F494308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1486 | 537 | 2972 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0409793|Ga0436364_0409793_2150_2686 |
| Length | 161 |
| Sequence | VADPTEAAKPAAEGSPADGPAGGAARPSRKPVVTGNGMGTGRRKEAIARVRIMPGTGKWQINERSLDEYFPNKVHQQLINEPFVTLGAEDSFDVVARITGGGVTGQAGALRLGLARALILVDPDSRSSLKRSGFLTRDARIKERKKAGLKKARKAPQYSKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 123 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 124 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 125 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 126 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 127 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 128 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 149 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 219 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 220 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 224 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 225 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 238 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 239 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 240 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 251 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 254 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 255 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 263 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 264 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 265 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 266 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 267 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 268 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 269 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 270 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 271 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 272 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 273 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 274 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 275 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 276 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 281 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 282 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 283 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 364 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 378 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 419 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 432 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 433 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 443 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 449 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 450 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 452 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 453 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 480 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 481 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 482 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 483 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 484 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 485 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 486 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 487 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 488 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 489 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 490 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 491 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 492 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 493 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 494 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 495 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 496 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 497 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 498 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 499 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 500 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 501 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 502 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 503 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 504 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 505 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 506 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 507 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 508 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 509 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 510 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 511 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 512 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 513 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 514 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 515 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 516 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 517 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 518 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 519 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 520 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 521 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 522 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 523 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 524 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 525 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 526 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 527 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 528 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 529 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 530 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 531 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 532 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 533 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 534 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 535 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 536 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 537 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.75 |
| Metatranscriptomes | 15.41 |
| Isolates | 3.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 2.36 |
| Nodule | 0 |
| Rhizoplane | 6.46 |
| Rhizosphere | 85.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_0409793 | 3300037853 | Bacteria | 2978 |
| 2 | JGI24740J21852_10019807 | 3300001979 | Bacteria | 2362 |
| 3 | JGI24737J22298_10003968 | 3300001990 | Bacteria | 5182 |
| 4 | JGI24735J21928_10075146 | 3300002067 | Bacteria | 967 |
| 5 | JGI24735J21928_10156563 | 3300002067 | Bacteria | 658 |
| 6 | JGI24738J21930_10002435 | 3300002075 | Bacteria | 4875 |
| 7 | JGI24738J21930_10015599 | 3300002075 | Bacteria | 1614 |
| 8 | JGI24749J21850_1012752 | 3300002076 | Bacteria | 1180 |
| 9 | JGI24744J21845_10004165 | 3300002077 | Bacteria | 2981 |
| 10 | JGI24034J26672_10007871 | 3300002239 | Bacteria | 1551 |
| 11 | JGI24742J22300_10015362 | 3300002244 | Bacteria | 1288 |
| 12 | JGI25154J39366_1001966 | 3300002738 | Bacteria | 6055 |
| 13 | Ga0006778J45830_1011174 | 3300003162 | Bacteria | 1341 |
| 14 | Ga0006759J45824_1013878 | 3300003163 | Bacteria | 1633 |
| 15 | Ga0006759J45824_1025628 | 3300003163 | Bacteria | 1233 |
| 16 | Ga0006777J48905_1019716 | 3300003308 | Bacteria | 1194 |
| 17 | Ga0006777J48905_1020582 | 3300003308 | Bacteria | 1664 |
| 18 | Ga0007417J51691_1011871 | 3300003544 | Bacteria | 1313 |
| 19 | Ga0007427J51700_103286 | 3300003559 | Bacteria | 2485 |
| 20 | Ga0006781J51513_1007583 | 3300003568 | Bacteria | 1850 |
| 21 | Ga0006781J51513_1013434 | 3300003568 | Bacteria | 884 |
| 22 | Ga0007410J51695_1015311 | 3300003574 | Bacteria | 1231 |
| 23 | Ga0007409J51694_1017714 | 3300003575 | Bacteria | 1187 |
| 24 | Ga0007409J51694_1018137 | 3300003575 | Bacteria | 1562 |
| 25 | Ga0007429J51699_1011248 | 3300003579 | Bacteria | 1777 |
| 26 | Ga0007429J51699_1016355 | 3300003579 | Bacteria | 1394 |
| 27 | Ga0007429J51699_1027302 | 3300003579 | Bacteria | 1130 |
| 28 | Ga0007429J51699_1030497 | 3300003579 | Bacteria | 1142 |
| 29 | Ga0032354_1006492 | 3300003693 | Bacteria | 1209 |
| 30 | Ga0032354_1009879 | 3300003693 | Bacteria | 2752 |
| 31 | Ga0006780_1004588 | 3300003735 | Bacteria | 1234 |
| 32 | Ga0006780_1006617 | 3300003735 | Bacteria | 1162 |
| 33 | Ga0058858_1425716 | 3300004785 | Bacteria | 812 |
| 34 | Ga0058861_10101139 | 3300004800 | Bacteria | 1143 |
| 35 | Ga0070658_10356842 | 3300005327 | Bacteria | 1252 |
| 36 | Ga0070676_10333614 | 3300005328 | Bacteria | 1038 |
| 37 | Ga0070683_100027696 | 3300005329 | Bacteria | 5113 |
| 38 | Ga0070683_100061434 | 3300005329 | Bacteria | 3494 |
| 39 | Ga0070683_100154117 | 3300005329 | Bacteria | 2179 |
| 40 | Ga0070683_100786439 | 3300005329 | Bacteria | 912 |
| 41 | Ga0070690_100153667 | 3300005330 | Bacteria | 1572 |
| 42 | Ga0070670_100327695 | 3300005331 | Bacteria | 1342 |
| 43 | Ga0068869_100085285 | 3300005334 | Bacteria | 2365 |
| 44 | Ga0070682_100005854 | 3300005337 | Bacteria | 6869 |
| 45 | Ga0070682_100076528 | 3300005337 | Bacteria | 2154 |
| 46 | Ga0070682_100078918 | 3300005337 | Bacteria | 2125 |
| 47 | Ga0070682_100091754 | 3300005337 | Bacteria | 1989 |
| 48 | Ga0070682_100121266 | 3300005337 | Bacteria | 1756 |
| 49 | Ga0070682_100272134 | 3300005337 | Bacteria | 1231 |
| 50 | Ga0070682_100471955 | 3300005337 | Bacteria | 966 |
| 51 | Ga0068868_100328938 | 3300005338 | Bacteria | 1304 |
| 52 | Ga0068868_100410141 | 3300005338 | Bacteria | 1171 |
| 53 | Ga0070660_100011189 | 3300005339 | Bacteria | 6367 |
| 54 | Ga0070660_100092118 | 3300005339 | Bacteria | 2392 |
| 55 | Ga0070660_100127673 | 3300005339 | Bacteria | 2033 |
| 56 | Ga0070660_100767913 | 3300005339 | Bacteria | 810 |
| 57 | Ga0070687_100005482 | 3300005343 | Bacteria | 5141 |
| 58 | Ga0070661_100041418 | 3300005344 | Bacteria | 3361 |
| 59 | Ga0070692_10007791 | 3300005345 | Bacteria | 4744 |
| 60 | Ga0070692_10236474 | 3300005345 | Bacteria | 1087 |
| 61 | Ga0070668_100015860 | 3300005347 | Bacteria | 5636 |
| 62 | Ga0070668_100028853 | 3300005347 | Bacteria | 4211 |
| 63 | Ga0070668_100039258 | 3300005347 | Bacteria | 3621 |
| 64 | Ga0070668_100124061 | 3300005347 | Bacteria | 2067 |
| 65 | Ga0070668_100172522 | 3300005347 | Bacteria | 1762 |
| 66 | Ga0070668_100314145 | 3300005347 | Bacteria | 1317 |
| 67 | Ga0070668_100383429 | 3300005347 | Bacteria | 1197 |
| 68 | Ga0070669_100237787 | 3300005353 | Bacteria | 1446 |
| 69 | Ga0070675_100125997 | 3300005354 | Bacteria | 2179 |
| 70 | Ga0070675_100506081 | 3300005354 | Bacteria | 1089 |
| 71 | Ga0070671_100267938 | 3300005355 | Bacteria | 1452 |
| 72 | Ga0070671_100704674 | 3300005355 | Bacteria | 876 |
| 73 | Ga0070674_100031514 | 3300005356 | Bacteria | 3513 |
| 74 | Ga0070674_100039323 | 3300005356 | Bacteria | 3193 |
| 75 | Ga0070674_100046760 | 3300005356 | Bacteria | 2963 |
| 76 | Ga0070674_100176996 | 3300005356 | Bacteria | 1631 |
| 77 | Ga0070674_100186605 | 3300005356 | Bacteria | 1592 |
| 78 | Ga0070674_100482961 | 3300005356 | Bacteria | 1029 |
| 79 | Ga0070673_100049892 | 3300005364 | Bacteria | 3269 |
| 80 | Ga0070673_101004101 | 3300005364 | Bacteria | 777 |
| 81 | Ga0070688_100220705 | 3300005365 | Bacteria | 1336 |
| 82 | Ga0070659_100036950 | 3300005366 | Bacteria | 3807 |
| 83 | Ga0070659_100046370 | 3300005366 | Bacteria | 3407 |
| 84 | Ga0070659_100072440 | 3300005366 | Bacteria | 2741 |
| 85 | Ga0070659_100090530 | 3300005366 | Bacteria | 2452 |
| 86 | Ga0070659_100286114 | 3300005366 | Bacteria | 1372 |
| 87 | Ga0070667_100046939 | 3300005367 | Bacteria | 3634 |
| 88 | Ga0070667_100217798 | 3300005367 | Bacteria | 1698 |
| 89 | Ga0070667_100955330 | 3300005367 | Bacteria | 799 |
| 90 | Ga0070714_100817971 | 3300005435 | Bacteria | 903 |
| 91 | Ga0070701_10009437 | 3300005438 | Bacteria | 4274 |
| 92 | Ga0070711_100848749 | 3300005439 | Bacteria | 777 |
| 93 | Ga0070705_100013603 | 3300005440 | Bacteria | 4166 |
| 94 | Ga0070700_100022153 | 3300005441 | Bacteria | 3701 |
| 95 | Ga0070700_100074865 | 3300005441 | Bacteria | 2171 |
| 96 | Ga0070700_100224108 | 3300005441 | Bacteria | 1334 |
| 97 | Ga0070700_100258115 | 3300005441 | Bacteria | 1254 |
| 98 | Ga0070663_100050083 | 3300005455 | Bacteria | 2969 |
| 99 | Ga0070663_100167443 | 3300005455 | Bacteria | 1696 |
| 100 | Ga0070663_100180785 | 3300005455 | Bacteria | 1636 |
| 101 | Ga0070663_100205322 | 3300005455 | Bacteria | 1540 |
| 102 | Ga0070663_100291292 | 3300005455 | Bacteria | 1304 |
| 103 | Ga0070663_100295605 | 3300005455 | Bacteria | 1295 |
| 104 | Ga0070678_100068714 | 3300005456 | Bacteria | 2642 |
| 105 | Ga0070678_100224560 | 3300005456 | Bacteria | 1562 |
| 106 | Ga0070678_100245588 | 3300005456 | Bacteria | 1499 |
| 107 | Ga0070678_100357447 | 3300005456 | Bacteria | 1257 |
| 108 | Ga0070678_100762382 | 3300005456 | Bacteria | 876 |
| 109 | Ga0070678_101273192 | 3300005456 | Bacteria | 684 |
| 110 | Ga0070662_100121384 | 3300005457 | Bacteria | 2003 |
| 111 | Ga0070662_100131554 | 3300005457 | Bacteria | 1930 |
| 112 | Ga0070681_10189399 | 3300005458 | Bacteria | 1977 |
| 113 | Ga0070681_10341204 | 3300005458 | Bacteria | 1408 |
| 114 | Ga0070681_10782795 | 3300005458 | Bacteria | 871 |
| 115 | Ga0068867_100000784 | 3300005459 | Bacteria | 21484 |
| 116 | Ga0068867_100117960 | 3300005459 | Bacteria | 2047 |
| 117 | Ga0068867_100724788 | 3300005459 | Bacteria | 880 |
| 118 | Ga0070685_10037258 | 3300005466 | Bacteria | 2754 |
| 119 | Ga0070685_10038115 | 3300005466 | Bacteria | 2725 |
| 120 | Ga0070685_10122794 | 3300005466 | Bacteria | 1615 |
