54 Ga0070692_10288979 3300005345 Bacteria 997
55 Ga0070692_10453038 3300005345 Bacteria 822
56 Ga0070668_100021493 3300005347 Bacteria 4875
57 Ga0070668_100107864 3300005347 Bacteria 2214
58 Ga0070668_100182623 3300005347 Bacteria 1714
59 Ga0070668_100693306 3300005347 Bacteria 898
60 Ga0070669_100462463 3300005353 Bacteria 1047
61 Ga0070675_100729324 3300005354 Bacteria 904
62 Ga0070671_101172590 3300005355 Bacteria 676
63 Ga0070674_100503008 3300005356 Bacteria 1009
64 Ga0070673_102360212 3300005364 Bacteria 506
65 Ga0070659_100111399 3300005366 Bacteria 2210
66 Ga0070659_100640384 3300005366 Bacteria 916
67 Ga0070659_101193347 3300005366 Bacteria 673
68 Ga0070667_100078188 3300005367 Bacteria 2826
69 Ga0070667_100141430 3300005367 Bacteria 2108
70 Ga0070705_100008713 3300005440 Bacteria 5023
71 Ga0070700_100129553 3300005441 Bacteria 1701
72 Ga0070700_100679643 3300005441 Bacteria 816
73 Ga0070700_100845956 3300005441 Bacteria 740
74 Ga0070708_100023805 3300005445 Bacteria 5211
75 Ga0070708_100025652 3300005445 Bacteria 5041
76 Ga0070663_100094024 3300005455 Bacteria 2225
77 Ga0070663_100517071 3300005455 Bacteria 993
78 Ga0070663_100586580 3300005455 Bacteria 936
79 Ga0070663_100679118 3300005455 Bacteria 873
80 Ga0070663_100725569 3300005455 Bacteria 847
81 Ga0070678_100077225 3300005456 Bacteria 2511
82 Ga0070678_100341599 3300005456 Bacteria 1285
83 Ga0070678_100346748 3300005456 Bacteria 1275
84 Ga0070678_100611851 3300005456 Bacteria 974
85 Ga0070678_100667822 3300005456 Bacteria 934
86 Ga0070678_101700126 3300005456 Bacteria 594
87 Ga0070662_100739347 3300005457 Bacteria 834
88 Ga0070681_10708312 3300005458 Bacteria 923
89 Ga0068867_101001609 3300005459 Bacteria 758
90 Ga0068867_101303255 3300005459 Bacteria 670
91 Ga0070685_11068274 3300005466 Bacteria 609
92 Ga0070685_11485567 3300005466 Bacteria 522
93 Ga0070707_100001472 3300005468 Bacteria 23074
94 Ga0070707_100365585 3300005468 Bacteria 1401
95 Ga0070679_100429772 3300005530 Bacteria 1266
96 Ga0070679_100459000 3300005530 Bacteria 1218
97 Ga0070684_100296354 3300005535 Bacteria 1483
98 Ga0068853_100470502 3300005539 Bacteria 1184
99 Ga0070686_101379806 3300005544 Bacteria 591
100 Ga0070696_100383610 3300005546 Bacteria 1096
101 Ga0070693_100025993 3300005547 Bacteria 3156
102 Ga0070665_100266394 3300005548 Bacteria 1715
103 Ga0070665_100338661 3300005548 Bacteria 1509
104 Ga0070665_100537694 3300005548 Bacteria 1180
105 Ga0070665_101281850 3300005548 Bacteria 743
106 Ga0070665_101413489 3300005548 Bacteria 705
107 Ga0068855_100128220 3300005563 Bacteria 2899
108 Ga0068855_102152786 3300005563 Bacteria 561
109 Ga0070664_101251127 3300005564 Bacteria 701
110 Ga0068857_100703026 3300005577 Bacteria 960
111 Ga0068857_100876349 3300005577 Bacteria 860
112 Ga0068856_100074941 3300005614 Bacteria 3351
113 Ga0068856_100372589 3300005614 Bacteria 1447
114 Ga0070702_100001851 3300005615 Bacteria 8827
115 Ga0070702_100233423 3300005615 Bacteria 1237
116 Ga0068852_100321047 3300005616 Bacteria 1504
117 Ga0068852_101215322 3300005616 Bacteria 775
118 Ga0068864_100533450 3300005618 Bacteria 1133
119 Ga0068866_10051130 3300005718 Bacteria 2102
120 Ga0068866_10267182 3300005718 Bacteria 1054
121 Ga0068866_10333666 3300005718 Bacteria 958
122 Ga0068861_100260323 3300005719 Bacteria 1485
123 Ga0068870_10019739 3300005840 Bacteria 3273
124 Ga0068870_10139115 3300005840 Bacteria 1419
125 Ga0068870_10262816 3300005840 Bacteria 1075
126 Ga0068863_100788022 3300005841 Bacteria 948
127 Ga0068858_101842406 3300005842 Bacteria 598
128 Ga0068860_100599304 3300005843 Bacteria 1107
129 Ga0068860_100765678 3300005843 Bacteria 978
130 Ga0068862_100094567 3300005844 Bacteria 2607
131 Ga0081455_10001192 3300005937 Bacteria 32566
132 Ga0070717_11160806 3300006028 Bacteria 703
133 Ga0075365_10029877 3300006038 Bacteria 3486
134 Ga0075368_10016248 3300006042 Bacteria 2774
135 Ga0075368_10352335 3300006042 Bacteria 641
136 Ga0075363_100050849 3300006048 Bacteria 2208
137 Ga0075364_10021121 3300006051 Bacteria 4100
138 Ga0075364_10027461 3300006051 Bacteria 3636
139 Ga0075364_10077143 3300006051 Bacteria 2199
140 Ga0075364_10135812 3300006051 Bacteria 1652
141 Ga0075364_10172148 3300006051 Bacteria 1464
142 Ga0075367_10009009 3300006178 Bacteria 5197
143 Ga0075367_10649143 3300006178 Bacteria 671
144 Ga0075369_10057201 3300006186 Bacteria 1696
145 Ga0075369_10347398 3300006186 Bacteria 696
146 Ga0075369_10406876 3300006186 Bacteria 642
147 Ga0075366_10045808 3300006195 Bacteria 2591
148 Ga0075366_10145844 3300006195 Bacteria 1432
149 Ga0097621_100580692 3300006237 Bacteria 1023
150 Ga0097621_101417960 3300006237 Bacteria 658
151 Ga0075370_10015347 3300006353 Bacteria 4099
152 Ga0075370_10077989 3300006353 Bacteria 1901
153 Ga0075370_10096038 3300006353 Bacteria 1712
154 Ga0075370_10346039 3300006353 Bacteria 888
155 Ga0075370_10598296 3300006353 Bacteria 668
156 Ga0068871_100523076 3300006358 Bacteria 1071
157 Ga0075428_100368871 3300006844 Bacteria 1540
158 Ga0075430_100297500 3300006846 Bacteria 1335
159 Ga0068865_100311213 3300006881 Bacteria 1264
160 Ga0105251_10195452 3300009011 Bacteria 911
161 Ga0105244_10004765 3300009036 Bacteria 9234
162 Ga0105244_10036504 3300009036 Bacteria 2574
163 Ga0105244_10147938 3300009036 Bacteria 1126
164 Ga0105244_10158798 3300009036 Bacteria 1080
165 Ga0105244_10278017 3300009036 Bacteria 777
166 Ga0105244_10290233 3300009036 Bacteria 758
167 Ga0105240_10356254 3300009093 Bacteria 1659
168 Ga0111539_10467874 3300009094 Bacteria 1468
169 Ga0111539_11004908 3300009094 Bacteria 970
170 Ga0105245_10165196 3300009098 Bacteria 2104
171 Ga0105245_10168828 3300009098 Bacteria 2082
172 Ga0105245_10279579 3300009098 Bacteria 1631
173 Ga0105245_10641006 3300009098 Bacteria 1092
174 Ga0105247_11068914 3300009101 Bacteria 635
175 Ga0105247_11202537 3300009101 Bacteria 603
176 Ga0105243_10044746 3300009148 Bacteria 3475
177 Ga0105243_10071898 3300009148 Bacteria 2798
178 Ga0105243_10097933 3300009148 Bacteria 2428
179 Ga0105243_10236531 3300009148 Bacteria 1623
180 Ga0105243_10375421 3300009148 Bacteria 1313
181 Ga0105243_10569588 3300009148 Bacteria 1085
182 Ga0105243_10725983 3300009148 Bacteria 971
183 Ga0105243_11938504 3300009148 Bacteria 622
184 Ga0105241_10152358 3300009174 Bacteria 1892
185 Ga0105241_10822900 3300009174 Bacteria 857
186 Ga0105242_10109566 3300009176 Bacteria 2351
187 Ga0105242_10189584 3300009176 Bacteria 1819
188 Ga0105242_10611042 3300009176 Bacteria 1054
189 Ga0105248_10715877 3300009177 Bacteria 1129
190 Ga0105237_10111613 3300009545 Bacteria 2726
191 Ga0105237_10419017 3300009545 Bacteria 1344
192 Ga0105237_11133241 3300009545 Bacteria 789
193 Ga0105237_11353180 3300009545 Bacteria 718
194 Ga0105238_10221731 3300009551 Bacteria 1867
195 Ga0105238_10303840 3300009551 Bacteria 1579
196 Ga0105238_11970814 3300009551 Bacteria 617
197 Ga0105249_10022697 3300009553 Bacteria 5623
198 Ga0105249_10121487 3300009553 Bacteria 2482
199 Ga0105249_10192852 3300009553 Bacteria 1989
200 Ga0105249_10976454 3300009553 Bacteria 915
201 Ga0105249_11644677 3300009553 Bacteria 715
202 Ga0105239_10305437 3300010375 Bacteria 1792
203 Ga0105239_11090066 3300010375 Bacteria 919
204 Ga0105246_10170900 3300011119 Bacteria 1665
205 Ga0105246_10258150 3300011119 Bacteria 1387
206 Ga0105246_10700586 3300011119 Bacteria 888
207 Ga0105246_10809179 3300011119 Bacteria 832
208 Ga0157317_1001612 3300012475 Bacteria 1239
209 Ga0157328_1000183 3300012478 Bacteria 2202
210 Ga0157329_1003604 3300012491 Bacteria 959
211 Ga0157329_1009143 3300012491 Bacteria 754
212 Ga0157313_1000883 3300012503 Bacteria 1491
213 Ga0157342_1038881 3300012507 Bacteria 629
214 Ga0157315_1000437 3300012508 Bacteria 1912
215 Ga0154019_134908 3300013044 Bacteria 860
216 Ga0157373_10797706 3300013100 Bacteria 696
217 Ga0157371_10023296 3300013102 Bacteria 4527
218 Ga0157371_10024138 3300013102 Bacteria 4442
219 Ga0157371_10173689 3300013102 Bacteria 1540
220 Ga0157371_10683145 3300013102 Bacteria 768
221 Ga0157371_11457936 3300013102 Bacteria 533
222 Ga0157370_10004984 3300013104 Bacteria 15027
223 Ga0157370_10093580 3300013104 Bacteria 2820
224 Ga0157370_10138272 3300013104 Bacteria 2269
225 Ga0157370_10496725 3300013104 Bacteria 1121
226 Ga0157369_10002930 3300013105 Bacteria 20411
227 Ga0157369_10084273 3300013105 Bacteria 3398
228 Ga0157369_10102675 3300013105 Bacteria 3046
229 Ga0157369_10235938 3300013105 Bacteria 1911
230 Ga0157369_10501405 3300013105 Bacteria 1256
231 Ga0157369_10622322 3300013105 Bacteria 1114
232 Ga0157369_10691367 3300013105 Bacteria 1051
233 Ga0157369_10960743 3300013105 Bacteria 875
234 Ga0171462_1001 3300013250 Bacteria 1135406
235 Ga0157378_10010737 3300013297 Bacteria 8006
236 Ga0157378_11669706 3300013297 Bacteria 684
237 Ga0163162_10071207 3300013306 Bacteria 3529
238 Ga0163162_10138655 3300013306 Bacteria 2544
239 Ga0163162_10172245 3300013306 Bacteria 2289
240 Ga0163162_10211924 3300013306 Bacteria 2067
241 Ga0163162_10354781 3300013306 Bacteria 1599
242 Ga0163162_10392412 3300013306 Bacteria 1520
243 Ga0163162_10719486 3300013306 Bacteria 1119
244 Ga0157372_10080192 3300013307 Bacteria 3692
245 Ga0157372_10221913 3300013307 Bacteria 2191
246 Ga0157372_10227095 3300013307 Bacteria 2164
247 Ga0157372_10234514 3300013307 Bacteria 2128
248 Ga0157372_10477669 3300013307 Bacteria 1453
249 Ga0157372_12779129 3300013307 Bacteria 561
250 Ga0157375_10008009 3300013308 Bacteria 9253
251 Ga0157375_10404844 3300013308 Bacteria 1531
252 Ga0157375_10649888 3300013308 Bacteria 1211
253 Ga0157375_10995988 3300013308 Bacteria 978
254 Ga0157375_12102725 3300013308 Bacteria 672
255 Ga0157375_13649035 3300013308 Bacteria 512
256 Ga0163163_10735395 3300014325 Bacteria 1050
257 Ga0157380_10036717 3300014326 Bacteria 3793
258 Ga0157380_10080206 3300014326 Bacteria 2667
259 Ga0157380_10216315 3300014326 Bacteria 1711
260 Ga0157380_10408751 3300014326 Bacteria 1290
261 Ga0157380_10821373 3300014326 Bacteria 948
262 Ga0157380_13166659 3300014326 Bacteria 525
263 Ga0182008_10082236 3300014497 Bacteria 1585
264 Ga0157377_10071436 3300014745 Bacteria 2007
265 Ga0157379_10873402 3300014968 Bacteria 852
266 Ga0157379_11889702 3300014968 Bacteria 588
267 Ga0157376_11447027 3300014969 Bacteria 719
268 Ga0163161_10050902 3300017792 Bacteria 2999
269 Ga0163161_10058703 3300017792 Bacteria 2796
270 Ga0163161_10076665 3300017792 Bacteria 2454
271 Ga0163161_10131187 3300017792 Bacteria 1890
272 Ga0163161_10204196 3300017792 Bacteria 1524
273 Ga0197907_10062010 3300020069 Bacteria 2097
274 Ga0197907_10308043 3300020069 Bacteria 3109
275 Ga0197907_10310388 3300020069 Bacteria 530
276 Ga0197907_11084650 3300020069 Bacteria 1570
277 Ga0197907_11198837 3300020069 Bacteria 2282
278 Ga0206356_10227615 3300020070 Bacteria 3960
279 Ga0206356_10876277 3300020070 Bacteria 1117
280 Ga0206349_1087569 3300020075 Bacteria 2204
281 Ga0206349_1307013 3300020075 Bacteria 804
282 Ga0206355_1076572 3300020076 Bacteria 1680
283 Ga0206355_1109217 3300020076 Bacteria 3159
284 Ga0206355_1201553 3300020076 Bacteria 1738
285 Ga0206355_1429317 3300020076 Bacteria 888
286 Ga0206355_1696798 3300020076 Bacteria 1461
287 Ga0206351_10684251 3300020077 Bacteria 594
288 Ga0206351_10726105 3300020077 Bacteria 1245
289 Ga0206351_10855438 3300020077 Bacteria 1466
290 Ga0206352_10051993 3300020078 Bacteria 1909
291 Ga0206352_10228094 3300020078 Bacteria 2898
292 Ga0206350_10274734 3300020080 Bacteria 1298
293 Ga0206350_10516798 3300020080 Bacteria 1905
294 Ga0206350_10985270 3300020080 Bacteria 3252
295 Ga0206350_11047778 3300020080 Bacteria 2012
296 Ga0206354_10548741 3300020081 Bacteria 7392
297 Ga0206354_10731429 3300020081 Bacteria 1964
298 Ga0206354_11455383 3300020081 Bacteria 1594
299 Ga0206353_10735845 3300020082 Bacteria 847
300 Ga0206353_11781331 3300020082 Bacteria 871
301 Ga0224712_10032350 3300022467 Bacteria 1905
302 Ga0224712_10069227 3300022467 Bacteria 1428
303 Ga0224712_10254296 3300022467 Bacteria 812
304 Ga0256744_106767 3300023309 Bacteria 601
305 Ga0209566_100066 3300025225 Bacteria 186951
306 Ga0209674_100001 3300025226 Bacteria 4013750
307 Ga0209672_100039 3300025228 Bacteria 283064
308 Ga0209563_100001 3300025230 Bacteria 4013775
309 Ga0207427_100042 3300025231 Bacteria 254170
310 Ga0209258_102672 3300025242 Bacteria 4394
311 Ga0209646_1000013 3300025246 Bacteria 565830
312 Ga0209646_1000014 3300025246 Bacteria 550484
313 Ga0209677_100001 3300025253 Bacteria 4013787
314 Ga0209148_1000004 3300025254 Bacteria 1844481
315 Ga0209233_1000001 3300025261 Bacteria 2992747
316 Ga0209455_1000117 3300025272 Bacteria 176940
317 Ga0209455_1009604 3300025272 Bacteria 2526
318 Ga0207655_1000386 3300025728 Bacteria 61740
319 Ga0207682_10009968 3300025893 Bacteria 3732
320 Ga0207642_10080673 3300025899 Bacteria 1579
321 Ga0207710_10389211 3300025900 Bacteria 714
322 Ga0207688_10235741 3300025901 Bacteria 1106
323 Ga0207688_10237116 3300025901 Bacteria 1102
324 Ga0207688_10540840 3300025901 Bacteria 732
325 Ga0207688_11004355 3300025901 Bacteria 527
326 Ga0207647_10033365 3300025904 Bacteria 3296
327 Ga0207647_10090900 3300025904 Bacteria 1820
328 Ga0207647_10139337 3300025904 Bacteria 1422
329 Ga0207647_10157012 3300025904 Bacteria 1328
330 Ga0207643_10024095 3300025908 Bacteria 3358
331 Ga0207643_10153512 3300025908 Bacteria 1382
332 Ga0207643_10160918 3300025908 Bacteria 1351
333 Ga0207643_10187141 3300025908 Bacteria 1255
334 Ga0207705_10000001 3300025909 Bacteria 2061880
335 Ga0207705_10062190 3300025909 Bacteria 2697
336 Ga0207705_10100818 3300025909 Bacteria 2124
337 Ga0207705_10221156 3300025909 Bacteria 1438
338 Ga0207705_10796736 3300025909 Bacteria 733
339 Ga0207654_10511051 3300025911 Bacteria 849
340 Ga0207671_10278854 3300025914 Bacteria 1318
341 Ga0207671_10399893 3300025914 Bacteria 1092
342 Ga0207671_10443025 3300025914 Bacteria 1034
343 Ga0207662_10066861 3300025918 Bacteria 2166
344 Ga0207652_11213675 3300025921 Bacteria 656
345 Ga0207646_10040913 3300025922 Bacteria 4167
346 Ga0207694_10686020 3300025924 Bacteria 864
347 Ga0207694_10754374 3300025924 Bacteria 821
348 Ga0207694_11210858 3300025924 Bacteria 639
349 Ga0207650_10344002 3300025925 Bacteria 1225
350 Ga0207659_10912513 3300025926 Bacteria 755
351 Ga0207659_11764418 3300025926 Bacteria 526
352 Ga0207687_10113053 3300025927 Bacteria 2019
353 Ga0207687_10176162 3300025927 Bacteria 1653
354 Ga0207664_10536996 3300025929 Bacteria 1049
355 Ga0207690_10356579 3300025932 Bacteria 1157
356 Ga0207690_10643393 3300025932 Bacteria 868
357 Ga0207706_10977040 3300025933 Bacteria 712
358 Ga0207686_10030825 3300025934 Bacteria 3180
359 Ga0207709_10013505 3300025935 Bacteria 4505
360 Ga0207709_10068641 3300025935 Bacteria 2241
361 Ga0207709_10224503 3300025935 Bacteria 1357
362 Ga0207709_10251021 3300025935 Bacteria 1292
363 Ga0207670_10600666 3300025936 Bacteria 903
364 Ga0207669_10062330 3300025937 Bacteria 2296
365 Ga0207669_10074422 3300025937 Bacteria 2148
366 Ga0207669_10156012 3300025937 Bacteria 1606
367 Ga0207704_10066080 3300025938 Bacteria 2268
368 Ga0207665_10256622 3300025939 Bacteria 1294
369 Ga0207665_10682858 3300025939 Bacteria 807
370 Ga0207691_10183912 3300025940 Bacteria 1825
371 Ga0207691_10414962 3300025940 Bacteria 1147
372 Ga0207711_11352916 3300025941 Bacteria 654
373 Ga0207689_10719463 3300025942 Bacteria 842
374 Ga0207661_10750984 3300025944 Bacteria 898
375 Ga0207661_10838677 3300025944 Bacteria 846
376 Ga0207667_10035600 3300025949 Bacteria 5340
377 Ga0207712_10183651 3300025961 Bacteria 1645
378 Ga0207712_10205800 3300025961 Bacteria 1564
379 Ga0207712_10259385 3300025961 Bacteria 1409
380 Ga0207668_10265855 3300025972 Bacteria 1400
381 Ga0207668_10268126 3300025972 Bacteria 1394
382 Ga0207668_10313931 3300025972 Bacteria 1298
383 Ga0207668_10785562 3300025972 Bacteria 842
384 Ga0207658_10048296 3300025986 Bacteria 3120
385 Ga0207658_10132805 3300025986 Bacteria 2003
386 Ga0207658_10249534 3300025986 Bacteria 1507
387 Ga0207658_11049665 3300025986 Bacteria 744
388 Ga0207677_10034485 3300026023 Bacteria 3277
389 Ga0207677_10351155 3300026023 Bacteria 1236
390 Ga0207677_10619768 3300026023 Bacteria 951
391 Ga0207703_10624626 3300026035 Bacteria 1020
392 Ga0207639_10135861 3300026041 Bacteria 2042
393 Ga0207639_10346873 3300026041 Bacteria 1325
394 Ga0207678_10101275 3300026067 Bacteria 2460
395 Ga0207678_10168701 3300026067 Bacteria 1869
396 Ga0207678_10186379 3300026067 Bacteria 1772
397 Ga0207678_10224251 3300026067 Bacteria 1609
398 Ga0207678_10244885 3300026067 Bacteria 1536
399 Ga0207678_10333745 3300026067 Bacteria 1306
400 Ga0207678_10699742 3300026067 Bacteria 892
401 Ga0207678_11197319 3300026067 Bacteria 673
402 Ga0207708_10386117 3300026075 Bacteria 1155
403 Ga0207708_10803938 3300026075 Bacteria 810
404 Ga0207708_10805618 3300026075 Bacteria 809
405 Ga0207702_10282130 3300026078 Bacteria 1571
406 Ga0207641_11084385 3300026088 Bacteria 799
407 Ga0207641_11285661 3300026088 Bacteria 732
408 Ga0207648_10203985 3300026089 Bacteria 1754
409 Ga0207676_10294275 3300026095 Bacteria 1480
410 Ga0207674_12179388 3300026116 Bacteria 517
411 Ga0207675_100127246 3300026118 Bacteria 2414
412 Ga0207675_100196139 3300026118 Bacteria 1938
413 Ga0207675_100227704 3300026118 Bacteria 1798
414 Ga0207683_10062314 3300026121 Bacteria 3284
415 Ga0207683_10125844 3300026121 Bacteria 2303
416 Ga0207683_10781348 3300026121 Bacteria 886
417 Ga0207683_11084084 3300026121 Bacteria 743
418 Ga0207683_11247654 3300026121 Bacteria 689
419 Ga0207698_10231830 3300026142 Bacteria 1677
420 Ga0207698_10553434 3300026142 Bacteria 1128
421 Ga0207698_10805573 3300026142 Bacteria 942
422 Ga0207698_12566702 3300026142 Bacteria 519
423 Ga0210002_1095674 3300027617 Bacteria 535
424 Ga0209813_10013478 3300027866 Bacteria 2183
425 Ga0209974_10026419 3300027876 Bacteria 1922
426 Ga0209974_10453051 3300027876 Bacteria 509
427 Ga0207428_10438399 3300027907 Bacteria 953
428 Ga0268266_11315133 3300028379 Bacteria 698
429 Ga0268265_10088033 3300028380 Bacteria 2473
430 Ga0268264_10143805 3300028381 Bacteria 2130
431 Ga0307515_10146200 3300028794 Bacteria 2502
432 Ga0307515_10279814 3300028794 Bacteria 1377
433 Ga0311001_1073003 3300029277 Bacteria 1103
434 Ga0316177_1027848 3300030731 Bacteria 5667
435 Ga0316176_1155217 3300030732 Bacteria 2197
436 Ga0314311_1015366 3300030733 Bacteria 2419
437 Ga0316179_1057719 3300030734 Bacteria 4081
438 Ga0316178_1099973 3300030735 Bacteria 1978
439 Ga0316181_1005005 3300030744 Bacteria 1586
440 Ga0316181_1027995 3300030744 Bacteria 2198
441 Ga0316182_1160810 3300030745 Bacteria 4679
442 Ga0316182_1335418 3300030745 Bacteria 3506
443 Ga0307513_10133255 3300031456 Bacteria 2425
444 Ga0307513_10522518 3300031456 Bacteria 902
445 Ga0307408_100023235 3300031548 Bacteria 4221
446 Ga0307408_100151605 3300031548 Bacteria 1830
447 Ga0307408_100547946 3300031548 Bacteria 1020
448 Ga0307408_101253362 3300031548 Bacteria 693
449 Ga0316575_10000071 3300031665 Bacteria 24774
450 Ga0307516_10231316 3300031730 Bacteria 1552
451 Ga0307405_10085747 3300031731 Bacteria 2071
452 Ga0307405_10102355 3300031731 Bacteria 1923
453 Ga0307405_10153486 3300031731 Bacteria 1622
454 Ga0307405_10246824 3300031731 Bacteria 1326
455 Ga0307405_10442717 3300031731 Bacteria 1028
456 Ga0307405_10525006 3300031731 Bacteria 953
457 Ga0307405_10684829 3300031731 Bacteria 847
458 Ga0307405_10999883 3300031731 Bacteria 713