| 121 | Ga0070706_100899683 | 3300005467 | Bacteria | 818 |
| 122 | Ga0070698_100010346 | 3300005471 | Bacteria | 9960 |
| 123 | Ga0070679_100284160 | 3300005530 | Bacteria | 1607 |
| 124 | Ga0070679_101277657 | 3300005530 | Bacteria | 679 |
| 125 | Ga0070684_100002313 | 3300005535 | Bacteria | 14044 |
| 126 | Ga0070684_100096172 | 3300005535 | Bacteria | 2640 |
| 127 | Ga0070684_100108463 | 3300005535 | Bacteria | 2487 |
| 128 | Ga0070684_100209837 | 3300005535 | Bacteria | 1775 |
| 129 | Ga0070684_100299370 | 3300005535 | Bacteria | 1476 |
| 130 | Ga0070684_100303011 | 3300005535 | Bacteria | 1466 |
| 131 | Ga0070684_100315931 | 3300005535 | Bacteria | 1435 |
| 132 | Ga0068853_100073776 | 3300005539 | Bacteria | 2976 |
| 133 | Ga0068853_100112874 | 3300005539 | Bacteria | 2415 |
| 134 | Ga0068853_100141854 | 3300005539 | Bacteria | 2157 |
| 135 | Ga0068853_100193957 | 3300005539 | Bacteria | 1846 |
| 136 | Ga0068853_100451793 | 3300005539 | Bacteria | 1209 |
| 137 | Ga0070672_100021433 | 3300005543 | Bacteria | 4728 |
| 138 | Ga0070672_100066444 | 3300005543 | Bacteria | 2856 |
| 139 | Ga0070672_100457835 | 3300005543 | Bacteria | 1099 |
| 140 | Ga0070672_101211483 | 3300005543 | Bacteria | 673 |
| 141 | Ga0070686_100024753 | 3300005544 | Bacteria | 3601 |
| 142 | Ga0070686_100211952 | 3300005544 | Bacteria | 1395 |
| 143 | Ga0070696_100007791 | 3300005546 | Bacteria | 7147 |
| 144 | Ga0070696_100077230 | 3300005546 | Bacteria | 2353 |
| 145 | Ga0070693_100027117 | 3300005547 | Bacteria | 3100 |
| 146 | Ga0070693_100753762 | 3300005547 | Bacteria | 718 |
| 147 | Ga0070665_100011936 | 3300005548 | Bacteria | 8774 |
| 148 | Ga0070665_100243480 | 3300005548 | Bacteria | 1799 |
| 149 | Ga0068855_100043083 | 3300005563 | Bacteria | 5348 |
| 150 | Ga0068855_100341815 | 3300005563 | Bacteria | 1650 |
| 151 | Ga0068855_100381020 | 3300005563 | Bacteria | 1549 |
| 152 | Ga0068855_100712583 | 3300005563 | Bacteria | 1073 |
| 153 | Ga0070664_100108586 | 3300005564 | Bacteria | 2420 |
| 154 | Ga0070664_100534720 | 3300005564 | Bacteria | 1083 |
| 155 | Ga0070664_101065513 | 3300005564 | Bacteria | 761 |
| 156 | Ga0068857_100008605 | 3300005577 | Bacteria | 8830 |
| 157 | Ga0068857_100577588 | 3300005577 | Bacteria | 1061 |
| 158 | Ga0068857_100973544 | 3300005577 | Bacteria | 816 |
| 159 | Ga0068854_100003214 | 3300005578 | Bacteria | 10192 |
| 160 | Ga0068854_100179576 | 3300005578 | Bacteria | 1653 |
| 161 | Ga0068854_100376948 | 3300005578 | Bacteria | 1168 |
| 162 | Ga0068854_100469773 | 3300005578 | Bacteria | 1054 |
| 163 | Ga0068854_100839667 | 3300005578 | Bacteria | 803 |
| 164 | Ga0068856_100031115 | 3300005614 | Bacteria | 5220 |
| 165 | Ga0068856_100133674 | 3300005614 | Bacteria | 2486 |
| 166 | Ga0068856_100372162 | 3300005614 | Bacteria | 1448 |
| 167 | Ga0070702_100000198 | 3300005615 | Bacteria | 19583 |
| 168 | Ga0070702_100000960 | 3300005615 | Bacteria | 11338 |
| 169 | Ga0070702_100027425 | 3300005615 | Bacteria | 3073 |
| 170 | Ga0070702_100097787 | 3300005615 | Bacteria | 1794 |
| 171 | Ga0070702_100315689 | 3300005615 | Bacteria | 1087 |
| 172 | Ga0070702_100448041 | 3300005615 | Bacteria | 936 |
| 173 | Ga0070702_100515872 | 3300005615 | Bacteria | 881 |
| 174 | Ga0068852_100040899 | 3300005616 | Bacteria | 3915 |
| 175 | Ga0068852_100219994 | 3300005616 | Bacteria | 1805 |
| 176 | Ga0068852_100287987 | 3300005616 | Bacteria | 1586 |
| 177 | Ga0068852_100924795 | 3300005616 | Bacteria | 890 |
| 178 | Ga0068859_100771629 | 3300005617 | Bacteria | 1050 |
| 179 | Ga0068859_101408252 | 3300005617 | Bacteria | 769 |
| 180 | Ga0068859_101497231 | 3300005617 | Bacteria | 745 |
| 181 | Ga0068864_100129089 | 3300005618 | Bacteria | 2269 |
| 182 | Ga0068864_100365270 | 3300005618 | Bacteria | 1365 |
| 183 | Ga0068864_101036297 | 3300005618 | Bacteria | 815 |
| 184 | Ga0068866_10065526 | 3300005718 | Bacteria | 1900 |
| 185 | Ga0068861_100003392 | 3300005719 | Bacteria | 10570 |
| 186 | Ga0068861_100113242 | 3300005719 | Bacteria | 2176 |
| 187 | Ga0068861_100147499 | 3300005719 | Bacteria | 1927 |
| 188 | Ga0068861_100182599 | 3300005719 | Bacteria | 1747 |
| 189 | Ga0068861_100822369 | 3300005719 | Bacteria | 873 |
| 190 | Ga0068851_10193429 | 3300005834 | Bacteria | 1132 |
| 191 | Ga0068851_10329431 | 3300005834 | Bacteria | 884 |
| 192 | Ga0068870_10308961 | 3300005840 | Bacteria | 1001 |
| 193 | Ga0068863_100472924 | 3300005841 | Bacteria | 1232 |
| 194 | Ga0068858_100589602 | 3300005842 | Bacteria | 1078 |
| 195 | Ga0068860_100161079 | 3300005843 | Bacteria | 2163 |
| 196 | Ga0068860_100169410 | 3300005843 | Bacteria | 2109 |
| 197 | Ga0068860_100219702 | 3300005843 | Bacteria | 1845 |
| 198 | Ga0068860_100435859 | 3300005843 | Bacteria | 1301 |
| 199 | Ga0068862_100442512 | 3300005844 | Bacteria | 1224 |
| 200 | Ga0081455_10010056 | 3300005937 | Bacteria | 9658 |
| 201 | Ga0081455_10128516 | 3300005937 | Bacteria | 1985 |
| 202 | Ga0081455_10451870 | 3300005937 | Bacteria | 877 |
| 203 | Ga0081538_10000264 | 3300005981 | Bacteria | 59881 |
| 204 | Ga0081540_1130051 | 3300005983 | Bacteria | 1030 |
| 205 | Ga0081539_10000238 | 3300005985 | Bacteria | 129119 |
| 206 | Ga0075365_10006159 | 3300006038 | Bacteria | 6567 |
| 207 | Ga0075365_10013835 | 3300006038 | Bacteria | 4841 |
| 208 | Ga0075365_10086841 | 3300006038 | Bacteria | 2126 |
| 209 | Ga0075368_10025746 | 3300006042 | Bacteria | 2258 |
| 210 | Ga0075363_100015813 | 3300006048 | Bacteria | 3716 |
| 211 | Ga0075363_100111268 | 3300006048 | Bacteria | 1522 |
| 212 | Ga0075363_100233350 | 3300006048 | Bacteria | 1057 |
| 213 | Ga0075364_10016481 | 3300006051 | Bacteria | 4598 |
| 214 | Ga0075364_10026351 | 3300006051 | Bacteria | 3708 |
| 215 | Ga0075364_10110319 | 3300006051 | Bacteria | 1835 |
| 216 | Ga0075364_10128675 | 3300006051 | Bacteria | 1699 |
| 217 | Ga0075364_10640723 | 3300006051 | Bacteria | 726 |
| 218 | Ga0075432_10007355 | 3300006058 | Bacteria | 3749 |
| 219 | Ga0075362_10019347 | 3300006177 | Bacteria | 2829 |
| 220 | Ga0075369_10004944 | 3300006186 | Bacteria | 4958 |
| 221 | Ga0075369_10010273 | 3300006186 | Bacteria | 3658 |
| 222 | Ga0075427_10002551 | 3300006194 | Bacteria | 2454 |
| 223 | Ga0097621_100923509 | 3300006237 | Bacteria | 814 |
| 224 | Ga0068871_101051707 | 3300006358 | Bacteria | 760 |
| 225 | Ga0075428_100016246 | 3300006844 | Bacteria | 8228 |
| 226 | Ga0075428_100134859 | 3300006844 | Bacteria | 2685 |
| 227 | Ga0075430_100003324 | 3300006846 | Bacteria | 13479 |
| 228 | Ga0075431_100002859 | 3300006847 | Bacteria | 16699 |
| 229 | Ga0075431_100054108 | 3300006847 | Bacteria | 4139 |
| 230 | Ga0075431_100111155 | 3300006847 | Bacteria | 2828 |
| 231 | Ga0075433_10001418 | 3300006852 | Bacteria | 17655 |
| 232 | Ga0075434_100049988 | 3300006871 | Bacteria | 4153 |
| 233 | Ga0075429_100033963 | 3300006880 | Bacteria | 4432 |
| 234 | Ga0068865_100010755 | 3300006881 | Bacteria | 5705 |
| 235 | Ga0068865_100012655 | 3300006881 | Bacteria | 5317 |
| 236 | Ga0068865_100025829 | 3300006881 | Bacteria | 3867 |
| 237 | Ga0068865_100772450 | 3300006881 | Bacteria | 827 |
| 238 | Ga0075436_100097717 | 3300006914 | Bacteria | 2043 |
| 239 | Ga0097620_100771677 | 3300006931 | Bacteria | 1050 |
| 240 | Ga0097620_101408410 | 3300006931 | Bacteria | 769 |
| 241 | Ga0097620_101497404 | 3300006931 | Bacteria | 745 |
| 242 | Ga0075435_100002572 | 3300007076 | Bacteria | 12099 |
| 243 | Ga0105244_10068218 | 3300009036 | Bacteria | 1777 |
| 244 | Ga0105240_10093336 | 3300009093 | Bacteria | 3674 |
| 245 | Ga0111539_10022754 | 3300009094 | Bacteria | 7697 |
| 246 | Ga0111539_11623467 | 3300009094 | Bacteria | 750 |
| 247 | Ga0111539_11711474 | 3300009094 | Bacteria | 729 |
| 248 | Ga0105245_10016704 | 3300009098 | Bacteria | 6409 |
| 249 | Ga0105245_10044869 | 3300009098 | Bacteria | 3946 |
| 250 | Ga0105245_10070074 | 3300009098 | Bacteria | 3181 |
| 251 | Ga0105245_10218504 | 3300009098 | Bacteria | 1838 |
| 252 | Ga0105245_10251582 | 3300009098 | Bacteria | 1717 |
| 253 | Ga0105245_10295747 | 3300009098 | Bacteria | 1587 |
| 254 | Ga0105245_10931082 | 3300009098 | Bacteria | 911 |
| 255 | Ga0105245_12459744 | 3300009098 | Bacteria | 574 |
| 256 | Ga0105247_10532272 | 3300009101 | Bacteria | 861 |
| 257 | Ga0105247_10585039 | 3300009101 | Bacteria | 826 |
| 258 | Ga0114129_10000234 | 3300009147 | Bacteria | 61922 |
| 259 | Ga0114129_10016860 | 3300009147 | Bacteria | 10400 |
| 260 | Ga0105243_10003243 | 3300009148 | Bacteria | 13268 |
| 261 | Ga0105243_10005983 | 3300009148 | Bacteria | 9422 |
| 262 | Ga0105243_10009041 | 3300009148 | Bacteria | 7609 |
| 263 | Ga0105243_10011327 | 3300009148 | Bacteria | 6747 |
| 264 | Ga0105243_10062730 | 3300009148 | Bacteria | 2976 |
| 265 | Ga0105243_10115080 | 3300009148 | Bacteria | 2258 |
| 266 | Ga0105243_10145722 | 3300009148 | Bacteria | 2026 |
| 267 | Ga0105243_10580052 | 3300009148 | Bacteria | 1076 |
| 268 | Ga0105243_10877187 | 3300009148 | Bacteria | 891 |
| 269 | Ga0105241_10002725 | 3300009174 | Bacteria | 13233 |
| 270 | Ga0105241_10911232 | 3300009174 | Bacteria | 817 |
| 271 | Ga0105241_11619442 | 3300009174 | Bacteria | 627 |
| 272 | Ga0105242_10037768 | 3300009176 | Bacteria | 3881 |
| 273 | Ga0105242_10060234 | 3300009176 | Bacteria | 3118 |
| 274 | Ga0105242_10155997 | 3300009176 | Bacteria | 1994 |
| 275 | Ga0105248_10011888 | 3300009177 | Bacteria | 9604 |
| 276 | Ga0105248_10284292 | 3300009177 | Bacteria | 1862 |
| 277 | Ga0105237_10024920 | 3300009545 | Bacteria | 6120 |
| 278 | Ga0105237_10183011 | 3300009545 | Bacteria | 2095 |
| 279 | Ga0105238_10019028 | 3300009551 | Bacteria | 6994 |
| 280 | Ga0105238_10062025 | 3300009551 | Bacteria | 3740 |
| 281 | Ga0105238_10104550 | 3300009551 | Bacteria | 2813 |
| 282 | Ga0105238_10109326 | 3300009551 | Bacteria | 2746 |
| 283 | Ga0105238_10410438 | 3300009551 | Bacteria | 1348 |
| 284 | Ga0105249_10006314 | 3300009553 | Bacteria | 10299 |
| 285 | Ga0105249_10008124 | 3300009553 | Bacteria | 9150 |
| 286 | Ga0105249_10057570 | 3300009553 | Bacteria | 3561 |
| 287 | Ga0105249_10061123 | 3300009553 | Bacteria | 3457 |
| 288 | Ga0105249_10138118 | 3300009553 | Bacteria | 2335 |
| 289 | Ga0105249_10268781 | 3300009553 | Bacteria | 1698 |
| 290 | Ga0105249_10325220 | 3300009553 | Bacteria | 1550 |
| 291 | Ga0105249_10377305 | 3300009553 | Bacteria | 1443 |
| 292 | Ga0105249_10379376 | 3300009553 | Bacteria | 1439 |
| 293 | Ga0105249_10509387 | 3300009553 | Bacteria | 1250 |
| 294 | Ga0105239_10002486 | 3300010375 | Bacteria | 23478 |
| 295 | Ga0105239_10088329 | 3300010375 | Bacteria | 3418 |
| 296 | Ga0105239_10095783 | 3300010375 | Bacteria | 3279 |
| 297 | Ga0105239_10127383 | 3300010375 | Bacteria | 2831 |
| 298 | Ga0105239_10215527 | 3300010375 | Bacteria | 2152 |
| 299 | Ga0105239_10248438 | 3300010375 | Bacteria | 1998 |
| 300 | Ga0105239_10296559 | 3300010375 | Bacteria | 1820 |
| 301 | Ga0105239_10325033 | 3300010375 | Bacteria | 1735 |
| 302 | Ga0105239_10584119 | 3300010375 | Bacteria | 1274 |
| 303 | Ga0105239_11127023 | 3300010375 | Bacteria | 903 |
| 304 | Ga0105246_10000375 | 3300011119 | Bacteria | 23857 |
| 305 | Ga0105246_10072522 | 3300011119 | Bacteria | 2428 |
| 306 | Ga0105246_10094043 | 3300011119 | Bacteria | 2167 |
| 307 | Ga0105246_10299301 | 3300011119 | Bacteria | 1298 |
| 308 | Ga0105246_10465319 | 3300011119 | Bacteria | 1066 |
| 309 | Ga0105246_10952920 | 3300011119 | Bacteria | 774 |
| 310 | Ga0157325_1004475 | 3300012485 | Bacteria | 821 |
| 311 | Ga0157321_1000406 | 3300012487 | Bacteria | 1953 |
| 312 | Ga0157343_1008122 | 3300012488 | Bacteria | 748 |
| 313 | Ga0157319_1004623 | 3300012497 | Bacteria | 912 |
| 314 | Ga0157347_1003844 | 3300012502 | Bacteria | 1369 |
| 315 | Ga0157313_1011957 | 3300012503 | Bacteria | 763 |
| 316 | Ga0157342_1010297 | 3300012507 | Bacteria | 954 |
| 317 | Ga0157373_10533853 | 3300013100 | Bacteria | 849 |
| 318 | Ga0157371_10019390 | 3300013102 | Bacteria | 5017 |
| 319 | Ga0157371_10079223 | 3300013102 | Bacteria | 2327 |
| 320 | Ga0157371_10573597 | 3300013102 | Bacteria | 838 |
| 321 | Ga0157370_10004788 | 3300013104 | Bacteria | 15386 |
| 322 | Ga0157370_10006538 | 3300013104 | Bacteria | 12835 |
| 323 | Ga0157370_10095226 | 3300013104 | Bacteria | 2793 |
| 324 | Ga0157370_10355780 | 3300013104 | Bacteria | 1349 |
| 325 | Ga0157370_10427220 | 3300013104 | Bacteria | 1219 |
| 326 | Ga0157370_11139210 | 3300013104 | Bacteria | 704 |
| 327 | Ga0157369_10010161 | 3300013105 | Bacteria | 10742 |
| 328 | Ga0157369_10016634 | 3300013105 | Bacteria | 8270 |
| 329 | Ga0157369_10105060 | 3300013105 | Bacteria | 3007 |
| 330 | Ga0157369_10108064 | 3300013105 | Bacteria | 2959 |
| 331 | Ga0157369_10272260 | 3300013105 | Bacteria | 1764 |
| 332 | Ga0157369_10364067 | 3300013105 | Bacteria | 1501 |
| 333 | Ga0157369_10408981 | 3300013105 | Bacteria | 1407 |
| 334 | Ga0157369_10466027 | 3300013105 | Bacteria | 1308 |
| 335 | Ga0157369_10590908 | 3300013105 | Bacteria | 1146 |
| 336 | Ga0157369_10732029 | 3300013105 | Bacteria | 1018 |
| 337 | Ga0157369_11191472 | 3300013105 | Bacteria | 777 |
| 338 | Ga0157374_10475851 | 3300013296 | Bacteria | 1252 |
| 339 | Ga0157378_10014969 | 3300013297 | Bacteria | 6792 |
| 340 | Ga0163162_10092421 | 3300013306 | Bacteria | 3109 |
| 341 | Ga0163162_10273040 | 3300013306 | Bacteria | 1823 |
| 342 | Ga0163162_10380119 | 3300013306 | Bacteria | 1545 |
| 343 | Ga0157372_10025059 | 3300013307 | Bacteria | 6482 |
| 344 | Ga0157372_10057267 | 3300013307 | Bacteria | 4356 |
| 345 | Ga0157372_10058284 | 3300013307 | Bacteria | 4316 |
| 346 | Ga0157372_10094943 | 3300013307 | Bacteria | 3397 |
| 347 | Ga0157372_10097076 | 3300013307 | Bacteria | 3360 |
| 348 | Ga0157372_10114562 | 3300013307 | Bacteria | 3090 |
| 349 | Ga0157372_10630238 | 3300013307 | Bacteria | 1249 |
| 350 | Ga0157372_11321908 | 3300013307 | Bacteria | 832 |
| 351 | Ga0157375_10026944 | 3300013308 | Bacteria | 5365 |
| 352 | Ga0157375_10038724 | 3300013308 | Bacteria | 4580 |
| 353 | Ga0157375_10079957 | 3300013308 | Bacteria | 3306 |
| 354 | Ga0157375_10321322 | 3300013308 | Bacteria | 1712 |
| 355 | Ga0157375_10385433 | 3300013308 | Bacteria | 1568 |
| 356 | Ga0157375_10557045 | 3300013308 | Bacteria | 1308 |
| 357 | Ga0157375_12297000 | 3300013308 | Bacteria | 643 |
| 358 | Ga0163163_10030515 | 3300014325 | Bacteria | 5195 |
| 359 | Ga0163163_10071780 | 3300014325 | Bacteria | 3451 |
| 360 | Ga0163163_10185290 | 3300014325 | Bacteria | 2129 |
| 361 | Ga0163163_10344432 | 3300014325 | Bacteria | 1546 |
| 362 | Ga0163163_10394324 | 3300014325 | Bacteria | 1442 |
| 363 | Ga0163163_10538988 | 3300014325 | Bacteria | 1229 |
| 364 | Ga0157380_10015279 | 3300014326 | Bacteria | 5640 |
| 365 | Ga0157380_10025399 | 3300014326 | Bacteria | 4493 |
| 366 | Ga0157380_10220676 | 3300014326 | Bacteria | 1696 |
| 367 | Ga0157380_10844187 | 3300014326 | Bacteria | 937 |
| 368 | Ga0157380_11924008 | 3300014326 | Bacteria | 652 |
| 369 | Ga0182008_10292172 | 3300014497 | Bacteria | 851 |
| 370 | Ga0157377_10102324 | 3300014745 | Bacteria | 1709 |
| 371 | Ga0157377_10172050 | 3300014745 | Bacteria | 1355 |
| 372 | Ga0157377_10393549 | 3300014745 | Bacteria | 942 |
| 373 | Ga0157377_10565305 | 3300014745 | Bacteria | 806 |
| 374 | Ga0157379_10184052 | 3300014968 | Bacteria | 1887 |
| 375 | Ga0157376_10465676 | 3300014969 | Bacteria | 1236 |
| 376 | Ga0163161_10011013 | 3300017792 | Bacteria | 6266 |
| 377 | Ga0163161_10020151 | 3300017792 | Bacteria | 4678 |
| 378 | Ga0163161_10020682 | 3300017792 | Bacteria | 4621 |
| 379 | Ga0163161_10098912 | 3300017792 | Bacteria | 2169 |
| 380 | Ga0163161_10135758 | 3300017792 | Bacteria | 1859 |
| 381 | Ga0163161_10193138 | 3300017792 | Bacteria | 1566 |
| 382 | Ga0163161_10242480 | 3300017792 | Bacteria | 1402 |
| 383 | Ga0163161_10314183 | 3300017792 | Bacteria | 1237 |
| 384 | Ga0163161_10372918 | 3300017792 | Bacteria | 1139 |
| 385 | Ga0197907_10126050 | 3300020069 | Bacteria | 1238 |
| 386 | Ga0197907_10461269 | 3300020069 | Bacteria | 1795 |
| 387 | Ga0197907_10816215 | 3300020069 | Bacteria | 1369 |
| 388 | Ga0197907_10855188 | 3300020069 | Bacteria | 1139 |
| 389 | Ga0197907_11033948 | 3300020069 | Bacteria | 818 |
| 390 | Ga0206356_10575752 | 3300020070 | Bacteria | 1301 |
| 391 | Ga0206356_11501797 | 3300020070 | Bacteria | 1252 |
| 392 | Ga0206356_11683455 | 3300020070 | Bacteria | 1063 |
| 393 | Ga0206349_1102446 | 3300020075 | Bacteria | 1404 |
| 394 | Ga0206349_1236471 | 3300020075 | Bacteria | 1054 |
| 395 | Ga0206349_1261242 | 3300020075 | Bacteria | 1091 |
| 396 | Ga0206349_1263143 | 3300020075 | Bacteria | 1276 |
| 397 | Ga0206349_1363221 | 3300020075 | Bacteria | 1179 |
| 398 | Ga0206349_1695142 | 3300020075 | Bacteria | 701 |
| 399 | Ga0206349_1741347 | 3300020075 | Bacteria | 1123 |
| 400 | Ga0206349_1983558 | 3300020075 | Bacteria | 1454 |
| 401 | Ga0206355_1045293 | 3300020076 | Bacteria | 1193 |
| 402 | Ga0206355_1051652 | 3300020076 | Bacteria | 1216 |
| 403 | Ga0206355_1375645 | 3300020076 | Bacteria | 1164 |
| 404 | Ga0206351_10765091 | 3300020077 | Bacteria | 1080 |
| 405 | Ga0206351_10824243 | 3300020077 | Bacteria | 1080 |
| 406 | Ga0206351_10837268 | 3300020077 | Bacteria | 808 |
| 407 | Ga0206352_10113150 | 3300020078 | Bacteria | 1115 |
| 408 | Ga0206352_10950465 | 3300020078 | Bacteria | 1229 |
| 409 | Ga0206352_10992946 | 3300020078 | Bacteria | 1134 |
| 410 | Ga0206352_11057851 | 3300020078 | Bacteria | 1390 |
| 411 | Ga0206350_10236030 | 3300020080 | Bacteria | 767 |
| 412 | Ga0206350_10280180 | 3300020080 | Bacteria | 1237 |
| 413 | Ga0206350_10362633 | 3300020080 | Bacteria | 1150 |
| 414 | Ga0206350_11330323 | 3300020080 | Bacteria | 1201 |
| 415 | Ga0206350_11372283 | 3300020080 | Bacteria | 718 |
| 416 | Ga0206350_11527026 | 3300020080 | Bacteria | 1044 |
| 417 | Ga0206354_10067382 | 3300020081 | Bacteria | 1198 |
| 418 | Ga0206354_10159348 | 3300020081 | Bacteria | 1061 |
| 419 | Ga0206354_10260975 | 3300020081 | Bacteria | 3019 |
| 420 | Ga0206354_10278352 | 3300020081 | Bacteria | 1455 |
| 421 | Ga0206354_10396242 | 3300020081 | Bacteria | 923 |
| 422 | Ga0206354_10724352 | 3300020081 | Bacteria | 1592 |
| 423 | Ga0206354_10782475 | 3300020081 | Bacteria | 1198 |
| 424 | Ga0206354_10857587 | 3300020081 | Bacteria | 739 |
| 425 | Ga0206354_11184045 | 3300020081 | Bacteria | 710 |
| 426 | Ga0206354_11358127 | 3300020081 | Bacteria | 1274 |
| 427 | Ga0206354_11505003 | 3300020081 | Bacteria | 1646 |
| 428 | Ga0206354_11524798 | 3300020081 | Bacteria | 1231 |
| 429 | Ga0206354_11570982 | 3300020081 | Bacteria | 1946 |
| 430 | Ga0206353_10239144 | 3300020082 | Bacteria | 1519 |
| 431 | Ga0206353_10481029 | 3300020082 | Bacteria | 3049 |
| 432 | Ga0206353_10875366 | 3300020082 | Bacteria | 856 |
| 433 | Ga0206353_11040760 | 3300020082 | Bacteria | 1010 |
| 434 | Ga0206353_11142484 | 3300020082 | Bacteria | 1279 |
| 435 | Ga0206353_11211517 | 3300020082 | Bacteria | 2437 |
| 436 | Ga0206353_11277739 | 3300020082 | Bacteria | 1421 |
| 437 | Ga0206353_11325172 | 3300020082 | Bacteria | 1659 |
| 438 | Ga0206353_11334241 | 3300020082 | Bacteria | 1313 |
| 439 | Ga0206353_11377281 | 3300020082 | Bacteria | 631 |
| 440 | Ga0206353_11402636 | 3300020082 | Bacteria | 1224 |
| 441 | Ga0206353_11724933 | 3300020082 | Bacteria | 1293 |
| 442 | Ga0154015_1274330 | 3300020610 | Bacteria | 2016 |
| 443 | Ga0154015_1375022 | 3300020610 | Bacteria | 1163 |
| 444 | Ga0213875_10266753 | 3300021388 | Bacteria | 808 |
| 445 | Ga0224712_10077111 | 3300022467 | Bacteria | 1367 |
| 446 | Ga0224712_10094614 | 3300022467 | Bacteria | 1257 |
| 447 | Ga0224712_10116741 | 3300022467 | Bacteria | 1151 |
| 448 | Ga0224712_10119699 | 3300022467 | Bacteria | 1139 |
| 449 | Ga0209646_1000088 | 3300025246 | Bacteria | 192345 |
| 450 | Ga0207697_10015594 | 3300025315 | Bacteria | 3137 |
| 451 | Ga0207655_1019276 | 3300025728 | Bacteria | 3575 |
| 452 | Ga0207655_1067251 | 3300025728 | Bacteria | 1350 |
| 453 | Ga0207682_10088748 | 3300025893 | Bacteria | 1337 |
| 454 | Ga0207682_10136850 | 3300025893 | Bacteria | 1097 |
| 455 | Ga0207642_10003527 | 3300025899 | Bacteria | 4952 |
| 456 | Ga0207642_10015040 | 3300025899 | Bacteria | 2873 |
| 457 | Ga0207642_10286385 | 3300025899 | Bacteria | 950 |
| 458 | Ga0207688_10011562 | 3300025901 | Bacteria | 4803 |
| 459 | Ga0207688_10016175 | 3300025901 | Bacteria | 4045 |
| 460 | Ga0207688_10016280 | 3300025901 | Bacteria | 4032 |
| 461 | Ga0207688_10077374 | 3300025901 | Bacteria | 1896 |
| 462 | Ga0207688_10101446 | 3300025901 | Bacteria | 1662 |
| 463 | Ga0207688_10133551 | 3300025901 | Bacteria | 1456 |
| 464 | Ga0207688_10160278 | 3300025901 | Bacteria | 1333 |
| 465 | Ga0207688_10165895 | 3300025901 | Bacteria | 1311 |
| 466 | Ga0207688_10334118 | 3300025901 | Bacteria | 931 |
| 467 | Ga0207647_10002961 | 3300025904 | Bacteria | 12781 |
| 468 | Ga0207647_10020382 | 3300025904 | Bacteria | 4447 |
| 469 | Ga0207647_10037728 | 3300025904 | Bacteria | 3061 |
| 470 | Ga0207647_10192684 | 3300025904 | Bacteria | 1181 |
| 471 | Ga0207647_10329880 | 3300025904 | Bacteria | 866 |
| 472 | Ga0207645_10149934 | 3300025907 | Bacteria | 1522 |
| 473 | Ga0207643_10027402 | 3300025908 | Bacteria | 3159 |
| 474 | Ga0207643_10287967 | 3300025908 | Bacteria | 1020 |
| 475 | Ga0207643_10385005 | 3300025908 | Bacteria | 885 |
| 476 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 477 | Ga0207705_10324895 | 3300025909 | Bacteria | 1183 |
| 478 | Ga0207684_10392112 | 3300025910 | Bacteria | 1194 |
| 479 | Ga0207654_10536722 | 3300025911 | Bacteria | 829 |
| 480 | Ga0207707_10269891 | 3300025912 | Bacteria | 1474 |
| 481 | Ga0207707_10619305 | 3300025912 | Bacteria | 915 |
| 482 | Ga0207695_10000465 | 3300025913 | Bacteria | 87928 |
| 483 | Ga0207671_10000128 | 3300025914 | Bacteria | 117836 |
| 484 | Ga0207671_10274193 | 3300025914 | Bacteria | 1329 |
| 485 | Ga0207660_10257186 | 3300025917 | Bacteria | 1380 |
| 486 | Ga0207662_10039062 | 3300025918 | Bacteria | 2783 |
| 487 | Ga0207662_10589718 | 3300025918 | Bacteria | 772 |
| 488 | Ga0207662_10765588 | 3300025918 | Bacteria | 679 |
| 489 | Ga0207657_10049317 | 3300025919 | Bacteria | 3670 |
| 490 | Ga0207657_10059784 | 3300025919 | Bacteria | 3272 |
| 491 | Ga0207657_10125259 | 3300025919 | Bacteria | 2110 |
| 492 | Ga0207657_10161338 | 3300025919 | Bacteria | 1821 |
| 493 | Ga0207657_10368056 | 3300025919 | Bacteria | 1132 |
| 494 | Ga0207649_10045895 | 3300025920 | Bacteria | 2681 |
| 495 | Ga0207649_10897042 | 3300025920 | Bacteria | 695 |
| 496 | Ga0207652_10205613 | 3300025921 | Bacteria | 1772 |
| 497 | Ga0207652_10680977 | 3300025921 | Bacteria | 918 |
| 498 | Ga0207652_10826294 | 3300025921 | Bacteria | 822 |
| 499 | Ga0207681_10197991 | 3300025923 | Bacteria | 1541 |
| 500 | Ga0207694_10002060 | 3300025924 | Bacteria | 16621 |
| 501 | Ga0207694_10067314 | 3300025924 | Bacteria | 2796 |
| 502 | Ga0207694_10110758 | 3300025924 | Bacteria | 2184 |
| 503 | Ga0207694_10210072 | 3300025924 | Bacteria | 1585 |
| 504 | Ga0207694_10224432 | 3300025924 | Bacteria | 1533 |
| 505 | Ga0207694_10367392 | 3300025924 | Bacteria | 1193 |
| 506 | Ga0207659_10114978 | 3300025926 | Bacteria | 2052 |
| 507 | Ga0207659_10235885 | 3300025926 | Bacteria | 1478 |
| 508 | Ga0207659_10257645 | 3300025926 | Bacteria | 1418 |
| 509 | Ga0207659_11393469 | 3300025926 | Bacteria | 601 |
| 510 | Ga0207687_10042556 | 3300025927 | Bacteria | 3126 |
| 511 | Ga0207687_10095826 | 3300025927 | Bacteria | 2174 |
| 512 | Ga0207687_10167381 | 3300025927 | Bacteria | 1692 |
| 513 | Ga0207687_10290339 | 3300025927 | Bacteria | 1314 |
| 514 | Ga0207687_10342592 | 3300025927 | Bacteria | 1216 |
| 515 | Ga0207644_10290383 | 3300025931 | Bacteria | 1315 |
| 516 | Ga0207690_10016816 | 3300025932 | Bacteria | 4457 |
| 517 | Ga0207690_10031073 | 3300025932 | Bacteria | 3414 |
| 518 | Ga0207690_10053882 | 3300025932 | Bacteria | 2701 |
| 519 | Ga0207690_10340464 | 3300025932 | Bacteria | 1184 |
| 520 | Ga0207690_10411309 | 3300025932 | Bacteria | 1080 |
| 521 | Ga0207690_10479034 | 3300025932 | Bacteria | 1004 |
| 522 | Ga0207690_10569851 | 3300025932 | Bacteria | 922 |
| 523 | Ga0207706_10054631 | 3300025933 | Bacteria | 3524 |
| 524 | Ga0207706_10287587 | 3300025933 | Bacteria | 1433 |
| 525 | Ga0207706_10302366 | 3300025933 | Bacteria | 1394 |
| 526 | Ga0207686_10022157 | 3300025934 | Bacteria | 3656 |
| 527 | Ga0207686_10059204 | 3300025934 | Bacteria | 2419 |
| 528 | Ga0207686_10369569 | 3300025934 | Bacteria | 1085 |
| 529 | Ga0207709_10012343 | 3300025935 | Bacteria | 4708 |
| 530 | Ga0207709_10018638 | 3300025935 | Bacteria | 3890 |
| 531 | Ga0207709_10051293 | 3300025935 | Bacteria | 2528 |
| 532 | Ga0207709_10070878 | 3300025935 | Bacteria | 2211 |
| 533 | Ga0207709_10243460 | 3300025935 | Bacteria | 1310 |
| 534 | Ga0207709_10253947 | 3300025935 | Bacteria | 1286 |
| 535 | Ga0207709_10265417 | 3300025935 | Bacteria | 1261 |
| 536 | Ga0207709_10927835 | 3300025935 | Bacteria | 709 |
| 537 | Ga0207670_10071964 | 3300025936 | Bacteria | 2392 |
| 538 | Ga0207670_10258098 | 3300025936 | Bacteria | 1350 |
| 539 | Ga0207669_10045971 | 3300025937 | Bacteria | 2576 |
| 540 | Ga0207669_10126333 | 3300025937 | Bacteria | 1748 |
| 541 | Ga0207669_10204167 | 3300025937 | Bacteria | 1437 |
| 542 | Ga0207669_10401292 | 3300025937 | Bacteria | 1074 |
| 543 | Ga0207669_10941574 | 3300025937 | Bacteria | 723 |
| 544 | Ga0207704_10007836 | 3300025938 | Bacteria | 5068 |
| 545 | Ga0207704_10081281 | 3300025938 | Bacteria | 2095 |
| 546 | Ga0207704_10091887 | 3300025938 | Bacteria | 1996 |
| 547 | Ga0207704_10351830 | 3300025938 | Bacteria | 1147 |
| 548 | Ga0207704_10773470 | 3300025938 | Bacteria | 800 |
| 549 | Ga0207691_10008019 | 3300025940 | Bacteria | 10151 |
| 550 | Ga0207711_10072369 | 3300025941 | Bacteria | 2995 |
| 551 | Ga0207711_10076921 | 3300025941 | Bacteria | 2908 |
| 552 | Ga0207711_10960028 | 3300025941 | Bacteria | 794 |
| 553 | Ga0207689_10017470 | 3300025942 | Bacteria | 6070 |
| 554 | Ga0207661_10001526 | 3300025944 | Bacteria | 15727 |
| 555 | Ga0207661_10030791 | 3300025944 | Bacteria | 4137 |
| 556 | Ga0207661_10039725 | 3300025944 | Bacteria | 3695 |
| 557 | Ga0207661_10052916 | 3300025944 | Bacteria | 3246 |
| 558 | Ga0207661_10081977 | 3300025944 | Bacteria | 2666 |
| 559 | Ga0207661_10120502 | 3300025944 | Bacteria | 2233 |
| 560 | Ga0207661_10181137 | 3300025944 | Bacteria | 1841 |
| 561 | Ga0207679_10036798 | 3300025945 | Bacteria | 3474 |
| 562 | Ga0207679_10317579 | 3300025945 | Bacteria | 1348 |
| 563 | Ga0207679_10534095 | 3300025945 | Bacteria | 1050 |
| 564 | Ga0207679_10802425 | 3300025945 | Bacteria | 858 |
| 565 | Ga0207679_10948305 | 3300025945 | Bacteria | 788 |
| 566 | Ga0207667_10012609 | 3300025949 | Bacteria | 9718 |
| 567 | Ga0207667_10129929 | 3300025949 | Bacteria | 2594 |
| 568 | Ga0207667_10359093 | 3300025949 | Bacteria | 1486 |
| 569 | Ga0207667_10639209 | 3300025949 | Bacteria | 1070 |
| 570 | Ga0207651_10010408 | 3300025960 | Bacteria | 5156 |
| 571 | Ga0207712_10057085 | 3300025961 | Bacteria | 2753 |
| 572 | Ga0207712_10116575 | 3300025961 | Bacteria | 2013 |
| 573 | Ga0207712_10220021 | 3300025961 | Bacteria | 1517 |
| 574 | Ga0207712_10466744 | 3300025961 | Bacteria | 1073 |
| 575 | Ga0207712_10535551 | 3300025961 | Bacteria | 1006 |
| 576 | Ga0207712_11062860 | 3300025961 | Bacteria | 720 |
| 577 | Ga0207712_11195608 | 3300025961 | Bacteria | 678 |
| 578 | Ga0207668_10118889 | 3300025972 | Bacteria | 1997 |
| 579 | Ga0207668_10123305 | 3300025972 | Bacteria | 1966 |
| 580 | Ga0207668_10606280 | 3300025972 | Bacteria | 954 |