459 Ga0307413_10083733 3300031824 Bacteria 2053
460 Ga0307413_10149594 3300031824 Bacteria 1625
461 Ga0307413_10780691 3300031824 Bacteria 801
462 Ga0307413_10824157 3300031824 Bacteria 782
463 Ga0307413_11069495 3300031824 Bacteria 695
464 Ga0307413_11119299 3300031824 Bacteria 681
465 Ga0307413_11383299 3300031824 Bacteria 618
466 Ga0307410_10008640 3300031852 Bacteria 5660
467 Ga0307410_10020536 3300031852 Bacteria 4042
468 Ga0307410_10042577 3300031852 Bacteria 3003
469 Ga0307410_10192093 3300031852 Bacteria 1553
470 Ga0307410_10258977 3300031852 Bacteria 1356
471 Ga0307410_10384323 3300031852 Bacteria 1130
472 Ga0307410_10602501 3300031852 Bacteria 916
473 Ga0307410_10974031 3300031852 Bacteria 730
474 Ga0307406_10000938 3300031901 Bacteria 16294
475 Ga0307406_10017666 3300031901 Bacteria 4156
476 Ga0307406_10032617 3300031901 Bacteria 3182
477 Ga0307406_10050533 3300031901 Bacteria 2636
478 Ga0307406_10056914 3300031901 Bacteria 2506
479 Ga0307406_10084412 3300031901 Bacteria 2120
480 Ga0307406_10581971 3300031901 Bacteria 920
481 Ga0307406_11785783 3300031901 Bacteria 546
482 Ga0307407_10013519 3300031903 Bacteria 3966
483 Ga0307407_10085533 3300031903 Bacteria 1919
484 Ga0307407_10104312 3300031903 Bacteria 1766
485 Ga0307407_10196927 3300031903 Bacteria 1347
486 Ga0307407_10212197 3300031903 Bacteria 1304
487 Ga0307407_10226071 3300031903 Bacteria 1268
488 Ga0307407_10457360 3300031903 Bacteria 928
489 Ga0307407_10613355 3300031903 Bacteria 811
490 Ga0307412_10140805 3300031911 Bacteria 1766
491 Ga0307412_10231849 3300031911 Bacteria 1422
492 Ga0307412_10546480 3300031911 Bacteria 972
493 Ga0307412_10561526 3300031911 Bacteria 960
494 Ga0307412_10870322 3300031911 Bacteria 787
495 Ga0307409_100001225 3300031995 Bacteria 12356
496 Ga0307409_100003633 3300031995 Bacteria 8433
497 Ga0307409_100189262 3300031995 Bacteria 1830
498 Ga0307409_100255938 3300031995 Bacteria 1603
499 Ga0307409_100413745 3300031995 Bacteria 1291
500 Ga0307409_100730058 3300031995 Bacteria 992
501 Ga0307409_100733608 3300031995 Bacteria 990
502 Ga0307409_100804016 3300031995 Bacteria 948
503 Ga0307409_101292185 3300031995 Bacteria 754
504 Ga0307409_101464559 3300031995 Bacteria 710
505 Ga0307409_102046551 3300031995 Bacteria 602
506 Ga0307409_102365416 3300031995 Bacteria 560
507 Ga0307416_100003637 3300032002 Bacteria 9109
508 Ga0307416_100038599 3300032002 Bacteria 3686
509 Ga0307416_100191288 3300032002 Bacteria 1930
510 Ga0307416_100299681 3300032002 Bacteria 1597
511 Ga0307416_100449570 3300032002 Bacteria 1341
512 Ga0307416_100508408 3300032002 Bacteria 1270
513 Ga0307416_100737369 3300032002 Bacteria 1077
514 Ga0307416_101082049 3300032002 Bacteria 906
515 Ga0307416_101199944 3300032002 Bacteria 864
516 Ga0307416_101637659 3300032002 Bacteria 749
517 Ga0307416_103033382 3300032002 Bacteria 562
518 Ga0307414_10070354 3300032004 Bacteria 2519
519 Ga0307414_10116419 3300032004 Bacteria 2046
520 Ga0307414_10171706 3300032004 Bacteria 1734
521 Ga0307414_10284275 3300032004 Bacteria 1392
522 Ga0307414_10306241 3300032004 Bacteria 1346
523 Ga0307414_10433077 3300032004 Bacteria 1149
524 Ga0307414_10439654 3300032004 Bacteria 1141
525 Ga0307414_10582372 3300032004 Bacteria 1001
526 Ga0307414_10654667 3300032004 Bacteria 947
527 Ga0307414_10798664 3300032004 Bacteria 860
528 Ga0307414_10871294 3300032004 Bacteria 824
529 Ga0307414_12310376 3300032004 Bacteria 502
530 Ga0307411_10149613 3300032005 Bacteria 1733
531 Ga0307411_10384118 3300032005 Bacteria 1156
532 Ga0307411_10543727 3300032005 Bacteria 990
533 Ga0307411_10641728 3300032005 Bacteria 918
534 Ga0307411_11586400 3300032005 Bacteria 603
535 Ga0307415_100072348 3300032126 Bacteria 2428
536 Ga0307415_100092413 3300032126 Bacteria 2194
537 Ga0307415_100131507 3300032126 Bacteria 1895
538 Ga0307415_100307763 3300032126 Bacteria 1315
539 Ga0307415_100404465 3300032126 Bacteria 1166
540 Ga0307415_100586092 3300032126 Bacteria 990
541 Ga0307415_100706984 3300032126 Bacteria 910
542 Ga0307415_101111408 3300032126 Bacteria 740
543 Ga0307415_101687985 3300032126 Bacteria 610
544 Ga0316593_10004869 3300032168 Bacteria 3491
545 Ga0316593_10246891 3300032168 Bacteria 667
546 Ga0373949_0157882 3300035090 Bacteria 660
547 Ga0373943_0424743 3300035170 Bacteria 770
548 Ga0373962_0038342 3300035242 Bacteria 1341
549 Ga0373927_0585126 3300035695 Bacteria 738
550 Ga0373937_1806843 3300036401 Bacteria 558
551 Ga0395899_0024632 3300037312 Bacteria 4548
552 Ga0395899_0181001 3300037312 Bacteria 1480
553 Ga0395899_0828700 3300037312 Bacteria 569
554 Ga0395900_0021670 3300037418 Bacteria 6569
555 Ga0395900_0175222 3300037418 Bacteria 2181
556 Ga0395900_0829268 3300037418 Bacteria 851
557 Ga0395900_0996087 3300037418 Bacteria 758
558 Ga0395898_0000381 3300037466 Bacteria 97274
559 Ga0395898_0024956 3300037466 Bacteria 6026
560 Ga0395898_0035678 3300037466 Bacteria 4942
561 Ga0395898_0434759 3300037466 Bacteria 1250
562 Ga0395898_0758712 3300037466 Bacteria 911
563 Ga0395898_1402426 3300037466 Bacteria 626
564 Ga0395905_0565965 3300037471 Bacteria 1038
565 Ga0395901_0011417 3300038443 Bacteria 8999
566 Ga0395901_0018326 3300038443 Bacteria 7147
567 Ga0395901_0043313 3300038443 Bacteria 4670
568 Ga0395901_0085307 3300038443 Bacteria 3301
569 Ga0395901_0115199 3300038443 Bacteria 2823
570 Ga0395901_0477955 3300038443 Bacteria 1271
571 Ga0439439_0106050 3300041406 Bacteria 776
572 Ga0439453_0024091 3300041408 Bacteria 1115
573 Ga0439461_0165187 3300041410 Bacteria 579
574 Ga0439466_0096364 3300041411 Bacteria 925
575 Ga0439465_0104304 3300041413 Bacteria 981
576 Ga0439465_0428718 3300041413 Bacteria 505
577 Ga0451787_754476 3300041441 Bacteria 1031
578 Ga0451789_0550523 3300041443 Bacteria 822
579 Ga0451789_0613489 3300041443 Bacteria 810
580 Ga0451789_0933274 3300041443 Bacteria 640
581 Ga0451789_1171264 3300041443 Bacteria 630
582 Ga0451790_43972 3300041444 Bacteria 525
583 Ga0451794_49779 3300041446 Bacteria 651
584 Ga0451791_0566873 3300041451 Bacteria 786
585 Ga0451791_0685368 3300041451 Bacteria 1176
586 Ga0451791_1010988 3300041451 Bacteria 1915
587 Ga0451793_0340172 3300041452 Bacteria 1067
588 Ga0451793_0347839 3300041452 Bacteria 542
589 Ga0451793_1130005 3300041452 Bacteria 1478
590 Ga0451797_1441145 3300041453 Bacteria 1171
591 Ga0451795_1171153 3300041456 Bacteria 605
592 Ga0451795_1394395 3300041456 Bacteria 1371
593 Ga0451798_1030053 3300041458 Bacteria 882
594 Ga0451802_0524866 3300041460 Bacteria 668
595 Ga0451802_0968729 3300041460 Bacteria 1139
596 Ga0451802_1495406 3300041460 Bacteria 714
597 Ga0451802_1709762 3300041460 Bacteria 1085
598 Ga0451802_1764020 3300041460 Bacteria 1803
599 Ga0451806_756032 3300041462 Bacteria 830
600 Ga0451804_0655263 3300041463 Bacteria 1046
601 Ga0451807_1389725 3300041486 Bacteria 2186
602 Ga0451807_1401067 3300041486 Bacteria 879
603 Ga0451833_0247859 3300041491 Bacteria 594
604 Ga0451833_0787441 3300041491 Bacteria 968
605 Ga0451833_0940272 3300041491 Bacteria 5554
606 Ga0451833_1014957 3300041491 Bacteria 2531
607 Ga0451835_0499652 3300041492 Bacteria 696
608 Ga0451837_0077982 3300041494 Bacteria 920
609 Ga0451837_0778344 3300041494 Bacteria 839
610 Ga0451837_1096605 3300041494 Bacteria 3790
611 Ga0451839_0200150 3300041496 Bacteria 2000
612 Ga0451839_0297290 3300041496 Bacteria 581
613 Ga0451839_0717896 3300041496 Bacteria 698
614 Ga0451839_1402782 3300041496 Bacteria 1538
615 Ga0451845_0205458 3300041501 Bacteria 753
616 Ga0451845_0242461 3300041501 Bacteria 784
617 Ga0451851_0078399 3300041507 Bacteria 1064
618 Ga0451851_1179869 3300041507 Bacteria 543
619 Ga0451843_0454725 3300041509 Bacteria 1340
620 Ga0451843_0890533 3300041509 Bacteria 585
621 Ga0451843_0931674 3300041509 Bacteria 1043
622 Ga0451855_1138313 3300041511 Bacteria 601
623 Ga0451855_1481772 3300041511 Bacteria 890
624 Ga0451853_0425433 3300041512 Bacteria 1190
625 Ga0439431_0019607 3300041997 Bacteria 1609
626 Ga0439431_0195508 3300041997 Bacteria 588
627 Ga0439433_0037647 3300041999 Bacteria 1120
628 Ga0439442_077750 3300042002 Bacteria 709
629 Ga0439442_102701 3300042002 Bacteria 620
630 Ga0439445_0141939 3300042004 Bacteria 697
631 Ga0439432_008227 3300042006 Bacteria 3667
632 Ga0439449_0045486 3300042007 Bacteria 1627
633 Ga0439451_100194 3300042009 Bacteria 586
634 Ga0439452_036323 3300042010 Bacteria 1181
635 Ga0439455_0248429 3300042012 Bacteria 521
636 Ga0439457_009641 3300042014 Bacteria 2244
637 Ga0439457_013788 3300042014 Bacteria 1813
638 Ga0439462_0024189 3300042015 Bacteria 1594
639 Ga0450914_047886 3300042118 Bacteria 557
640 Ga0450894_025631 3300042131 Bacteria 808
641 Ga0450900_002853 3300042136 Bacteria 1871
642 Ga0450905_004403 3300042142 Bacteria 1868
643 Ga0450906_018795 3300042145 Bacteria 1239
644 Ga0450907_004972 3300042146 Bacteria 2260
645 Ga0439458_0233677 3300042157 Bacteria 509
646 Ga0439434_0005739 3300042435 Bacteria 3623
647 Ga0450918_005705 3300042531 Bacteria 2226
648 Ga0451577_1065886 3300042876 Bacteria 724
649 Ga0466972_0053616 3300044658 Bacteria 1942
650 Ga0466972_0161155 3300044658 Bacteria 1054
651 Ga0453683_0446401 3300044673 Bacteria 836
652 Ga0466965_0005112 3300044683 Bacteria 5889
653 Ga0466965_0005434 3300044683 Bacteria 5740
654 Ga0466965_0005702 3300044683 Bacteria 5616
655 Ga0466965_0045670 3300044683 Bacteria 2167
656 Ga0466965_0103092 3300044683 Bacteria 1460
657 Ga0466966_0020615 3300044684 Bacteria 4331
658 Ga0466966_0986897 3300044684 Bacteria 508
659 Ga0466961_0200780 3300044693 Bacteria 1233
660 Ga0466961_0222654 3300044693 Bacteria 1162
661 Ga0466963_0997249 3300044694 Bacteria 590
662 Ga0466964_0043493 3300044706 Bacteria 1822
663 Ga0466964_0669198 3300044706 Bacteria 576
664 Ga0453684_1308853 3300044712 Bacteria 756
665 Ga0466971_0013185 3300044719 Bacteria 3627
666 Ga0466971_0075480 3300044719 Bacteria 1533
667 Ga0466968_0014966 3300044735 Bacteria 3071
668 Ga0466968_0100908 3300044735 Bacteria 1288
669 Ga0466970_0000027 3300044765 Bacteria 56103
670 Ga0466970_0014327 3300044765 Bacteria 4069
671 Ga0466970_0035231 3300044765 Bacteria 2652
672 Ga0466970_0116911 3300044765 Bacteria 1458
673 Ga0466970_0375951 3300044765 Bacteria 808
674 Ga0466970_0416595 3300044765 Bacteria 767
675 Ga0466970_0454737 3300044765 Bacteria 734
676 Ga0466970_0463316 3300044765 Bacteria 727
677 Ga0466970_0877315 3300044765 Bacteria 527
678 Ga0466957_0015729 3300044842 Bacteria 4420
679 Ga0466957_1186468 3300044842 Bacteria 552
680 Ga0466960_0017576 3300044901 Bacteria 3120
681 Ga0466960_0045006 3300044901 Bacteria 2106
682 Ga0466960_0056630 3300044901 Bacteria 1909
683 Ga0466960_0135955 3300044901 Bacteria 1301
684 Ga0466960_0321606 3300044901 Bacteria 876
685 Ga0466960_0350286 3300044901 Bacteria 842
686 Ga0466960_0869752 3300044901 Bacteria 549
687 Ga0466960_0972536 3300044901 Bacteria 520
688 Ga0466959_0214509 3300045049 Bacteria 1336
689 Ga0466959_0409550 3300045049 Bacteria 921
690 Ga0466959_0455966 3300045049 Bacteria 866
691 Ga0451576_2307141 3300045051 Bacteria 551
692 Ga0466958_0140824 3300045836 Bacteria 1518
693 Ga0466958_1083706 3300045836 Bacteria 523
694 Ga0466967_0257891 3300045976 Bacteria 1667
695 Ga0466967_0405282 3300045976 Bacteria 1327
696 Ga0495627_001687 3300046453 Bacteria 12164
697 Ga0495627_010611 3300046453 Bacteria 3340
698 Ga0495627_097109 3300046453 Bacteria 844
699 Ga0495592_0787716 3300046454 Bacteria 566
700 Ga0495603_0313515 3300046455 Bacteria 901
701 Ga0495629_0474132 3300046459 Bacteria 846
702 Ga0495638_0114263 3300046460 Bacteria 1601
703 Ga0495641_0035689 3300046461 Bacteria 2341
704 Ga0495641_0048011 3300046461 Bacteria 1958
705 Ga0495641_0063343 3300046461 Bacteria 1667
706 Ga0495641_0149837 3300046461 Bacteria 1042
707 Ga0495651_0614045 3300046462 Bacteria 685
708 Ga0495651_0644054 3300046462 Bacteria 665
709 Ga0495653_0135069 3300046463 Bacteria 1741
710 Ga0495650_0065495 3300046471 Bacteria 1442
711 Ga0495650_0070523 3300046471 Bacteria 1372
712 Ga0495650_0076653 3300046471 Bacteria 1299
713 Ga0495582_0177485 3300046473 Bacteria 1213
714 Ga0495582_0279176 3300046473 Bacteria 959
715 Ga0495582_0649277 3300046473 Bacteria 610
716 Ga0495639_0054995 3300046475 Bacteria 1815
717 Ga0495639_0150642 3300046475 Bacteria 1122
718 Ga0495664_0201137 3300046477 Bacteria 1207
719 Ga0495596_0194635 3300046500 Bacteria 788
720 Ga0495596_0233999 3300046500 Bacteria 713
721 Ga0495608_0533013 3300046511 Bacteria 709
722 Ga0495610_0017172 3300046512 Bacteria 4133
723 Ga0495620_0029591 3300046515 Bacteria 2532
724 Ga0495620_0225612 3300046515 Bacteria 716
725 Ga0495631_0117084 3300046518 Bacteria 1146
726 Ga0495631_0170356 3300046518 Bacteria 934
727 Ga0495631_0197684 3300046518 Bacteria 860
728 Ga0495631_0433999 3300046518 Bacteria 559
729 Ga0495643_0437973 3300046522 Bacteria 571
730 Ga0495643_0524340 3300046522 Bacteria 507
731 Ga0495663_0171817 3300046525 Bacteria 748
732 Ga0495666_0409851 3300046526 Bacteria 609
733 Ga0495652_0537954 3300046529 Bacteria 805
734 Ga0495654_0016801 3300046530 Bacteria 3856
735 Ga0495665_0074242 3300046531 Bacteria 1791
736 Ga0495640_0481487 3300046533 Bacteria 756
737 Ga0495598_0133572 3300046537 Bacteria 853
738 Ga0495609_0086941 3300046538 Bacteria 1362
739 Ga0495609_0155191 3300046538 Bacteria 972
740 Ga0495645_0009818 3300046543 Bacteria 6696
741 Ga0495645_0139337 3300046543 Bacteria 1694
742 Ga0495633_0071159 3300046558 Bacteria 1623
743 Ga0495633_0206595 3300046558 Bacteria 901
744 Ga0495633_0336722 3300046558 Bacteria 684
745 Ga0495633_0545355 3300046558 Bacteria 522
746 Ga0495656_0027599 3300046615 Bacteria 2269
747 Ga0495634_0836279 3300046642 Bacteria 523
748 Ga0495625_0157617 3300046660 Bacteria 1523
749 Ga0495625_0295344 3300046660 Bacteria 1038
750 Ga0495635_0064597 3300046663 Bacteria 2512
751 Ga0495635_0334355 3300046663 Bacteria 1012
752 Ga0495588_0475607 3300046674 Bacteria 655
753 Ga0495588_0505385 3300046674 Bacteria 633
754 Ga0495624_0258091 3300046690 Bacteria 1053
755 Ga0495670_0039865 3300046691 Bacteria 2343
756 Ga0495649_0337349 3300046694 Bacteria 763
757 Ga0495649_0580566 3300046694 Bacteria 554
758 Ga0495600_0149486 3300046809 Bacteria 1513
759 Ga0495660_0358644 3300046810 Bacteria 647
760 Ga0495604_0212515 3300047317 Bacteria 1336
761 Ga0495604_0303970 3300047317 Bacteria 1071
762 Ga0495636_0066571 3300047318 Bacteria 1532
763 Ga0495674_0586965 3300047319 Bacteria 884
764 Ga0495680_0979705 3300047322 Bacteria 541
765 Ga0495675_0299463 3300047444 Bacteria 955
766 Ga0495685_148217 3300047447 Bacteria 763
767 Ga0495686_0077413 3300047472 Bacteria 2037
768 Ga0495593_0216739 3300047673 Bacteria 961
769 Ga0495615_0054387 3300048090 Bacteria 1039
770 Ga0495615_0226477 3300048090 Bacteria 585
771 Ga0496100_0004803 3300048903 Bacteria 7217
772 Ga0496100_0005639 3300048903 Bacteria 6765
773 Ga0496100_0207887 3300048903 Bacteria 1430
774 Ga0496100_0240916 3300048903 Bacteria 1334
775 Ga0496100_0241720 3300048903 Bacteria 1332
776 Ga0496100_0539623 3300048903 Bacteria 901
777 Ga0496100_0845973 3300048903 Bacteria 717
778 Ga0496100_1408911 3300048903 Bacteria 550
779 Ga0496101_0002898 3300048904 Bacteria 10559
780 Ga0496101_0006142 3300048904 Bacteria 7710
781 Ga0496101_0008133 3300048904 Bacteria 6844
782 Ga0496101_0187846 3300048904 Bacteria 1594
783 Ga0496101_0191760 3300048904 Bacteria 1577
784 Ga0496101_0289904 3300048904 Bacteria 1280
785 Ga0496101_0842652 3300048904 Bacteria 722
786 Ga0496101_1311354 3300048904 Bacteria 566
787 Ga0496102_0030623 3300048905 Bacteria 4816
788 Ga0496102_0032510 3300048905 Bacteria 4686
789 Ga0496102_0033359 3300048905 Bacteria 4626
790 Ga0496102_0142933 3300048905 Bacteria 2244
791 Ga0496102_0153529 3300048905 Bacteria 2164
792 Ga0496102_0190689 3300048905 Bacteria 1931
793 Ga0496102_0196778 3300048905 Bacteria 1900
794 Ga0496102_0280685 3300048905 Bacteria 1570
795 Ga0496103_0005136 3300048906 Bacteria 7881
796 Ga0496103_0012385 3300048906 Bacteria 5058
797 Ga0496103_0066663 3300048906 Bacteria 2247
798 Ga0496103_0091392 3300048906 Bacteria 1921
799 Ga0496103_0400859 3300048906 Bacteria 881
800 Ga0496103_0439975 3300048906 Bacteria 836
801 Ga0496104_0003769 3300048907 Bacteria 13107
802 Ga0496104_0044706 3300048907 Bacteria 4161
803 Ga0496104_0073603 3300048907 Bacteria 3250
804 Ga0496104_0331808 3300048907 Bacteria 1434
805 Ga0496104_0440159 3300048907 Bacteria 1215
806 Ga0496104_0681506 3300048907 Bacteria 936
807 Ga0496104_0997443 3300048907 Bacteria 741
808 Ga0496105_0005038 3300048908 Bacteria 10001
809 Ga0496105_0026767 3300048908 Bacteria 4707
810 Ga0496105_0237925 3300048908 Bacteria 1478
811 Ga0496105_0293318 3300048908 Bacteria 1309
812 Ga0496105_0613038 3300048908 Bacteria 843
813 Ga0496105_0727735 3300048908 Bacteria 759
814 Ga0496105_0838660 3300048908 Bacteria 696
815 Ga0496106_0216500 3300048909 Bacteria 1526
816 Ga0496107_0001328 3300048910 Bacteria 15168
817 Ga0496107_0047291 3300048910 Bacteria 3099
818 Ga0496107_0104323 3300048910 Bacteria 2080
819 Ga0496107_0221247 3300048910 Bacteria 1408
820 Ga0496107_0858167 3300048910 Bacteria 663
821 Ga0496108_0125559 3300048911 Bacteria 2202
822 Ga0496108_0142727 3300048911 Bacteria 2063
823 Ga0496108_0478114 3300048911 Bacteria 1088
824 Ga0496108_1051641 3300048911 Bacteria 693
825 Ga0496108_1229856 3300048911 Bacteria 632
826 Ga0496108_1654766 3300048911 Bacteria 528
827 Ga0496109_0016841 3300048912 Bacteria 6396
828 Ga0496109_0071948 3300048912 Bacteria 3175
829 Ga0496109_0180492 3300048912 Bacteria 1982
830 Ga0496109_0667101 3300048912 Bacteria 977
831 Ga0496109_1741895 3300048912 Bacteria 556
832 Ga0496110_0146636 3300048913 Bacteria 2135
833 Ga0496110_0173973 3300048913 Bacteria 1954
834 Ga0496110_0192836 3300048913 Bacteria 1850
835 Ga0496110_0270447 3300048913 Bacteria 1547
836 Ga0496110_0528209 3300048913 Bacteria 1073
837 Ga0496110_0864200 3300048913 Bacteria 810
838 Ga0496110_0957381 3300048913 Bacteria 763
839 Ga0496110_1093964 3300048913 Bacteria 705
840 Ga0496110_1487995 3300048913 Bacteria 587
841 Ga0496111_0039015 3300048914 Bacteria 3403
842 Ga0496111_0057502 3300048914 Bacteria 2816
843 Ga0496111_0365330 3300048914 Bacteria 1068
844 Ga0496111_0811053 3300048914 Bacteria 677
845 Ga0496111_1340515 3300048914 Bacteria 503
846 Ga0496112_0020079 3300048915 Bacteria 6325
847 Ga0496112_0354840 3300048915 Bacteria 1409
848 Ga0496112_1710298 3300048915 Bacteria 542
849 Ga0496113_0005620 3300048916 Bacteria 7845
850 Ga0496113_0094246 3300048916 Bacteria 2313
851 Ga0496113_0219147 3300048916 Bacteria 1516
852 Ga0496113_0289280 3300048916 Bacteria 1311
853 Ga0496113_1477399 3300048916 Bacteria 525
854 Ga0496114_0004840 3300048917 Bacteria 10491
855 Ga0496114_0011682 3300048917 Bacteria 7020
856 Ga0496114_0016801 3300048917 Bacteria 5901
857 Ga0496114_0066335 3300048917 Bacteria 3025
858 Ga0496114_0069313 3300048917 Bacteria 2961
859 Ga0496114_0088508 3300048917 Bacteria 2626
860 Ga0496114_0110990 3300048917 Bacteria 2349
861 Ga0496114_0140938 3300048917 Bacteria 2087
862 Ga0496114_0293175 3300048917 Bacteria 1435
863 Ga0496114_0336485 3300048917 Bacteria 1334
864 Ga0496115_0002702 3300048918 Bacteria 12733
865 Ga0496115_0022436 3300048918 Bacteria 4890
866 Ga0496115_0043029 3300048918 Bacteria 3600
867 Ga0496115_0088708 3300048918 Bacteria 2525
868 Ga0496115_0189625 3300048918 Bacteria 1698
869 Ga0496115_0360288 3300048918 Bacteria 1185
870 Ga0496115_0461865 3300048918 Bacteria 1024
871 Ga0496116_0018694 3300048919 Bacteria 5327
872 Ga0496116_0190459 3300048919 Bacteria 1086
873 Ga0496116_0357589 3300048919 Bacteria 665
874 Ga0496117_0000362 3300048920 Bacteria 79224
875 Ga0496117_0003610 3300048920 Bacteria 17825
876 Ga0496117_0004032 3300048920 Bacteria 16539
877 Ga0496117_0004445 3300048920 Bacteria 15459
878 Ga0496117_0006530 3300048920 Bacteria 11750
879 Ga0496117_0009885 3300048920 Bacteria 8783
880 Ga0496117_0031402 3300048920 Bacteria 4055
881 Ga0496117_0070709 3300048920 Bacteria 2342
882 Ga0496117_0105894 3300048920 Bacteria 1766
883 Ga0496117_0115251 3300048920 Bacteria 1664
884 Ga0496117_0120128 3300048920 Bacteria 1616
885 Ga0496117_0152774 3300048920 Bacteria 1364
886 Ga0496117_0224314 3300048920 Bacteria 1043
887 Ga0496117_0272684 3300048920 Bacteria 910
888 Ga0496117_0305829 3300048920 Bacteria 839
889 Ga0496118_0000116 3300048921 Bacteria 145054
890 Ga0496118_0002856 3300048921 Bacteria 22535
891 Ga0496118_0006345 3300048921 Bacteria 13050
892 Ga0496118_0008749 3300048921 Bacteria 10383
893 Ga0496118_0040002 3300048921 Bacteria 3733
894 Ga0496118_0048135 3300048921 Bacteria 3297
895 Ga0496118_0056469 3300048921 Bacteria 2951
896 Ga0496118_0093399 3300048921 Bacteria 2061
897 Ga0496118_0114304 3300048921 Bacteria 1780
898 Ga0496118_0191856 3300048921 Bacteria 1221
899 Ga0496118_0219746 3300048921 Bacteria 1107
900 Ga0496119_0000720 3300048922 Bacteria 44520
901 Ga0496119_0003034 3300048922 Bacteria 17774
902 Ga0496119_0010149 3300048922 Bacteria 7953
903 Ga0496119_0019667 3300048922 Bacteria 4960
904 Ga0496119_0023416 3300048922 Bacteria 4380
905 Ga0496119_0037894 3300048922 Bacteria 3123
906 Ga0496119_0054042 3300048922 Bacteria 2448
907 Ga0496119_0055468 3300048922 Bacteria 2407
908 Ga0496119_0073119 3300048922 Bacteria 2000
909 Ga0496119_0103763 3300048922 Bacteria 1592
910 Ga0496119_0194550 3300048922 Bacteria 1054
911 Ga0496120_0015932 3300048923 Bacteria 4934
912 Ga0496120_0020440 3300048923 Bacteria 4207
913 Ga0496120_0037279 3300048923 Bacteria 2886
914 Ga0496120_0052780 3300048923 Bacteria 2313
915 Ga0496120_0187051 3300048923 Bacteria 1012
916 Ga0496120_0411284 3300048923 Bacteria 596
917 Ga0496121_0028500 3300048924 Bacteria 5195
918 Ga0496122_0000022 3300048925 Bacteria 388704
919 Ga0496122_0000799 3300048925 Bacteria 60347
920 Ga0496122_0001054 3300048925 Bacteria 48096
921 Ga0496122_0001412 3300048925 Bacteria 38911
922 Ga0496122_0003594 3300048925 Bacteria 20199
923 Ga0496122_0010341 3300048925 Bacteria 9645
924 Ga0496122_0019341 3300048925 Bacteria 6225
925 Ga0496122_0053840 3300048925 Bacteria 3028
926 Ga0496122_0055803 3300048925 Bacteria 2952
927 Ga0496122_0074281 3300048925 Bacteria 2406
928 Ga0496122_0090523 3300048925 Bacteria 2087
929 Ga0496122_0098924 3300048925 Bacteria 1957
930 Ga0496122_0180178 3300048925 Bacteria 1261
931 Ga0496122_0286844 3300048925 Bacteria 896
932 Ga0496122_0420214 3300048925 Bacteria 672
933 Ga0496122_0515858 3300048925 Bacteria 577
934 Ga0496123_0000009 3300048926 Bacteria 509486
935 Ga0496123_0000016 3300048926 Bacteria 424330
936 Ga0496123_0001017 3300048926 Bacteria 42804
937 Ga0496123_0004251 3300048926 Bacteria 15248
938 Ga0496123_0019835 3300048926 Bacteria 5279
939 Ga0496123_0100149 3300048926 Bacteria 1689
940 Ga0496123_0125566 3300048926 Bacteria 1433
941 Ga0496123_0185551 3300048926 Bacteria 1081
942 Ga0496123_0305552 3300048926 Bacteria 757
943 Ga0496123_0344271 3300048926 Bacteria 695
944 Ga0496124_0000135 3300048927 Bacteria 152458
945 Ga0496124_0001625 3300048927 Bacteria 32229
946 Ga0496124_0002766 3300048927 Bacteria 22302
947 Ga0496124_0006965 3300048927 Bacteria 12143
948 Ga0496124_0021715 3300048927 Bacteria 5909
949 Ga0496124_0024430 3300048927 Bacteria 5494
950 Ga0496124_0029307 3300048927 Bacteria 4907
951 Ga0496124_0036040 3300048927 Bacteria 4320
952 Ga0496124_0046112 3300048927 Bacteria 3734
953 Ga0496124_0552230 3300048927 Bacteria 760
954 Ga0496124_0616949 3300048927 Bacteria 702
955 Ga0496125_0000086 3300048928 Bacteria 216489
956 Ga0496125_0002082 3300048928 Bacteria 26957
957 Ga0496125_0002578 3300048928 Bacteria 23316
958 Ga0496125_0005769 3300048928 Bacteria 13604
959 Ga0496125_0029529 3300048928 Bacteria 4925
960 Ga0496125_0030145 3300048928 Bacteria 4857
961 Ga0496125_0043499 3300048928 Bacteria 3810
962 Ga0496125_0073122 3300048928 Bacteria 2667
963 Ga0496125_0218531 3300048928 Bacteria 1230
964 Ga0496125_0283745 3300048928 Bacteria 1024
965 Ga0496125_0509383 3300048928 Bacteria 675
966 Ga0496126_0002077 3300048929 Bacteria 28059
967 Ga0496126_0002563 3300048929 Bacteria 24311
968 Ga0496126_0019423 3300048929 Bacteria 6691
969 Ga0496126_0052186 3300048929 Bacteria 3717
970 Ga0496126_0103173 3300048929 Bacteria 2492
971 Ga0496126_0354970 3300048929 Bacteria 1198
972 Ga0496126_0389128 3300048929 Bacteria 1133
973 Ga0496126_0877838 3300048929 Bacteria 682
974 Ga0496126_0920373 3300048929 Bacteria 662
975 Ga0496126_1101121 3300048929 Bacteria 590
976 Ga0501306_000074 3300049127 Bacteria 5266
977 Ga0501306_002419 3300049127 Bacteria 1911
978 Ga0501306_010703 3300049127 Bacteria 1158
979 Ga0501306_012130 3300049127 Bacteria 1107
980 Ga0501306_012525 3300049127 Bacteria 1094
981 Ga0501306_017094 3300049127 Bacteria 981
982 Ga0501306_019733 3300049127 Bacteria 932
983 Ga0501306_021991 3300049127 Bacteria 897
984 Ga0501306_024605 3300049127 Bacteria 861
985 Ga0501306_026301 3300049127 Bacteria 842
986 Ga0501306_033127 3300049127 Bacteria 776
987 Ga0501306_037195 3300049127 Bacteria 744
988 Ga0501306_103801 3300049127 Bacteria 511
989 Ga0501308_003607 3300049128 Bacteria 1444
990 Ga0501308_006102 3300049128 Bacteria 1224
991 Ga0501308_014028 3300049128 Bacteria 933
992 Ga0501309_000159 3300049129 Bacteria 4373
993 Ga0501309_008319 3300049129 Bacteria 1303
994 Ga0501309_008504 3300049129 Bacteria 1293
995 Ga0501309_016414 3300049129 Bacteria 1009
996 Ga0501309_020388 3300049129 Bacteria 927
997 Ga0501309_047036 3300049129 Bacteria 671
998 Ga0501310_000445 3300049130 Bacteria 3625
999 Ga0501310_010188 3300049130 Bacteria 1045
1000 Ga0501310_010786 3300049130 Bacteria 1025
1001 Ga0501310_012589 3300049130 Bacteria 972
1002 Ga0501310_015452 3300049130 Bacteria 906
1003 Ga0501310_017019 3300049130 Bacteria 876
1004 Ga0501310_026934 3300049130 Bacteria 747
1005 Ga0501310_060766 3300049130 Bacteria 563
1006 Ga0501310_076471 3300049130 Bacteria 520
1007 Ga0501341_04474 3300049131 Bacteria 817
1008 Ga0501341_17254 3300049131 Bacteria 517
1009 Ga0501304_004362 3300049160 Bacteria 1073
1010 Ga0501304_016246 3300049160 Bacteria 703
1011 Ga0501305_007591 3300049161 Bacteria 1381
1012 Ga0501305_015912 3300049161 Bacteria 1067
1013 Ga0501305_017957 3300049161 Bacteria 1020
1014 Ga0501305_026946 3300049161 Bacteria 879
1015 Ga0501305_029064 3300049161 Bacteria 854
1016 Ga0501305_032786 3300049161 Bacteria 817
1017 Ga0501305_034505 3300049161 Bacteria 802
1018 Ga0501305_048651 3300049161 Bacteria 707
1019 Ga0501305_064155 3300049161 Bacteria 637
1020 Ga0501305_104026 3300049161 Bacteria 531
1021 Ga0501307_000425 3300049162 Bacteria 2824
1022 Ga0501307_000974 3300049162 Bacteria 2234
1023 Ga0501307_003484 3300049162 Bacteria 1546
1024 Ga0501307_004162 3300049162 Bacteria 1462
1025 Ga0501307_006092 3300049162 Bacteria 1291
1026 Ga0501311_004863 3300049527 Bacteria 1447
1027 Ga0501311_006003 3300049527 Bacteria 1353
1028 Ga0501311_006327 3300049527 Bacteria 1330
1029 Ga0501311_008623 3300049527 Bacteria 1200
1030 Ga0501311_010632 3300049527 Bacteria 1120
1031 Ga0501311_016281 3300049527 Bacteria 968
1032 Ga0501311_058822 3300049527 Bacteria 617
1033 Ga0501312_000860 3300049528 Bacteria 2716
1034 Ga0501312_003515 3300049528 Bacteria 1785
1035 Ga0501312_020345 3300049528 Bacteria 981
1036 Ga0501312_023459 3300049528 Bacteria 930
1037 Ga0501312_024955 3300049528 Bacteria 909
1038 Ga0501312_085232 3300049528 Bacteria 577
1039 Ga0501313_004212 3300049529 Bacteria 1468
1040 Ga0501313_008642 3300049529 Bacteria 1137
1041 Ga0501313_026916 3300049529 Bacteria 733
1042 Ga0501313_043773 3300049529 Bacteria 607
1043 Ga0501313_056434 3300049529 Bacteria 551
1044 Ga0501314_004913 3300049530 Bacteria 1124
1045 Ga0501315_001948 3300049531 Bacteria 1869
1046 Ga0501315_011591 3300049531 Bacteria 1079
1047 Ga0501315_023756 3300049531 Bacteria 844
1048 Ga0501315_024209 3300049531 Bacteria 838
1049 Ga0501315_104509 3300049531 Bacteria 503
1050 Ga0501316_000024 3300049532 Bacteria 6284
1051 Ga0501316_008552 3300049532 Bacteria 1133
1052 Ga0501316_011765 3300049532 Bacteria 1014
1053 Ga0501316_015971 3300049532 Bacteria 909
1054 Ga0501316_017272 3300049532 Bacteria 884
1055 Ga0501316_017601 3300049532 Bacteria 878
1056 Ga0501316_027929 3300049532 Bacteria 744
1057 Ga0501317_000104 3300049533 Bacteria 4459
1058 Ga0501317_005229 3300049533 Bacteria 1383
1059 Ga0501317_008450 3300049533 Bacteria 1186
1060 Ga0501317_009921 3300049533 Bacteria 1128
1061 Ga0501317_012454 3300049533 Bacteria 1050
1062 Ga0501317_019285 3300049533 Bacteria 909
1063 Ga0501317_025803 3300049533 Bacteria 825
1064 Ga0501317_027576 3300049533 Bacteria 807
1065 Ga0501317_030191 3300049533 Bacteria 783
1066 Ga0501317_030540 3300049533 Bacteria 780
1067 Ga0501317_108453 3300049533 Bacteria 508
1068 Ga0501318_000019 3300049534 Bacteria 6962
1069 Ga0501318_001927 3300049534 Bacteria 1725
1070 Ga0501318_002080 3300049534 Bacteria 1685
1071 Ga0501318_003086 3300049534 Bacteria 1501
1072 Ga0501318_024453 3300049534 Bacteria 786
1073 Ga0501318_073235 3300049534 Bacteria 544
1074 Ga0501319_010342 3300049535 Bacteria 741
1075 Ga0501320_009030 3300049536 Bacteria 992
1076 Ga0501320_009591 3300049536 Bacteria 972
1077 Ga0501320_052192 3300049536 Bacteria 559
1078 Ga0501320_060698 3300049536 Bacteria 531
1079 Ga0501321_000071 3300049537 Bacteria 4546
1080 Ga0501321_004182 3300049537 Bacteria 1366
1081 Ga0501321_006013 3300049537 Bacteria 1220
1082 Ga0501321_006103 3300049537 Bacteria 1214
1083 Ga0501321_006971 3300049537 Bacteria 1163
1084 Ga0501321_010778 3300049537 Bacteria 1009
1085 Ga0501322_006970 3300049538 Bacteria 814
1086 Ga0501323_029474 3300049539 Bacteria 764
1087 Ga0501323_038583 3300049539 Bacteria 694
1088 Ga0501323_045929 3300049539 Bacteria 652
1089 Ga0501324_001472 3300049540 Bacteria 1574
1090 Ga0501324_002357 3300049540 Bacteria 1360
1091 Ga0501324_003769 3300049540 Bacteria 1178
1092 Ga0501324_014659 3300049540 Bacteria 753
1093 Ga0501324_018804 3300049540 Bacteria 694
1094 Ga0501325_000321 3300049541 Bacteria 2134
1095 Ga0501325_006979 3300049541 Bacteria 944
1096 Ga0501325_009137 3300049541 Bacteria 875
1097 Ga0501325_011821 3300049541 Bacteria 813
1098 Ga0501325_015205 3300049541 Bacteria 757
1099 Ga0501325_039807 3300049541 Bacteria 568
1100 Ga0501326_08913 3300049542 Bacteria 588
1101 Ga0501330_001061 3300049546 Bacteria 1360
1102 Ga0501330_004116 3300049546 Bacteria 891
1103 Ga0501332_03604 3300049548 Bacteria 900
1104 Ga0501340_007454 3300049556 Bacteria 755
1105 Ga0501340_007500 3300049556 Bacteria 753
1106 Ga0501031_0015860 3300049568 Bacteria 4891
1107 Ga0501031_0025920 3300049568 Bacteria 3824
1108 Ga0501031_0031053 3300049568 Bacteria 3486
1109 Ga0501031_0039671 3300049568 Bacteria 3073
1110 Ga0501032_0001225 3300049569 Bacteria 20568
1111 Ga0501032_0003386 3300049569 Bacteria 12226
1112 Ga0501032_0011095 3300049569 Bacteria 6474
1113 Ga0501032_0201460 3300049569 Bacteria 1299
1114 Ga0501032_0409819 3300049569 Bacteria 870
1115 Ga0501032_0446765 3300049569 Bacteria 828
1116 Ga0501033_0002214 3300049570 Bacteria 16754
1117 Ga0501033_0042005 3300049570 Bacteria 3410
1118 Ga0501033_0051677 3300049570 Bacteria 3046
1119 Ga0501033_0089311 3300049570 Bacteria 2254
1120 Ga0501033_0232746 3300049570 Bacteria 1308
1121 Ga0501034_0002490 3300049571 Bacteria 22119
1122 Ga0501034_0008687 3300049571 Bacteria 10701
1123 Ga0501034_0012335 3300049571 Bacteria 8829
1124 Ga0501034_0055806 3300049571 Bacteria 3975
1125 Ga0501034_0332863 3300049571 Bacteria 1450
1126 Ga0501034_0347168 3300049571 Bacteria 1413
1127 Ga0501034_0640264 3300049571 Bacteria 965
1128 Ga0501034_1374164 3300049571 Bacteria 582
1129 Ga0501034_1498532 3300049571 Bacteria 548
1130 Ga0501034_1713383 3300049571 Bacteria 501
1131 Ga0501036_0005365 3300049572 Bacteria 10380
1132 Ga0501036_0106530 3300049572 Bacteria 2370
1133 Ga0501036_0110654 3300049572 Bacteria 2321
1134 Ga0501036_0198946 3300049572 Bacteria 1685
1135 Ga0501036_0287835 3300049572 Bacteria 1375
1136 Ga0501036_0337907 3300049572 Bacteria 1258
1137 Ga0501036_0380919 3300049572 Bacteria 1177
1138 Ga0501036_0462651 3300049572 Bacteria 1056
1139 Ga0501036_0733406 3300049572 Bacteria 815
1140 Ga0501037_0001422 3300049573 Bacteria 17565
1141 Ga0501037_0148444 3300049573 Bacteria 1676
1142 Ga0501037_0165634 3300049573 Bacteria 1574
1143 Ga0501037_0332057 3300049573 Bacteria 1051
1144 Ga0501038_0000144 3300049574 Bacteria 61149
1145 Ga0501038_0003511 3300049574 Bacteria 14597
1146 Ga0501038_0020229 3300049574 Bacteria 5988
1147 Ga0501038_0051796 3300049574 Bacteria 3540
1148 Ga0501038_0067971 3300049574 Bacteria 3030
1149 Ga0501038_0250801 3300049574 Bacteria 1402
1150 Ga0501038_0471927 3300049574 Bacteria 962
1151 Ga0501039_0008941 3300049575 Bacteria 7631
1152 Ga0501039_0031996 3300049575 Bacteria 4055
1153 Ga0501039_0069542 3300049575 Bacteria 2734
1154 Ga0501039_0123550 3300049575 Bacteria 2029
1155 Ga0501039_0139746 3300049575 Bacteria 1902
1156 Ga0501039_0329581 3300049575 Bacteria 1200
1157 Ga0501039_0509386 3300049575 Bacteria 945
1158 Ga0501040_0013091 3300049576 Bacteria 5454
1159 Ga0501040_0339871 3300049576 Bacteria 1075
1160 Ga0501040_0557268 3300049576 Bacteria 827
1161 Ga0501040_0600636 3300049576 Bacteria 795
1162 Ga0501041_0151505 3300049577 Bacteria 1448
1163 Ga0501041_0206672 3300049577 Bacteria 1231
1164 Ga0501042_0102421 3300049578 Bacteria 2059
1165 Ga0501042_0195588 3300049578 Bacteria 1458
1166 Ga0501042_0271189 3300049578 Bacteria 1225
1167 Ga0501043_0016944 3300049579 Bacteria 5710
1168 Ga0501043_0033951 3300049579 Bacteria 4013
1169 Ga0501043_0037575 3300049579 Bacteria 3808
1170 Ga0501043_0058998 3300049579 Bacteria 3011
1171 Ga0501046_0009583 3300049580 Bacteria 8355
1172 Ga0501046_0087067 3300049580 Bacteria 2408
1173 Ga0501046_0341081 3300049580 Bacteria 1089
1174 Ga0501046_0923919 3300049580 Bacteria 608
1175 Ga0501047_0006944 3300049581 Bacteria 10634
1176 Ga0501047_0011785 3300049581 Bacteria 8268
1177 Ga0501047_0025223 3300049581 Bacteria 5712
1178 Ga0501047_0028559 3300049581 Bacteria 5380
1179 Ga0501047_0677558 3300049581 Bacteria 849
1180 Ga0501048_0029778 3300049582 Bacteria 3954
1181 Ga0501048_0031589 3300049582 Bacteria 3830
1182 Ga0501048_0195110 3300049582 Bacteria 1435
1183 Ga0501048_0571384 3300049582 Bacteria 811
1184 Ga0501048_0617385 3300049582 Bacteria 778
1185 Ga0501048_0732237 3300049582 Bacteria 710
1186 Ga0501067_0109872 3300049583 Bacteria 1533
1187 Ga0501067_0331675 3300049583 Bacteria 847
1188 Ga0501068_0026130 3300049584 Bacteria 3438
1189 Ga0501068_0208056 3300049584 Bacteria 1242
1190 Ga0501068_0248747 3300049584 Bacteria 1133
1191 Ga0501068_0357970 3300049584 Bacteria 938
1192 Ga0501068_0389567 3300049584 Bacteria 898
1193 Ga0501069_0252681 3300049585 Bacteria 1028
1194 Ga0501069_0566188 3300049585 Bacteria 680
1195 Ga0501070_0007064 3300049586 Bacteria 9552
1196 Ga0501070_0010457 3300049586 Bacteria 7846
1197 Ga0501070_0040019 3300049586 Bacteria 3910
1198 Ga0501070_0054412 3300049586 Bacteria 3319
1199 Ga0501070_0068175 3300049586 Bacteria 2945
1200 Ga0501070_0090899 3300049586 Bacteria 2526
1201 Ga0501070_0250015 3300049586 Bacteria 1450
1202 Ga0501070_0373624 3300049586 Bacteria 1155
1203 Ga0501071_0005669 3300049587 Bacteria 8053
1204 Ga0501071_0055231 3300049587 Bacteria 2867
1205 Ga0501072_0047842 3300049588 Bacteria 3368
1206 Ga0501072_0123160 3300049588 Bacteria 2066
1207 Ga0501072_0587802 3300049588 Bacteria 878
1208 Ga0501073_0095105 3300049589 Bacteria 2069
1209 Ga0501073_0138452 3300049589 Bacteria 1687
1210 Ga0501073_0414762 3300049589 Bacteria 930
1211 Ga0501073_0435913 3300049589 Bacteria 906
1212 Ga0501074_0042917 3300049590 Bacteria 3272
1213 Ga0501074_0144623 3300049590 Bacteria 1700
1214 Ga0501075_0014320 3300049591 Bacteria 5682
1215 Ga0501076_0003905 3300049592 Bacteria 10504
1216 Ga0501076_0108815 3300049592 Bacteria 2239
1217 Ga0501076_1155938 3300049592 Bacteria 637
1218 Ga0501077_0058976 3300049593 Bacteria 2436
1219 Ga0501077_0591777 3300049593 Bacteria 712
1220 Ga0501202_165850 3300049652 Bacteria 587
1221 Ga0501217_260054 3300049661 Bacteria 562
1222 Ga0501079_0048517 3300049741 Bacteria 3276
1223 Ga0501079_1511458 3300049741 Bacteria 528
1224 Ga0501080_0045350 3300049742 Bacteria 4092
1225 Ga0501080_0129750 3300049742 Bacteria 2333
1226 Ga0501080_0719443 3300049742 Bacteria 880
1227 Ga0501083_0048591 3300049744 Bacteria 2863
1228 Ga0501083_0246002 3300049744 Bacteria 1164
1229 Ga0501083_0370263 3300049744 Bacteria 932
1230 Ga0501035_0004487 3300049822 Bacteria 13250
1231 Ga0501035_0078006 3300049822 Bacteria 2927
1232 Ga0501035_0089409 3300049822 Bacteria 2712
1233 Ga0501035_0698053 3300049822 Bacteria 819
1234 Ga0501044_0001222 3300049823 Bacteria 30539
1235 Ga0501044_0001531 3300049823 Bacteria 27116
1236 Ga0501044_0011319 3300049823 Bacteria 9669
1237 Ga0501044_0024266 3300049823 Bacteria 6441
1238 Ga0501044_0063853 3300049823 Bacteria 3760
1239 Ga0501044_0097399 3300049823 Bacteria 2963
1240 Ga0501044_0108524 3300049823 Bacteria 2785
1241 Ga0501044_0766304 3300049823 Bacteria 846
1242 Ga0501044_0843909 3300049823 Bacteria 793
1243 Ga0501045_0027072 3300049824 Bacteria 4129
1244 Ga0501045_0037135 3300049824 Bacteria 3540
1245 Ga0501045_1140872 3300049824 Bacteria 569
1246 nmdc:mga03n38_33332_c1 3300050490 Bacteria 2190
1247 nmdc:mga00v17_209789_c1 3300050491 Bacteria 1260
1248 nmdc:mga00v17_24368_c1 3300050491 Bacteria 3509
1249 nmdc:mga00v17_354242_c1 3300050491 Bacteria 954
1250 nmdc:mga00v17_380333_c1 3300050491 Bacteria 918
1251 nmdc:mga00v17_535305_c1 3300050491 Bacteria 758
1252 nmdc:mga00v17_663867_c1 3300050491 Bacteria 670
1253 nmdc:mga00v17_8123_c1 3300050491 Bacteria 5634
1254 nmdc:mga00v17_99131_c1 3300050491 Bacteria 1838
1255 nmdc:mga0yw44_277_c1 3300050492 Bacteria 17596
1256 nmdc:mga0yw44_518948_c1 3300050492 Bacteria 808
1257 nmdc:mga0yw44_5399_c1 3300050492 Bacteria 6031
1258 nmdc:mga0k408_228743_c1 3300050493 Bacteria 1110
1259 nmdc:mga06z11_11796_c1 3300050494 Bacteria 3780
1260 nmdc:mga04h51_10547_c1 3300050495 Bacteria 2540
1261 nmdc:mga07m45_149130_c1 3300050496 Bacteria 1356
1262 nmdc:mga07m45_24923_c1 3300050496 Bacteria 3279
1263 nmdc:mga07m45_450753_c1 3300050496 Bacteria 746
1264 nmdc:mga07m45_560849_c1 3300050496 Bacteria 660
1265 nmdc:mga08y16_387012_c1 3300050511 Bacteria 1433
1266 nmdc:mga0sz30_6222_c2 3300050516 Bacteria 3757
1267 Ga0495601_0382741 3300053077 Bacteria 913
1268 Ga0500635_0000204 3300053080 Bacteria 29368
1269 Ga0495595_0071204 3300053084 Bacteria 1644
1270 Ga0495595_0555078 3300053084 Bacteria 586
1271 Ga0495619_0510368 3300053085 Bacteria 826
1272 Ga0500583_0241471 3300053092 Bacteria 893
1273 Ga0500606_179694 3300053152 Bacteria 666
1274 Ga0500616_0000144 3300053153 Bacteria 121889
1275 Ga0500616_0000947 3300053153 Bacteria 31587
1276 Ga0500616_0002723 3300053153 Bacteria 14334
1277 Ga0500645_089171 3300053730 Bacteria 876
1278 Ga0501084_0082056 3300054114 Bacteria 2705
1279 Ga0501084_0157824 3300054114 Bacteria 1913