| 581 | Ga0207668_10834844 | 3300025972 | Bacteria | 817 |
| 582 | Ga0207640_10005084 | 3300025981 | Bacteria | 7154 |
| 583 | Ga0207640_10156829 | 3300025981 | Bacteria | 1679 |
| 584 | Ga0207640_10342266 | 3300025981 | Bacteria | 1198 |
| 585 | Ga0207640_10680714 | 3300025981 | Bacteria | 880 |
| 586 | Ga0207640_10827943 | 3300025981 | Bacteria | 804 |
| 587 | Ga0207658_10063520 | 3300025986 | Bacteria | 2767 |
| 588 | Ga0207658_10469078 | 3300025986 | Bacteria | 1117 |
| 589 | Ga0207658_11011336 | 3300025986 | Bacteria | 758 |
| 590 | Ga0207677_10098967 | 3300026023 | Bacteria | 2140 |
| 591 | Ga0207677_10253451 | 3300026023 | Bacteria | 1431 |
| 592 | Ga0207677_10810763 | 3300026023 | Bacteria | 839 |
| 593 | Ga0207677_10923858 | 3300026023 | Bacteria | 788 |
| 594 | Ga0207639_10035824 | 3300026041 | Bacteria | 3674 |
| 595 | Ga0207639_10062063 | 3300026041 | Bacteria | 2888 |
| 596 | Ga0207639_10062509 | 3300026041 | Bacteria | 2880 |
| 597 | Ga0207639_10257158 | 3300026041 | Bacteria | 1525 |
| 598 | Ga0207639_10557672 | 3300026041 | Bacteria | 1052 |
| 599 | Ga0207639_10614819 | 3300026041 | Bacteria | 1003 |
| 600 | Ga0207678_10045508 | 3300026067 | Bacteria | 3795 |
| 601 | Ga0207678_10069737 | 3300026067 | Bacteria | 3014 |
| 602 | Ga0207678_10224531 | 3300026067 | Bacteria | 1608 |
| 603 | Ga0207678_10544054 | 3300026067 | Bacteria | 1015 |
| 604 | Ga0207708_10001069 | 3300026075 | Bacteria | 20541 |
| 605 | Ga0207708_10122988 | 3300026075 | Bacteria | 2023 |
| 606 | Ga0207708_10630564 | 3300026075 | Bacteria | 911 |
| 607 | Ga0207708_10644253 | 3300026075 | Bacteria | 901 |
| 608 | Ga0207708_10696383 | 3300026075 | Bacteria | 868 |
| 609 | Ga0207702_10085444 | 3300026078 | Bacteria | 2750 |
| 610 | Ga0207702_10581606 | 3300026078 | Bacteria | 1098 |
| 611 | Ga0207702_11103980 | 3300026078 | Bacteria | 787 |
| 612 | Ga0207702_11277392 | 3300026078 | Bacteria | 728 |
| 613 | Ga0207641_10858749 | 3300026088 | Bacteria | 900 |
| 614 | Ga0207648_10185813 | 3300026089 | Bacteria | 1841 |
| 615 | Ga0207676_10095535 | 3300026095 | Bacteria | 2451 |
| 616 | Ga0207676_11708079 | 3300026095 | Bacteria | 628 |
| 617 | Ga0207674_10007103 | 3300026116 | Bacteria | 13086 |
| 618 | Ga0207674_10040017 | 3300026116 | Bacteria | 4858 |
| 619 | Ga0207674_10135959 | 3300026116 | Bacteria | 2420 |
| 620 | Ga0207674_10518408 | 3300026116 | Bacteria | 1151 |
| 621 | Ga0207674_10887166 | 3300026116 | Bacteria | 860 |
| 622 | Ga0207674_11300190 | 3300026116 | Bacteria | 697 |
| 623 | Ga0207675_100010022 | 3300026118 | Bacteria | 8881 |
| 624 | Ga0207675_100053232 | 3300026118 | Bacteria | 3776 |
| 625 | Ga0207675_100156720 | 3300026118 | Bacteria | 2170 |
| 626 | Ga0207675_100215039 | 3300026118 | Bacteria | 1850 |
| 627 | Ga0207675_100253106 | 3300026118 | Bacteria | 1705 |
| 628 | Ga0207675_100588245 | 3300026118 | Bacteria | 1115 |
| 629 | Ga0207683_10036960 | 3300026121 | Bacteria | 4252 |
| 630 | Ga0207683_10043268 | 3300026121 | Bacteria | 3936 |
| 631 | Ga0207683_10059593 | 3300026121 | Bacteria | 3353 |
| 632 | Ga0207683_10069837 | 3300026121 | Bacteria | 3102 |
| 633 | Ga0207683_10150972 | 3300026121 | Bacteria | 2097 |
| 634 | Ga0207683_10167624 | 3300026121 | Bacteria | 1988 |
| 635 | Ga0207683_10196077 | 3300026121 | Bacteria | 1835 |
| 636 | Ga0207683_10242834 | 3300026121 | Bacteria | 1643 |
| 637 | Ga0207683_10386925 | 3300026121 | Bacteria | 1286 |
| 638 | Ga0207683_10673340 | 3300026121 | Bacteria | 959 |
| 639 | Ga0207683_11395983 | 3300026121 | Bacteria | 648 |
| 640 | Ga0207683_11649167 | 3300026121 | Bacteria | 591 |
| 641 | Ga0207698_10038296 | 3300026142 | Bacteria | 3541 |
| 642 | Ga0207698_10093155 | 3300026142 | Bacteria | 2472 |
| 643 | Ga0207698_10121155 | 3300026142 | Bacteria | 2214 |
| 644 | Ga0207698_10199750 | 3300026142 | Bacteria | 1789 |
| 645 | Ga0207698_10650438 | 3300026142 | Bacteria | 1044 |
| 646 | Ga0207698_11090255 | 3300026142 | Bacteria | 811 |
| 647 | Ga0209974_10038742 | 3300027876 | Bacteria | 1584 |
| 648 | Ga0207428_10000964 | 3300027907 | Bacteria | 31921 |
| 649 | Ga0268266_10204244 | 3300028379 | Bacteria | 1809 |
| 650 | Ga0268265_10765304 | 3300028380 | Bacteria | 938 |
| 651 | Ga0268264_10000716 | 3300028381 | Bacteria | 38128 |
| 652 | Ga0268264_10375200 | 3300028381 | Bacteria | 1361 |
| 653 | Ga0268264_10452867 | 3300028381 | Bacteria | 1244 |
| 654 | Ga0307517_10177704 | 3300028786 | Bacteria | 1382 |
| 655 | Ga0316183_1096233 | 3300030742 | Bacteria | 1779 |
| 656 | Ga0316181_1110679 | 3300030744 | Bacteria | 1818 |
| 657 | Ga0316181_1238547 | 3300030744 | Bacteria | 4374 |
| 658 | Ga0316181_1251928 | 3300030744 | Bacteria | 1492 |
| 659 | Ga0316182_1417880 | 3300030745 | Bacteria | 3090 |
| 660 | Ga0307513_10139703 | 3300031456 | Bacteria | 2351 |
| 661 | Ga0307408_100018661 | 3300031548 | Bacteria | 4660 |
| 662 | Ga0307408_100125180 | 3300031548 | Bacteria | 1997 |
| 663 | Ga0307408_100129335 | 3300031548 | Bacteria | 1968 |
| 664 | Ga0307408_100249651 | 3300031548 | Bacteria | 1463 |
| 665 | Ga0307408_100262927 | 3300031548 | Bacteria | 1429 |
| 666 | Ga0316579_10045825 | 3300031691 | Bacteria | 2039 |
| 667 | Ga0316576_10000044 | 3300031727 | Bacteria | 38025 |
| 668 | Ga0316576_10043684 | 3300031727 | Bacteria | 3234 |
| 669 | Ga0316578_10020590 | 3300031728 | Bacteria | 3647 |
| 670 | Ga0307405_10001317 | 3300031731 | Bacteria | 10385 |
| 671 | Ga0307405_10003937 | 3300031731 | Bacteria | 6944 |
| 672 | Ga0307405_10087749 | 3300031731 | Bacteria | 2051 |
| 673 | Ga0307405_10091114 | 3300031731 | Bacteria | 2019 |
| 674 | Ga0307405_10106517 | 3300031731 | Bacteria | 1891 |
| 675 | Ga0307405_10106930 | 3300031731 | Bacteria | 1888 |
| 676 | Ga0307405_10224977 | 3300031731 | Bacteria | 1379 |
| 677 | Ga0307405_10518794 | 3300031731 | Bacteria | 958 |
| 678 | Ga0307413_10000082 | 3300031824 | Bacteria | 23658 |
| 679 | Ga0307413_10084647 | 3300031824 | Bacteria | 2045 |
| 680 | Ga0307413_10100465 | 3300031824 | Bacteria | 1910 |
| 681 | Ga0307413_10321596 | 3300031824 | Bacteria | 1182 |
| 682 | Ga0307413_10331269 | 3300031824 | Bacteria | 1167 |
| 683 | Ga0307410_10011148 | 3300031852 | Bacteria | 5127 |
| 684 | Ga0307410_10017454 | 3300031852 | Bacteria | 4310 |
| 685 | Ga0307410_10018360 | 3300031852 | Bacteria | 4226 |
| 686 | Ga0307410_10061238 | 3300031852 | Bacteria | 2575 |
| 687 | Ga0307410_10136142 | 3300031852 | Bacteria | 1811 |
| 688 | Ga0307410_10197025 | 3300031852 | Bacteria | 1535 |
| 689 | Ga0307410_10270233 | 3300031852 | Bacteria | 1329 |
| 690 | Ga0307410_10403599 | 3300031852 | Bacteria | 1105 |
| 691 | Ga0307406_10002332 | 3300031901 | Bacteria | 10314 |
| 692 | Ga0307406_10004112 | 3300031901 | Bacteria | 7924 |
| 693 | Ga0307406_10005754 | 3300031901 | Bacteria | 6793 |
| 694 | Ga0307406_10026994 | 3300031901 | Bacteria | 3454 |
| 695 | Ga0307406_10160376 | 3300031901 | Bacteria | 1616 |
| 696 | Ga0307406_10294194 | 3300031901 | Bacteria | 1244 |
| 697 | Ga0307406_10519179 | 3300031901 | Bacteria | 969 |
| 698 | Ga0307406_10744407 | 3300031901 | Bacteria | 822 |
| 699 | Ga0307406_10783431 | 3300031901 | Bacteria | 803 |
| 700 | Ga0307406_11282403 | 3300031901 | Bacteria | 639 |
| 701 | Ga0307407_10002766 | 3300031903 | Bacteria | 6986 |
| 702 | Ga0307407_10031526 | 3300031903 | Bacteria | 2871 |
| 703 | Ga0307407_10033737 | 3300031903 | Bacteria | 2795 |
| 704 | Ga0307407_10055716 | 3300031903 | Bacteria | 2286 |
| 705 | Ga0307407_10075247 | 3300031903 | Bacteria | 2023 |
| 706 | Ga0307407_10109185 | 3300031903 | Bacteria | 1734 |
| 707 | Ga0307407_10125730 | 3300031903 | Bacteria | 1633 |
| 708 | Ga0307407_10196173 | 3300031903 | Bacteria | 1349 |
| 709 | Ga0307407_10419247 | 3300031903 | Bacteria | 964 |
| 710 | Ga0307407_11167375 | 3300031903 | Bacteria | 601 |
| 711 | Ga0307412_10023822 | 3300031911 | Bacteria | 3772 |
| 712 | Ga0307412_10031696 | 3300031911 | Bacteria | 3341 |
| 713 | Ga0307412_10082524 | 3300031911 | Bacteria | 2226 |
| 714 | Ga0307412_10189789 | 3300031911 | Bacteria | 1553 |
| 715 | Ga0307412_10257670 | 3300031911 | Bacteria | 1358 |
| 716 | Ga0307412_10495138 | 3300031911 | Bacteria | 1016 |
| 717 | Ga0307412_10827502 | 3300031911 | Bacteria | 806 |
| 718 | Ga0307409_100000050 | 3300031995 | Bacteria | 42042 |
| 719 | Ga0307409_100008307 | 3300031995 | Bacteria | 6291 |
| 720 | Ga0307409_100040626 | 3300031995 | Bacteria | 3465 |
| 721 | Ga0307409_100046691 | 3300031995 | Bacteria | 3281 |
| 722 | Ga0307409_100070481 | 3300031995 | Bacteria | 2775 |
| 723 | Ga0307409_100071899 | 3300031995 | Bacteria | 2752 |
| 724 | Ga0307409_101316939 | 3300031995 | Bacteria | 748 |
| 725 | Ga0307416_100000150 | 3300032002 | Bacteria | 41366 |
| 726 | Ga0307416_100023522 | 3300032002 | Bacteria | 4473 |
| 727 | Ga0307416_100078718 | 3300032002 | Bacteria | 2775 |
| 728 | Ga0307416_100094006 | 3300032002 | Bacteria | 2584 |
| 729 | Ga0307416_100126118 | 3300032002 | Bacteria | 2293 |
| 730 | Ga0307416_100221560 | 3300032002 | Bacteria | 1815 |
| 731 | Ga0307416_100366011 | 3300032002 | Bacteria | 1466 |
| 732 | Ga0307416_100576308 | 3300032002 | Bacteria | 1202 |
| 733 | Ga0307416_100761619 | 3300032002 | Bacteria | 1061 |
| 734 | Ga0307416_101175456 | 3300032002 | Bacteria | 872 |
| 735 | Ga0307414_10002253 | 3300032004 | Bacteria | 10077 |
| 736 | Ga0307414_10146268 | 3300032004 | Bacteria | 1857 |
| 737 | Ga0307414_10176030 | 3300032004 | Bacteria | 1716 |
| 738 | Ga0307414_10270642 | 3300032004 | Bacteria | 1422 |
| 739 | Ga0307414_10287591 | 3300032004 | Bacteria | 1384 |
| 740 | Ga0307414_10305081 | 3300032004 | Bacteria | 1349 |
| 741 | Ga0307414_10951889 | 3300032004 | Bacteria | 789 |
| 742 | Ga0307414_10991117 | 3300032004 | Bacteria | 773 |
| 743 | Ga0307411_10019042 | 3300032005 | Bacteria | 3955 |
| 744 | Ga0307411_10037214 | 3300032005 | Bacteria | 3057 |
| 745 | Ga0307411_10040253 | 3300032005 | Bacteria | 2963 |
| 746 | Ga0307411_10352240 | 3300032005 | Bacteria | 1201 |
| 747 | Ga0307411_10480043 | 3300032005 | Bacteria | 1046 |
| 748 | Ga0307415_100031578 | 3300032126 | Bacteria | 3414 |
| 749 | Ga0307415_100146442 | 3300032126 | Bacteria | 1811 |
| 750 | Ga0307415_100158736 | 3300032126 | Bacteria | 1750 |
| 751 | Ga0307415_100167957 | 3300032126 | Bacteria | 1708 |
| 752 | Ga0307415_100206740 | 3300032126 | Bacteria | 1562 |
| 753 | Ga0307415_100280796 | 3300032126 | Bacteria | 1369 |
| 754 | Ga0316583_10023709 | 3300032133 | Bacteria | 2190 |
| 755 | Ga0316585_10017855 | 3300032137 | Bacteria | 2147 |
| 756 | Ga0316580_10060057 | 3300032139 | Bacteria | 1168 |
| 757 | Ga0316588_1033508 | 3300033528 | Bacteria | 1211 |
| 758 | Ga0316596_1053502 | 3300033541 | Bacteria | 1070 |
| 759 | Ga0373931_0053018 | 3300035691 | Bacteria | 2164 |
| 760 | Ga0373937_0537888 | 3300036401 | Bacteria | 1110 |
| 761 | Ga0316584_0036284 | 3300036712 | Bacteria | 3657 |
| 762 | Ga0316584_0492845 | 3300036712 | Bacteria | 862 |
| 763 | Ga0395899_0179802 | 3300037312 | Bacteria | 1486 |
| 764 | Ga0395899_0283766 | 3300037312 | Bacteria | 1126 |
| 765 | Ga0395899_0351035 | 3300037312 | Bacteria | 987 |
| 766 | Ga0395900_0147607 | 3300037418 | Bacteria | 2404 |
| 767 | Ga0395900_0209282 | 3300037418 | Bacteria | 1970 |
| 768 | Ga0395900_0957769 | 3300037418 | Bacteria | 777 |
| 769 | Ga0395898_0116077 | 3300037466 | Bacteria | 2565 |
| 770 | Ga0395898_0356157 | 3300037466 | Bacteria | 1395 |
| 771 | Ga0316581_0000918 | 3300037588 | Bacteria | 6259 |
| 772 | Ga0436364_0980202 | 3300037853 | Bacteria | 1129 |
| 773 | Ga0395901_0257689 | 3300038443 | Bacteria | 1816 |
| 774 | Ga0395901_0426330 | 3300038443 | Bacteria | 1359 |
| 775 | Ga0395901_0556527 | 3300038443 | Bacteria | 1162 |
| 776 | Ga0395901_0991661 | 3300038443 | Bacteria | 816 |
| 777 | Ga0400488_11281 | 3300038741 | Bacteria | 7659 |
| 778 | Ga0400486_03564 | 3300038742 | Bacteria | 38786 |
| 779 | Ga0436365_1705036 | 3300039437 | Bacteria | 653 |
| 780 | Ga0439436_0010622 | 3300041404 | Bacteria | 2806 |
| 781 | Ga0439436_0140863 | 3300041404 | Bacteria | 678 |
| 782 | Ga0439465_0031175 | 3300041413 | Bacteria | 1698 |
| 783 | Ga0439465_0185367 | 3300041413 | Bacteria | 754 |
| 784 | Ga0451791_1478727 | 3300041451 | Bacteria | 1821 |
| 785 | Ga0451793_1618369 | 3300041452 | Bacteria | 1367 |
| 786 | Ga0451800_0512413 | 3300041459 | Bacteria | 647 |
| 787 | Ga0451806_586639 | 3300041462 | Bacteria | 958 |
| 788 | Ga0451807_2174170 | 3300041486 | Bacteria | 1949 |
| 789 | Ga0451837_1113271 | 3300041494 | Bacteria | 863 |
| 790 | Ga0439448_0011573 | 3300042005 | Bacteria | 2631 |
| 791 | Ga0439448_0146839 | 3300042005 | Bacteria | 817 |
| 792 | Ga0439432_025491 | 3300042006 | Bacteria | 1940 |
| 793 | Ga0439450_032831 | 3300042008 | Bacteria | 1174 |
| 794 | Ga0439462_0036390 | 3300042015 | Bacteria | 1310 |
| 795 | Ga0439463_002858 | 3300042016 | Bacteria | 4378 |
| 796 | Ga0439463_128134 | 3300042016 | Bacteria | 657 |
| 797 | Ga0450912_011710 | 3300042116 | Bacteria | 766 |
| 798 | Ga0450920_060584 | 3300042122 | Bacteria | 764 |
| 799 | Ga0439446_0151778 | 3300042156 | Bacteria | 762 |
| 800 | Ga0439435_0004572 | 3300042436 | Bacteria | 2994 |
| 801 | Ga0439444_0001270 | 3300042437 | Bacteria | 3218 |
| 802 | Ga0439464_0010535 | 3300042439 | Bacteria | 2441 |
| 803 | Ga0439464_0067924 | 3300042439 | Bacteria | 1051 |
| 804 | Ga0450918_096169 | 3300042531 | Bacteria | 576 |
| 805 | Ga0439440_0004003 | 3300042993 | Bacteria | 2878 |
| 806 | Ga0439440_0019724 | 3300042993 | Bacteria | 1507 |
| 807 | Ga0466969_0026550 | 3300044656 | Bacteria | 2969 |
| 808 | Ga0466969_0031800 | 3300044656 | Bacteria | 2685 |
| 809 | Ga0466969_0044386 | 3300044656 | Bacteria | 2211 |
| 810 | Ga0466972_0205735 | 3300044658 | Bacteria | 922 |
| 811 | Ga0466965_0063382 | 3300044683 | Bacteria | 1850 |