1280 Ga0587084_000004 3300059477 Bacteria 10690
1281 Ga0587084_009664 3300059477 Bacteria 1251
1282 Ga0587093_060602 3300059478 Bacteria 617
1283 Ga0587066_015241 3300059490 Bacteria 1192
1284 Ga0587070_000783 3300059491 Bacteria 2928
1285 Ga0587070_163144 3300059491 Bacteria 568
1286 Ga0587073_0064840 3300059492 Bacteria 867
1287 Ga0587077_001116 3300059493 Bacteria 2744
1288 Ga0587077_044432 3300059493 Bacteria 905
1289 Ga0587080_005427 3300059503 Bacteria 1712
1290 Ga0587080_009155 3300059503 Bacteria 1434
1291 Ga0587080_065031 3300059503 Bacteria 718
1292 Ga0587080_164959 3300059503 Bacteria 522
1293 Ga0587082_013342 3300059504 Bacteria 1237
1294 Ga0587082_020552 3300059504 Bacteria 1071
1295 Ga0587082_055588 3300059504 Bacteria 767
1296 Ga0587083_0037084 3300059505 Bacteria 1001
1297 Ga0587083_0063474 3300059505 Bacteria 839
1298 Ga0587083_0206067 3300059505 Bacteria 564
1299 Ga0587085_001114 3300059506 Bacteria 2368
1300 Ga0587085_043127 3300059506 Bacteria 794
1301 Ga0587086_000329 3300059507 Bacteria 3204
1302 Ga0587086_016610 3300059507 Bacteria 963
1303 Ga0587088_005805 3300059508 Bacteria 1640
1304 Ga0587088_009994 3300059508 Bacteria 1380
1305 Ga0587089_003194 3300059509 Bacteria 1724
1306 Ga0587089_108682 3300059509 Bacteria 510
1307 Ga0587090_001053 3300059510 Bacteria 2661
1308 Ga0587090_013431 3300059510 Bacteria 1184
1309 Ga0587090_016430 3300059510 Bacteria 1106
1310 Ga0587091_000453 3300059511 Bacteria 3511
1311 Ga0587091_155186 3300059511 Bacteria 584
1312 Ga0587092_000723 3300059512 Bacteria 2857
1313 Ga0587092_090791 3300059512 Bacteria 616
1314 Ga0587092_102881 3300059512 Bacteria 591
1315 Ga0587094_000376 3300059513 Bacteria 3298
1316 Ga0587094_022240 3300059513 Bacteria 930
1317 Ga0587095_000117 3300059514 Bacteria 3212
1318 Ga0587097_00183 3300059603 Bacteria 1542
1319 Ga0587098_003011 3300059604 Bacteria 1480
1320 Ga0587098_004556 3300059604 Bacteria 1317
1321 Ga0587106_002677 3300059605 Bacteria 1780
1322 Ga0587106_002979 3300059605 Bacteria 1725
1323 Ga0587106_010351 3300059605 Bacteria 1207
1324 Ga0587106_045237 3300059605 Bacteria 762
1325 Ga0587125_000594 3300059607 Bacteria 2220
1326 Ga0587099_006725 3300059622 Bacteria 1070
1327 Ga0587099_010809 3300059622 Bacteria 917
1328 Ga0587099_016335 3300059622 Bacteria 801
1329 Ga0587099_019680 3300059622 Bacteria 754
1330 Ga0587099_033532 3300059622 Bacteria 633
1331 Ga0587099_061972 3300059622 Bacteria 518
1332 Ga0587101_000011 3300059623 Bacteria 8540
1333 Ga0587101_015282 3300059623 Bacteria 1037
1334 Ga0587113_002137 3300059625 Bacteria 1387
1335 Ga0587115_000267 3300059626 Bacteria 3477
1336 Ga0587115_122321 3300059626 Bacteria 502
1337 Ga0587117_002508 3300059627 Bacteria 1724
1338 Ga0587122_008348 3300059628 Bacteria 937
1339 Ga0587128_001907 3300059630 Bacteria 2077
1340 Ga0587128_007988 3300059630 Bacteria 1355
1341 Ga0587128_041335 3300059630 Bacteria 807
1342 Ga0587062_017327 3300059639 Bacteria 984
1343 Ga0587062_056679 3300059639 Bacteria 677
1344 Ga0587067_055523 3300059640 Bacteria 815
1345 Ga0587067_056100 3300059640 Bacteria 812
1346 Ga0587068_118364 3300059641 Bacteria 573
1347 Ga0587069_009409 3300059642 Bacteria 1261
1348 Ga0587069_028866 3300059642 Bacteria 884
1349 Ga0587072_012807 3300059643 Bacteria 1391
1350 Ga0587072_012818 3300059643 Bacteria 1390
1351 Ga0587075_093482 3300059644 Bacteria 591
1352 Ga0587076_030461 3300059645 Bacteria 953
1353 Ga0587078_004265 3300059646 Bacteria 1487
1354 Ga0587079_037960 3300059647 Bacteria 959
1355 Ga0587079_062060 3300059647 Bacteria 813
1356 Ga0587100_000081 3300059648 Bacteria 3481
1357 Ga0587102_003585 3300059649 Bacteria 1273
1358 Ga0587104_009913 3300059650 Bacteria 692
1359 Ga0587105_013753 3300059651 Bacteria 648
1360 Ga0587107_048985 3300059652 Bacteria 710
1361 Ga0587107_065915 3300059652 Bacteria 650
1362 Ga0587108_016657 3300059653 Bacteria 670
1363 Ga0587110_010684 3300059654 Bacteria 921
1364 Ga0587114_027206 3300059655 Bacteria 851
1365 Ga0587124_000269 3300059660 Bacteria 2596
1366 Ga0587071_007630 3300060344 Bacteria 1731
1367 Ga0587071_023737 3300060344 Bacteria 1141
1368 Ga0587071_190544 3300060344 Bacteria 531
1369 Ga0587111_0000761 3300060346 Bacteria 3397
1370 Ga0587111_0007121 3300060346 Bacteria 1804
1371 Ga0587111_0051039 3300060346 Bacteria 913
1372 Ga0587111_0068791 3300060346 Bacteria 822
1373 Ga0501082_0005640 3300060353 Bacteria 10866
1374 Ga0501082_0077375 3300060353 Bacteria 2868
1375 Ga0501082_0901376 3300060353 Bacteria 773
1376 Ga0501082_1164888 3300060353 Bacteria 674
1377 Ga0466962_0007926 3300061719 Bacteria 5093
1378 Ga0466962_0315320 3300061719 Bacteria 775
1379 Ga0466962_0460770 3300061719 Bacteria 641
1380 Ga0530510_1301477 3300061734 Bacteria 557

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0732237 Ga0501048_0732237_36_365 106
2 3300059623 Ga0587101_015282 Ga0587101_015282_486_863 114
3 3300009148 Ga0105243_11938504 Ga0105243_119385042 123
4 3300009177 Ga0105248_10715877 Ga0105248_107158771 123
5 3300009545 Ga0105237_10419017 Ga0105237_104190172 123
6 3300013102 Ga0157371_10023296 Ga0157371_100232963 123
7 3300013104 Ga0157370_10004984 Ga0157370_1000498411 123
8 3300013105 Ga0157369_10084273 Ga0157369_100842735 123
9 3300013105 Ga0157369_10501405 Ga0157369_105014052 123
10 3300013307 Ga0157372_10477669 Ga0157372_104776692 123
11 3300013308 Ga0157375_10995988 Ga0157375_109959882 123
12 3300014326 Ga0157380_10821373 Ga0157380_108213732 123
13 3300020076 Ga0206355_1429317 Ga0206355_14293172 123
14 3300020080 Ga0206350_11047778 Ga0206350_110477783 123
15 3300025908 Ga0207643_10187141 Ga0207643_101871413 123
16 3300025914 Ga0207671_10399893 Ga0207671_103998931 123
17 3300036401 Ga0373937_1806843 Ga0373937_1806843_173_544 123
18 3300037466 Ga0395898_0758712 Ga0395898_0758712_20_391 123
19 3300041446 Ga0451794_49779 Ga0451794_49779_264_635 123
20 3300041491 Ga0451833_0247859 Ga0451833_0247859_36_407 123
21 3300042002 Ga0439442_102701 Ga0439442_102701_167_538 123
22 3300042007 Ga0439449_0045486 Ga0439449_0045486_16_387 123
23 3300044683 Ga0466965_0005434 Ga0466965_0005434_1838_2209 123
24 3300044719 Ga0466971_0075480 Ga0466971_0075480_16_387 123
25 3300044765 Ga0466970_0035231 Ga0466970_0035231_970_1341 123
26 3300044901 Ga0466960_0321606 Ga0466960_0321606_442_813 123
27 3300046454 Ga0495592_0787716 Ga0495592_0787716_53_424 123
28 3300046515 Ga0495620_0029591 Ga0495620_0029591_2143_2514 123
29 3300046515 Ga0495620_0225612 Ga0495620_0225612_12_383 123
30 3300046518 Ga0495631_0197684 Ga0495631_0197684_13_384 123
31 3300046809 Ga0495600_0149486 Ga0495600_0149486_620_991 123
32 3300047322 Ga0495680_0979705 Ga0495680_0979705_16_387 123
33 3300048904 Ga0496101_0187846 Ga0496101_0187846_64_435 123
34 3300048905 Ga0496102_0033359 Ga0496102_0033359_20_391 123
35 3300048908 Ga0496105_0293318 Ga0496105_0293318_924_1295 123
36 3300048911 Ga0496108_0142727 Ga0496108_0142727_1165_1536 123
37 3300048911 Ga0496108_1051641 Ga0496108_1051641_103_474 123
38 3300048912 Ga0496109_0071948 Ga0496109_0071948_2403_2774 123
39 3300048913 Ga0496110_0192836 Ga0496110_0192836_1120_1491 123
40 3300048913 Ga0496110_1487995 Ga0496110_1487995_16_387 123
41 3300048914 Ga0496111_0057502 Ga0496111_0057502_1029_1400 123
42 3300048917 Ga0496114_0088508 Ga0496114_0088508_2021_2392 123
43 3300048920 Ga0496117_0031402 Ga0496117_0031402_2498_2869 123
44 3300048921 Ga0496118_0008749 Ga0496118_0008749_3785_4156 123
45 3300048921 Ga0496118_0191856 Ga0496118_0191856_308_679 123
46 3300048925 Ga0496122_0000799 Ga0496122_0000799_22009_22380 123
47 3300048926 Ga0496123_0000009 Ga0496123_0000009_382285_382656 123
48 3300048927 Ga0496124_0006965 Ga0496124_0006965_5297_5668 123
49 3300048927 Ga0496124_0552230 Ga0496124_0552230_334_705 123
50 3300048927 Ga0496124_0616949 Ga0496124_0616949_17_388 123
51 3300049127 Ga0501306_019733 Ga0501306_019733_10_381 123
52 3300049127 Ga0501306_021991 Ga0501306_021991_10_381 123
53 3300049127 Ga0501306_033127 Ga0501306_033127_16_387 123
54 3300049128 Ga0501308_003607 Ga0501308_003607_753_1124 123
55 3300049128 Ga0501308_006102 Ga0501308_006102_836_1207 123
56 3300049128 Ga0501308_014028 Ga0501308_014028_551_922 123
57 3300049130 Ga0501310_010188 Ga0501310_010188_338_709 123
58 3300049130 Ga0501310_017019 Ga0501310_017019_472_843 123
59 3300049131 Ga0501341_17254 Ga0501341_17254_10_381 123
60 3300049161 Ga0501305_015912 Ga0501305_015912_427_798 123
61 3300049161 Ga0501305_017957 Ga0501305_017957_384_755 123
62 3300049161 Ga0501305_026946 Ga0501305_026946_446_817 123
63 3300049527 Ga0501311_004863 Ga0501311_004863_759_1130 123
64 3300049527 Ga0501311_006327 Ga0501311_006327_17_388 123
65 3300049528 Ga0501312_023459 Ga0501312_023459_27_398 123
66 3300049529 Ga0501313_008642 Ga0501313_008642_109_480 123
67 3300049529 Ga0501313_026916 Ga0501313_026916_17_388 123
68 3300049531 Ga0501315_011591 Ga0501315_011591_369_740 123
69 3300049531 Ga0501315_104509 Ga0501315_104509_121_492 123
70 3300049532 Ga0501316_015971 Ga0501316_015971_401_772 123
71 3300049533 Ga0501317_009921 Ga0501317_009921_262_633 123
72 3300049534 Ga0501318_024453 Ga0501318_024453_80_451 123
73 3300049534 Ga0501318_073235 Ga0501318_073235_94_465 123
74 3300049556 Ga0501340_007454 Ga0501340_007454_93_464 123
75 3300049586 Ga0501070_0068175 Ga0501070_0068175_1252_1623 123
76 3300049823 Ga0501044_0843909 Ga0501044_0843909_305_676 123
77 3300050490 nmdc:mga03n38_33332_c1 nmdc:mga03n38_33332_c1_927_1298 123
78 3300050492 nmdc:mga0yw44_5399_c1 nmdc:mga0yw44_5399_c1_3760_4131 123
79 3300050493 nmdc:mga0k408_228743_c1 nmdc:mga0k408_228743_c1_343_714 123
80 3300050494 nmdc:mga06z11_11796_c1 nmdc:mga06z11_11796_c1_2972_3343 123
81 3300050495 nmdc:mga04h51_10547_c1 nmdc:mga04h51_10547_c1_1768_2139 123
82 3300050496 nmdc:mga07m45_24923_c1 nmdc:mga07m45_24923_c1_1435_1806 123
83 3300053084 Ga0495595_0555078 Ga0495595_0555078_200_571 123
84 3300059652 Ga0587107_048985 Ga0587107_048985_74_445 123
85 3300059654 Ga0587110_010684 Ga0587110_010684_202_573 123
86 3300049130 Ga0501310_012589 Ga0501310_012589_526_903 125
87 iso_pu_bacteria 2738541272 2738693788 126
88 iso_pu_bacteria 2738543027 2739327020 126
89 iso_pu_bacteria 2739367654 2739607377 126
90 iso_pu_bacteria 2758568621 2760621469 126
91 iso_pu_bacteria 2808606394 2809026257 126
92 iso_pu_bacteria 2835188231 2835189427 126
93 iso_pu_bacteria 2839986021 2839988342 126
94 iso_pu_bacteria 2857729791 2857730654 126
95 iso_pu_bacteria 2884994152 2884996441 126
96 iso_pu_bacteria 2887443736 2887444566 126
97 iso_pu_bacteria 2904430863 2904432390 126
98 iso_pu_bacteria 2904501621 2904501814 126
99 iso_pu_bacteria 2908674828 2908676132 126
100 iso_pu_bacteria 2909074476 2909076609 126
101 iso_pu_bacteria 2919039151 2919040060 126
102 iso_pu_bacteria 2919042368 2919043187 126
103 iso_pu_bacteria 2919446982 2919449333 126
104 iso_pu_bacteria 2928104781 2928105482 126
105 iso_pu_bacteria 2928500415 2928500992 126
106 iso_pu_bacteria 2932431166 2932432203 126
107 iso_pu_bacteria 8056579771 8056583186 126
108 iso_pu_bacteria 2585428157 2588107956 128
109 iso_pu_bacteria 2643221542 2643732574 128
110 iso_pu_bacteria 2643221546 2643753721 128
111 iso_pu_bacteria 2643221549 2643768609 128
112 iso_pu_bacteria 2643221553 2643786360 128
113 iso_pu_bacteria 2643221566 2643847793 128
114 iso_pu_bacteria 2643221567 2643851172 128
115 iso_pu_bacteria 2643221572 2643876440 128
116 iso_pu_bacteria 2643221597 2643994820 128
117 iso_pu_bacteria 2643221613 2644082375 128
118 iso_pu_bacteria 2643221616 2644096415 128
119 iso_pu_bacteria 2643221619 2644111987 128
120 iso_pu_bacteria 2643221624 2644134961 128
121 iso_pu_bacteria 2643221630 2644171374 128
122 iso_pu_bacteria 2643221669 2644383495 128
123 iso_pu_bacteria 2643221681 2644455945 128
124 iso_pu_bacteria 2643221690 2644502848 128
125 iso_pu_bacteria 2643221694 2644525208 128
126 iso_pu_bacteria 2643221721 2644667002 128
127 iso_pu_bacteria 2643221722 2644669296 128
128 iso_pu_bacteria 2643221724 2644681060 128
129 iso_pu_bacteria 2728369380 2730230507 128
130 iso_pu_bacteria 2747842429 2747952130 128
131 iso_pu_bacteria 2751185788 2753303685 128
132 iso_pu_bacteria 2757320536 2758224794 128
133 iso_pu_bacteria 2758568522 2760304715 128
134 iso_pu_bacteria 2773857758 2774378918 128
135 iso_pu_bacteria 2773857759 2774382005 128
136 iso_pu_bacteria 2773857763 2774400764 128
137 iso_pu_bacteria 2808606306 2808628766 128
138 iso_pu_bacteria 2808606365 2808872990 128
139 iso_pu_bacteria 2808606368 2808884773 128
140 iso_pu_bacteria 2808606372 2808901039 128
141 iso_pu_bacteria 2808606447 2809226255 128
142 iso_pu_bacteria 2811994872 2812322092 128
143 iso_pu_bacteria 2811994880 2812364373 128
144 iso_pu_bacteria 2821268502 2821269004 128
145 iso_pu_bacteria 2833709550 2833709894 128
146 iso_pu_bacteria 2844841374 2844843362 128
147 iso_pu_bacteria 2852632344 2852632514 128
148 iso_pu_bacteria 2852646457 2852647576 128
149 iso_pu_bacteria 2852663356 2852664090 128
150 iso_pu_bacteria 2857720070 2857722747 128
151 iso_pu_bacteria 2857723135 2857725826 128
152 iso_pu_bacteria 2870628048 2870629399 128
153 iso_pu_bacteria 2884763398 2884766389 128
154 iso_pu_bacteria 2887478801 2887486650 128
155 iso_pu_bacteria 2895660088 2895660615 128
156 iso_pu_bacteria 2897561785 2897564335 128
157 iso_pu_bacteria 2904509784 2904510380 128
158 iso_pu_bacteria 2906799679 2906801170 128
159 iso_pu_bacteria 2908678064 2908678402 128
160 iso_pu_bacteria 2919055335 2919055340 128
161 iso_pu_bacteria 2919069694 2919070726 128
162 iso_pu_bacteria 2919395869 2919397195 128
163 iso_pu_bacteria 2919443155 2919445556 128
164 iso_pu_bacteria 2919523602 2919525416 128
165 iso_pu_bacteria 2928090899 2928093833 128
166 iso_pu_bacteria 2928121344 2928121460 128
167 iso_pu_bacteria 2928153084 2928153499 128
168 iso_pu_bacteria 2935890801 2935893605 128
169 iso_pu_bacteria 2945968032 2945968743 128
170 iso_pu_bacteria 2946041624 2946045184 128
171 iso_pu_bacteria 2946080515 2946084048 128
172 iso_pu_bacteria 2974294766 2974294864 128
173 iso_pu_bacteria 2974324384 2974325336 128
174 iso_pu_bacteria 2977228692 2977230298 128
175 iso_pu_bacteria 2977236895 2977239102 128
176 iso_pu_bacteria 2977251589 2977252166 128
177 iso_pu_bacteria 2977264416 2977265516 128
178 iso_pu_bacteria 2984542743 2984543113 128
179 iso_pu_bacteria 2984551494 2984551981 128
180 iso_pu_bacteria 2984580707 2984582480 128
181 iso_pu_bacteria 2984592036 2984592293 128
182 iso_pu_bacteria 2995726249 2995728364 128
183 iso_pu_bacteria 3001889506 3001890602 128
184 iso_pu_bacteria 8001781756 8001785164 128
185 iso_pu_bacteria 8002811521 8002811574 128
186 iso_pu_bacteria 8004021418 8004021551 128
187 iso_pu_bacteria 8004025490 8004028551 128
188 iso_pu_bacteria 8004182704 8004184529 128
189 iso_pu_bacteria 8004212874 8004213335 128
190 iso_pu_bacteria 8016254467 8016255119 128
191 iso_pu_bacteria 8045830549 8045832196 128
192 iso_pu_bacteria 8046352972 8046353808 128
193 iso_pu_bacteria 8055034563 8055035313 128
194 iso_pu_bacteria 8055037949 8055038998 128
195 iso_pu_bacteria 8056037122 8056039379 128
196 iso_pu_bacteria 8057345674 8057347413 128
197 3300001979 JGI24740J21852_10000460 JGI24740J21852_1000046016 130
198 3300002738 JGI25154J39366_1001910 JGI25154J39366_10019106 130
199 3300005445 Ga0070708_100023805 Ga0070708_1000238059 130
200 3300005445 Ga0070708_100025652 Ga0070708_1000256522 130
201 3300005468 Ga0070707_100001472 Ga0070707_10000147214 130
202 3300005468 Ga0070707_100365585 Ga0070707_1003655851 130
203 3300009036 Ga0105244_10290233 Ga0105244_102902332 130
204 3300009098 Ga0105245_10168828 Ga0105245_101688283 130
205 3300009176 Ga0105242_10611042 Ga0105242_106110421 130
206 3300009551 Ga0105238_10221731 Ga0105238_102217312 130
207 3300009553 Ga0105249_11644677 Ga0105249_116446771 130
208 3300010375 Ga0105239_10305437 Ga0105239_103054371 130
209 3300011119 Ga0105246_10809179 Ga0105246_108091792 130
210 3300013102 Ga0157371_11457936 Ga0157371_114579361 130
211 3300013105 Ga0157369_10960743 Ga0157369_109607431 130
212 3300013250 Ga0171462_1001 Ga0171462_1001816 130
213 3300013297 Ga0157378_10010737 Ga0157378_100107379 130
214 3300013306 Ga0163162_10071207 Ga0163162_100712077 130
215 3300013306 Ga0163162_10172245 Ga0163162_101722453 130
216 3300013306 Ga0163162_10354781 Ga0163162_103547812 130
217 3300013306 Ga0163162_10392412 Ga0163162_103924122 130
218 3300013308 Ga0157375_10008009 Ga0157375_1000800917 130
219 3300013308 Ga0157375_12102725 Ga0157375_121027251 130
220 3300014326 Ga0157380_10036717 Ga0157380_100367174 130
221 3300014326 Ga0157380_10408751 Ga0157380_104087513 130
222 3300014326 Ga0157380_13166659 Ga0157380_131666591 130
223 3300014745 Ga0157377_10071436 Ga0157377_100714362 130
224 3300014968 Ga0157379_10873402 Ga0157379_108734021 130
225 3300014969 Ga0157376_11447027 Ga0157376_114470272 130
226 3300020076 Ga0206355_1076572 Ga0206355_10765723 130
227 3300022467 Ga0224712_10069227 Ga0224712_100692272 130
228 3300025922 Ga0207646_10040913 Ga0207646_100409139 130
229 3300025927 Ga0207687_10113053 Ga0207687_101130534 130
230 3300025935 Ga0207709_10251021 Ga0207709_102510211 130
231 3300025986 Ga0207658_10048296 Ga0207658_100482963 130
232 3300028794 Ga0307515_10279814 Ga0307515_102798143 130
233 3300030731 Ga0316177_1027848 Ga0316177_10278487 130
234 3300030732 Ga0316176_1155217 Ga0316176_11552175 130
235 3300030733 Ga0314311_1015366 Ga0314311_10153663 130
236 3300030734 Ga0316179_1057719 Ga0316179_10577192 130
237 3300030735 Ga0316178_1099973 Ga0316178_10999735 130
238 3300030744 Ga0316181_1027995 Ga0316181_10279952 130
239 3300030745 Ga0316182_1335418 Ga0316182_13354183 130
240 3300031730 Ga0307516_10231316 Ga0307516_102313163 130
241 3300031824 Ga0307413_10083733 Ga0307413_100837332 130
242 3300031824 Ga0307413_11069495 Ga0307413_110694951 130
243 3300031824 Ga0307413_11383299 Ga0307413_113832991 130
244 3300031852 Ga0307410_10042577 Ga0307410_100425776 130
245 3300031852 Ga0307410_10258977 Ga0307410_102589772 130
246 3300031903 Ga0307407_10212197 Ga0307407_102121972 130
247 3300031995 Ga0307409_100003633 Ga0307409_1000036334 130
248 3300031995 Ga0307409_102365416 Ga0307409_1023654161 130
249 3300032002 Ga0307416_100038599 Ga0307416_1000385994 130
250 3300032002 Ga0307416_100299681 Ga0307416_1002996812 130
251 3300032002 Ga0307416_101637659 Ga0307416_1016376592 130
252 3300032004 Ga0307414_10171706 Ga0307414_101717063 130
253 3300032004 Ga0307414_10284275 Ga0307414_102842753 130
254 3300032005 Ga0307411_10543727 Ga0307411_105437272 130
255 3300032126 Ga0307415_100072348 Ga0307415_1000723487 130
256 3300032126 Ga0307415_101111408 Ga0307415_1011114082 130
257 3300037312 Ga0395899_0828700 Ga0395899_0828700_106_498 130
258 3300038443 Ga0395901_0085307 Ga0395901_0085307_943_1335 130
259 3300041410 Ga0439461_0165187 Ga0439461_0165187_52_444 130
260 3300041443 Ga0451789_0933274 Ga0451789_0933274_103_495 130
261 3300041452 Ga0451793_0347839 Ga0451793_0347839_100_492 130
262 3300041460 Ga0451802_1709762 Ga0451802_1709762_324_716 130
263 3300041494 Ga0451837_0077982 Ga0451837_0077982_296_688 130
264 3300041496 Ga0451839_0297290 Ga0451839_0297290_101_493 130
265 3300041509 Ga0451843_0890533 Ga0451843_0890533_146_538 130
266 3300041511 Ga0451855_1138313 Ga0451855_1138313_190_591 130
267 3300042004 Ga0439445_0141939 Ga0439445_0141939_43_435 130
268 3300042142 Ga0450905_004403 Ga0450905_004403_446_838 130
269 3300044658 Ga0466972_0161155 Ga0466972_0161155_596_988 130
270 3300044673 Ga0453683_0446401 Ga0453683_0446401_233_625 130
271 3300044683 Ga0466965_0045670 Ga0466965_0045670_541_933 130
272 3300044693 Ga0466961_0200780 Ga0466961_0200780_97_489 130
273 3300044735 Ga0466968_0014966 Ga0466968_0014966_1502_1894 130
274 3300044765 Ga0466970_0014327 Ga0466970_0014327_1155_1547 130
275 3300044765 Ga0466970_0454737 Ga0466970_0454737_177_569 130
276 3300044765 Ga0466970_0463316 Ga0466970_0463316_272_664 130
277 3300044901 Ga0466960_0056630 Ga0466960_0056630_541_933 130
278 3300044901 Ga0466960_0972536 Ga0466960_0972536_53_445 130
279 3300045836 Ga0466958_0140824 Ga0466958_0140824_566_958 130
280 3300046453 Ga0495627_001687 Ga0495627_001687_8399_8791 130
281 3300046453 Ga0495627_010611 Ga0495627_010611_1625_2017 130
282 3300046453 Ga0495627_097109 Ga0495627_097109_411_803 130
283 3300046471 Ga0495650_0076653 Ga0495650_0076653_427_819 130
284 3300046473 Ga0495582_0177485 Ga0495582_0177485_265_657 130
285 3300046475 Ga0495639_0150642 Ga0495639_0150642_260_652 130
286 3300046500 Ga0495596_0194635 Ga0495596_0194635_19_411 130
287 3300046512 Ga0495610_0017172 Ga0495610_0017172_608_1000 130
288 3300046518 Ga0495631_0170356 Ga0495631_0170356_453_845 130
289 3300046537 Ga0495598_0133572 Ga0495598_0133572_344_736 130
290 3300046558 Ga0495633_0206595 Ga0495633_0206595_499_891 130
291 3300046558 Ga0495633_0545355 Ga0495633_0545355_30_422 130
292 3300046660 Ga0495625_0157617 Ga0495625_0157617_184_576 130
293 3300046690 Ga0495624_0258091 Ga0495624_0258091_598_990 130
294 3300046694 Ga0495649_0337349 Ga0495649_0337349_182_574 130
295 3300047317 Ga0495604_0212515 Ga0495604_0212515_856_1248 130
296 3300047319 Ga0495674_0586965 Ga0495674_0586965_145_537 130
297 3300047472 Ga0495686_0077413 Ga0495686_0077413_1463_1855 130
298 3300048090 Ga0495615_0054387 Ga0495615_0054387_490_882 130
299 3300048090 Ga0495615_0226477 Ga0495615_0226477_29_421 130
300 3300048903 Ga0496100_0207887 Ga0496100_0207887_123_515 130
301 3300048903 Ga0496100_0240916 Ga0496100_0240916_106_498 130
302 3300048903 Ga0496100_0845973 Ga0496100_0845973_309_701 130
303 3300048904 Ga0496101_0006142 Ga0496101_0006142_4977_5369 130
304 3300048905 Ga0496102_0196778 Ga0496102_0196778_1359_1751 130
305 3300048906 Ga0496103_0091392 Ga0496103_0091392_791_1183 130
306 3300048906 Ga0496103_0400859 Ga0496103_0400859_477_869 130
307 3300048907 Ga0496104_0073603 Ga0496104_0073603_1147_1539 130
308 3300048907 Ga0496104_0997443 Ga0496104_0997443_47_439 130
309 3300048908 Ga0496105_0026767 Ga0496105_0026767_190_582 130
310 3300048908 Ga0496105_0237925 Ga0496105_0237925_265_657 130
311 3300048908 Ga0496105_0613038 Ga0496105_0613038_269_661 130
312 3300048910 Ga0496107_0047291 Ga0496107_0047291_773_1165 130
313 3300048911 Ga0496108_0125559 Ga0496108_0125559_947_1339 130
314 3300048912 Ga0496109_0180492 Ga0496109_0180492_1051_1443 130
315 3300048913 Ga0496110_0173973 Ga0496110_0173973_1299_1691 130
316 3300048913 Ga0496110_0528209 Ga0496110_0528209_188_580 130
317 3300048913 Ga0496110_0957381 Ga0496110_0957381_278_670 130
318 3300048915 Ga0496112_0354840 Ga0496112_0354840_447_839 130
319 3300048916 Ga0496113_0289280 Ga0496113_0289280_461_853 130
320 3300048916 Ga0496113_1477399 Ga0496113_1477399_100_501 130
321 3300048917 Ga0496114_0004840 Ga0496114_0004840_8644_9036 130
322 3300048917 Ga0496114_0016801 Ga0496114_0016801_3343_3735 130
323 3300048918 Ga0496115_0043029 Ga0496115_0043029_2579_2971 130
324 3300048918 Ga0496115_0189625 Ga0496115_0189625_572_964 130
325 3300048918 Ga0496115_0360288 Ga0496115_0360288_411_803 130
326 3300048920 Ga0496117_0004032 Ga0496117_0004032_15672_16064 130
327 3300048920 Ga0496117_0105894 Ga0496117_0105894_1128_1520 130
328 3300048921 Ga0496118_0002856 Ga0496118_0002856_18296_18688 130
329 3300048922 Ga0496119_0003034 Ga0496119_0003034_13612_14004 130
330 3300048922 Ga0496119_0010149 Ga0496119_0010149_120_512 130
331 3300048922 Ga0496119_0103763 Ga0496119_0103763_751_1143 130
332 3300048923 Ga0496120_0037279 Ga0496120_0037279_2132_2524 130
333 3300048923 Ga0496120_0411284 Ga0496120_0411284_44_445 130
334 3300048925 Ga0496122_0019341 Ga0496122_0019341_5446_5838 130
335 3300048925 Ga0496122_0053840 Ga0496122_0053840_22_414 130
336 3300048925 Ga0496122_0055803 Ga0496122_0055803_923_1324 130
337 3300048925 Ga0496122_0090523 Ga0496122_0090523_1659_2051 130
338 3300048925 Ga0496122_0180178 Ga0496122_0180178_69_461 130
339 3300048925 Ga0496122_0420214 Ga0496122_0420214_121_513 130
340 3300048926 Ga0496123_0019835 Ga0496123_0019835_923_1324 130
341 3300048926 Ga0496123_0100149 Ga0496123_0100149_208_600 130
342 3300048926 Ga0496123_0305552 Ga0496123_0305552_221_613 130
343 3300048928 Ga0496125_0029529 Ga0496125_0029529_4349_4741 130
344 3300048928 Ga0496125_0043499 Ga0496125_0043499_1316_1708 130
345 3300048928 Ga0496125_0073122 Ga0496125_0073122_317_709 130
346 3300048928 Ga0496125_0283745 Ga0496125_0283745_364_756 130
347 3300048929 Ga0496126_0052186 Ga0496126_0052186_1997_2389 130
348 3300048929 Ga0496126_0103173 Ga0496126_0103173_1944_2336 130
349 3300048929 Ga0496126_0920373 Ga0496126_0920373_114_506 130
350 3300049127 Ga0501306_000074 Ga0501306_000074_1007_1399 130
351 3300049127 Ga0501306_010703 Ga0501306_010703_592_984 130
352 3300049127 Ga0501306_012525 Ga0501306_012525_649_1041 130
353 3300049129 Ga0501309_000159 Ga0501309_000159_944_1336 130
354 3300049129 Ga0501309_008504 Ga0501309_008504_716_1108 130
355 3300049130 Ga0501310_000445 Ga0501310_000445_2225_2617 130
356 3300049130 Ga0501310_076471 Ga0501310_076471_48_440 130
357 3300049160 Ga0501304_004362 Ga0501304_004362_21_413 130
358 3300049161 Ga0501305_064155 Ga0501305_064155_39_431 130
359 3300049162 Ga0501307_003484 Ga0501307_003484_704_1096 130
360 3300049527 Ga0501311_008623 Ga0501311_008623_93_485 130
361 3300049527 Ga0501311_010632 Ga0501311_010632_43_435 130
362 3300049528 Ga0501312_000860 Ga0501312_000860_1848_2240 130
363 3300049528 Ga0501312_020345 Ga0501312_020345_426_818 130
364 3300049529 Ga0501313_004212 Ga0501313_004212_750_1142 130
365 3300049530 Ga0501314_004913 Ga0501314_004913_379_771 130
366 3300049531 Ga0501315_024209 Ga0501315_024209_426_818 130
367 3300049532 Ga0501316_000024 Ga0501316_000024_4212_4604 130
368 3300049532 Ga0501316_011765 Ga0501316_011765_600_992 130
369 3300049533 Ga0501317_000104 Ga0501317_000104_2221_2613 130
370 3300049533 Ga0501317_025803 Ga0501317_025803_341_733 130
371 3300049534 Ga0501318_000019 Ga0501318_000019_2356_2748 130
372 3300049537 Ga0501321_000071 Ga0501321_000071_942_1334 130
373 3300049537 Ga0501321_004182 Ga0501321_004182_350_742 130
374 3300049539 Ga0501323_045929 Ga0501323_045929_88_480 130
375 3300049540 Ga0501324_001472 Ga0501324_001472_440_832 130
376 3300049541 Ga0501325_000321 Ga0501325_000321_971_1363 130
377 3300049541 Ga0501325_039807 Ga0501325_039807_95_487 130
378 3300049568 Ga0501031_0015860 Ga0501031_0015860_4383_4775 130
379 3300049568 Ga0501031_0031053 Ga0501031_0031053_1589_1981 130
380 3300049569 Ga0501032_0003386 Ga0501032_0003386_9851_10243 130
381 3300049569 Ga0501032_0201460 Ga0501032_0201460_238_630 130
382 3300049570 Ga0501033_0002214 Ga0501033_0002214_10058_10450 130
383 3300049570 Ga0501033_0089311 Ga0501033_0089311_753_1145 130
384 3300049571 Ga0501034_0002490 Ga0501034_0002490_6095_6487 130
385 3300049571 Ga0501034_0008687 Ga0501034_0008687_9713_10105 130
386 3300049571 Ga0501034_0332863 Ga0501034_0332863_347_739 130
387 3300049571 Ga0501034_0347168 Ga0501034_0347168_17_409 130
388 3300049572 Ga0501036_0005365 Ga0501036_0005365_209_601 130
389 3300049572 Ga0501036_0106530 Ga0501036_0106530_1670_2062 130
390 3300049572 Ga0501036_0287835 Ga0501036_0287835_307_699 130
391 3300049572 Ga0501036_0462651 Ga0501036_0462651_76_468 130
392 3300049573 Ga0501037_0001422 Ga0501037_0001422_8186_8578 130
393 3300049573 Ga0501037_0165634 Ga0501037_0165634_890_1282 130
394 3300049573 Ga0501037_0332057 Ga0501037_0332057_301_693 130
395 3300049574 Ga0501038_0003511 Ga0501038_0003511_6010_6402 130
396 3300049574 Ga0501038_0067971 Ga0501038_0067971_1414_1806 130
397 3300049574 Ga0501038_0250801 Ga0501038_0250801_58_450 130
398 3300049575 Ga0501039_0008941 Ga0501039_0008941_5032_5424 130
399 3300049575 Ga0501039_0031996 Ga0501039_0031996_2042_2434 130
400 3300049575 Ga0501039_0069542 Ga0501039_0069542_1280_1672 130
401 3300049576 Ga0501040_0013091 Ga0501040_0013091_3524_3916 130
402 3300049577 Ga0501041_0206672 Ga0501041_0206672_781_1173 130
403 3300049578 Ga0501042_0195588 Ga0501042_0195588_263_655 130
404 3300049579 Ga0501043_0016944 Ga0501043_0016944_4722_5114 130
405 3300049579 Ga0501043_0058998 Ga0501043_0058998_1081_1473 130
406 3300049580 Ga0501046_0009583 Ga0501046_0009583_6271_6663 130
407 3300049582 Ga0501048_0029778 Ga0501048_0029778_1466_1858 130
408 3300049582 Ga0501048_0031589 Ga0501048_0031589_2995_3387 130
409 3300049582 Ga0501048_0571384 Ga0501048_0571384_363_755 130
410 3300049582 Ga0501048_0617385 Ga0501048_0617385_111_503 130
411 3300049584 Ga0501068_0026130 Ga0501068_0026130_1068_1460 130
412 3300049584 Ga0501068_0208056 Ga0501068_0208056_269_661 130
413 3300049584 Ga0501068_0357970 Ga0501068_0357970_533_925 130
414 3300049585 Ga0501069_0252681 Ga0501069_0252681_529_921 130
415 3300049586 Ga0501070_0007064 Ga0501070_0007064_2345_2737 130
416 3300049586 Ga0501070_0373624 Ga0501070_0373624_702_1094 130
417 3300049587 Ga0501071_0005669 Ga0501071_0005669_6779_7171 130
418 3300049588 Ga0501072_0047842 Ga0501072_0047842_2447_2839 130
419 3300049589 Ga0501073_0414762 Ga0501073_0414762_455_847 130
420 3300049589 Ga0501073_0435913 Ga0501073_0435913_149_541 130
421 3300049590 Ga0501074_0042917 Ga0501074_0042917_1672_2064 130
422 3300049591 Ga0501075_0014320 Ga0501075_0014320_1599_1991 130
423 3300049592 Ga0501076_0003905 Ga0501076_0003905_6726_7118 130
424 3300049592 Ga0501076_1155938 Ga0501076_1155938_11_403 130
425 3300049593 Ga0501077_0058976 Ga0501077_0058976_1415_1807 130
426 3300049593 Ga0501077_0591777 Ga0501077_0591777_238_630 130
427 3300049661 Ga0501217_260054 Ga0501217_260054_104_496 130
428 3300049741 Ga0501079_0048517 Ga0501079_0048517_1051_1443 130
429 3300049742 Ga0501080_0045350 Ga0501080_0045350_3381_3773 130
430 3300049744 Ga0501083_0246002 Ga0501083_0246002_188_580 130
431 3300049744 Ga0501083_0370263 Ga0501083_0370263_430_822 130
432 3300049822 Ga0501035_0078006 Ga0501035_0078006_895_1287 130
433 3300049822 Ga0501035_0089409 Ga0501035_0089409_209_601 130
434 3300049823 Ga0501044_0001531 Ga0501044_0001531_9726_10118 130
435 3300049823 Ga0501044_0097399 Ga0501044_0097399_577_969 130
436 3300049824 Ga0501045_0027072 Ga0501045_0027072_239_631 130
437 3300049824 Ga0501045_0037135 Ga0501045_0037135_1448_1840 130
438 3300050491 nmdc:mga00v17_209789_c1 nmdc:mga00v17_209789_c1_557_949 130
439 3300050491 nmdc:mga00v17_380333_c1 nmdc:mga00v17_380333_c1_397_789 130
440 3300050491 nmdc:mga00v17_535305_c1 nmdc:mga00v17_535305_c1_218_610 130
441 3300050491 nmdc:mga00v17_99131_c1 nmdc:mga00v17_99131_c1_622_1014 130
442 3300050496 nmdc:mga07m45_450753_c1 nmdc:mga07m45_450753_c1_258_650 130
443 3300053080 Ga0500635_0000204 Ga0500635_0000204_86_478 130
444 3300053085 Ga0495619_0510368 Ga0495619_0510368_405_797 130
445 3300053152 Ga0500606_179694 Ga0500606_179694_120_512 130
446 3300053730 Ga0500645_089171 Ga0500645_089171_465_857 130
447 3300054114 Ga0501084_0157824 Ga0501084_0157824_905_1297 130
448 3300060353 Ga0501082_0005640 Ga0501082_0005640_7211_7603 130
449 3300060353 Ga0501082_0077375 Ga0501082_0077375_1660_2052 130
450 3300005544 Ga0070686_101379806 Ga0070686_1013798061 131
451 3300009098 Ga0105245_10641006 Ga0105245_106410063 131
452 3300042876 Ga0451577_1065886 Ga0451577_1065886_150_548 131
453 3300044712 Ga0453684_1308853 Ga0453684_1308853_193_591 131
454 3300045051 Ga0451576_2307141 Ga0451576_2307141_89_487 131
455 3300001915 JGI24741J21665_1022643 JGI24741J21665_10226432 132
456 3300001978 JGI24747J21853_1032885 JGI24747J21853_10328851 132
457 3300001979 JGI24740J21852_10016332 JGI24740J21852_100163325 132
458 3300001989 JGI24739J22299_10020519 JGI24739J22299_100205194 132
459 3300001989 JGI24739J22299_10024956 JGI24739J22299_100249564 132
460 3300001989 JGI24739J22299_10037100 JGI24739J22299_100371002 132
461 3300002067 JGI24735J21928_10006549 JGI24735J21928_100065495 132
462 3300002067 JGI24735J21928_10008244 JGI24735J21928_100082446 132
463 3300002067 JGI24735J21928_10076169 JGI24735J21928_100761692 132
464 3300003160 Ga0006779J45831_103484 Ga0006779J45831_1034841 132
465 3300003162 Ga0006778J45830_1059030 Ga0006778J45830_10590301 132
466 3300003214 JGI25165J46597_1000061 JGI25165J46597_100006144 132
467 3300003284 Ga0006773J48901_13709 Ga0006773J48901_137091 132
468 3300003285 Ga0007423J48922_100034 Ga0007423J48922_1000341 132
469 3300003305 Ga0006770J48903_1038806 Ga0006770J48903_10388061 132
470 3300003559 Ga0007427J51700_104765 Ga0007427J51700_1047651 132
471 3300003567 Ga0006554J51385_1034793 Ga0006554J51385_10347931 132
472 3300003568 Ga0006781J51513_1008175 Ga0006781J51513_10081751 132
473 3300003574 Ga0007410J51695_1083441 Ga0007410J51695_10834412 132
474 3300003578 Ga0006562J51391_1016567 Ga0006562J51391_10165676 132
475 3300003578 Ga0006562J51391_1016574 Ga0006562J51391_10165746 132
476 3300003735 Ga0006780_1007001 Ga0006780_10070013 132
477 3300003752 Ga0055539_1016041 Ga0055539_10160412 132
478 3300003756 Ga0055533_1000001 Ga0055533_10000011676 132
479 3300003760 Ga0055527_1000017 Ga0055527_100001750 132
480 3300003762 Ga0055542_1000044 Ga0055542_100004450 132
481 3300003763 Ga0055529_1000279 Ga0055529_10002795 132
482 3300003763 Ga0055529_1016596 Ga0055529_10165962 132
483 3300003841 Ga0055541_1000889 Ga0055541_10008896 132
484 3300004800 Ga0058861_11949457 Ga0058861_119494573 132
485 3300005288 Ga0065714_10067377 Ga0065714_100673779 132
486 3300005327 Ga0070658_10034660 Ga0070658_100346606 132
487 3300005327 Ga0070658_10122166 Ga0070658_101221664 132
488 3300005327 Ga0070658_10363008 Ga0070658_103630082 132
489 3300005327 Ga0070658_10705701 Ga0070658_107057012 132
490 3300005329 Ga0070683_100097167 Ga0070683_1000971674 132
491 3300005329 Ga0070683_100186250 Ga0070683_1001862505 132
492 3300005331 Ga0070670_100092850 Ga0070670_1000928504 132
493 3300005331 Ga0070670_100475220 Ga0070670_1004752203 132
494 3300005337 Ga0070682_100071596 Ga0070682_1000715962 132
495 3300005337 Ga0070682_100086115 Ga0070682_1000861154 132
496 3300005337 Ga0070682_100108095 Ga0070682_1001080953 132
497 3300005337 Ga0070682_100190820 Ga0070682_1001908202 132
498 3300005337 Ga0070682_100343921 Ga0070682_1003439211 132
499 3300005337 Ga0070682_101152976 Ga0070682_1011529762 132
500 3300005338 Ga0068868_100427436 Ga0068868_1004274362 132
501 3300005339 Ga0070660_100689724 Ga0070660_1006897242 132
502 3300005339 Ga0070660_100804503 Ga0070660_1008045031 132
503 3300005340 Ga0070689_101211672 Ga0070689_1012116721 132
504 3300005343 Ga0070687_100073840 Ga0070687_1000738402 132
505 3300005343 Ga0070687_101170186 Ga0070687_1011701861 132
506 3300005345 Ga0070692_10288979 Ga0070692_102889792 132
507 3300005345 Ga0070692_10453038 Ga0070692_104530382 132
508 3300005347 Ga0070668_100021493 Ga0070668_1000214932 132
509 3300005347 Ga0070668_100107864 Ga0070668_1001078643 132
510 3300005347 Ga0070668_100182623 Ga0070668_1001826233 132
511 3300005347 Ga0070668_100693306 Ga0070668_1006933062 132
512 3300005353 Ga0070669_100462463 Ga0070669_1004624632 132
513 3300005354 Ga0070675_100729324 Ga0070675_1007293242 132
514 3300005355 Ga0070671_101172590 Ga0070671_1011725901 132
515 3300005356 Ga0070674_100503008 Ga0070674_1005030082 132
516 3300005364 Ga0070673_102360212 Ga0070673_1023602121 132
517 3300005366 Ga0070659_100111399 Ga0070659_1001113994 132
518 3300005366 Ga0070659_100640384 Ga0070659_1006403842 132
519 3300005366 Ga0070659_101193347 Ga0070659_1011933471 132
520 3300005367 Ga0070667_100078188 Ga0070667_1000781883 132
521 3300005367 Ga0070667_100141430 Ga0070667_1001414304 132
522 3300005440 Ga0070705_100008713 Ga0070705_1000087136 132
523 3300005441 Ga0070700_100129553 Ga0070700_1001295533 132
524 3300005441 Ga0070700_100679643 Ga0070700_1006796431 132
525 3300005441 Ga0070700_100845956 Ga0070700_1008459561 132
526 3300005455 Ga0070663_100094024 Ga0070663_1000940245 132
527 3300005455 Ga0070663_100517071 Ga0070663_1005170713 132
528 3300005455 Ga0070663_100586580 Ga0070663_1005865802 132
529 3300005455 Ga0070663_100679118 Ga0070663_1006791182 132
530 3300005455 Ga0070663_100725569 Ga0070663_1007255692 132
531 3300005456 Ga0070678_100077225 Ga0070678_1000772254 132
532 3300005456 Ga0070678_100341599 Ga0070678_1003415991 132
533 3300005456 Ga0070678_100346748 Ga0070678_1003467483 132
534 3300005456 Ga0070678_100611851 Ga0070678_1006118512 132
535 3300005456 Ga0070678_100667822 Ga0070678_1006678221 132
536 3300005456 Ga0070678_101700126 Ga0070678_1017001261 132
537 3300005457 Ga0070662_100739347 Ga0070662_1007393471 132
538 3300005458 Ga0070681_10708312 Ga0070681_107083122 132
539 3300005459 Ga0068867_101001609 Ga0068867_1010016092 132
540 3300005459 Ga0068867_101303255 Ga0068867_1013032551 132
541 3300005466 Ga0070685_11068274 Ga0070685_110682741 132
542 3300005466 Ga0070685_11485567 Ga0070685_114855671 132
543 3300005530 Ga0070679_100429772 Ga0070679_1004297723 132
544 3300005530 Ga0070679_100459000 Ga0070679_1004590002 132
545 3300005535 Ga0070684_100296354 Ga0070684_1002963543 132
546 3300005539 Ga0068853_100470502 Ga0068853_1004705021 132
547 3300005546 Ga0070696_100383610 Ga0070696_1003836103 132
548 3300005547 Ga0070693_100025993 Ga0070693_1000259934 132
549 3300005548 Ga0070665_100266394 Ga0070665_1002663943 132
550 3300005548 Ga0070665_100338661 Ga0070665_1003386612 132
551 3300005548 Ga0070665_100537694 Ga0070665_1005376942 132
552 3300005548 Ga0070665_101281850 Ga0070665_1012818502 132
553 3300005548 Ga0070665_101413489 Ga0070665_1014134892 132
554 3300005563 Ga0068855_100128220 Ga0068855_1001282203 132
555 3300005563 Ga0068855_102152786 Ga0068855_1021527862 132
556 3300005564 Ga0070664_101251127 Ga0070664_1012511272 132
557 3300005577 Ga0068857_100703026 Ga0068857_1007030262 132
558 3300005577 Ga0068857_100876349 Ga0068857_1008763492 132
559 3300005614 Ga0068856_100074941 Ga0068856_1000749412 132
560 3300005614 Ga0068856_100372589 Ga0068856_1003725892 132
561 3300005615 Ga0070702_100001851 Ga0070702_10000185111 132
562 3300005615 Ga0070702_100233423 Ga0070702_1002334231 132
563 3300005616 Ga0068852_100321047 Ga0068852_1003210472 132
564 3300005616 Ga0068852_101215322 Ga0068852_1012153222 132
565 3300005618 Ga0068864_100533450 Ga0068864_1005334502 132
566 3300005718 Ga0068866_10051130 Ga0068866_100511303 132
567 3300005718 Ga0068866_10267182 Ga0068866_102671821 132
568 3300005718 Ga0068866_10333666 Ga0068866_103336661 132
569 3300005719 Ga0068861_100260323 Ga0068861_1002603233 132
570 3300005840 Ga0068870_10019739 Ga0068870_100197394 132
571 3300005840 Ga0068870_10139115 Ga0068870_101391152 132
572 3300005840 Ga0068870_10262816 Ga0068870_102628161 132
573 3300005841 Ga0068863_100788022 Ga0068863_1007880222 132
574 3300005842 Ga0068858_101842406 Ga0068858_1018424061 132
575 3300005843 Ga0068860_100599304 Ga0068860_1005993042 132
576 3300005843 Ga0068860_100765678 Ga0068860_1007656783 132
577 3300005844 Ga0068862_100094567 Ga0068862_1000945676 132
578 3300005937 Ga0081455_10001192 Ga0081455_1000119229 132