| 812 | Ga0466965_0134546 | 3300044683 | Bacteria | 1284 |
| 813 | Ga0466965_0135622 | 3300044683 | Bacteria | 1278 |
| 814 | Ga0466965_0159769 | 3300044683 | Bacteria | 1181 |
| 815 | Ga0466965_0239806 | 3300044683 | Bacteria | 970 |
| 816 | Ga0466966_0007159 | 3300044684 | Bacteria | 7393 |
| 817 | Ga0466966_0015403 | 3300044684 | Bacteria | 5055 |
| 818 | Ga0466966_0028371 | 3300044684 | Bacteria | 3646 |
| 819 | Ga0466966_0419245 | 3300044684 | Bacteria | 804 |
| 820 | Ga0466961_0019337 | 3300044693 | Bacteria | 4382 |
| 821 | Ga0466961_0037545 | 3300044693 | Bacteria | 3107 |
| 822 | Ga0466961_0064101 | 3300044693 | Bacteria | 2335 |
| 823 | Ga0466961_0096221 | 3300044693 | Bacteria | 1867 |
| 824 | Ga0466961_0201734 | 3300044693 | Bacteria | 1230 |
| 825 | Ga0466961_0263842 | 3300044693 | Bacteria | 1056 |
| 826 | Ga0466961_0707591 | 3300044693 | Bacteria | 603 |
| 827 | Ga0466963_0013682 | 3300044694 | Bacteria | 4989 |
| 828 | Ga0466963_0041521 | 3300044694 | Bacteria | 3017 |
| 829 | Ga0466963_0272509 | 3300044694 | Bacteria | 1189 |
| 830 | Ga0466963_0361708 | 3300044694 | Bacteria | 1022 |
| 831 | Ga0466963_0809494 | 3300044694 | Bacteria | 661 |
| 832 | Ga0466963_1071301 | 3300044694 | Bacteria | 567 |
| 833 | Ga0466964_0006978 | 3300044706 | Bacteria | 4221 |
| 834 | Ga0466964_0019416 | 3300044706 | Bacteria | 2612 |
| 835 | Ga0466971_0012855 | 3300044719 | Bacteria | 3670 |
| 836 | Ga0466971_0018447 | 3300044719 | Bacteria | 3090 |
| 837 | Ga0466968_0165165 | 3300044735 | Bacteria | 1023 |
| 838 | Ga0466970_0000027 | 3300044765 | Bacteria | 56103 |
| 839 | Ga0466970_0001734 | 3300044765 | Bacteria | 10509 |
| 840 | Ga0466970_0058140 | 3300044765 | Bacteria | 2069 |
| 841 | Ga0466970_0064028 | 3300044765 | Bacteria | 1971 |
| 842 | Ga0466970_0093046 | 3300044765 | Bacteria | 1637 |
| 843 | Ga0466970_0161057 | 3300044765 | Bacteria | 1241 |
| 844 | Ga0466970_0270609 | 3300044765 | Bacteria | 954 |
| 845 | Ga0466970_0370452 | 3300044765 | Bacteria | 814 |
| 846 | Ga0466957_0068291 | 3300044842 | Bacteria | 2194 |
| 847 | Ga0466957_0223574 | 3300044842 | Bacteria | 1244 |
| 848 | Ga0466957_0368680 | 3300044842 | Bacteria | 977 |
| 849 | Ga0466957_0651528 | 3300044842 | Bacteria | 740 |
| 850 | Ga0466957_0839109 | 3300044842 | Bacteria | 654 |
| 851 | Ga0466960_0012073 | 3300044901 | Bacteria | 3635 |
| 852 | Ga0466960_0024128 | 3300044901 | Bacteria | 2740 |
| 853 | Ga0466960_0034018 | 3300044901 | Bacteria | 2372 |
| 854 | Ga0466960_0041643 | 3300044901 | Bacteria | 2177 |
| 855 | Ga0466960_0053836 | 3300044901 | Bacteria | 1951 |
| 856 | Ga0466960_0254480 | 3300044901 | Bacteria | 976 |
| 857 | Ga0466960_0400834 | 3300044901 | Bacteria | 790 |
| 858 | Ga0466959_0022475 | 3300045049 | Bacteria | 4663 |
| 859 | Ga0466959_0050657 | 3300045049 | Bacteria | 3048 |
| 860 | Ga0466959_0089417 | 3300045049 | Bacteria | 2212 |
| 861 | Ga0466959_0214515 | 3300045049 | Bacteria | 1336 |
| 862 | Ga0466959_0328588 | 3300045049 | Bacteria | 1044 |
| 863 | Ga0451576_0165085 | 3300045051 | Bacteria | 2311 |
| 864 | Ga0466958_0127343 | 3300045836 | Bacteria | 1597 |
| 865 | Ga0466958_0271336 | 3300045836 | Bacteria | 1086 |
| 866 | Ga0466958_0781369 | 3300045836 | Bacteria | 622 |
| 867 | Ga0466967_0019414 | 3300045976 | Bacteria | 5465 |
| 868 | Ga0466967_0025932 | 3300045976 | Bacteria | 4843 |
| 869 | Ga0466967_0058636 | 3300045976 | Bacteria | 3404 |
| 870 | Ga0466967_0228547 | 3300045976 | Bacteria | 1770 |
| 871 | Ga0466967_0381743 | 3300045976 | Bacteria | 1368 |
| 872 | Ga0466967_0575945 | 3300045976 | Bacteria | 1109 |
| 873 | Ga0466967_0670159 | 3300045976 | Bacteria | 1026 |
| 874 | Ga0466967_0780758 | 3300045976 | Bacteria | 948 |
| 875 | Ga0466967_0856091 | 3300045976 | Bacteria | 903 |
| 876 | Ga0495627_000366 | 3300046453 | Bacteria | 42078 |
| 877 | Ga0495627_073803 | 3300046453 | Bacteria | 994 |
| 878 | Ga0495627_076911 | 3300046453 | Bacteria | 970 |
| 879 | Ga0495592_0015950 | 3300046454 | Bacteria | 5699 |
| 880 | Ga0495603_0271340 | 3300046455 | Bacteria | 976 |
| 881 | Ga0495603_0354456 | 3300046455 | Bacteria | 842 |
| 882 | Ga0495638_0071684 | 3300046460 | Bacteria | 2119 |
| 883 | Ga0495641_0067371 | 3300046461 | Bacteria | 1610 |
| 884 | Ga0495651_0002063 | 3300046462 | Bacteria | 15529 |
| 885 | Ga0495651_0002864 | 3300046462 | Bacteria | 13360 |
| 886 | Ga0495651_0037156 | 3300046462 | Bacteria | 3791 |
| 887 | Ga0495651_0100669 | 3300046462 | Bacteria | 2152 |
| 888 | Ga0495653_0013086 | 3300046463 | Bacteria | 6764 |
| 889 | Ga0495653_0053217 | 3300046463 | Bacteria | 3098 |
| 890 | Ga0495653_0409546 | 3300046463 | Bacteria | 860 |
| 891 | Ga0495650_0286394 | 3300046471 | Bacteria | 554 |
| 892 | Ga0495580_0005827 | 3300046472 | Bacteria | 10107 |
| 893 | Ga0495582_0548271 | 3300046473 | Bacteria | 669 |
| 894 | Ga0495662_0000390 | 3300046476 | Bacteria | 19590 |
| 895 | Ga0495664_0003456 | 3300046477 | Bacteria | 8593 |
| 896 | Ga0495596_0167194 | 3300046500 | Bacteria | 855 |
| 897 | Ga0495608_0006616 | 3300046511 | Bacteria | 8228 |
| 898 | Ga0495608_0098578 | 3300046511 | Bacteria | 1886 |
| 899 | Ga0495608_0288386 | 3300046511 | Bacteria | 1018 |
| 900 | Ga0495618_0081028 | 3300046514 | Bacteria | 2072 |
| 901 | Ga0495620_0040118 | 3300046515 | Bacteria | 2063 |
| 902 | Ga0495628_0036245 | 3300046516 | Bacteria | 3960 |
| 903 | Ga0495628_0100147 | 3300046516 | Bacteria | 2237 |
| 904 | Ga0495630_0038944 | 3300046517 | Bacteria | 3555 |
| 905 | Ga0495630_0409753 | 3300046517 | Bacteria | 1039 |
| 906 | Ga0495631_0083179 | 3300046518 | Bacteria | 1380 |
| 907 | Ga0495631_0205127 | 3300046518 | Bacteria | 843 |
| 908 | Ga0495631_0244585 | 3300046518 | Bacteria | 765 |
| 909 | Ga0495632_0224480 | 3300046519 | Bacteria | 849 |
| 910 | Ga0495666_0018682 | 3300046526 | Bacteria | 3444 |
| 911 | Ga0495652_0005073 | 3300046529 | Bacteria | 12464 |
| 912 | Ga0495652_0030673 | 3300046529 | Bacteria | 4712 |
| 913 | Ga0495665_0011264 | 3300046531 | Bacteria | 4842 |
| 914 | Ga0495640_0010828 | 3300046533 | Bacteria | 7035 |
| 915 | Ga0495586_0016566 | 3300046535 | Bacteria | 3921 |
| 916 | Ga0495587_0005716 | 3300046536 | Bacteria | 8104 |
| 917 | Ga0495587_0099437 | 3300046536 | Bacteria | 1676 |
| 918 | Ga0495598_0084838 | 3300046537 | Bacteria | 1023 |
| 919 | Ga0495597_0123881 | 3300046542 | Bacteria | 1076 |
| 920 | Ga0495645_0003715 | 3300046543 | Bacteria | 10377 |
| 921 | Ga0495645_0021561 | 3300046543 | Bacteria | 4655 |
| 922 | Ga0495622_0028293 | 3300046557 | Bacteria | 2617 |
| 923 | Ga0495667_0008797 | 3300046559 | Bacteria | 6864 |
| 924 | Ga0495667_0476054 | 3300046559 | Bacteria | 783 |
| 925 | Ga0495656_0276568 | 3300046615 | Bacteria | 855 |
| 926 | Ga0495656_0306878 | 3300046615 | Bacteria | 815 |
| 927 | Ga0495656_0494259 | 3300046615 | Bacteria | 648 |
| 928 | Ga0495611_0038558 | 3300046648 | Bacteria | 2126 |
| 929 | Ga0495625_0106558 | 3300046660 | Bacteria | 1919 |
| 930 | Ga0495635_0012485 | 3300046663 | Bacteria | 5950 |
| 931 | Ga0495599_0005565 | 3300046678 | Bacteria | 7556 |
| 932 | Ga0495623_0007953 | 3300046679 | Bacteria | 6891 |
| 933 | Ga0495646_0008190 | 3300046680 | Bacteria | 6642 |
| 934 | Ga0495646_0071459 | 3300046680 | Bacteria | 2042 |
| 935 | Ga0495647_0099843 | 3300046681 | Bacteria | 1201 |
| 936 | Ga0495647_0216796 | 3300046681 | Bacteria | 844 |
| 937 | Ga0495647_0310652 | 3300046681 | Bacteria | 712 |
| 938 | Ga0495658_0006908 | 3300046683 | Bacteria | 5596 |
| 939 | Ga0495658_0231664 | 3300046683 | Bacteria | 1158 |
| 940 | Ga0495658_0253129 | 3300046683 | Bacteria | 1108 |
| 941 | Ga0495658_0311014 | 3300046683 | Bacteria | 997 |
| 942 | Ga0495658_0373709 | 3300046683 | Bacteria | 907 |
| 943 | Ga0495658_0537296 | 3300046683 | Bacteria | 748 |
| 944 | Ga0495613_0018672 | 3300046689 | Bacteria | 5170 |
| 945 | Ga0495613_0242161 | 3300046689 | Bacteria | 1261 |
| 946 | Ga0495624_0333751 | 3300046690 | Bacteria | 912 |
| 947 | Ga0495670_0120949 | 3300046691 | Bacteria | 1360 |
| 948 | Ga0495600_0002560 | 3300046809 | Bacteria | 10482 |
| 949 | Ga0495600_0078541 | 3300046809 | Bacteria | 2155 |
| 950 | Ga0495581_0012598 | 3300047315 | Bacteria | 4900 |
| 951 | Ga0495581_0063337 | 3300047315 | Bacteria | 2137 |
| 952 | Ga0495581_0170093 | 3300047315 | Bacteria | 1274 |
| 953 | Ga0495604_0000113 | 3300047317 | Bacteria | 68389 |
| 954 | Ga0495604_0073835 | 3300047317 | Bacteria | 2572 |
| 955 | Ga0495604_0424629 | 3300047317 | Bacteria | 872 |
| 956 | Ga0495674_0014322 | 3300047319 | Bacteria | 7426 |
| 957 | Ga0495674_0172173 | 3300047319 | Bacteria | 1806 |
| 958 | Ga0495672_0011090 | 3300047320 | Bacteria | 6380 |
| 959 | Ga0495672_0043999 | 3300047320 | Bacteria | 2681 |
| 960 | Ga0495676_0108581 | 3300047321 | Bacteria | 2041 |
| 961 | Ga0495676_0233635 | 3300047321 | Bacteria | 1262 |
| 962 | Ga0495676_0309627 | 3300047321 | Bacteria | 1063 |
| 963 | Ga0495676_0722909 | 3300047321 | Bacteria | 643 |
| 964 | Ga0495675_0002112 | 3300047444 | Bacteria | 11852 |
| 965 | Ga0495681_0168170 | 3300047470 | Bacteria | 909 |
| 966 | Ga0495684_0011762 | 3300047471 | Bacteria | 6755 |
| 967 | Ga0495593_0003677 | 3300047673 | Bacteria | 9157 |
| 968 | Ga0495602_0015786 | 3300048088 | Bacteria | 7606 |
| 969 | Ga0495615_0145115 | 3300048090 | Bacteria | 703 |
| 970 | Ga0496100_0155095 | 3300048903 | Bacteria | 1637 |
| 971 | Ga0496100_0236947 | 3300048903 | Bacteria | 1345 |
| 972 | Ga0496100_0490988 | 3300048903 | Bacteria | 945 |
| 973 | Ga0496101_0108207 | 3300048904 | Bacteria | 2089 |
| 974 | Ga0496101_0161065 | 3300048904 | Bacteria | 1721 |
| 975 | Ga0496101_0420515 | 3300048904 | Bacteria | 1053 |
| 976 | Ga0496101_0494603 | 3300048904 | Bacteria | 966 |
| 977 | Ga0496101_0531927 | 3300048904 | Bacteria | 929 |
| 978 | Ga0496101_0666531 | 3300048904 | Bacteria | 822 |
| 979 | Ga0496101_1103318 | 3300048904 | Bacteria | 623 |
| 980 | Ga0496102_0009934 | 3300048905 | Bacteria | 8186 |
| 981 | Ga0496102_0028027 | 3300048905 | Bacteria | 5032 |
| 982 | Ga0496102_0239967 | 3300048905 | Bacteria | 1709 |
| 983 | Ga0496102_0617350 | 3300048905 | Bacteria | 1007 |
| 984 | Ga0496103_0034233 | 3300048906 | Bacteria | 3106 |
| 985 | Ga0496104_0316126 | 3300048907 | Bacteria | 1475 |
| 986 | Ga0496104_0435768 | 3300048907 | Bacteria | 1222 |
| 987 | Ga0496104_0899131 | 3300048907 | Bacteria | 790 |
| 988 | Ga0496105_0357227 | 3300048908 | Bacteria | 1166 |
| 989 | Ga0496105_0432883 | 3300048908 | Bacteria | 1040 |
| 990 | Ga0496105_0440495 | 3300048908 | Bacteria | 1029 |
| 991 | Ga0496105_0866846 | 3300048908 | Bacteria | 682 |
| 992 | Ga0496105_1023298 | 3300048908 | Bacteria | 617 |
| 993 | Ga0496106_0006764 | 3300048909 | Bacteria | 8490 |
| 994 | Ga0496106_0135921 | 3300048909 | Bacteria | 1931 |
| 995 | Ga0496106_0249673 | 3300048909 | Bacteria | 1418 |
| 996 | Ga0496106_0383805 | 3300048909 | Bacteria | 1129 |
| 997 | Ga0496107_0209976 | 3300048910 | Bacteria | 1448 |
| 998 | Ga0496107_0275723 | 3300048910 | Bacteria | 1252 |
| 999 | Ga0496107_0913733 | 3300048910 | Bacteria | 639 |
| 1000 | Ga0496108_0016525 | 3300048911 | Bacteria | 6023 |
| 1001 | Ga0496108_0032449 | 3300048911 | Bacteria | 4338 |
| 1002 | Ga0496108_0080994 | 3300048911 | Bacteria | 2751 |
| 1003 | Ga0496108_0145139 | 3300048911 | Bacteria | 2046 |
| 1004 | Ga0496108_0277932 | 3300048911 | Bacteria | 1458 |
| 1005 | Ga0496108_0305004 | 3300048911 | Bacteria | 1387 |
| 1006 | Ga0496108_0636755 | 3300048911 | Bacteria | 927 |
| 1007 | Ga0496108_0902018 | 3300048911 | Bacteria | 759 |
| 1008 | Ga0496108_1004936 | 3300048911 | Bacteria | 712 |
| 1009 | Ga0496108_1050387 | 3300048911 | Bacteria | 694 |
| 1010 | Ga0496109_0004619 | 3300048912 | Bacteria | 11495 |
| 1011 | Ga0496109_0010829 | 3300048912 | Bacteria | 7808 |
| 1012 | Ga0496109_0026873 | 3300048912 | Bacteria | 5133 |
| 1013 | Ga0496109_0156938 | 3300048912 | Bacteria | 2131 |
| 1014 | Ga0496109_0256958 | 3300048912 | Bacteria | 1645 |
| 1015 | Ga0496109_0332801 | 3300048912 | Bacteria | 1434 |
| 1016 | Ga0496109_0372274 | 3300048912 | Bacteria | 1349 |
| 1017 | Ga0496109_0538290 | 3300048912 | Bacteria | 1102 |
| 1018 | Ga0496109_0603304 | 3300048912 | Bacteria | 1034 |
| 1019 | Ga0496109_0612320 | 3300048912 | Bacteria | 1025 |
| 1020 | Ga0496109_0782719 | 3300048912 | Bacteria | 892 |
| 1021 | Ga0496109_1033756 | 3300048912 | Bacteria | 759 |
| 1022 | Ga0496109_1213135 | 3300048912 | Bacteria | 691 |
| 1023 | Ga0496109_1500909 | 3300048912 | Bacteria | 609 |
| 1024 | Ga0496110_0003002 | 3300048913 | Bacteria | 12801 |
| 1025 | Ga0496110_0009432 | 3300048913 | Bacteria | 7905 |
| 1026 | Ga0496110_0102021 | 3300048913 | Bacteria | 2573 |
| 1027 | Ga0496110_0135817 | 3300048913 | Bacteria | 2222 |
| 1028 | Ga0496110_0224581 | 3300048913 | Bacteria | 1708 |
| 1029 | Ga0496110_0241567 | 3300048913 | Bacteria | 1643 |
| 1030 | Ga0496110_0411080 | 3300048913 | Bacteria | 1234 |
| 1031 | Ga0496110_0429112 | 3300048913 | Bacteria | 1205 |
| 1032 | Ga0496110_0661898 | 3300048913 | Bacteria | 944 |
| 1033 | Ga0496110_0721746 | 3300048913 | Bacteria | 899 |
| 1034 | Ga0496110_0947279 | 3300048913 | Bacteria | 768 |
| 1035 | Ga0496111_0047733 | 3300048914 | Bacteria | 3083 |
| 1036 | Ga0496111_0166218 | 3300048914 | Bacteria | 1638 |
| 1037 | Ga0496111_0362966 | 3300048914 | Bacteria | 1072 |
| 1038 | Ga0496112_0164633 | 3300048915 | Bacteria | 2184 |
| 1039 | Ga0496112_0580270 | 3300048915 | Bacteria | 1054 |
| 1040 | Ga0496113_0065187 | 3300048916 | Bacteria | 2756 |
| 1041 | Ga0496113_0163409 | 3300048916 | Bacteria | 1761 |
| 1042 | Ga0496113_0234387 | 3300048916 | Bacteria | 1464 |
| 1043 | Ga0496113_1250241 | 3300048916 | Bacteria | 578 |
| 1044 | Ga0496114_0014209 | 3300048917 | Bacteria | 6386 |
| 1045 | Ga0496114_0021729 | 3300048917 | Bacteria | 5223 |