579 3300006028 Ga0070717_11160806 Ga0070717_111608061 132
580 3300006038 Ga0075365_10029877 Ga0075365_100298777 132
581 3300006042 Ga0075368_10016248 Ga0075368_100162483 132
582 3300006042 Ga0075368_10352335 Ga0075368_103523351 132
583 3300006048 Ga0075363_100050849 Ga0075363_1000508493 132
584 3300006051 Ga0075364_10021121 Ga0075364_100211215 132
585 3300006051 Ga0075364_10027461 Ga0075364_100274614 132
586 3300006051 Ga0075364_10077143 Ga0075364_100771433 132
587 3300006051 Ga0075364_10135812 Ga0075364_101358122 132
588 3300006051 Ga0075364_10172148 Ga0075364_101721483 132
589 3300006178 Ga0075367_10009009 Ga0075367_1000900911 132
590 3300006178 Ga0075367_10649143 Ga0075367_106491432 132
591 3300006186 Ga0075369_10057201 Ga0075369_100572012 132
592 3300006186 Ga0075369_10347398 Ga0075369_103473982 132
593 3300006186 Ga0075369_10406876 Ga0075369_104068761 132
594 3300006195 Ga0075366_10045808 Ga0075366_100458082 132
595 3300006195 Ga0075366_10145844 Ga0075366_101458443 132
596 3300006237 Ga0097621_100580692 Ga0097621_1005806922 132
597 3300006237 Ga0097621_101417960 Ga0097621_1014179601 132
598 3300006353 Ga0075370_10015347 Ga0075370_100153476 132
599 3300006353 Ga0075370_10077989 Ga0075370_100779893 132
600 3300006353 Ga0075370_10096038 Ga0075370_100960382 132
601 3300006353 Ga0075370_10346039 Ga0075370_103460393 132
602 3300006353 Ga0075370_10598296 Ga0075370_105982962 132
603 3300006358 Ga0068871_100523076 Ga0068871_1005230763 132
604 3300006844 Ga0075428_100368871 Ga0075428_1003688713 132
605 3300006846 Ga0075430_100297500 Ga0075430_1002975002 132
606 3300006881 Ga0068865_100311213 Ga0068865_1003112132 132
607 3300009011 Ga0105251_10195452 Ga0105251_101954522 132
608 3300009036 Ga0105244_10004765 Ga0105244_1000476513 132
609 3300009036 Ga0105244_10036504 Ga0105244_100365043 132
610 3300009036 Ga0105244_10147938 Ga0105244_101479382 132
611 3300009036 Ga0105244_10158798 Ga0105244_101587983 132
612 3300009036 Ga0105244_10278017 Ga0105244_102780172 132
613 3300009093 Ga0105240_10356254 Ga0105240_103562543 132
614 3300009094 Ga0111539_10467874 Ga0111539_104678742 132
615 3300009094 Ga0111539_11004908 Ga0111539_110049082 132
616 3300009098 Ga0105245_10165196 Ga0105245_101651964 132
617 3300009098 Ga0105245_10279579 Ga0105245_102795792 132
618 3300009101 Ga0105247_11068914 Ga0105247_110689141 132
619 3300009101 Ga0105247_11202537 Ga0105247_112025372 132
620 3300009148 Ga0105243_10044746 Ga0105243_100447463 132
621 3300009148 Ga0105243_10071898 Ga0105243_100718983 132
622 3300009148 Ga0105243_10097933 Ga0105243_100979334 132
623 3300009148 Ga0105243_10236531 Ga0105243_102365314 132
624 3300009148 Ga0105243_10375421 Ga0105243_103754211 132
625 3300009148 Ga0105243_10569588 Ga0105243_105695883 132
626 3300009148 Ga0105243_10725983 Ga0105243_107259832 132
627 3300009174 Ga0105241_10152358 Ga0105241_101523584 132
628 3300009174 Ga0105241_10822900 Ga0105241_108229001 132
629 3300009176 Ga0105242_10109566 Ga0105242_101095662 132
630 3300009176 Ga0105242_10189584 Ga0105242_101895841 132
631 3300009545 Ga0105237_10111613 Ga0105237_101116134 132
632 3300009545 Ga0105237_11133241 Ga0105237_111332412 132
633 3300009545 Ga0105237_11353180 Ga0105237_113531801 132
634 3300009551 Ga0105238_10303840 Ga0105238_103038401 132
635 3300009551 Ga0105238_11970814 Ga0105238_119708141 132
636 3300009553 Ga0105249_10022697 Ga0105249_100226978 132
637 3300009553 Ga0105249_10121487 Ga0105249_101214874 132
638 3300009553 Ga0105249_10192852 Ga0105249_101928522 132
639 3300009553 Ga0105249_10976454 Ga0105249_109764541 132
640 3300010375 Ga0105239_11090066 Ga0105239_110900662 132
641 3300011119 Ga0105246_10170900 Ga0105246_101709004 132
642 3300011119 Ga0105246_10258150 Ga0105246_102581503 132
643 3300011119 Ga0105246_10700586 Ga0105246_107005862 132
644 3300012475 Ga0157317_1001612 Ga0157317_10016122 132
645 3300012478 Ga0157328_1000183 Ga0157328_10001832 132
646 3300012491 Ga0157329_1003604 Ga0157329_10036043 132
647 3300012491 Ga0157329_1009143 Ga0157329_10091432 132
648 3300012503 Ga0157313_1000883 Ga0157313_10008832 132
649 3300012507 Ga0157342_1038881 Ga0157342_10388811 132
650 3300012508 Ga0157315_1000437 Ga0157315_10004375 132
651 3300013044 Ga0154019_134908 Ga0154019_1349082 132
652 3300013100 Ga0157373_10797706 Ga0157373_107977062 132
653 3300013102 Ga0157371_10024138 Ga0157371_100241385 132
654 3300013102 Ga0157371_10173689 Ga0157371_101736892 132
655 3300013102 Ga0157371_10683145 Ga0157371_106831451 132
656 3300013104 Ga0157370_10093580 Ga0157370_100935802 132
657 3300013104 Ga0157370_10138272 Ga0157370_101382722 132
658 3300013104 Ga0157370_10496725 Ga0157370_104967252 132
659 3300013105 Ga0157369_10002930 Ga0157369_1000293023 132
660 3300013105 Ga0157369_10102675 Ga0157369_101026756 132
661 3300013105 Ga0157369_10235938 Ga0157369_102359382 132
662 3300013105 Ga0157369_10622322 Ga0157369_106223222 132
663 3300013105 Ga0157369_10691367 Ga0157369_106913673 132
664 3300013297 Ga0157378_11669706 Ga0157378_116697061 132
665 3300013306 Ga0163162_10138655 Ga0163162_101386554 132
666 3300013306 Ga0163162_10211924 Ga0163162_102119244 132
667 3300013306 Ga0163162_10719486 Ga0163162_107194863 132
668 3300013307 Ga0157372_10080192 Ga0157372_100801926 132
669 3300013307 Ga0157372_10221913 Ga0157372_102219134 132
670 3300013307 Ga0157372_10227095 Ga0157372_102270952 132
671 3300013307 Ga0157372_10234514 Ga0157372_102345144 132
672 3300013307 Ga0157372_12779129 Ga0157372_127791291 132
673 3300013308 Ga0157375_10404844 Ga0157375_104048442 132
674 3300013308 Ga0157375_10649888 Ga0157375_106498882 132
675 3300013308 Ga0157375_13649035 Ga0157375_136490351 132
676 3300014325 Ga0163163_10735395 Ga0163163_107353952 132
677 3300014326 Ga0157380_10080206 Ga0157380_100802062 132
678 3300014326 Ga0157380_10216315 Ga0157380_102163152 132
679 3300014497 Ga0182008_10082236 Ga0182008_100822361 132
680 3300014968 Ga0157379_11889702 Ga0157379_118897022 132
681 3300017792 Ga0163161_10050902 Ga0163161_100509025 132
682 3300017792 Ga0163161_10058703 Ga0163161_100587032 132
683 3300017792 Ga0163161_10076665 Ga0163161_100766655 132
684 3300017792 Ga0163161_10131187 Ga0163161_101311872 132
685 3300017792 Ga0163161_10204196 Ga0163161_102041962 132
686 3300020069 Ga0197907_10062010 Ga0197907_100620101 132
687 3300020069 Ga0197907_10308043 Ga0197907_103080436 132
688 3300020069 Ga0197907_10310388 Ga0197907_103103882 132
689 3300020069 Ga0197907_11084650 Ga0197907_110846502 132
690 3300020069 Ga0197907_11198837 Ga0197907_111988374 132
691 3300020070 Ga0206356_10227615 Ga0206356_102276153 132
692 3300020070 Ga0206356_10876277 Ga0206356_108762771 132
693 3300020075 Ga0206349_1087569 Ga0206349_10875692 132
694 3300020075 Ga0206349_1307013 Ga0206349_13070131 132
695 3300020076 Ga0206355_1109217 Ga0206355_11092174 132
696 3300020076 Ga0206355_1201553 Ga0206355_12015531 132
697 3300020076 Ga0206355_1696798 Ga0206355_16967983 132
698 3300020077 Ga0206351_10684251 Ga0206351_106842512 132
699 3300020077 Ga0206351_10726105 Ga0206351_107261052 132
700 3300020077 Ga0206351_10855438 Ga0206351_108554382 132
701 3300020078 Ga0206352_10051993 Ga0206352_100519932 132
702 3300020078 Ga0206352_10228094 Ga0206352_102280943 132
703 3300020080 Ga0206350_10274734 Ga0206350_102747342 132
704 3300020080 Ga0206350_10516798 Ga0206350_105167982 132
705 3300020080 Ga0206350_10985270 Ga0206350_109852706 132
706 3300020081 Ga0206354_10548741 Ga0206354_1054874111 132
707 3300020081 Ga0206354_10731429 Ga0206354_107314293 132
708 3300020081 Ga0206354_11455383 Ga0206354_114553831 132
709 3300020082 Ga0206353_10735845 Ga0206353_107358452 132
710 3300020082 Ga0206353_11781331 Ga0206353_117813312 132
711 3300022467 Ga0224712_10032350 Ga0224712_100323504 132
712 3300022467 Ga0224712_10254296 Ga0224712_102542962 132
713 3300023309 Ga0256744_106767 Ga0256744_1067672 132
714 3300025225 Ga0209566_100066 Ga0209566_100066151 132
715 3300025226 Ga0209674_100001 Ga0209674_1000011679 132
716 3300025228 Ga0209672_100039 Ga0209672_10003950 132
717 3300025230 Ga0209563_100001 Ga0209563_1000011679 132
718 3300025231 Ga0207427_100042 Ga0207427_10004237 132
719 3300025242 Ga0209258_102672 Ga0209258_1026724 132
720 3300025246 Ga0209646_1000013 Ga0209646_1000013291 132
721 3300025246 Ga0209646_1000014 Ga0209646_100001484 132
722 3300025253 Ga0209677_100001 Ga0209677_1000011679 132
723 3300025254 Ga0209148_1000004 Ga0209148_100000450 132
724 3300025261 Ga0209233_1000001 Ga0209233_10000011123 132
725 3300025272 Ga0209455_1000117 Ga0209455_1000117183 132
726 3300025272 Ga0209455_1009604 Ga0209455_10096042 132
727 3300025728 Ga0207655_1000386 Ga0207655_100038626 132
728 3300025893 Ga0207682_10009968 Ga0207682_100099687 132
729 3300025899 Ga0207642_10080673 Ga0207642_100806733 132
730 3300025900 Ga0207710_10389211 Ga0207710_103892112 132
731 3300025901 Ga0207688_10235741 Ga0207688_102357413 132
732 3300025901 Ga0207688_10237116 Ga0207688_102371162 132
733 3300025901 Ga0207688_10540840 Ga0207688_105408402 132
734 3300025901 Ga0207688_11004355 Ga0207688_110043551 132
735 3300025904 Ga0207647_10033365 Ga0207647_100333653 132
736 3300025904 Ga0207647_10090900 Ga0207647_100909002 132
737 3300025904 Ga0207647_10139337 Ga0207647_101393372 132
738 3300025904 Ga0207647_10157012 Ga0207647_101570123 132
739 3300025908 Ga0207643_10024095 Ga0207643_100240954 132
740 3300025908 Ga0207643_10153512 Ga0207643_101535123 132
741 3300025908 Ga0207643_10160918 Ga0207643_101609183 132
742 3300025909 Ga0207705_10000001 Ga0207705_10000001687 132
743 3300025909 Ga0207705_10062190 Ga0207705_100621906 132
744 3300025909 Ga0207705_10100818 Ga0207705_101008184 132
745 3300025909 Ga0207705_10221156 Ga0207705_102211562 132
746 3300025909 Ga0207705_10796736 Ga0207705_107967361 132
747 3300025911 Ga0207654_10511051 Ga0207654_105110512 132
748 3300025914 Ga0207671_10278854 Ga0207671_102788542 132
749 3300025914 Ga0207671_10443025 Ga0207671_104430252 132
750 3300025918 Ga0207662_10066861 Ga0207662_100668614 132
751 3300025921 Ga0207652_11213675 Ga0207652_112136751 132
752 3300025924 Ga0207694_10686020 Ga0207694_106860202 132
753 3300025924 Ga0207694_10754374 Ga0207694_107543742 132
754 3300025924 Ga0207694_11210858 Ga0207694_112108582 132
755 3300025925 Ga0207650_10344002 Ga0207650_103440023 132
756 3300025926 Ga0207659_10912513 Ga0207659_109125131 132
757 3300025926 Ga0207659_11764418 Ga0207659_117644181 132
758 3300025927 Ga0207687_10176162 Ga0207687_101761621 132
759 3300025929 Ga0207664_10536996 Ga0207664_105369963 132
760 3300025932 Ga0207690_10356579 Ga0207690_103565793 132
761 3300025932 Ga0207690_10643393 Ga0207690_106433931 132
762 3300025933 Ga0207706_10977040 Ga0207706_109770401 132
763 3300025934 Ga0207686_10030825 Ga0207686_100308254 132
764 3300025935 Ga0207709_10013505 Ga0207709_100135053 132
765 3300025935 Ga0207709_10068641 Ga0207709_100686413 132
766 3300025935 Ga0207709_10224503 Ga0207709_102245033 132
767 3300025936 Ga0207670_10600666 Ga0207670_106006662 132
768 3300025937 Ga0207669_10062330 Ga0207669_100623303 132
769 3300025937 Ga0207669_10074422 Ga0207669_100744225 132
770 3300025937 Ga0207669_10156012 Ga0207669_101560122 132
771 3300025938 Ga0207704_10066080 Ga0207704_100660803 132
772 3300025939 Ga0207665_10256622 Ga0207665_102566222 132
773 3300025939 Ga0207665_10682858 Ga0207665_106828581 132
774 3300025940 Ga0207691_10183912 Ga0207691_101839122 132
775 3300025940 Ga0207691_10414962 Ga0207691_104149622 132
776 3300025941 Ga0207711_11352916 Ga0207711_113529161 132
777 3300025942 Ga0207689_10719463 Ga0207689_107194632 132
778 3300025944 Ga0207661_10750984 Ga0207661_107509841 132
779 3300025944 Ga0207661_10838677 Ga0207661_108386771 132
780 3300025949 Ga0207667_10035600 Ga0207667_1003560011 132
781 3300025961 Ga0207712_10183651 Ga0207712_101836511 132
782 3300025961 Ga0207712_10205800 Ga0207712_102058003 132
783 3300025961 Ga0207712_10259385 Ga0207712_102593853 132
784 3300025972 Ga0207668_10265855 Ga0207668_102658552 132
785 3300025972 Ga0207668_10268126 Ga0207668_102681262 132
786 3300025972 Ga0207668_10313931 Ga0207668_103139313 132
787 3300025972 Ga0207668_10785562 Ga0207668_107855621 132
788 3300025986 Ga0207658_10132805 Ga0207658_101328053 132
789 3300025986 Ga0207658_10249534 Ga0207658_102495342 132
790 3300025986 Ga0207658_11049665 Ga0207658_110496652 132
791 3300026023 Ga0207677_10034485 Ga0207677_100344856 132
792 3300026023 Ga0207677_10351155 Ga0207677_103511551 132
793 3300026023 Ga0207677_10619768 Ga0207677_106197682 132
794 3300026035 Ga0207703_10624626 Ga0207703_106246263 132
795 3300026041 Ga0207639_10135861 Ga0207639_101358612 132
796 3300026041 Ga0207639_10346873 Ga0207639_103468732 132
797 3300026067 Ga0207678_10101275 Ga0207678_101012754 132
798 3300026067 Ga0207678_10168701 Ga0207678_101687014 132
799 3300026067 Ga0207678_10186379 Ga0207678_101863793 132
800 3300026067 Ga0207678_10224251 Ga0207678_102242513 132
801 3300026067 Ga0207678_10244885 Ga0207678_102448852 132
802 3300026067 Ga0207678_10333745 Ga0207678_103337453 132
803 3300026067 Ga0207678_10699742 Ga0207678_106997422 132
804 3300026067 Ga0207678_11197319 Ga0207678_111973192 132
805 3300026075 Ga0207708_10386117 Ga0207708_103861171 132
806 3300026075 Ga0207708_10803938 Ga0207708_108039382 132
807 3300026075 Ga0207708_10805618 Ga0207708_108056182 132
808 3300026078 Ga0207702_10282130 Ga0207702_102821302 132
809 3300026088 Ga0207641_11084385 Ga0207641_110843852 132
810 3300026088 Ga0207641_11285661 Ga0207641_112856612 132
811 3300026089 Ga0207648_10203985 Ga0207648_102039854 132
812 3300026095 Ga0207676_10294275 Ga0207676_102942753 132
813 3300026116 Ga0207674_12179388 Ga0207674_121793881 132
814 3300026118 Ga0207675_100127246 Ga0207675_1001272464 132
815 3300026118 Ga0207675_100196139 Ga0207675_1001961392 132
816 3300026118 Ga0207675_100227704 Ga0207675_1002277044 132
817 3300026121 Ga0207683_10062314 Ga0207683_100623144 132
818 3300026121 Ga0207683_10125844 Ga0207683_101258444 132
819 3300026121 Ga0207683_10781348 Ga0207683_107813481 132
820 3300026121 Ga0207683_11084084 Ga0207683_110840842 132
821 3300026121 Ga0207683_11247654 Ga0207683_112476541 132
822 3300026142 Ga0207698_10231830 Ga0207698_102318302 132
823 3300026142 Ga0207698_10553434 Ga0207698_105534342 132
824 3300026142 Ga0207698_10805573 Ga0207698_108055732 132
825 3300026142 Ga0207698_12566702 Ga0207698_125667022 132
826 3300027617 Ga0210002_1095674 Ga0210002_10956741 132
827 3300027866 Ga0209813_10013478 Ga0209813_100134784 132
828 3300027876 Ga0209974_10026419 Ga0209974_100264194 132
829 3300027876 Ga0209974_10453051 Ga0209974_104530511 132
830 3300027907 Ga0207428_10438399 Ga0207428_104383992 132
831 3300028379 Ga0268266_11315133 Ga0268266_113151332 132
832 3300028380 Ga0268265_10088033 Ga0268265_100880332 132
833 3300028381 Ga0268264_10143805 Ga0268264_101438053 132
834 3300028794 Ga0307515_10146200 Ga0307515_101462004 132
835 3300029277 Ga0311001_1073003 Ga0311001_10730032 132
836 3300030744 Ga0316181_1005005 Ga0316181_10050052 132
837 3300030745 Ga0316182_1160810 Ga0316182_11608103 132
838 3300031456 Ga0307513_10133255 Ga0307513_101332555 132
839 3300031456 Ga0307513_10522518 Ga0307513_105225183 132
840 3300031548 Ga0307408_100023235 Ga0307408_1000232354 132
841 3300031548 Ga0307408_100151605 Ga0307408_1001516054 132
842 3300031548 Ga0307408_100547946 Ga0307408_1005479463 132
843 3300031548 Ga0307408_101253362 Ga0307408_1012533622 132
844 3300031665 Ga0316575_10000071 Ga0316575_1000007122 132
845 3300031731 Ga0307405_10085747 Ga0307405_100857474 132
846 3300031731 Ga0307405_10102355 Ga0307405_101023554 132
847 3300031731 Ga0307405_10153486 Ga0307405_101534862 132
848 3300031731 Ga0307405_10246824 Ga0307405_102468242 132
849 3300031731 Ga0307405_10442717 Ga0307405_104427172 132
850 3300031731 Ga0307405_10525006 Ga0307405_105250062 132
851 3300031731 Ga0307405_10684829 Ga0307405_106848292 132
852 3300031731 Ga0307405_10999883 Ga0307405_109998832 132
853 3300031824 Ga0307413_10149594 Ga0307413_101495942 132
854 3300031824 Ga0307413_10780691 Ga0307413_107806912 132
855 3300031824 Ga0307413_10824157 Ga0307413_108241571 132
856 3300031824 Ga0307413_11119299 Ga0307413_111192992 132
857 3300031852 Ga0307410_10008640 Ga0307410_100086409 132
858 3300031852 Ga0307410_10020536 Ga0307410_100205362 132
859 3300031852 Ga0307410_10192093 Ga0307410_101920931 132
860 3300031852 Ga0307410_10384323 Ga0307410_103843232 132
861 3300031852 Ga0307410_10602501 Ga0307410_106025012 132
862 3300031852 Ga0307410_10974031 Ga0307410_109740312 132
863 3300031901 Ga0307406_10000938 Ga0307406_1000093815 132
864 3300031901 Ga0307406_10017666 Ga0307406_100176665 132
865 3300031901 Ga0307406_10032617 Ga0307406_100326174 132
866 3300031901 Ga0307406_10050533 Ga0307406_100505336 132
867 3300031901 Ga0307406_10056914 Ga0307406_100569143 132
868 3300031901 Ga0307406_10084412 Ga0307406_100844124 132
869 3300031901 Ga0307406_10581971 Ga0307406_105819713 132
870 3300031901 Ga0307406_11785783 Ga0307406_117857831 132
871 3300031903 Ga0307407_10013519 Ga0307407_100135197 132
872 3300031903 Ga0307407_10085533 Ga0307407_100855335 132
873 3300031903 Ga0307407_10104312 Ga0307407_101043124 132
874 3300031903 Ga0307407_10196927 Ga0307407_101969272 132
875 3300031903 Ga0307407_10226071 Ga0307407_102260712 132
876 3300031903 Ga0307407_10457360 Ga0307407_104573602 132
877 3300031903 Ga0307407_10613355 Ga0307407_106133552 132
878 3300031911 Ga0307412_10140805 Ga0307412_101408052 132
879 3300031911 Ga0307412_10231849 Ga0307412_102318493 132
880 3300031911 Ga0307412_10546480 Ga0307412_105464802 132
881 3300031911 Ga0307412_10561526 Ga0307412_105615262 132
882 3300031911 Ga0307412_10870322 Ga0307412_108703221 132
883 3300031995 Ga0307409_100001225 Ga0307409_1000012259 132
884 3300031995 Ga0307409_100189262 Ga0307409_1001892624 132
885 3300031995 Ga0307409_100255938 Ga0307409_1002559382 132
886 3300031995 Ga0307409_100413745 Ga0307409_1004137452 132
887 3300031995 Ga0307409_100730058 Ga0307409_1007300582 132
888 3300031995 Ga0307409_100733608 Ga0307409_1007336081 132
889 3300031995 Ga0307409_100804016 Ga0307409_1008040161 132
890 3300031995 Ga0307409_101292185 Ga0307409_1012921851 132
891 3300031995 Ga0307409_101464559 Ga0307409_1014645592 132
892 3300031995 Ga0307409_102046551 Ga0307409_1020465511 132
893 3300032002 Ga0307416_100003637 Ga0307416_10000363710 132
894 3300032002 Ga0307416_100191288 Ga0307416_1001912882 132
895 3300032002 Ga0307416_100449570 Ga0307416_1004495702 132
896 3300032002 Ga0307416_100508408 Ga0307416_1005084082 132
897 3300032002 Ga0307416_100737369 Ga0307416_1007373692 132
898 3300032002 Ga0307416_101082049 Ga0307416_1010820492 132
899 3300032002 Ga0307416_101199944 Ga0307416_1011999442 132
900 3300032002 Ga0307416_103033382 Ga0307416_1030333821 132
901 3300032004 Ga0307414_10070354 Ga0307414_100703542 132
902 3300032004 Ga0307414_10116419 Ga0307414_101164194 132
903 3300032004 Ga0307414_10306241 Ga0307414_103062413 132
904 3300032004 Ga0307414_10433077 Ga0307414_104330772 132
905 3300032004 Ga0307414_10439654 Ga0307414_104396542 132
906 3300032004 Ga0307414_10582372 Ga0307414_105823722 132
907 3300032004 Ga0307414_10654667 Ga0307414_106546672 132
908 3300032004 Ga0307414_10798664 Ga0307414_107986642 132
909 3300032004 Ga0307414_10871294 Ga0307414_108712942 132
910 3300032004 Ga0307414_12310376 Ga0307414_123103761 132
911 3300032005 Ga0307411_10149613 Ga0307411_101496133 132