| 1046 | Ga0496114_0037958 | 3300048917 | Bacteria | 3985 |
| 1047 | Ga0496114_0045393 | 3300048917 | Bacteria | 3650 |
| 1048 | Ga0496114_0046928 | 3300048917 | Bacteria | 3591 |
| 1049 | Ga0496114_0099311 | 3300048917 | Bacteria | 2483 |
| 1050 | Ga0496114_0100486 | 3300048917 | Bacteria | 2468 |
| 1051 | Ga0496114_0164138 | 3300048917 | Bacteria | 1933 |
| 1052 | Ga0496114_0226403 | 3300048917 | Bacteria | 1642 |
| 1053 | Ga0496114_0329099 | 3300048917 | Bacteria | 1350 |
| 1054 | Ga0496114_0369396 | 3300048917 | Bacteria | 1269 |
| 1055 | Ga0496114_0482584 | 3300048917 | Bacteria | 1097 |
| 1056 | Ga0496114_0492402 | 3300048917 | Bacteria | 1084 |
| 1057 | Ga0496114_0735405 | 3300048917 | Bacteria | 863 |
| 1058 | Ga0496114_0794512 | 3300048917 | Bacteria | 825 |
| 1059 | Ga0496114_1155620 | 3300048917 | Bacteria | 660 |
| 1060 | Ga0496114_1225007 | 3300048917 | Bacteria | 637 |
| 1061 | Ga0496116_0179449 | 3300048919 | Bacteria | 1136 |
| 1062 | Ga0496117_0000651 | 3300048920 | Bacteria | 55785 |
| 1063 | Ga0496117_0001417 | 3300048920 | Bacteria | 34751 |
| 1064 | Ga0496117_0001865 | 3300048920 | Bacteria | 28449 |
| 1065 | Ga0496117_0006565 | 3300048920 | Bacteria | 11704 |
| 1066 | Ga0496117_0361887 | 3300048920 | Bacteria | 745 |
| 1067 | Ga0496118_0004583 | 3300048921 | Bacteria | 16257 |
| 1068 | Ga0496118_0040541 | 3300048921 | Bacteria | 3701 |
| 1069 | Ga0496119_0002760 | 3300048922 | Bacteria | 18892 |
| 1070 | Ga0496119_0010799 | 3300048922 | Bacteria | 7642 |
| 1071 | Ga0496119_0015791 | 3300048922 | Bacteria | 5785 |
| 1072 | Ga0496119_0255209 | 3300048922 | Bacteria | 882 |
| 1073 | Ga0496120_0003180 | 3300048923 | Bacteria | 15284 |
| 1074 | Ga0496120_0006039 | 3300048923 | Bacteria | 9417 |
| 1075 | Ga0496120_0008033 | 3300048923 | Bacteria | 7762 |
| 1076 | Ga0496120_0347590 | 3300048923 | Bacteria | 667 |
| 1077 | Ga0496122_0001412 | 3300048925 | Bacteria | 38911 |
| 1078 | Ga0496122_0001962 | 3300048925 | Bacteria | 30783 |
| 1079 | Ga0496122_0003791 | 3300048925 | Bacteria | 19486 |
| 1080 | Ga0496122_0011371 | 3300048925 | Bacteria | 9022 |
| 1081 | Ga0496122_0016759 | 3300048925 | Bacteria | 6904 |
| 1082 | Ga0496122_0022308 | 3300048925 | Bacteria | 5633 |
| 1083 | Ga0496123_0000009 | 3300048926 | Bacteria | 509486 |
| 1084 | Ga0496123_0002420 | 3300048926 | Bacteria | 23276 |
| 1085 | Ga0496123_0165602 | 3300048926 | Bacteria | 1173 |
| 1086 | Ga0496124_0016122 | 3300048927 | Bacteria | 7128 |
| 1087 | Ga0496124_0120964 | 3300048927 | Bacteria | 2092 |
| 1088 | Ga0496124_0255380 | 3300048927 | Bacteria | 1293 |
| 1089 | Ga0496124_0434039 | 3300048927 | Bacteria | 901 |
| 1090 | Ga0496125_0000086 | 3300048928 | Bacteria | 216489 |
| 1091 | Ga0496125_0005854 | 3300048928 | Bacteria | 13496 |
| 1092 | Ga0496125_0012271 | 3300048928 | Bacteria | 8519 |
| 1093 | Ga0496125_0019618 | 3300048928 | Bacteria | 6369 |
| 1094 | Ga0496125_0050862 | 3300048928 | Bacteria | 3425 |
| 1095 | Ga0496125_0051614 | 3300048928 | Bacteria | 3390 |
| 1096 | Ga0496126_0001361 | 3300048929 | Bacteria | 38739 |
| 1097 | Ga0496126_0004955 | 3300048929 | Bacteria | 15529 |
| 1098 | Ga0496126_0072850 | 3300048929 | Bacteria | 3055 |
| 1099 | Ga0496126_0079413 | 3300048929 | Bacteria | 2904 |
| 1100 | Ga0496126_0130003 | 3300048929 | Bacteria | 2177 |
| 1101 | Ga0496126_0562656 | 3300048929 | Bacteria | 903 |
| 1102 | Ga0501306_005444 | 3300049127 | Bacteria | 1460 |
| 1103 | Ga0501306_005481 | 3300049127 | Bacteria | 1456 |
| 1104 | Ga0501306_009793 | 3300049127 | Bacteria | 1194 |
| 1105 | Ga0501306_009840 | 3300049127 | Bacteria | 1192 |
| 1106 | Ga0501306_013272 | 3300049127 | Bacteria | 1072 |
| 1107 | Ga0501306_017558 | 3300049127 | Bacteria | 972 |
| 1108 | Ga0501306_018175 | 3300049127 | Bacteria | 960 |
| 1109 | Ga0501306_020788 | 3300049127 | Bacteria | 915 |
| 1110 | Ga0501306_038680 | 3300049127 | Bacteria | 733 |
| 1111 | Ga0501308_003250 | 3300049128 | Bacteria | 1494 |
| 1112 | Ga0501308_008813 | 3300049128 | Bacteria | 1088 |
| 1113 | Ga0501308_016950 | 3300049128 | Bacteria | 877 |
| 1114 | Ga0501308_028109 | 3300049128 | Bacteria | 742 |
| 1115 | Ga0501309_007448 | 3300049129 | Bacteria | 1357 |
| 1116 | Ga0501309_010739 | 3300049129 | Bacteria | 1185 |
| 1117 | Ga0501309_030598 | 3300049129 | Bacteria | 793 |
| 1118 | Ga0501309_064581 | 3300049129 | Bacteria | 594 |
| 1119 | Ga0501310_000203 | 3300049130 | Bacteria | 5643 |
| 1120 | Ga0501310_004679 | 3300049130 | Bacteria | 1382 |
| 1121 | Ga0501310_011248 | 3300049130 | Bacteria | 1010 |
| 1122 | Ga0501310_013202 | 3300049130 | Bacteria | 956 |
| 1123 | Ga0501310_019314 | 3300049130 | Bacteria | 838 |
| 1124 | Ga0501310_021706 | 3300049130 | Bacteria | 805 |
| 1125 | Ga0501310_043217 | 3300049130 | Bacteria | 633 |
| 1126 | Ga0501310_054264 | 3300049130 | Bacteria | 586 |
| 1127 | Ga0501304_005285 | 3300049160 | Bacteria | 1008 |
| 1128 | Ga0501304_006590 | 3300049160 | Bacteria | 940 |
| 1129 | Ga0501304_035168 | 3300049160 | Bacteria | 545 |
| 1130 | Ga0501305_009438 | 3300049161 | Bacteria | 1282 |
| 1131 | Ga0501305_011341 | 3300049161 | Bacteria | 1202 |
| 1132 | Ga0501305_013752 | 3300049161 | Bacteria | 1123 |
| 1133 | Ga0501305_017779 | 3300049161 | Bacteria | 1024 |
| 1134 | Ga0501305_021051 | 3300049161 | Bacteria | 962 |
| 1135 | Ga0501305_022577 | 3300049161 | Bacteria | 937 |
| 1136 | Ga0501305_039732 | 3300049161 | Bacteria | 762 |
| 1137 | Ga0501307_001336 | 3300049162 | Bacteria | 2053 |
| 1138 | Ga0501307_007043 | 3300049162 | Bacteria | 1231 |
| 1139 | Ga0501307_008681 | 3300049162 | Bacteria | 1147 |
| 1140 | Ga0501307_008773 | 3300049162 | Bacteria | 1143 |
| 1141 | Ga0501307_008990 | 3300049162 | Bacteria | 1134 |
| 1142 | Ga0501307_009302 | 3300049162 | Bacteria | 1121 |
| 1143 | Ga0501291_003463 | 3300049514 | Bacteria | 1962 |
| 1144 | Ga0501311_002733 | 3300049527 | Bacteria | 1722 |
| 1145 | Ga0501311_006387 | 3300049527 | Bacteria | 1326 |
| 1146 | Ga0501311_006689 | 3300049527 | Bacteria | 1307 |
| 1147 | Ga0501311_007519 | 3300049527 | Bacteria | 1256 |
| 1148 | Ga0501311_009584 | 3300049527 | Bacteria | 1159 |
| 1149 | Ga0501311_012613 | 3300049527 | Bacteria | 1057 |
| 1150 | Ga0501311_015533 | 3300049527 | Bacteria | 984 |
| 1151 | Ga0501311_016867 | 3300049527 | Bacteria | 956 |
| 1152 | Ga0501311_024585 | 3300049527 | Bacteria | 840 |
| 1153 | Ga0501311_070326 | 3300049527 | Bacteria | 580 |
| 1154 | Ga0501312_008978 | 3300049528 | Bacteria | 1309 |
| 1155 | Ga0501312_010973 | 3300049528 | Bacteria | 1223 |
| 1156 | Ga0501312_013905 | 3300049528 | Bacteria | 1125 |
| 1157 | Ga0501312_014606 | 3300049528 | Bacteria | 1105 |
| 1158 | Ga0501312_033162 | 3300049528 | Bacteria | 818 |
| 1159 | Ga0501312_053797 | 3300049528 | Bacteria | 684 |
| 1160 | Ga0501312_077440 | 3300049528 | Bacteria | 598 |
| 1161 | Ga0501313_004416 | 3300049529 | Bacteria | 1444 |
| 1162 | Ga0501313_007160 | 3300049529 | Bacteria | 1225 |
| 1163 | Ga0501313_008814 | 3300049529 | Bacteria | 1129 |
| 1164 | Ga0501314_005361 | 3300049530 | Bacteria | 1089 |
| 1165 | Ga0501314_016981 | 3300049530 | Bacteria | 730 |
| 1166 | Ga0501315_004377 | 3300049531 | Bacteria | 1474 |
| 1167 | Ga0501315_007175 | 3300049531 | Bacteria | 1264 |
| 1168 | Ga0501315_007980 | 3300049531 | Bacteria | 1220 |
| 1169 | Ga0501315_012376 | 3300049531 | Bacteria | 1054 |
| 1170 | Ga0501315_012540 | 3300049531 | Bacteria | 1050 |
| 1171 | Ga0501315_013901 | 3300049531 | Bacteria | 1014 |
| 1172 | Ga0501315_024447 | 3300049531 | Bacteria | 836 |
| 1173 | Ga0501315_035972 | 3300049531 | Bacteria | 733 |
| 1174 | Ga0501316_010829 | 3300049532 | Bacteria | 1043 |
| 1175 | Ga0501316_013105 | 3300049532 | Bacteria | 977 |
| 1176 | Ga0501316_016456 | 3300049532 | Bacteria | 899 |
| 1177 | Ga0501316_022147 | 3300049532 | Bacteria | 808 |
| 1178 | Ga0501316_035199 | 3300049532 | Bacteria | 683 |
| 1179 | Ga0501317_000644 | 3300049533 | Bacteria | 2598 |
| 1180 | Ga0501317_005272 | 3300049533 | Bacteria | 1378 |
| 1181 | Ga0501317_005710 | 3300049533 | Bacteria | 1344 |
| 1182 | Ga0501317_014600 | 3300049533 | Bacteria | 997 |
| 1183 | Ga0501317_016193 | 3300049533 | Bacteria | 964 |
| 1184 | Ga0501317_024164 | 3300049533 | Bacteria | 844 |
| 1185 | Ga0501317_034421 | 3300049533 | Bacteria | 750 |
| 1186 | Ga0501317_071509 | 3300049533 | Bacteria | 586 |
| 1187 | Ga0501318_000479 | 3300049534 | Bacteria | 2560 |
| 1188 | Ga0501318_001868 | 3300049534 | Bacteria | 1741 |
| 1189 | Ga0501318_004917 | 3300049534 | Bacteria | 1303 |
| 1190 | Ga0501318_005596 | 3300049534 | Bacteria | 1253 |
| 1191 | Ga0501318_007572 | 3300049534 | Bacteria | 1139 |
| 1192 | Ga0501318_008705 | 3300049534 | Bacteria | 1091 |
| 1193 | Ga0501318_009413 | 3300049534 | Bacteria | 1065 |
| 1194 | Ga0501318_009609 | 3300049534 | Bacteria | 1058 |
| 1195 | Ga0501318_011015 | 3300049534 | Bacteria | 1015 |
| 1196 | Ga0501318_020431 | 3300049534 | Bacteria | 834 |
| 1197 | Ga0501319_003021 | 3300049535 | Bacteria | 1102 |
| 1198 | Ga0501320_001217 | 3300049536 | Bacteria | 1820 |
| 1199 | Ga0501320_004125 | 3300049536 | Bacteria | 1265 |
| 1200 | Ga0501320_008104 | 3300049536 | Bacteria | 1027 |
| 1201 | Ga0501320_008184 | 3300049536 | Bacteria | 1023 |
| 1202 | Ga0501320_053653 | 3300049536 | Bacteria | 554 |
| 1203 | Ga0501321_000742 | 3300049537 | Bacteria | 2282 |
| 1204 | Ga0501321_000877 | 3300049537 | Bacteria | 2172 |
| 1205 | Ga0501321_001896 | 3300049537 | Bacteria | 1742 |
| 1206 | Ga0501321_010063 | 3300049537 | Bacteria | 1031 |
| 1207 | Ga0501321_013390 | 3300049537 | Bacteria | 942 |
| 1208 | Ga0501321_022531 | 3300049537 | Bacteria | 793 |
| 1209 | Ga0501322_002959 | 3300049538 | Bacteria | 1074 |
| 1210 | Ga0501323_001151 | 3300049539 | Bacteria | 2257 |
| 1211 | Ga0501323_024076 | 3300049539 | Bacteria | 821 |
| 1212 | Ga0501324_001175 | 3300049540 | Bacteria | 1689 |
| 1213 | Ga0501324_007700 | 3300049540 | Bacteria | 935 |
| 1214 | Ga0501324_010748 | 3300049540 | Bacteria | 838 |
| 1215 | Ga0501325_001878 | 3300049541 | Bacteria | 1365 |
| 1216 | Ga0501325_007953 | 3300049541 | Bacteria | 909 |
| 1217 | Ga0501031_0001904 | 3300049568 | Bacteria | 13145 |
| 1218 | Ga0501031_0003864 | 3300049568 | Bacteria | 9636 |
| 1219 | Ga0501031_0004771 | 3300049568 | Bacteria | 8806 |
| 1220 | Ga0501031_0012109 | 3300049568 | Bacteria | 5623 |
| 1221 | Ga0501031_0167765 | 3300049568 | Bacteria | 1434 |
| 1222 | Ga0501032_0021323 | 3300049569 | Bacteria | 4505 |
| 1223 | Ga0501032_0084511 | 3300049569 | Bacteria | 2110 |
| 1224 | Ga0501032_0085575 | 3300049569 | Bacteria | 2095 |
| 1225 | Ga0501032_0349515 | 3300049569 | Bacteria | 953 |
| 1226 | Ga0501032_0699600 | 3300049569 | Bacteria | 642 |
| 1227 | Ga0501033_0018229 | 3300049570 | Bacteria | 5304 |
| 1228 | Ga0501033_0035975 | 3300049570 | Bacteria | 3711 |
| 1229 | Ga0501034_0112724 | 3300049571 | Bacteria | 2709 |
| 1230 | Ga0501034_0301751 | 3300049571 | Bacteria | 1538 |
| 1231 | Ga0501034_0345444 | 3300049571 | Bacteria | 1417 |
| 1232 | Ga0501036_0002252 | 3300049572 | Bacteria | 15060 |
| 1233 | Ga0501036_0009602 | 3300049572 | Bacteria | 7957 |
| 1234 | Ga0501036_0050131 | 3300049572 | Bacteria | 3535 |
| 1235 | Ga0501036_0055279 | 3300049572 | Bacteria | 3362 |
| 1236 | Ga0501036_0510300 | 3300049572 | Bacteria | 1000 |
| 1237 | Ga0501036_0598772 | 3300049572 | Bacteria | 914 |
| 1238 | Ga0501037_0023238 | 3300049573 | Bacteria | 4585 |
| 1239 | Ga0501037_0028258 | 3300049573 | Bacteria | 4143 |
| 1240 | Ga0501037_0070320 | 3300049573 | Bacteria | 2546 |
| 1241 | Ga0501037_0122037 | 3300049573 | Bacteria | 1873 |
| 1242 | Ga0501037_0469845 | 3300049573 | Bacteria | 856 |
| 1243 | Ga0501038_0025278 | 3300049574 | Bacteria | 5295 |
| 1244 | Ga0501038_0030416 | 3300049574 | Bacteria | 4779 |
| 1245 | Ga0501038_0054600 | 3300049574 | Bacteria | 3436 |
| 1246 | Ga0501038_0059870 | 3300049574 | Bacteria | 3260 |
| 1247 | Ga0501038_0136034 | 3300049574 | Bacteria | 2013 |
| 1248 | Ga0501039_0006886 | 3300049575 | Bacteria | 8646 |
| 1249 | Ga0501039_0012457 | 3300049575 | Bacteria | 6492 |
| 1250 | Ga0501039_0048864 | 3300049575 | Bacteria | 3270 |
| 1251 | Ga0501039_0064077 | 3300049575 | Bacteria | 2848 |
| 1252 | Ga0501039_0271708 | 3300049575 | Bacteria | 1332 |
| 1253 | Ga0501039_0323047 | 3300049575 | Bacteria | 1213 |
| 1254 | Ga0501040_0006842 | 3300049576 | Bacteria | 7390 |
| 1255 | Ga0501040_0028375 | 3300049576 | Bacteria | 3772 |
| 1256 | Ga0501040_0204015 | 3300049576 | Bacteria | 1404 |
| 1257 | Ga0501040_0267132 | 3300049576 | Bacteria | 1221 |
| 1258 | Ga0501040_0519211 | 3300049576 | Bacteria | 859 |
| 1259 | Ga0501040_0824722 | 3300049576 | Bacteria | 671 |
| 1260 | Ga0501041_0003749 | 3300049577 | Bacteria | 8744 |
| 1261 | Ga0501041_0030801 | 3300049577 | Bacteria | 3239 |
| 1262 | Ga0501041_0054720 | 3300049577 | Bacteria | 2435 |
| 1263 | Ga0501042_0002441 | 3300049578 | Bacteria | 11407 |
| 1264 | Ga0501042_0022916 | 3300049578 | Bacteria | 4363 |
| 1265 | Ga0501042_0045764 | 3300049578 | Bacteria | 3119 |
| 1266 | Ga0501043_0002200 | 3300049579 | Bacteria | 16615 |
| 1267 | Ga0501043_0305605 | 3300049579 | Bacteria | 1215 |
| 1268 | Ga0501046_0013207 | 3300049580 | Bacteria | 7002 |
| 1269 | Ga0501046_0032560 | 3300049580 | Bacteria | 4221 |
| 1270 | Ga0501046_0090343 | 3300049580 | Bacteria | 2357 |
| 1271 | Ga0501048_0022554 | 3300049582 | Bacteria | 4603 |
| 1272 | Ga0501048_0031363 | 3300049582 | Bacteria | 3844 |
| 1273 | Ga0501048_0131984 | 3300049582 | Bacteria | 1765 |
| 1274 | Ga0501048_0149903 | 3300049582 | Bacteria | 1649 |
| 1275 | Ga0501048_0211903 | 3300049582 | Bacteria | 1374 |
| 1276 | Ga0501067_0030199 | 3300049583 | Bacteria | 3006 |
| 1277 | Ga0501067_0100591 | 3300049583 | Bacteria | 1606 |
| 1278 | Ga0501068_0034975 | 3300049584 | Bacteria | 2998 |
| 1279 | Ga0501068_0039920 | 3300049584 | Bacteria | 2816 |
| 1280 | Ga0501068_0075443 | 3300049584 | Bacteria | 2063 |
| 1281 | Ga0501069_0000273 | 3300049585 | Bacteria | 23416 |
| 1282 | Ga0501069_0079871 | 3300049585 | Bacteria | 1841 |
| 1283 | Ga0501070_0015859 | 3300049586 | Bacteria | 6335 |
| 1284 | Ga0501071_0019237 | 3300049587 | Bacteria | 4737 |
| 1285 | Ga0501071_0038154 | 3300049587 | Bacteria | 3432 |
| 1286 | Ga0501071_0069590 | 3300049587 | Bacteria | 2563 |
| 1287 | Ga0501071_0170372 | 3300049587 | Bacteria | 1630 |
| 1288 | Ga0501072_0006470 | 3300049588 | Bacteria | 8920 |
| 1289 | Ga0501072_0125162 | 3300049588 | Bacteria | 2047 |
| 1290 | Ga0501072_0235125 | 3300049588 | Bacteria | 1459 |
| 1291 | Ga0501072_0507509 | 3300049588 | Bacteria | 954 |
| 1292 | Ga0501073_0038561 | 3300049589 | Bacteria | 3388 |
| 1293 | Ga0501073_0113814 | 3300049589 | Bacteria | 1876 |
| 1294 | Ga0501074_0010467 | 3300049590 | Bacteria | 6732 |
| 1295 | Ga0501074_0012517 | 3300049590 | Bacteria | 6168 |
| 1296 | Ga0501074_0054490 | 3300049590 | Bacteria | 2884 |
| 1297 | Ga0501074_0080968 | 3300049590 | Bacteria | 2329 |
| 1298 | Ga0501074_0526723 | 3300049590 | Bacteria | 837 |
| 1299 | Ga0501075_0016824 | 3300049591 | Bacteria | 5273 |
| 1300 | Ga0501075_0298517 | 3300049591 | Bacteria | 1227 |
| 1301 | Ga0501075_0779902 | 3300049591 | Bacteria | 727 |
| 1302 | Ga0501076_0022797 | 3300049592 | Bacteria | 4816 |
| 1303 | Ga0501076_0029017 | 3300049592 | Bacteria | 4300 |
| 1304 | Ga0501077_0017885 | 3300049593 | Bacteria | 4480 |
| 1305 | Ga0501077_0063158 | 3300049593 | Bacteria | 2349 |
| 1306 | Ga0501077_0284565 | 3300049593 | Bacteria | 1052 |
| 1307 | Ga0501235_096090 | 3300049669 | Bacteria | 720 |
| 1308 | Ga0501225_0043477 | 3300049705 | Bacteria | 1242 |
| 1309 | Ga0501079_0002786 | 3300049741 | Bacteria | 12749 |
| 1310 | Ga0501079_0525365 | 3300049741 | Bacteria | 930 |
| 1311 | Ga0501080_0000473 | 3300049742 | Bacteria | 31252 |
| 1312 | Ga0501080_0038075 | 3300049742 | Bacteria | 4491 |
| 1313 | Ga0501080_0061686 | 3300049742 | Bacteria | 3490 |
| 1314 | Ga0501081_0001282 | 3300049743 | Bacteria | 15279 |
| 1315 | Ga0501081_0047474 | 3300049743 | Bacteria | 2954 |
| 1316 | Ga0501081_0059287 | 3300049743 | Bacteria | 2649 |
| 1317 | Ga0501081_0377431 | 3300049743 | Bacteria | 1047 |
| 1318 | Ga0501083_0003730 | 3300049744 | Bacteria | 10699 |
| 1319 | Ga0501083_0220023 | 3300049744 | Bacteria | 1237 |
| 1320 | Ga0501083_0543400 | 3300049744 | Bacteria | 756 |
| 1321 | Ga0501035_0002239 | 3300049822 | Bacteria | 19166 |
| 1322 | Ga0501035_0155006 | 3300049822 | Bacteria | 1986 |
| 1323 | Ga0501035_0266777 | 3300049822 | Bacteria | 1450 |
| 1324 | Ga0501035_0467391 | 3300049822 | Bacteria | 1042 |
| 1325 | Ga0501044_0337356 | 3300049823 | Bacteria | 1429 |
| 1326 | Ga0501045_0017260 | 3300049824 | Bacteria | 5123 |
| 1327 | Ga0501045_0051860 | 3300049824 | Bacteria | 2994 |
| 1328 | Ga0501045_0096947 | 3300049824 | Bacteria | 2182 |
| 1329 | Ga0501045_0654372 | 3300049824 | Bacteria | 776 |
| 1330 | nmdc:mga03683_24840_c1 | 3300050489 | Bacteria | 2347 |
| 1331 | nmdc:mga03n38_199879_c1 | 3300050490 | Bacteria | 1034 |
| 1332 | nmdc:mga03n38_277943_c1 | 3300050490 | Bacteria | 893 |
| 1333 | nmdc:mga00v17_116578_c1 | 3300050491 | Bacteria | 1698 |
| 1334 | nmdc:mga00v17_165046_c1 | 3300050491 | Bacteria | 1427 |
| 1335 | nmdc:mga00v17_35494_c1 | 3300050491 | Bacteria | 2968 |
| 1336 | nmdc:mga00v17_54795_c1 | 3300050491 | Bacteria | 2433 |
| 1337 | nmdc:mga00v17_574884_c1 | 3300050491 | Bacteria | 728 |
| 1338 | nmdc:mga00v17_6495_c1 | 3300050491 | Bacteria | 6205 |
| 1339 | nmdc:mga0yw44_103044_c1 | 3300050492 | Bacteria | 1820 |
| 1340 | nmdc:mga0yw44_106706_c1 | 3300050492 | Bacteria | 1791 |
| 1341 | nmdc:mga0yw44_306043_c1 | 3300050492 | Bacteria | 1065 |
| 1342 | nmdc:mga0yw44_515124_c1 | 3300050492 | Bacteria | 812 |
| 1343 | nmdc:mga0yw44_7451_c1 | 3300050492 | Bacteria | 5386 |
| 1344 | nmdc:mga06z11_125951_c1 | 3300050494 | Bacteria | 1434 |
| 1345 | nmdc:mga06z11_871932_c1 | 3300050494 | Bacteria | 548 |
| 1346 | nmdc:mga07m45_625818_c1 | 3300050496 | Bacteria | 621 |
| 1347 | nmdc:mga05p37_168329_c1 | 3300050507 | Bacteria | 2674 |
| 1348 | nmdc:mga05p37_4106_c1 | 3300050507 | Bacteria | 17020 |
| 1349 | nmdc:mga09592_20670_c1 | 3300050508 | Bacteria | 5418 |
| 1350 | nmdc:mga0qj67_115114_c1 | 3300050509 | Bacteria | 2172 |
| 1351 | nmdc:mga0qj67_4474_c1 | 3300050509 | Bacteria | 10127 |
| 1352 | nmdc:mga06r32_51858_c1 | 3300050510 | Bacteria | 3927 |
| 1353 | nmdc:mga06r32_5549_c1 | 3300050510 | Bacteria | 11370 |
| 1354 | nmdc:mga08y16_23474_c1 | 3300050511 | Bacteria | 6516 |
| 1355 | nmdc:mga0n895_24811_c1 | 3300050512 | Bacteria | 5657 |
| 1356 | nmdc:mga0rr50_14624_c1 | 3300050513 | Bacteria | 5154 |
| 1357 | nmdc:mga08x19_85717_c1 | 3300050514 | Bacteria | 2073 |
| 1358 | nmdc:mga0a205_18368_c1 | 3300050515 | Bacteria | 6574 |
| 1359 | nmdc:mga0sz30_6024_c1 | 3300050516 | Bacteria | 4479 |
| 1360 | Ga0495601_0001806 | 3300053077 | Bacteria | 11880 |
| 1361 | Ga0495601_0005598 | 3300053077 | Bacteria | 7326 |
| 1362 | Ga0495612_0008090 | 3300053078 | Bacteria | 4281 |
| 1363 | Ga0495612_0220906 | 3300053078 | Bacteria | 839 |
| 1364 | Ga0495612_0326289 | 3300053078 | Bacteria | 691 |
| 1365 | Ga0495655_0085274 | 3300053083 | Bacteria | 910 |
| 1366 | Ga0495655_0195219 | 3300053083 | Bacteria | 659 |
| 1367 | Ga0495595_0093034 | 3300053084 | Bacteria | 1448 |
| 1368 | Ga0495595_0119311 | 3300053084 | Bacteria | 1284 |
| 1369 | Ga0495619_0011061 | 3300053085 | Bacteria | 5677 |
| 1370 | Ga0495619_0133782 | 3300053085 | Bacteria | 1705 |
| 1371 | Ga0495619_0166497 | 3300053085 | Bacteria | 1523 |
| 1372 | Ga0495619_0181164 | 3300053085 | Bacteria | 1458 |
| 1373 | Ga0500566_0269698 | 3300053094 | Bacteria | 817 |
| 1374 | Ga0500573_0026341 | 3300053140 | Bacteria | 3342 |
| 1375 | Ga0501084_0006859 | 3300054114 | Bacteria | 9376 |
| 1376 | Ga0501084_0017067 | 3300054114 | Bacteria | 6031 |
| 1377 | Ga0501084_0038500 | 3300054114 | Bacteria | 3997 |
| 1378 | Ga0501084_0069026 | 3300054114 | Bacteria | 2958 |
| 1379 | Ga0501084_0252010 | 3300054114 | Bacteria | 1490 |
| 1380 | Ga0501084_1097914 | 3300054114 | Bacteria | 668 |
| 1381 | Ga0590075_009505 | 3300059424 | Bacteria | 2331 |
| 1382 | Ga0590077_031510 | 3300059426 | Bacteria | 1159 |
| 1383 | Ga0587084_000583 | 3300059477 | Bacteria | 2990 |
| 1384 | Ga0587070_016923 | 3300059491 | Bacteria | 1174 |
| 1385 | Ga0587070_088211 | 3300059491 | Bacteria | 693 |
| 1386 | Ga0587077_015691 | 3300059493 | Bacteria | 1265 |
| 1387 | Ga0587082_014163 | 3300059504 | Bacteria | 1213 |
| 1388 | Ga0587083_0016325 | 3300059505 | Bacteria | 1312 |
| 1389 | Ga0587088_015149 | 3300059508 | Bacteria | 1211 |
| 1390 | Ga0587089_010078 | 3300059509 | Bacteria | 1171 |
| 1391 | Ga0587092_003462 | 3300059512 | Bacteria | 1796 |
| 1392 | Ga0587094_011500 | 3300059513 | Bacteria | 1166 |
| 1393 | Ga0587106_010468 | 3300059605 | Bacteria | 1202 |
| 1394 | Ga0587106_011255 | 3300059605 | Bacteria | 1176 |
| 1395 | Ga0587129_002032 | 3300059608 | Bacteria | 1163 |
| 1396 | Ga0587099_003208 | 3300059622 | Bacteria | 1344 |
| 1397 | Ga0587101_000649 | 3300059623 | Bacteria | 2599 |
| 1398 | Ga0587109_021552 | 3300059624 | Bacteria | 1153 |
| 1399 | Ga0587115_001523 | 3300059626 | Bacteria | 2148 |
| 1400 | Ga0587117_009121 | 3300059627 | Bacteria | 1180 |
| 1401 | Ga0587122_003478 | 3300059628 | Bacteria | 1218 |
| 1402 | Ga0587122_006539 | 3300059628 | Bacteria | 1010 |
| 1403 | Ga0587128_030836 | 3300059630 | Bacteria | 887 |
| 1404 | Ga0587069_012198 | 3300059642 | Bacteria | 1162 |
| 1405 | Ga0587072_054887 | 3300059643 | Bacteria | 807 |
| 1406 | Ga0587100_002541 | 3300059648 | Bacteria | 1186 |
| 1407 | Ga0587110_018867 | 3300059654 | Bacteria | 765 |
| 1408 | Ga0587119_001968 | 3300059658 | Bacteria | 1788 |
| 1409 | Ga0587124_003438 | 3300059660 | Bacteria | 1175 |
| 1410 | Ga0587111_0002409 | 3300060346 | Bacteria | 2487 |
| 1411 | Ga0501082_0005074 | 3300060353 | Bacteria | 11478 |
| 1412 | Ga0501082_0053946 | 3300060353 | Bacteria | 3465 |
| 1413 | Ga0501082_0070496 | 3300060353 | Bacteria | 3009 |
| 1414 | Ga0501082_0103067 | 3300060353 | Bacteria | 2468 |
| 1415 | Ga0501082_0362276 | 3300060353 | Bacteria | 1265 |
| 1416 | Ga0501082_0472208 | 3300060353 | Bacteria | 1096 |
| 1417 | Ga0501082_0969902 | 3300060353 | Bacteria | 743 |
| 1418 | Ga0466962_0010205 | 3300061719 | Bacteria | 4511 |
| 1419 | Ga0466962_0032219 | 3300061719 | Bacteria | 2509 |
| 1420 | Ga0466962_0063964 | 3300061719 | Bacteria | 1756 |
| 1421 | Ga0466962_0066884 | 3300061719 | Bacteria | 1716 |
| 1422 | Ga0466962_0317566 | 3300061719 | Bacteria | 772 |
| 1423 | Ga0466962_0341716 | 3300061719 | Bacteria | 745 |
| 1424 | Ga0466962_0373690 | 3300061719 | Bacteria | 711 |
| 1425 | Ga0530510_0018929 | 3300061734 | Bacteria | 4883 |
| 1426 | Ga0530510_0037945 | 3300061734 | Bacteria | 3476 |
| 1427 | Ga0530510_0060257 | 3300061734 | Bacteria | 2746 |
| 1428 | Ga0530510_0402199 | 3300061734 | Bacteria | 1032 |
| 1429 | Ga0530510_0762549 | 3300061734 | Bacteria | 738 |
| 1430 | 2643734775 | 2643221542 | Bacteria | 3563959 |
| 1431 | 2643768589 | 2643221549 | Bacteria | 4042819 |
| 1432 | 2643847815 | 2643221566 | Bacteria | 3460379 |
| 1433 | 2643851144 | 2643221567 | Bacteria | 4163945 |
| 1434 | 2643888167 | 2643221575 | Bacteria | 4022601 |
| 1435 | 2644134933 | 2643221624 | Bacteria | 4384879 |
| 1436 | 2644172935 | 2643221630 | Bacteria | 3601215 |
| 1437 | 2644197876 | 2643221635 | Bacteria | 2632343 |
| 1438 | 2644502872 | 2643221690 | Bacteria | 4654705 |
| 1439 | 2644525232 | 2643221694 | Bacteria | 4392972 |
| 1440 | 2644669320 | 2643221722 | Bacteria | 4247614 |
| 1441 | 2676476355 | 2675903058 | Bacteria | 6822861 |
| 1442 | 2723643124 | 2721755702 | Bacteria | 4373124 |
| 1443 | 2739607397 | 2739367654 | Bacteria | 6049412 |
| 1444 | 2747951865 | 2747842429 | Bacteria | 3914386 |
| 1445 | 2760304695 | 2758568522 | Bacteria | 5953541 |
| 1446 | 2809026277 | 2808606394 | Bacteria | 6248540 |
| 1447 | 2809226479 | 2808606447 | Bacteria | 3572005 |
| 1448 | 2810363380 | 2808606700 | Bacteria | 3482157 |
| 1449 | 2812364396 | 2811994880 | Bacteria | 4147780 |
| 1450 | 2812373752 | 2811994882 | Bacteria | 4688362 |
| 1451 | 2816421112 | 2816332119 | Bacteria | 8120218 |
| 1452 | 2819665408 | 2818991458 | Bacteria | 4794049 |
| 1453 | 2819691388 | 2818991462 | Bacteria | 4320267 |
| 1454 | 2819727576 | 2818991469 | Bacteria | 4644110 |
| 1455 | 2827632163 | 2827628540 | Bacteria | 6858585 |
| 1456 | 2848553212 | 2848551377 | Bacteria | 3720646 |
| 1457 | 2852632730 | 2852632344 | Bacteria | 3463163 |
| 1458 | 2852648356 | 2852646457 | Bacteria | 3408613 |
| 1459 | 2852665910 | 2852663356 | Bacteria | 4090475 |
| 1460 | 2852678607 | 2852677369 | Bacteria | 3768884 |
| 1461 | 2857712608 | 2857710386 | Bacteria | 3186771 |
| 1462 | 2857722324 | 2857720070 | Bacteria | 3189373 |
| 1463 | 2857724603 | 2857723135 | Bacteria | 4217853 |
| 1464 | 2857730635 | 2857729791 | Bacteria | 4040535 |
| 1465 | 2862993602 | 2862993130 | Bacteria | 3860849 |
| 1466 | 2883823179 | 2883821847 | Bacteria | 5121194 |
| 1467 | 2887444587 | 2887443736 | Bacteria | 4426037 |
| 1468 | 2893685172 | 2893684298 | Bacteria | 2897960 |
| 1469 | 2897562451 | 2897561785 | Bacteria | 3256946 |
| 1470 | 2905927996 | 2905926851 | Bacteria | 4423176 |
| 1471 | 2919397727 | 2919395869 | Bacteria | 3704152 |
| 1472 | 2928090913 | 2928090899 | Bacteria | 3158267 |
| 1473 | 2928121441 | 2928121344 | Bacteria | 3972376 |
| 1474 | 2946005578 | 2946003308 | Bacteria | 3857229 |
| 1475 | 2946034818 | 2946033335 | Bacteria | 3835514 |
| 1476 | 2946081869 | 2946080515 | Bacteria | 4310960 |
| 1477 | 2984577126 | 2984576629 | Bacteria | 4248407 |
| 1478 | 2984582345 | 2984580707 | Bacteria | 3351387 |
| 1479 | 2984592263 | 2984592036 | Bacteria | 3670284 |
| 1480 | 2990260447 | 2990256926 | Bacteria | 4252839 |
| 1481 | 2995728382 | 2995726249 | Bacteria | 3470435 |
| 1482 | 3001890625 | 3001889506 | Bacteria | 2975194 |
| 1483 | 8004021569 | 8004021418 | Bacteria | 4313954 |
| 1484 | 8004028569 | 8004025490 | Bacteria | 4327753 |
| 1485 | 8004183484 | 8004182704 | Bacteria | 3391155 |
| 1486 | 8055035331 | 8055034563 | Bacteria | 3562128 |
| 1487 | Ga0436364_0409793 | |||
| 1488 | JGI24740J21852_10019807 | |||
| 1489 | JGI24737J22298_10003968 | |||
| 1490 | JGI24735J21928_10075146 | |||
| 1491 | JGI24735J21928_10156563 | |||
| 1492 | JGI24738J21930_10002435 | |||
| 1493 | JGI24738J21930_10015599 | |||
| 1494 | JGI24749J21850_1012752 | |||
| 1495 | JGI24744J21845_10004165 | |||
| 1496 | JGI24034J26672_10007871 | |||
| 1497 | JGI24742J22300_10015362 | |||
| 1498 | JGI25154J39366_1001966 | |||
| 1499 | Ga0006778J45830_1011174 | |||
| 1500 | Ga0006759J45824_1013878 | |||
| 1501 | Ga0006759J45824_1025628 | |||
| 1502 | Ga0006777J48905_1019716 | |||
| 1503 | Ga0006777J48905_1020582 | |||
| 1504 | Ga0007417J51691_1011871 | |||
| 1505 | Ga0007427J51700_103286 | |||
| 1506 | Ga0006781J51513_1007583 | |||
| 1507 | Ga0006781J51513_1013434 | |||
| 1508 | Ga0007410J51695_1015311 | |||
| 1509 | Ga0007409J51694_1017714 | |||
| 1510 | Ga0007409J51694_1018137 | |||
| 1511 | Ga0007429J51699_1011248 | |||
| 1512 | Ga0007429J51699_1016355 | |||
| 1513 | Ga0007429J51699_1027302 | |||
| 1514 | Ga0007429J51699_1030497 | |||
| 1515 | Ga0032354_1006492 | |||
| 1516 | Ga0032354_1009879 | |||
| 1517 | Ga0006780_1004588 | |||
| 1518 | Ga0006780_1006617 | |||
| 1519 | Ga0058858_1425716 | |||
| 1520 | Ga0058861_10101139 | |||
| 1521 | Ga0070658_10356842 | |||
| 1522 | Ga0070676_10333614 | |||
| 1523 | Ga0070683_100027696 | |||
| 1524 | Ga0070683_100061434 | |||
| 1525 | Ga0070683_100154117 | |||