912 3300032005 Ga0307411_10384118 Ga0307411_103841183 132
913 3300032005 Ga0307411_10641728 Ga0307411_106417282 132
914 3300032005 Ga0307411_11586400 Ga0307411_115864002 132
915 3300032126 Ga0307415_100092413 Ga0307415_1000924134 132
916 3300032126 Ga0307415_100131507 Ga0307415_1001315071 132
917 3300032126 Ga0307415_100307763 Ga0307415_1003077632 132
918 3300032126 Ga0307415_100404465 Ga0307415_1004044652 132
919 3300032126 Ga0307415_100586092 Ga0307415_1005860922 132
920 3300032126 Ga0307415_100706984 Ga0307415_1007069842 132
921 3300032126 Ga0307415_101687985 Ga0307415_1016879851 132
922 3300032168 Ga0316593_10004869 Ga0316593_100048697 132
923 3300032168 Ga0316593_10246891 Ga0316593_102468911 132
924 3300035090 Ga0373949_0157882 Ga0373949_0157882_90_488 132
925 3300035170 Ga0373943_0424743 Ga0373943_0424743_108_506 132
926 3300035242 Ga0373962_0038342 Ga0373962_0038342_859_1257 132
927 3300035695 Ga0373927_0585126 Ga0373927_0585126_287_685 132
928 3300037312 Ga0395899_0024632 Ga0395899_0024632_2710_3108 132
929 3300037312 Ga0395899_0181001 Ga0395899_0181001_20_418 132
930 3300037418 Ga0395900_0021670 Ga0395900_0021670_4684_5082 132
931 3300037418 Ga0395900_0175222 Ga0395900_0175222_587_985 132
932 3300037418 Ga0395900_0829268 Ga0395900_0829268_335_733 132
933 3300037418 Ga0395900_0996087 Ga0395900_0996087_49_447 132
934 3300037466 Ga0395898_0000381 Ga0395898_0000381_95553_95951 132
935 3300037466 Ga0395898_0024956 Ga0395898_0024956_4862_5260 132
936 3300037466 Ga0395898_0035678 Ga0395898_0035678_566_964 132
937 3300037466 Ga0395898_0434759 Ga0395898_0434759_628_1026 132
938 3300037466 Ga0395898_1402426 Ga0395898_1402426_60_458 132
939 3300037471 Ga0395905_0565965 Ga0395905_0565965_32_430 132
940 3300038443 Ga0395901_0011417 Ga0395901_0011417_3878_4276 132
941 3300038443 Ga0395901_0018326 Ga0395901_0018326_3489_3887 132
942 3300038443 Ga0395901_0043313 Ga0395901_0043313_2578_2976 132
943 3300038443 Ga0395901_0115199 Ga0395901_0115199_1277_1675 132
944 3300038443 Ga0395901_0477955 Ga0395901_0477955_254_652 132
945 3300041406 Ga0439439_0106050 Ga0439439_0106050_133_531 132
946 3300041408 Ga0439453_0024091 Ga0439453_0024091_552_950 132
947 3300041411 Ga0439466_0096364 Ga0439466_0096364_500_907 132
948 3300041413 Ga0439465_0104304 Ga0439465_0104304_42_449 132
949 3300041413 Ga0439465_0428718 Ga0439465_0428718_66_464 132
950 3300041441 Ga0451787_754476 Ga0451787_754476_509_907 132
951 3300041443 Ga0451789_0550523 Ga0451789_0550523_376_774 132
952 3300041443 Ga0451789_0613489 Ga0451789_0613489_124_522 132
953 3300041443 Ga0451789_1171264 Ga0451789_1171264_193_591 132
954 3300041444 Ga0451790_43972 Ga0451790_43972_54_452 132
955 3300041451 Ga0451791_0566873 Ga0451791_0566873_159_557 132
956 3300041451 Ga0451791_0685368 Ga0451791_0685368_451_849 132
957 3300041451 Ga0451791_1010988 Ga0451791_1010988_1195_1593 132
958 3300041452 Ga0451793_0340172 Ga0451793_0340172_564_962 132
959 3300041452 Ga0451793_1130005 Ga0451793_1130005_717_1124 132
960 3300041453 Ga0451797_1441145 Ga0451797_1441145_563_961 132
961 3300041456 Ga0451795_1171153 Ga0451795_1171153_146_544 132
962 3300041456 Ga0451795_1394395 Ga0451795_1394395_130_528 132
963 3300041458 Ga0451798_1030053 Ga0451798_1030053_124_522 132
964 3300041460 Ga0451802_0524866 Ga0451802_0524866_133_531 132
965 3300041460 Ga0451802_0968729 Ga0451802_0968729_174_572 132
966 3300041460 Ga0451802_1495406 Ga0451802_1495406_141_539 132
967 3300041460 Ga0451802_1764020 Ga0451802_1764020_1250_1657 132
968 3300041462 Ga0451806_756032 Ga0451806_756032_261_659 132
969 3300041463 Ga0451804_0655263 Ga0451804_0655263_351_749 132
970 3300041486 Ga0451807_1389725 Ga0451807_1389725_1438_1836 132
971 3300041486 Ga0451807_1401067 Ga0451807_1401067_57_455 132
972 3300041491 Ga0451833_0787441 Ga0451833_0787441_536_934 132
973 3300041491 Ga0451833_0940272 Ga0451833_0940272_664_1071 132
974 3300041491 Ga0451833_1014957 Ga0451833_1014957_726_1133 132
975 3300041492 Ga0451835_0499652 Ga0451835_0499652_130_528 132
976 3300041494 Ga0451837_0778344 Ga0451837_0778344_288_695 132
977 3300041494 Ga0451837_1096605 Ga0451837_1096605_1146_1553 132
978 3300041496 Ga0451839_0200150 Ga0451839_0200150_465_872 132
979 3300041496 Ga0451839_0717896 Ga0451839_0717896_127_525 132
980 3300041496 Ga0451839_1402782 Ga0451839_1402782_1015_1413 132
981 3300041501 Ga0451845_0205458 Ga0451845_0205458_167_574 132
982 3300041501 Ga0451845_0242461 Ga0451845_0242461_130_528 132
983 3300041507 Ga0451851_0078399 Ga0451851_0078399_316_714 132
984 3300041507 Ga0451851_1179869 Ga0451851_1179869_107_505 132
985 3300041509 Ga0451843_0454725 Ga0451843_0454725_893_1291 132
986 3300041509 Ga0451843_0931674 Ga0451843_0931674_74_472 132
987 3300041511 Ga0451855_1481772 Ga0451855_1481772_234_632 132
988 3300041512 Ga0451853_0425433 Ga0451853_0425433_637_1044 132
989 3300041997 Ga0439431_0019607 Ga0439431_0019607_517_924 132
990 3300041997 Ga0439431_0195508 Ga0439431_0195508_177_575 132
991 3300041999 Ga0439433_0037647 Ga0439433_0037647_475_873 132
992 3300042002 Ga0439442_077750 Ga0439442_077750_236_634 132
993 3300042006 Ga0439432_008227 Ga0439432_008227_2202_2609 132
994 3300042009 Ga0439451_100194 Ga0439451_100194_143_541 132
995 3300042010 Ga0439452_036323 Ga0439452_036323_540_947 132
996 3300042012 Ga0439455_0248429 Ga0439455_0248429_89_487 132
997 3300042014 Ga0439457_009641 Ga0439457_009641_1732_2130 132
998 3300042014 Ga0439457_013788 Ga0439457_013788_731_1129 132
999 3300042015 Ga0439462_0024189 Ga0439462_0024189_157_555 132
1000 3300042118 Ga0450914_047886 Ga0450914_047886_66_464 132
1001 3300042131 Ga0450894_025631 Ga0450894_025631_276_674 132
1002 3300042136 Ga0450900_002853 Ga0450900_002853_1440_1838 132
1003 3300042145 Ga0450906_018795 Ga0450906_018795_37_435 132
1004 3300042146 Ga0450907_004972 Ga0450907_004972_1197_1595 132
1005 3300042157 Ga0439458_0233677 Ga0439458_0233677_97_495 132
1006 3300042435 Ga0439434_0005739 Ga0439434_0005739_2458_2865 132
1007 3300042531 Ga0450918_005705 Ga0450918_005705_1349_1747 132
1008 3300044658 Ga0466972_0053616 Ga0466972_0053616_1305_1703 132
1009 3300044683 Ga0466965_0005112 Ga0466965_0005112_2553_2951 132
1010 3300044683 Ga0466965_0005702 Ga0466965_0005702_2905_3354 132
1011 3300044683 Ga0466965_0103092 Ga0466965_0103092_133_531 132
1012 3300044684 Ga0466966_0020615 Ga0466966_0020615_1355_1753 132
1013 3300044684 Ga0466966_0986897 Ga0466966_0986897_75_473 132
1014 3300044693 Ga0466961_0222654 Ga0466961_0222654_112_510 132
1015 3300044694 Ga0466963_0997249 Ga0466963_0997249_20_418 132
1016 3300044706 Ga0466964_0043493 Ga0466964_0043493_103_501 132
1017 3300044706 Ga0466964_0669198 Ga0466964_0669198_79_477 132
1018 3300044719 Ga0466971_0013185 Ga0466971_0013185_2839_3237 132
1019 3300044735 Ga0466968_0100908 Ga0466968_0100908_865_1263 132
1020 3300044765 Ga0466970_0000027 Ga0466970_0000027_11458_11856 132
1021 3300044765 Ga0466970_0116911 Ga0466970_0116911_139_537 132
1022 3300044765 Ga0466970_0375951 Ga0466970_0375951_13_411 132
1023 3300044765 Ga0466970_0416595 Ga0466970_0416595_286_684 132
1024 3300044765 Ga0466970_0877315 Ga0466970_0877315_47_445 132
1025 3300044842 Ga0466957_0015729 Ga0466957_0015729_3410_3808 132
1026 3300044842 Ga0466957_1186468 Ga0466957_1186468_88_486 132
1027 3300044901 Ga0466960_0017576 Ga0466960_0017576_1304_1702 132
1028 3300044901 Ga0466960_0045006 Ga0466960_0045006_1460_1879 132
1029 3300044901 Ga0466960_0135955 Ga0466960_0135955_687_1085 132
1030 3300044901 Ga0466960_0350286 Ga0466960_0350286_306_755 132
1031 3300044901 Ga0466960_0869752 Ga0466960_0869752_76_474 132
1032 3300045049 Ga0466959_0214509 Ga0466959_0214509_653_1051 132
1033 3300045049 Ga0466959_0409550 Ga0466959_0409550_105_503 132
1034 3300045049 Ga0466959_0455966 Ga0466959_0455966_98_517 132
1035 3300045836 Ga0466958_1083706 Ga0466958_1083706_50_448 132
1036 3300045976 Ga0466967_0257891 Ga0466967_0257891_500_898 132
1037 3300045976 Ga0466967_0405282 Ga0466967_0405282_35_433 132
1038 3300046455 Ga0495603_0313515 Ga0495603_0313515_231_629 132
1039 3300046459 Ga0495629_0474132 Ga0495629_0474132_328_726 132
1040 3300046460 Ga0495638_0114263 Ga0495638_0114263_803_1201 132
1041 3300046461 Ga0495641_0035689 Ga0495641_0035689_956_1354 132
1042 3300046461 Ga0495641_0048011 Ga0495641_0048011_1005_1403 132
1043 3300046461 Ga0495641_0063343 Ga0495641_0063343_258_656 132
1044 3300046461 Ga0495641_0149837 Ga0495641_0149837_136_534 132
1045 3300046462 Ga0495651_0614045 Ga0495651_0614045_273_671 132
1046 3300046462 Ga0495651_0644054 Ga0495651_0644054_156_554 132
1047 3300046463 Ga0495653_0135069 Ga0495653_0135069_27_425 132
1048 3300046471 Ga0495650_0065495 Ga0495650_0065495_317_715 132
1049 3300046471 Ga0495650_0070523 Ga0495650_0070523_905_1303 132
1050 3300046473 Ga0495582_0279176 Ga0495582_0279176_459_857 132
1051 3300046473 Ga0495582_0649277 Ga0495582_0649277_69_467 132
1052 3300046475 Ga0495639_0054995 Ga0495639_0054995_63_461 132
1053 3300046477 Ga0495664_0201137 Ga0495664_0201137_491_889 132
1054 3300046500 Ga0495596_0233999 Ga0495596_0233999_143_541 132
1055 3300046511 Ga0495608_0533013 Ga0495608_0533013_42_440 132
1056 3300046518 Ga0495631_0117084 Ga0495631_0117084_378_776 132
1057 3300046518 Ga0495631_0433999 Ga0495631_0433999_66_464 132
1058 3300046522 Ga0495643_0437973 Ga0495643_0437973_22_420 132
1059 3300046522 Ga0495643_0524340 Ga0495643_0524340_94_492 132
1060 3300046525 Ga0495663_0171817 Ga0495663_0171817_152_550 132
1061 3300046526 Ga0495666_0409851 Ga0495666_0409851_56_454 132
1062 3300046529 Ga0495652_0537954 Ga0495652_0537954_324_722 132
1063 3300046530 Ga0495654_0016801 Ga0495654_0016801_2133_2573 132
1064 3300046531 Ga0495665_0074242 Ga0495665_0074242_794_1192 132
1065 3300046533 Ga0495640_0481487 Ga0495640_0481487_38_436 132
1066 3300046538 Ga0495609_0086941 Ga0495609_0086941_277_675 132
1067 3300046538 Ga0495609_0155191 Ga0495609_0155191_96_536 132
1068 3300046543 Ga0495645_0009818 Ga0495645_0009818_6239_6637 132
1069 3300046543 Ga0495645_0139337 Ga0495645_0139337_748_1146 132
1070 3300046558 Ga0495633_0071159 Ga0495633_0071159_129_527 132
1071 3300046558 Ga0495633_0336722 Ga0495633_0336722_252_650 132
1072 3300046615 Ga0495656_0027599 Ga0495656_0027599_67_465 132
1073 3300046642 Ga0495634_0836279 Ga0495634_0836279_77_475 132
1074 3300046660 Ga0495625_0295344 Ga0495625_0295344_455_853 132
1075 3300046663 Ga0495635_0064597 Ga0495635_0064597_925_1323 132
1076 3300046663 Ga0495635_0334355 Ga0495635_0334355_477_875 132
1077 3300046674 Ga0495588_0475607 Ga0495588_0475607_215_613 132
1078 3300046674 Ga0495588_0505385 Ga0495588_0505385_123_521 132
1079 3300046691 Ga0495670_0039865 Ga0495670_0039865_1523_1921 132
1080 3300046694 Ga0495649_0580566 Ga0495649_0580566_109_516 132
1081 3300046810 Ga0495660_0358644 Ga0495660_0358644_58_456 132
1082 3300047317 Ga0495604_0303970 Ga0495604_0303970_166_564 132
1083 3300047318 Ga0495636_0066571 Ga0495636_0066571_417_824 132
1084 3300047444 Ga0495675_0299463 Ga0495675_0299463_135_533 132
1085 3300047447 Ga0495685_148217 Ga0495685_148217_158_556 132
1086 3300047673 Ga0495593_0216739 Ga0495593_0216739_169_567 132
1087 3300048903 Ga0496100_0004803 Ga0496100_0004803_6334_6732 132
1088 3300048903 Ga0496100_0005639 Ga0496100_0005639_3323_3742 132
1089 3300048903 Ga0496100_0241720 Ga0496100_0241720_582_980 132
1090 3300048903 Ga0496100_0539623 Ga0496100_0539623_58_456 132
1091 3300048903 Ga0496100_1408911 Ga0496100_1408911_38_436 132
1092 3300048904 Ga0496101_0002898 Ga0496101_0002898_7230_7628 132
1093 3300048904 Ga0496101_0008133 Ga0496101_0008133_6043_6462 132
1094 3300048904 Ga0496101_0191760 Ga0496101_0191760_502_900 132
1095 3300048904 Ga0496101_0289904 Ga0496101_0289904_735_1133 132
1096 3300048904 Ga0496101_0842652 Ga0496101_0842652_272_670 132
1097 3300048904 Ga0496101_1311354 Ga0496101_1311354_110_508 132
1098 3300048905 Ga0496102_0030623 Ga0496102_0030623_2660_3058 132
1099 3300048905 Ga0496102_0032510 Ga0496102_0032510_2775_3173 132
1100 3300048905 Ga0496102_0142933 Ga0496102_0142933_1344_1742 132
1101 3300048905 Ga0496102_0153529 Ga0496102_0153529_508_906 132
1102 3300048905 Ga0496102_0190689 Ga0496102_0190689_1103_1501 132
1103 3300048905 Ga0496102_0280685 Ga0496102_0280685_443_841 132
1104 3300048906 Ga0496103_0005136 Ga0496103_0005136_884_1282 132
1105 3300048906 Ga0496103_0012385 Ga0496103_0012385_1067_1486 132
1106 3300048906 Ga0496103_0066663 Ga0496103_0066663_1393_1791 132
1107 3300048906 Ga0496103_0439975 Ga0496103_0439975_345_743 132
1108 3300048907 Ga0496104_0003769 Ga0496104_0003769_9606_10025 132
1109 3300048907 Ga0496104_0044706 Ga0496104_0044706_2563_2961 132
1110 3300048907 Ga0496104_0331808 Ga0496104_0331808_927_1325 132
1111 3300048907 Ga0496104_0440159 Ga0496104_0440159_723_1121 132
1112 3300048907 Ga0496104_0681506 Ga0496104_0681506_168_566 132
1113 3300048908 Ga0496105_0005038 Ga0496105_0005038_5443_5862 132
1114 3300048908 Ga0496105_0727735 Ga0496105_0727735_194_592 132
1115 3300048908 Ga0496105_0838660 Ga0496105_0838660_274_672 132
1116 3300048909 Ga0496106_0216500 Ga0496106_0216500_352_750 132
1117 3300048910 Ga0496107_0001328 Ga0496107_0001328_6155_6553 132
1118 3300048910 Ga0496107_0104323 Ga0496107_0104323_1265_1684 132
1119 3300048910 Ga0496107_0221247 Ga0496107_0221247_715_1113 132
1120 3300048910 Ga0496107_0858167 Ga0496107_0858167_13_411 132
1121 3300048911 Ga0496108_0478114 Ga0496108_0478114_106_504 132
1122 3300048911 Ga0496108_1229856 Ga0496108_1229856_74_472 132
1123 3300048911 Ga0496108_1654766 Ga0496108_1654766_19_417 132
1124 3300048912 Ga0496109_0016841 Ga0496109_0016841_1786_2184 132
1125 3300048912 Ga0496109_0667101 Ga0496109_0667101_67_465 132
1126 3300048912 Ga0496109_1741895 Ga0496109_1741895_79_477 132
1127 3300048913 Ga0496110_0146636 Ga0496110_0146636_486_884 132
1128 3300048913 Ga0496110_0270447 Ga0496110_0270447_257_655 132
1129 3300048913 Ga0496110_0864200 Ga0496110_0864200_291_689 132
1130 3300048913 Ga0496110_1093964 Ga0496110_1093964_29_427 132
1131 3300048914 Ga0496111_0039015 Ga0496111_0039015_1400_1798 132
1132 3300048914 Ga0496111_0365330 Ga0496111_0365330_32_430 132
1133 3300048914 Ga0496111_0811053 Ga0496111_0811053_131_529 132
1134 3300048914 Ga0496111_1340515 Ga0496111_1340515_44_442 132
1135 3300048915 Ga0496112_0020079 Ga0496112_0020079_3907_4305 132
1136 3300048915 Ga0496112_1710298 Ga0496112_1710298_97_495 132
1137 3300048916 Ga0496113_0005620 Ga0496113_0005620_6247_6645 132
1138 3300048916 Ga0496113_0094246 Ga0496113_0094246_653_1051 132
1139 3300048916 Ga0496113_0219147 Ga0496113_0219147_509_907 132
1140 3300048917 Ga0496114_0011682 Ga0496114_0011682_2027_2446 132
1141 3300048917 Ga0496114_0066335 Ga0496114_0066335_65_463 132
1142 3300048917 Ga0496114_0069313 Ga0496114_0069313_2153_2551 132
1143 3300048917 Ga0496114_0110990 Ga0496114_0110990_1856_2254 132
1144 3300048917 Ga0496114_0140938 Ga0496114_0140938_1142_1540 132
1145 3300048917 Ga0496114_0293175 Ga0496114_0293175_978_1376 132
1146 3300048917 Ga0496114_0336485 Ga0496114_0336485_184_582 132
1147 3300048918 Ga0496115_0002702 Ga0496115_0002702_7470_7868 132
1148 3300048918 Ga0496115_0022436 Ga0496115_0022436_4223_4642 132
1149 3300048918 Ga0496115_0088708 Ga0496115_0088708_106_504 132
1150 3300048918 Ga0496115_0461865 Ga0496115_0461865_259_657 132
1151 3300048919 Ga0496116_0018694 Ga0496116_0018694_468_866 132
1152 3300048919 Ga0496116_0190459 Ga0496116_0190459_320_718 132
1153 3300048919 Ga0496116_0357589 Ga0496116_0357589_234_632 132
1154 3300048920 Ga0496117_0000362 Ga0496117_0000362_29360_29758 132
1155 3300048920 Ga0496117_0003610 Ga0496117_0003610_3618_4016 132
1156 3300048920 Ga0496117_0004445 Ga0496117_0004445_6811_7209 132
1157 3300048920 Ga0496117_0006530 Ga0496117_0006530_6114_6512 132
1158 3300048920 Ga0496117_0009885 Ga0496117_0009885_3038_3436 132
1159 3300048920 Ga0496117_0070709 Ga0496117_0070709_741_1139 132
1160 3300048920 Ga0496117_0115251 Ga0496117_0115251_832_1230 132
1161 3300048920 Ga0496117_0120128 Ga0496117_0120128_314_712 132
1162 3300048920 Ga0496117_0152774 Ga0496117_0152774_83_481 132
1163 3300048920 Ga0496117_0224314 Ga0496117_0224314_241_639 132
1164 3300048920 Ga0496117_0272684 Ga0496117_0272684_477_896 132
1165 3300048920 Ga0496117_0305829 Ga0496117_0305829_139_537 132
1166 3300048921 Ga0496118_0000116 Ga0496118_0000116_142219_142617 132
1167 3300048921 Ga0496118_0006345 Ga0496118_0006345_3458_3856 132
1168 3300048921 Ga0496118_0040002 Ga0496118_0040002_2394_2792 132
1169 3300048921 Ga0496118_0048135 Ga0496118_0048135_2265_2663 132
1170 3300048921 Ga0496118_0056469 Ga0496118_0056469_231_629 132
1171 3300048921 Ga0496118_0093399 Ga0496118_0093399_1047_1445 132
1172 3300048921 Ga0496118_0114304 Ga0496118_0114304_660_1058 132
1173 3300048921 Ga0496118_0219746 Ga0496118_0219746_503_922 132
1174 3300048922 Ga0496119_0000720 Ga0496119_0000720_27576_27974 132
1175 3300048922 Ga0496119_0019667 Ga0496119_0019667_1428_1847 132
1176 3300048922 Ga0496119_0023416 Ga0496119_0023416_470_868 132
1177 3300048922 Ga0496119_0037894 Ga0496119_0037894_2526_2924 132
1178 3300048922 Ga0496119_0054042 Ga0496119_0054042_1193_1591 132
1179 3300048922 Ga0496119_0055468 Ga0496119_0055468_507_905 132
1180 3300048922 Ga0496119_0073119 Ga0496119_0073119_557_955 132
1181 3300048922 Ga0496119_0194550 Ga0496119_0194550_604_1002 132
1182 3300048923 Ga0496120_0015932 Ga0496120_0015932_961_1359 132
1183 3300048923 Ga0496120_0020440 Ga0496120_0020440_3230_3649 132
1184 3300048923 Ga0496120_0052780 Ga0496120_0052780_1105_1503 132
1185 3300048923 Ga0496120_0187051 Ga0496120_0187051_587_985 132
1186 3300048924 Ga0496121_0028500 Ga0496121_0028500_3669_4088 132
1187 3300048925 Ga0496122_0000022 Ga0496122_0000022_253235_253633 132
1188 3300048925 Ga0496122_0001054 Ga0496122_0001054_32742_33140 132
1189 3300048925 Ga0496122_0001412 Ga0496122_0001412_10951_11349 132
1190 3300048925 Ga0496122_0003594 Ga0496122_0003594_16771_17169 132
1191 3300048925 Ga0496122_0010341 Ga0496122_0010341_7311_7709 132
1192 3300048925 Ga0496122_0074281 Ga0496122_0074281_193_591 132
1193 3300048925 Ga0496122_0098924 Ga0496122_0098924_523_921 132
1194 3300048925 Ga0496122_0286844 Ga0496122_0286844_299_697 132
1195 3300048925 Ga0496122_0515858 Ga0496122_0515858_130_528 132
1196 3300048926 Ga0496123_0000016 Ga0496123_0000016_288718_289116 132
1197 3300048926 Ga0496123_0001017 Ga0496123_0001017_33767_34165 132
1198 3300048926 Ga0496123_0004251 Ga0496123_0004251_2203_2601 132
1199 3300048926 Ga0496123_0125566 Ga0496123_0125566_20_418 132
1200 3300048926 Ga0496123_0185551 Ga0496123_0185551_454_852 132
1201 3300048926 Ga0496123_0344271 Ga0496123_0344271_15_413 132
1202 3300048927 Ga0496124_0000135 Ga0496124_0000135_2757_3155 132
1203 3300048927 Ga0496124_0001625 Ga0496124_0001625_2985_3383 132
1204 3300048927 Ga0496124_0002766 Ga0496124_0002766_18289_18687 132
1205 3300048927 Ga0496124_0021715 Ga0496124_0021715_309_707 132
1206 3300048927 Ga0496124_0024430 Ga0496124_0024430_4950_5348 132
1207 3300048927 Ga0496124_0029307 Ga0496124_0029307_997_1395 132
1208 3300048927 Ga0496124_0036040 Ga0496124_0036040_1826_2224 132
1209 3300048927 Ga0496124_0046112 Ga0496124_0046112_1997_2395 132
1210 3300048928 Ga0496125_0000086 Ga0496125_0000086_100966_101364 132
1211 3300048928 Ga0496125_0002082 Ga0496125_0002082_24068_24466 132
1212 3300048928 Ga0496125_0002578 Ga0496125_0002578_9094_9492 132
1213 3300048928 Ga0496125_0005769 Ga0496125_0005769_2093_2491 132
1214 3300048928 Ga0496125_0030145 Ga0496125_0030145_2680_3078 132
1215 3300048928 Ga0496125_0218531 Ga0496125_0218531_467_865 132
1216 3300048928 Ga0496125_0509383 Ga0496125_0509383_201_599 132
1217 3300048929 Ga0496126_0002077 Ga0496126_0002077_7772_8170 132
1218 3300048929 Ga0496126_0002563 Ga0496126_0002563_2662_3078 132
1219 3300048929 Ga0496126_0019423 Ga0496126_0019423_249_668 132
1220 3300048929 Ga0496126_0354970 Ga0496126_0354970_502_900 132
1221 3300048929 Ga0496126_0389128 Ga0496126_0389128_215_613 132
1222 3300048929 Ga0496126_0877838 Ga0496126_0877838_128_526 132
1223 3300048929 Ga0496126_1101121 Ga0496126_1101121_108_506 132
1224 3300049127 Ga0501306_002419 Ga0501306_002419_604_1002 132
1225 3300049127 Ga0501306_012130 Ga0501306_012130_184_582 132
1226 3300049127 Ga0501306_017094 Ga0501306_017094_124_522 132
1227 3300049127 Ga0501306_024605 Ga0501306_024605_150_548 132
1228 3300049127 Ga0501306_026301 Ga0501306_026301_414_812 132
1229 3300049127 Ga0501306_037195 Ga0501306_037195_112_510 132
1230 3300049127 Ga0501306_103801 Ga0501306_103801_33_431 132
1231 3300049129 Ga0501309_008319 Ga0501309_008319_496_894 132
1232 3300049129 Ga0501309_016414 Ga0501309_016414_54_452 132
1233 3300049129 Ga0501309_020388 Ga0501309_020388_40_438 132
1234 3300049129 Ga0501309_047036 Ga0501309_047036_140_538 132
1235 3300049130 Ga0501310_010786 Ga0501310_010786_285_683 132
1236 3300049130 Ga0501310_015452 Ga0501310_015452_23_421 132
1237 3300049130 Ga0501310_026934 Ga0501310_026934_325_723 132
1238 3300049130 Ga0501310_060766 Ga0501310_060766_99_497 132
1239 3300049131 Ga0501341_04474 Ga0501341_04474_211_609 132
1240 3300049160 Ga0501304_016246 Ga0501304_016246_35_433 132
1241 3300049161 Ga0501305_007591 Ga0501305_007591_752_1150 132
1242 3300049161 Ga0501305_029064 Ga0501305_029064_366_764 132
1243 3300049161 Ga0501305_032786 Ga0501305_032786_41_439 132
1244 3300049161 Ga0501305_034505 Ga0501305_034505_81_479 132
1245 3300049161 Ga0501305_048651 Ga0501305_048651_78_476 132
1246 3300049161 Ga0501305_104026 Ga0501305_104026_41_439 132
1247 3300049162 Ga0501307_000425 Ga0501307_000425_982_1380 132
1248 3300049162 Ga0501307_000974 Ga0501307_000974_1820_2218 132
1249 3300049162 Ga0501307_004162 Ga0501307_004162_543_941 132
1250 3300049162 Ga0501307_006092 Ga0501307_006092_556_954 132
1251 3300049527 Ga0501311_006003 Ga0501311_006003_393_791 132
1252 3300049527 Ga0501311_016281 Ga0501311_016281_237_635 132
1253 3300049527 Ga0501311_058822 Ga0501311_058822_195_593 132
1254 3300049528 Ga0501312_003515 Ga0501312_003515_1303_1701 132
1255 3300049528 Ga0501312_024955 Ga0501312_024955_232_630 132
1256 3300049528 Ga0501312_085232 Ga0501312_085232_20_418 132
1257 3300049529 Ga0501313_043773 Ga0501313_043773_181_579 132
1258 3300049529 Ga0501313_056434 Ga0501313_056434_30_428 132
1259 3300049531 Ga0501315_001948 Ga0501315_001948_1070_1468 132
1260 3300049531 Ga0501315_023756 Ga0501315_023756_197_595 132
1261 3300049532 Ga0501316_008552 Ga0501316_008552_605_1003 132
1262 3300049532 Ga0501316_017272 Ga0501316_017272_405_803 132
1263 3300049532 Ga0501316_017601 Ga0501316_017601_221_619 132
1264 3300049532 Ga0501316_027929 Ga0501316_027929_323_721 132
1265 3300049533 Ga0501317_005229 Ga0501317_005229_575_973 132
1266 3300049533 Ga0501317_008450 Ga0501317_008450_380_778 132
1267 3300049533 Ga0501317_012454 Ga0501317_012454_75_473 132
1268 3300049533 Ga0501317_019285 Ga0501317_019285_54_452 132
1269 3300049533 Ga0501317_027576 Ga0501317_027576_73_471 132
1270 3300049533 Ga0501317_030191 Ga0501317_030191_41_439 132
1271 3300049533 Ga0501317_030540 Ga0501317_030540_28_426 132
1272 3300049533 Ga0501317_108453 Ga0501317_108453_55_453 132
1273 3300049534 Ga0501318_001927 Ga0501318_001927_563_961 132
1274 3300049534 Ga0501318_002080 Ga0501318_002080_358_756 132
1275 3300049534 Ga0501318_003086 Ga0501318_003086_692_1090 132
1276 3300049535 Ga0501319_010342 Ga0501319_010342_321_719 132
1277 3300049536 Ga0501320_009030 Ga0501320_009030_455_853 132
1278 3300049536 Ga0501320_009591 Ga0501320_009591_360_758 132
1279 3300049536 Ga0501320_052192 Ga0501320_052192_89_487 132
1280 3300049536 Ga0501320_060698 Ga0501320_060698_61_459 132
1281 3300049537 Ga0501321_006013 Ga0501321_006013_411_809 132
1282 3300049537 Ga0501321_006103 Ga0501321_006103_704_1102 132
1283 3300049537 Ga0501321_006971 Ga0501321_006971_424_822 132
1284 3300049537 Ga0501321_010778 Ga0501321_010778_347_745 132
1285 3300049538 Ga0501322_006970 Ga0501322_006970_40_438 132
1286 3300049539 Ga0501323_029474 Ga0501323_029474_48_446 132
1287 3300049539 Ga0501323_038583 Ga0501323_038583_225_623 132
1288 3300049540 Ga0501324_002357 Ga0501324_002357_924_1322 132
1289 3300049540 Ga0501324_003769 Ga0501324_003769_421_819 132
1290 3300049540 Ga0501324_014659 Ga0501324_014659_177_575 132
1291 3300049540 Ga0501324_018804 Ga0501324_018804_23_421 132
1292 3300049541 Ga0501325_006979 Ga0501325_006979_159_557 132
1293 3300049541 Ga0501325_009137 Ga0501325_009137_413_811 132
1294 3300049541 Ga0501325_011821 Ga0501325_011821_20_418 132
1295 3300049541 Ga0501325_015205 Ga0501325_015205_328_726 132
1296 3300049542 Ga0501326_08913 Ga0501326_08913_34_432 132
1297 3300049546 Ga0501330_001061 Ga0501330_001061_557_955 132
1298 3300049546 Ga0501330_004116 Ga0501330_004116_51_449 132
1299 3300049548 Ga0501332_03604 Ga0501332_03604_220_618 132
1300 3300049556 Ga0501340_007500 Ga0501340_007500_132_530 132
1301 3300049568 Ga0501031_0025920 Ga0501031_0025920_1944_2342 132
1302 3300049568 Ga0501031_0039671 Ga0501031_0039671_457_855 132
1303 3300049569 Ga0501032_0001225 Ga0501032_0001225_16953_17351 132
1304 3300049569 Ga0501032_0011095 Ga0501032_0011095_5813_6211 132
1305 3300049569 Ga0501032_0409819 Ga0501032_0409819_280_678 132
1306 3300049569 Ga0501032_0446765 Ga0501032_0446765_97_495 132
1307 3300049570 Ga0501033_0042005 Ga0501033_0042005_568_966 132
1308 3300049570 Ga0501033_0051677 Ga0501033_0051677_2080_2478 132
1309 3300049570 Ga0501033_0232746 Ga0501033_0232746_127_525 132
1310 3300049571 Ga0501034_0012335 Ga0501034_0012335_2954_3385 132
1311 3300049571 Ga0501034_0055806 Ga0501034_0055806_1859_2257 132
1312 3300049571 Ga0501034_0640264 Ga0501034_0640264_32_430 132
1313 3300049571 Ga0501034_1374164 Ga0501034_1374164_46_453 132
1314 3300049571 Ga0501034_1498532 Ga0501034_1498532_100_498 132
1315 3300049571 Ga0501034_1713383 Ga0501034_1713383_40_438 132
1316 3300049572 Ga0501036_0110654 Ga0501036_0110654_1635_2033 132
1317 3300049572 Ga0501036_0198946 Ga0501036_0198946_566_964 132
1318 3300049572 Ga0501036_0337907 Ga0501036_0337907_387_785 132
1319 3300049572 Ga0501036_0380919 Ga0501036_0380919_680_1078 132
1320 3300049572 Ga0501036_0733406 Ga0501036_0733406_309_707 132
1321 3300049573 Ga0501037_0148444 Ga0501037_0148444_32_430 132
1322 3300049574 Ga0501038_0000144 Ga0501038_0000144_42631_43029 132
1323 3300049574 Ga0501038_0020229 Ga0501038_0020229_2148_2546 132
1324 3300049574 Ga0501038_0051796 Ga0501038_0051796_2669_3067 132
1325 3300049574 Ga0501038_0471927 Ga0501038_0471927_56_454 132
1326 3300049575 Ga0501039_0123550 Ga0501039_0123550_1283_1681 132
1327 3300049575 Ga0501039_0139746 Ga0501039_0139746_676_1074 132
1328 3300049575 Ga0501039_0329581 Ga0501039_0329581_239_637 132
1329 3300049575 Ga0501039_0509386 Ga0501039_0509386_206_604 132
1330 3300049576 Ga0501040_0339871 Ga0501040_0339871_562_960 132
1331 3300049576 Ga0501040_0557268 Ga0501040_0557268_279_677 132
1332 3300049576 Ga0501040_0600636 Ga0501040_0600636_345_743 132
1333 3300049577 Ga0501041_0151505 Ga0501041_0151505_585_983 132
1334 3300049578 Ga0501042_0102421 Ga0501042_0102421_331_729 132
1335 3300049578 Ga0501042_0271189 Ga0501042_0271189_652_1050 132
1336 3300049579 Ga0501043_0033951 Ga0501043_0033951_2666_3064 132
1337 3300049579 Ga0501043_0037575 Ga0501043_0037575_1723_2121 132
1338 3300049580 Ga0501046_0087067 Ga0501046_0087067_261_659 132
1339 3300049580 Ga0501046_0341081 Ga0501046_0341081_25_423 132
1340 3300049580 Ga0501046_0923919 Ga0501046_0923919_37_444 132
1341 3300049581 Ga0501047_0006944 Ga0501047_0006944_3322_3720 132
1342 3300049581 Ga0501047_0011785 Ga0501047_0011785_1602_2000 132
1343 3300049581 Ga0501047_0025223 Ga0501047_0025223_4441_4848 132
1344 3300049581 Ga0501047_0028559 Ga0501047_0028559_3128_3559 132
1345 3300049581 Ga0501047_0677558 Ga0501047_0677558_109_507 132
1346 3300049582 Ga0501048_0195110 Ga0501048_0195110_938_1336 132
1347 3300049583 Ga0501067_0109872 Ga0501067_0109872_410_808 132
1348 3300049583 Ga0501067_0331675 Ga0501067_0331675_152_550 132
1349 3300049584 Ga0501068_0248747 Ga0501068_0248747_142_540 132
1350 3300049584 Ga0501068_0389567 Ga0501068_0389567_375_782 132
1351 3300049585 Ga0501069_0566188 Ga0501069_0566188_222_620 132
1352 3300049586 Ga0501070_0010457 Ga0501070_0010457_3582_3980 132
1353 3300049586 Ga0501070_0040019 Ga0501070_0040019_2735_3166 132
1354 3300049586 Ga0501070_0054412 Ga0501070_0054412_129_527 132
1355 3300049586 Ga0501070_0090899 Ga0501070_0090899_2080_2478 132
1356 3300049586 Ga0501070_0250015 Ga0501070_0250015_692_1090 132
1357 3300049587 Ga0501071_0055231 Ga0501071_0055231_1270_1668 132
1358 3300049588 Ga0501072_0123160 Ga0501072_0123160_1252_1650 132
1359 3300049588 Ga0501072_0587802 Ga0501072_0587802_101_499 132
1360 3300049589 Ga0501073_0095105 Ga0501073_0095105_722_1120 132
1361 3300049589 Ga0501073_0138452 Ga0501073_0138452_586_984 132
1362 3300049590 Ga0501074_0144623 Ga0501074_0144623_535_933 132
1363 3300049592 Ga0501076_0108815 Ga0501076_0108815_409_807 132
1364 3300049652 Ga0501202_165850 Ga0501202_165850_108_506 132
1365 3300049741 Ga0501079_1511458 Ga0501079_1511458_96_494 132
1366 3300049742 Ga0501080_0129750 Ga0501080_0129750_1525_1923 132
1367 3300049742 Ga0501080_0719443 Ga0501080_0719443_30_428 132
1368 3300049744 Ga0501083_0048591 Ga0501083_0048591_837_1235 132
1369 3300049822 Ga0501035_0004487 Ga0501035_0004487_2405_2803 132
1370 3300049822 Ga0501035_0698053 Ga0501035_0698053_155_553 132
1371 3300049823 Ga0501044_0001222 Ga0501044_0001222_7043_7474 132
1372 3300049823 Ga0501044_0011319 Ga0501044_0011319_9207_9605 132
1373 3300049823 Ga0501044_0024266 Ga0501044_0024266_1536_1934 132
1374 3300049823 Ga0501044_0063853 Ga0501044_0063853_2818_3225 132
1375 3300049823 Ga0501044_0108524 Ga0501044_0108524_2259_2657 132
1376 3300049823 Ga0501044_0766304 Ga0501044_0766304_228_626 132
1377 3300049824 Ga0501045_1140872 Ga0501045_1140872_123_521 132
1378 3300050491 nmdc:mga00v17_24368_c1 nmdc:mga00v17_24368_c1_1208_1606 132
1379 3300050491 nmdc:mga00v17_354242_c1 nmdc:mga00v17_354242_c1_84_491 132
1380 3300050491 nmdc:mga00v17_663867_c1 nmdc:mga00v17_663867_c1_231_638 132
1381 3300050491 nmdc:mga00v17_8123_c1 nmdc:mga00v17_8123_c1_3701_4099 132
1382 3300050492 nmdc:mga0yw44_277_c1 nmdc:mga0yw44_277_c1_7167_7565 132
1383 3300050492 nmdc:mga0yw44_518948_c1 nmdc:mga0yw44_518948_c1_131_529 132
1384 3300050496 nmdc:mga07m45_149130_c1 nmdc:mga07m45_149130_c1_389_796 132
1385 3300050496 nmdc:mga07m45_560849_c1 nmdc:mga07m45_560849_c1_239_637 132
1386 3300050511 nmdc:mga08y16_387012_c1 nmdc:mga08y16_387012_c1_472_870 132
1387 3300050516 nmdc:mga0sz30_6222_c2 nmdc:mga0sz30_6222_c2_2293_2691 132
1388 3300053077 Ga0495601_0382741 Ga0495601_0382741_134_532 132
1389 3300053084 Ga0495595_0071204 Ga0495595_0071204_658_1056 132
1390 3300053092 Ga0500583_0241471 Ga0500583_0241471_304_702 132
1391 3300053153 Ga0500616_0000144 Ga0500616_0000144_38323_38721 132
1392 3300053153 Ga0500616_0000947 Ga0500616_0000947_8662_9060 132
1393 3300053153 Ga0500616_0002723 Ga0500616_0002723_8326_8724 132
1394 3300054114 Ga0501084_0082056 Ga0501084_0082056_1087_1485 132
1395 3300059477 Ga0587084_000004 Ga0587084_000004_7627_8025 132
1396 3300059477 Ga0587084_009664 Ga0587084_009664_611_1009 132
1397 3300059478 Ga0587093_060602 Ga0587093_060602_67_465 132
1398 3300059490 Ga0587066_015241 Ga0587066_015241_642_1040 132
1399 3300059491 Ga0587070_000783 Ga0587070_000783_1785_2183 132
1400 3300059491 Ga0587070_163144 Ga0587070_163144_22_420 132
1401 3300059492 Ga0587073_0064840 Ga0587073_0064840_41_439 132
1402 3300059493 Ga0587077_001116 Ga0587077_001116_947_1345 132
1403 3300059493 Ga0587077_044432 Ga0587077_044432_42_440 132
1404 3300059503 Ga0587080_005427 Ga0587080_005427_745_1143 132
1405 3300059503 Ga0587080_009155 Ga0587080_009155_239_637 132
1406 3300059503 Ga0587080_065031 Ga0587080_065031_286_684 132
1407 3300059503 Ga0587080_164959 Ga0587080_164959_52_450 132
1408 3300059504 Ga0587082_013342 Ga0587082_013342_361_759 132
1409 3300059504 Ga0587082_020552 Ga0587082_020552_58_456 132
1410 3300059504 Ga0587082_055588 Ga0587082_055588_47_445 132
1411 3300059505 Ga0587083_0037084 Ga0587083_0037084_143_541 132
1412 3300059505 Ga0587083_0063474 Ga0587083_0063474_193_591 132
1413 3300059505 Ga0587083_0206067 Ga0587083_0206067_93_491 132
1414 3300059506 Ga0587085_001114 Ga0587085_001114_855_1253 132
1415 3300059506 Ga0587085_043127 Ga0587085_043127_147_545 132
1416 3300059507 Ga0587086_000329 Ga0587086_000329_2097_2495 132
1417 3300059507 Ga0587086_016610 Ga0587086_016610_494_892 132
1418 3300059508 Ga0587088_005805 Ga0587088_005805_926_1324 132
1419 3300059508 Ga0587088_009994 Ga0587088_009994_140_538 132
1420 3300059509 Ga0587089_003194 Ga0587089_003194_578_976 132
1421 3300059509 Ga0587089_108682 Ga0587089_108682_66_464 132
1422 3300059510 Ga0587090_001053 Ga0587090_001053_1687_2085 132
1423 3300059510 Ga0587090_013431 Ga0587090_013431_266_664 132
1424 3300059510 Ga0587090_016430 Ga0587090_016430_540_938 132
1425 3300059511 Ga0587091_000453 Ga0587091_000453_2129_2527 132
1426 3300059511 Ga0587091_155186 Ga0587091_155186_20_418 132
1427 3300059512 Ga0587092_000723 Ga0587092_000723_651_1049 132
1428 3300059512 Ga0587092_090791 Ga0587092_090791_80_478 132
1429 3300059512 Ga0587092_102881 Ga0587092_102881_57_455 132
1430 3300059513 Ga0587094_000376 Ga0587094_000376_2056_2454 132
1431 3300059513 Ga0587094_022240 Ga0587094_022240_74_472 132
1432 3300059514 Ga0587095_000117 Ga0587095_000117_2062_2460 132
1433 3300059603 Ga0587097_00183 Ga0587097_00183_273_671 132
1434 3300059604 Ga0587098_003011 Ga0587098_003011_148_546 132
1435 3300059604 Ga0587098_004556 Ga0587098_004556_704_1102 132
1436 3300059605 Ga0587106_002677 Ga0587106_002677_519_917 132
1437 3300059605 Ga0587106_002979 Ga0587106_002979_178_576 132
1438 3300059605 Ga0587106_010351 Ga0587106_010351_270_668 132
1439 3300059605 Ga0587106_045237 Ga0587106_045237_155_553 132
1440 3300059607 Ga0587125_000594 Ga0587125_000594_951_1349 132
1441 3300059622 Ga0587099_006725 Ga0587099_006725_207_605 132
1442 3300059622 Ga0587099_010809 Ga0587099_010809_469_867 132
1443 3300059622 Ga0587099_016335 Ga0587099_016335_100_498 132
1444 3300059622 Ga0587099_019680 Ga0587099_019680_304_702 132
1445 3300059622 Ga0587099_033532 Ga0587099_033532_148_546 132
1446 3300059622 Ga0587099_061972 Ga0587099_061972_29_427 132
1447 3300059623 Ga0587101_000011 Ga0587101_000011_956_1354 132
1448 3300059625 Ga0587113_002137 Ga0587113_002137_143_541 132
1449 3300059626 Ga0587115_000267 Ga0587115_000267_2091_2489 132
1450 3300059626 Ga0587115_122321 Ga0587115_122321_35_433 132
1451 3300059627 Ga0587117_002508 Ga0587117_002508_578_976 132
1452 3300059628 Ga0587122_008348 Ga0587122_008348_275_673 132
1453 3300059630 Ga0587128_001907 Ga0587128_001907_1123_1521 132
1454 3300059630 Ga0587128_007988 Ga0587128_007988_881_1279 132
1455 3300059630 Ga0587128_041335 Ga0587128_041335_147_545 132
1456 3300059639 Ga0587062_017327 Ga0587062_017327_209_607 132
1457 3300059639 Ga0587062_056679 Ga0587062_056679_226_624 132
1458 3300059640 Ga0587067_055523 Ga0587067_055523_258_656 132
1459 3300059640 Ga0587067_056100 Ga0587067_056100_161_559 132
1460 3300059641 Ga0587068_118364 Ga0587068_118364_146_544 132
1461 3300059642 Ga0587069_009409 Ga0587069_009409_771_1169 132
1462 3300059642 Ga0587069_028866 Ga0587069_028866_395_793 132
1463 3300059643 Ga0587072_012807 Ga0587072_012807_148_546 132
1464 3300059643 Ga0587072_012818 Ga0587072_012818_708_1106 132
1465 3300059644 Ga0587075_093482 Ga0587075_093482_126_524 132
1466 3300059645 Ga0587076_030461 Ga0587076_030461_94_492 132
1467 3300059646 Ga0587078_004265 Ga0587078_004265_484_882 132
1468 3300059647 Ga0587079_037960 Ga0587079_037960_285_683 132
1469 3300059647 Ga0587079_062060 Ga0587079_062060_68_466 132
1470 3300059648 Ga0587100_000081 Ga0587100_000081_1275_1673 132
1471 3300059649 Ga0587102_003585 Ga0587102_003585_143_541 132
1472 3300059650 Ga0587104_009913 Ga0587104_009913_58_456 132
1473 3300059651 Ga0587105_013753 Ga0587105_013753_214_612 132
1474 3300059652 Ga0587107_065915 Ga0587107_065915_97_495 132
1475 3300059653 Ga0587108_016657 Ga0587108_016657_56_454 132
1476 3300059655 Ga0587114_027206 Ga0587114_027206_121_519 132
1477 3300059660 Ga0587124_000269 Ga0587124_000269_989_1387 132
1478 3300060344 Ga0587071_007630 Ga0587071_007630_735_1133 132
1479 3300060344 Ga0587071_023737 Ga0587071_023737_707_1105 132
1480 3300060344 Ga0587071_190544 Ga0587071_190544_18_416 132
1481 3300060346 Ga0587111_0000761 Ga0587111_0000761_2016_2414 132
1482 3300060346 Ga0587111_0007121 Ga0587111_0007121_1145_1543 132
1483 3300060346 Ga0587111_0051039 Ga0587111_0051039_433_831 132
1484 3300060346 Ga0587111_0068791 Ga0587111_0068791_107_505 132
1485 3300060353 Ga0501082_0901376 Ga0501082_0901376_354_752 132
1486 3300060353 Ga0501082_1164888 Ga0501082_1164888_188_586 132
1487 3300061719 Ga0466962_0007926 Ga0466962_0007926_2034_2432 132
1488 3300061719 Ga0466962_0315320 Ga0466962_0315320_337_735 132
1489 3300061719 Ga0466962_0460770 Ga0466962_0460770_77_496 132
1490 3300061734 Ga0530510_1301477 Ga0530510_1301477_148_546 132
1491 iso_pu_bacteria 2966924647 2966926533 132
1492 iso_pu_bacteria 8056060235 8056065599 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

22

149

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zeb-assembly1.cif.gz_h m. smegmatis p/p state 70s ribosome structure 0.9653 3 132
8cwo-assembly1.cif.gz_H cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.9622 2 132
5xyu-assembly1.cif.gz_H small subunit of mycobacterium smegmatis ribosome 0.962 2 132
8fmw-assembly1.cif.gz_H the structure of a hibernating ribosome in the lyme disease pathogen 0.9618 1 132
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9603 4 132
ID Description Score Start End Superfamily
4pdbA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9592 4 74 3.30.1370.30
4pdbA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9464 4 74 3.30.1370.30
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9302 76 132 3.30.1490.10
af_Q9M0E0_2_68_3.30.1370.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9286 7 65 3.30.1370.30
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9281 76 132 3.30.1490.10
ID Description Score Start End GO Terms
AF-A0A538FPV7-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9782 22 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A5N8YII2-F1-model_v4 Small ribosomal subunit protein uS8 0.9773 11 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3D1NLH9-F1-model_v4 deleted 0.9771 9 132
AF-A0A0H4T3E4-F1-model_v4 Small ribosomal subunit protein uS8 0.9766 4 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F8KYC1-F1-model_v4 Small ribosomal subunit protein uS8 0.9741 11 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
92.72 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map