| 1526 | Ga0070683_100786439 | |||
| 1527 | Ga0070690_100153667 | |||
| 1528 | Ga0070670_100327695 | |||
| 1529 | Ga0068869_100085285 | |||
| 1530 | Ga0070682_100005854 | |||
| 1531 | Ga0070682_100076528 | |||
| 1532 | Ga0070682_100078918 | |||
| 1533 | Ga0070682_100091754 | |||
| 1534 | Ga0070682_100121266 | |||
| 1535 | Ga0070682_100272134 | |||
| 1536 | Ga0070682_100471955 | |||
| 1537 | Ga0068868_100328938 | |||
| 1538 | Ga0068868_100410141 | |||
| 1539 | Ga0070660_100011189 | |||
| 1540 | Ga0070660_100092118 | |||
| 1541 | Ga0070660_100127673 | |||
| 1542 | Ga0070660_100767913 | |||
| 1543 | Ga0070687_100005482 | |||
| 1544 | Ga0070661_100041418 | |||
| 1545 | Ga0070692_10007791 | |||
| 1546 | Ga0070692_10236474 | |||
| 1547 | Ga0070668_100015860 | |||
| 1548 | Ga0070668_100028853 | |||
| 1549 | Ga0070668_100039258 | |||
| 1550 | Ga0070668_100124061 | |||
| 1551 | Ga0070668_100172522 | |||
| 1552 | Ga0070668_100314145 | |||
| 1553 | Ga0070668_100383429 | |||
| 1554 | Ga0070669_100237787 | |||
| 1555 | Ga0070675_100125997 | |||
| 1556 | Ga0070675_100506081 | |||
| 1557 | Ga0070671_100267938 | |||
| 1558 | Ga0070671_100704674 | |||
| 1559 | Ga0070674_100031514 | |||
| 1560 | Ga0070674_100039323 | |||
| 1561 | Ga0070674_100046760 | |||
| 1562 | Ga0070674_100176996 | |||
| 1563 | Ga0070674_100186605 | |||
| 1564 | Ga0070674_100482961 | |||
| 1565 | Ga0070673_100049892 | |||
| 1566 | Ga0070673_101004101 | |||
| 1567 | Ga0070688_100220705 | |||
| 1568 | Ga0070659_100036950 | |||
| 1569 | Ga0070659_100046370 | |||
| 1570 | Ga0070659_100072440 | |||
| 1571 | Ga0070659_100090530 | |||
| 1572 | Ga0070659_100286114 | |||
| 1573 | Ga0070667_100046939 | |||
| 1574 | Ga0070667_100217798 | |||
| 1575 | Ga0070667_100955330 | |||
| 1576 | Ga0070714_100817971 | |||
| 1577 | Ga0070701_10009437 | |||
| 1578 | Ga0070711_100848749 | |||
| 1579 | Ga0070705_100013603 | |||
| 1580 | Ga0070700_100022153 | |||
| 1581 | Ga0070700_100074865 | |||
| 1582 | Ga0070700_100224108 | |||
| 1583 | Ga0070700_100258115 | |||
| 1584 | Ga0070663_100050083 | |||
| 1585 | Ga0070663_100167443 | |||
| 1586 | Ga0070663_100180785 | |||
| 1587 | Ga0070663_100205322 | |||
| 1588 | Ga0070663_100291292 | |||
| 1589 | Ga0070663_100295605 | |||
| 1590 | Ga0070678_100068714 | |||
| 1591 | Ga0070678_100224560 | |||
| 1592 | Ga0070678_100245588 | |||
| 1593 | Ga0070678_100357447 | |||
| 1594 | Ga0070678_100762382 | |||
| 1595 | Ga0070678_101273192 | |||
| 1596 | Ga0070662_100121384 | |||
| 1597 | Ga0070662_100131554 | |||
| 1598 | Ga0070681_10189399 | |||
| 1599 | Ga0070681_10341204 | |||
| 1600 | Ga0070681_10782795 | |||
| 1601 | Ga0068867_100000784 | |||
| 1602 | Ga0068867_100117960 | |||
| 1603 | Ga0068867_100724788 | |||
| 1604 | Ga0070685_10037258 | |||
| 1605 | Ga0070685_10038115 | |||
| 1606 | Ga0070685_10122794 | |||
| 1607 | Ga0070706_100899683 | |||
| 1608 | Ga0070698_100010346 | |||
| 1609 | Ga0070679_100284160 | |||
| 1610 | Ga0070679_101277657 | |||
| 1611 | Ga0070684_100002313 | |||
| 1612 | Ga0070684_100096172 | |||
| 1613 | Ga0070684_100108463 | |||
| 1614 | Ga0070684_100209837 | |||
| 1615 | Ga0070684_100299370 | |||
| 1616 | Ga0070684_100303011 | |||
| 1617 | Ga0070684_100315931 | |||
| 1618 | Ga0068853_100073776 | |||
| 1619 | Ga0068853_100112874 | |||
| 1620 | Ga0068853_100141854 | |||
| 1621 | Ga0068853_100193957 | |||
| 1622 | Ga0068853_100451793 | |||
| 1623 | Ga0070672_100021433 | |||
| 1624 | Ga0070672_100066444 | |||
| 1625 | Ga0070672_100457835 | |||
| 1626 | Ga0070672_101211483 | |||
| 1627 | Ga0070686_100024753 | |||
| 1628 | Ga0070686_100211952 | |||
| 1629 | Ga0070696_100007791 | |||
| 1630 | Ga0070696_100077230 | |||
| 1631 | Ga0070693_100027117 | |||
| 1632 | Ga0070693_100753762 | |||
| 1633 | Ga0070665_100011936 | |||
| 1634 | Ga0070665_100243480 | |||
| 1635 | Ga0068855_100043083 | |||
| 1636 | Ga0068855_100341815 | |||
| 1637 | Ga0068855_100381020 | |||
| 1638 | Ga0068855_100712583 | |||
| 1639 | Ga0070664_100108586 | |||
| 1640 | Ga0070664_100534720 | |||
| 1641 | Ga0070664_101065513 | |||
| 1642 | Ga0068857_100008605 | |||
| 1643 | Ga0068857_100577588 | |||
| 1644 | Ga0068857_100973544 | |||
| 1645 | Ga0068854_100003214 | |||
| 1646 | Ga0068854_100179576 | |||
| 1647 | Ga0068854_100376948 | |||
| 1648 | Ga0068854_100469773 | |||
| 1649 | Ga0068854_100839667 | |||
| 1650 | Ga0068856_100031115 | |||
| 1651 | Ga0068856_100133674 | |||
| 1652 | Ga0068856_100372162 | |||
| 1653 | Ga0070702_100000198 | |||
| 1654 | Ga0070702_100000960 | |||
| 1655 | Ga0070702_100027425 | |||
| 1656 | Ga0070702_100097787 | |||
| 1657 | Ga0070702_100315689 | |||
| 1658 | Ga0070702_100448041 | |||
| 1659 | Ga0070702_100515872 | |||
| 1660 | Ga0068852_100040899 | |||
| 1661 | Ga0068852_100219994 | |||
| 1662 | Ga0068852_100287987 | |||
| 1663 | Ga0068852_100924795 | |||
| 1664 | Ga0068859_100771629 | |||
| 1665 | Ga0068859_101408252 | |||
| 1666 | Ga0068859_101497231 | |||
| 1667 | Ga0068864_100129089 | |||
| 1668 | Ga0068864_100365270 | |||
| 1669 | Ga0068864_101036297 | |||
| 1670 | Ga0068866_10065526 | |||
| 1671 | Ga0068861_100003392 | |||
| 1672 | Ga0068861_100113242 | |||
| 1673 | Ga0068861_100147499 | |||
| 1674 | Ga0068861_100182599 | |||
| 1675 | Ga0068861_100822369 | |||
| 1676 | Ga0068851_10193429 | |||
| 1677 | Ga0068851_10329431 | |||
| 1678 | Ga0068870_10308961 | |||
| 1679 | Ga0068863_100472924 | |||
| 1680 | Ga0068858_100589602 | |||
| 1681 | Ga0068860_100161079 | |||
| 1682 | Ga0068860_100169410 | |||
| 1683 | Ga0068860_100219702 | |||
| 1684 | Ga0068860_100435859 | |||
| 1685 | Ga0068862_100442512 | |||
| 1686 | Ga0081455_10010056 | |||
| 1687 | Ga0081455_10128516 | |||
| 1688 | Ga0081455_10451870 | |||
| 1689 | Ga0081538_10000264 | |||
| 1690 | Ga0081540_1130051 | |||
| 1691 | Ga0081539_10000238 | |||
| 1692 | Ga0075365_10006159 | |||
| 1693 | Ga0075365_10013835 | |||
| 1694 | Ga0075365_10086841 | |||
| 1695 | Ga0075368_10025746 | |||
| 1696 | Ga0075363_100015813 | |||
| 1697 | Ga0075363_100111268 | |||
| 1698 | Ga0075363_100233350 | |||
| 1699 | Ga0075364_10016481 | |||
| 1700 | Ga0075364_10026351 | |||
| 1701 | Ga0075364_10110319 | |||
| 1702 | Ga0075364_10128675 | |||
| 1703 | Ga0075364_10640723 | |||
| 1704 | Ga0075432_10007355 | |||
| 1705 | Ga0075362_10019347 | |||
| 1706 | Ga0075369_10004944 | |||
| 1707 | Ga0075369_10010273 | |||
| 1708 | Ga0075427_10002551 | |||
| 1709 | Ga0097621_100923509 | |||
| 1710 | Ga0068871_101051707 | |||
| 1711 | Ga0075428_100016246 | |||
| 1712 | Ga0075428_100134859 | |||
| 1713 | Ga0075430_100003324 | |||
| 1714 | Ga0075431_100002859 | |||
| 1715 | Ga0075431_100054108 | |||
| 1716 | Ga0075431_100111155 | |||
| 1717 | Ga0075433_10001418 | |||
| 1718 | Ga0075434_100049988 | |||
| 1719 | Ga0075429_100033963 | |||
| 1720 | Ga0068865_100010755 | |||
| 1721 | Ga0068865_100012655 | |||
| 1722 | Ga0068865_100025829 | |||
| 1723 | Ga0068865_100772450 | |||
| 1724 | Ga0075436_100097717 | |||
| 1725 | Ga0097620_100771677 | |||
| 1726 | Ga0097620_101408410 | |||
| 1727 | Ga0097620_101497404 | |||
| 1728 | Ga0075435_100002572 | |||
| 1729 | Ga0105244_10068218 | |||
| 1730 | Ga0105240_10093336 | |||
| 1731 | Ga0111539_10022754 | |||
| 1732 | Ga0111539_11623467 | |||
| 1733 | Ga0111539_11711474 | |||
| 1734 | Ga0105245_10016704 | |||
| 1735 | Ga0105245_10044869 | |||
| 1736 | Ga0105245_10070074 | |||
| 1737 | Ga0105245_10218504 | |||
| 1738 | Ga0105245_10251582 | |||
| 1739 | Ga0105245_10295747 | |||
| 1740 | Ga0105245_10931082 | |||
| 1741 | Ga0105245_12459744 | |||
| 1742 | Ga0105247_10532272 | |||
| 1743 | Ga0105247_10585039 | |||
| 1744 | Ga0114129_10000234 | |||
| 1745 | Ga0114129_10016860 | |||
| 1746 | Ga0105243_10003243 | |||
| 1747 | Ga0105243_10005983 | |||
| 1748 | Ga0105243_10009041 | |||
| 1749 | Ga0105243_10011327 | |||
| 1750 | Ga0105243_10062730 | |||
| 1751 | Ga0105243_10115080 | |||
| 1752 | Ga0105243_10145722 | |||
| 1753 | Ga0105243_10580052 | |||
| 1754 | Ga0105243_10877187 | |||
| 1755 | Ga0105241_10002725 | |||
| 1756 | Ga0105241_10911232 | |||
| 1757 | Ga0105241_11619442 | |||
| 1758 | Ga0105242_10037768 | |||
| 1759 | Ga0105242_10060234 | |||
| 1760 | Ga0105242_10155997 | |||
| 1761 | Ga0105248_10011888 | |||
| 1762 | Ga0105248_10284292 | |||
| 1763 | Ga0105237_10024920 | |||
| 1764 | Ga0105237_10183011 | |||
| 1765 | Ga0105238_10019028 | |||
| 1766 | Ga0105238_10062025 | |||
| 1767 | Ga0105238_10104550 | |||
| 1768 | Ga0105238_10109326 | |||
| 1769 | Ga0105238_10410438 | |||
| 1770 | Ga0105249_10006314 | |||
| 1771 | Ga0105249_10008124 | |||
| 1772 | Ga0105249_10057570 | |||
| 1773 | Ga0105249_10061123 | |||
| 1774 | Ga0105249_10138118 | |||
| 1775 | Ga0105249_10268781 | |||
| 1776 | Ga0105249_10325220 | |||
| 1777 | Ga0105249_10377305 | |||
| 1778 | Ga0105249_10379376 | |||
| 1779 | Ga0105249_10509387 | |||
| 1780 | Ga0105239_10002486 | |||
| 1781 | Ga0105239_10088329 | |||
| 1782 | Ga0105239_10095783 | |||
| 1783 | Ga0105239_10127383 | |||
| 1784 | Ga0105239_10215527 | |||
| 1785 | Ga0105239_10248438 | |||
| 1786 | Ga0105239_10296559 | |||
| 1787 | Ga0105239_10325033 | |||
| 1788 | Ga0105239_10584119 | |||
| 1789 | Ga0105239_11127023 | |||
| 1790 | Ga0105246_10000375 | |||
| 1791 | Ga0105246_10072522 | |||
| 1792 | Ga0105246_10094043 | |||
| 1793 | Ga0105246_10299301 | |||
| 1794 | Ga0105246_10465319 | |||
| 1795 | Ga0105246_10952920 | |||
| 1796 | Ga0157325_1004475 | |||
| 1797 | Ga0157321_1000406 | |||
| 1798 | Ga0157343_1008122 | |||
| 1799 | Ga0157319_1004623 | |||
| 1800 | Ga0157347_1003844 | |||
| 1801 | Ga0157313_1011957 | |||
| 1802 | Ga0157342_1010297 | |||
| 1803 | Ga0157373_10533853 | |||
| 1804 | Ga0157371_10019390 | |||
| 1805 | Ga0157371_10079223 | |||
| 1806 | Ga0157371_10573597 | |||
| 1807 | Ga0157370_10004788 | |||
| 1808 | Ga0157370_10006538 | |||
| 1809 | Ga0157370_10095226 | |||
| 1810 | Ga0157370_10355780 | |||
| 1811 | Ga0157370_10427220 | |||
| 1812 | Ga0157370_11139210 | |||
| 1813 | Ga0157369_10010161 | |||
| 1814 | Ga0157369_10016634 | |||
| 1815 | Ga0157369_10105060 | |||
| 1816 | Ga0157369_10108064 | |||
| 1817 | Ga0157369_10272260 | |||
| 1818 | Ga0157369_10364067 | |||
| 1819 | Ga0157369_10408981 | |||
| 1820 | Ga0157369_10466027 | |||
| 1821 | Ga0157369_10590908 | |||
| 1822 | Ga0157369_10732029 | |||
| 1823 | Ga0157369_11191472 | |||
| 1824 | Ga0157374_10475851 | |||
| 1825 | Ga0157378_10014969 | |||
| 1826 | Ga0163162_10092421 | |||
| 1827 | Ga0163162_10273040 | |||
| 1828 | Ga0163162_10380119 | |||
| 1829 | Ga0157372_10025059 | |||
| 1830 | Ga0157372_10057267 | |||
| 1831 | Ga0157372_10058284 | |||
| 1832 | Ga0157372_10094943 | |||
| 1833 | Ga0157372_10097076 | |||
| 1834 | Ga0157372_10114562 | |||
| 1835 | Ga0157372_10630238 | |||
| 1836 | Ga0157372_11321908 | |||
| 1837 | Ga0157375_10026944 | |||
| 1838 | Ga0157375_10038724 | |||
| 1839 | Ga0157375_10079957 | |||
| 1840 | Ga0157375_10321322 | |||
| 1841 | Ga0157375_10385433 | |||
| 1842 | Ga0157375_10557045 | |||
| 1843 | Ga0157375_12297000 | |||
| 1844 | Ga0163163_10030515 | |||
| 1845 | Ga0163163_10071780 | |||
| 1846 | Ga0163163_10185290 | |||
| 1847 | Ga0163163_10344432 | |||
| 1848 | Ga0163163_10394324 | |||
| 1849 | Ga0163163_10538988 | |||
| 1850 | Ga0157380_10015279 | |||
| 1851 | Ga0157380_10025399 | |||
| 1852 | Ga0157380_10220676 | |||
| 1853 | Ga0157380_10844187 | |||
| 1854 | Ga0157380_11924008 | |||
| 1855 | Ga0182008_10292172 | |||
| 1856 | Ga0157377_10102324 | |||
| 1857 | Ga0157377_10172050 | |||
| 1858 | Ga0157377_10393549 | |||
| 1859 | Ga0157377_10565305 | |||
| 1860 | Ga0157379_10184052 | |||
| 1861 | Ga0157376_10465676 | |||
| 1862 | Ga0163161_10011013 | |||
| 1863 | Ga0163161_10020151 | |||
| 1864 | Ga0163161_10020682 | |||
| 1865 | Ga0163161_10098912 | |||
| 1866 | Ga0163161_10135758 | |||
| 1867 | Ga0163161_10193138 | |||
| 1868 | Ga0163161_10242480 | |||
| 1869 | Ga0163161_10314183 | |||
| 1870 | Ga0163161_10372918 | |||
| 1871 | Ga0197907_10126050 | |||
| 1872 | Ga0197907_10461269 | |||
| 1873 | Ga0197907_10816215 | |||
| 1874 | Ga0197907_10855188 | |||
| 1875 | Ga0197907_11033948 | |||
| 1876 | Ga0206356_10575752 | |||
| 1877 | Ga0206356_11501797 | |||
| 1878 | Ga0206356_11683455 | |||
| 1879 | Ga0206349_1102446 | |||
| 1880 | Ga0206349_1236471 | |||
| 1881 | Ga0206349_1261242 | |||
| 1882 | Ga0206349_1263143 | |||
| 1883 | Ga0206349_1363221 | |||
| 1884 | Ga0206349_1695142 | |||
| 1885 | Ga0206349_1741347 | |||
| 1886 | Ga0206349_1983558 | |||
| 1887 | Ga0206355_1045293 | |||
| 1888 | Ga0206355_1051652 | |||
| 1889 | Ga0206355_1375645 | |||
| 1890 | Ga0206351_10765091 | |||
| 1891 | Ga0206351_10824243 | |||
| 1892 | Ga0206351_10837268 | |||
| 1893 | Ga0206352_10113150 | |||
| 1894 | Ga0206352_10950465 | |||
| 1895 | Ga0206352_10992946 | |||
| 1896 | Ga0206352_11057851 | |||
| 1897 | Ga0206350_10236030 | |||
| 1898 | Ga0206350_10280180 | |||
| 1899 | Ga0206350_10362633 | |||
| 1900 | Ga0206350_11330323 | |||
| 1901 | Ga0206350_11372283 | |||
| 1902 | Ga0206350_11527026 | |||
| 1903 | Ga0206354_10067382 | |||
| 1904 | Ga0206354_10159348 | |||
| 1905 | Ga0206354_10260975 | |||
| 1906 | Ga0206354_10278352 | |||
| 1907 | Ga0206354_10396242 | |||
| 1908 | Ga0206354_10724352 | |||
| 1909 | Ga0206354_10782475 | |||
| 1910 | Ga0206354_10857587 | |||
| 1911 | Ga0206354_11184045 | |||
| 1912 | Ga0206354_11358127 | |||
| 1913 | Ga0206354_11505003 | |||
| 1914 | Ga0206354_11524798 | |||
| 1915 | Ga0206354_11570982 | |||
| 1916 | Ga0206353_10239144 | |||
| 1917 | Ga0206353_10481029 | |||
| 1918 | Ga0206353_10875366 | |||
| 1919 | Ga0206353_11040760 | |||
| 1920 | Ga0206353_11142484 | |||
| 1921 | Ga0206353_11211517 | |||
| 1922 | Ga0206353_11277739 | |||
| 1923 | Ga0206353_11325172 | |||
| 1924 | Ga0206353_11334241 | |||
| 1925 | Ga0206353_11377281 | |||
| 1926 | Ga0206353_11402636 | |||
| 1927 | Ga0206353_11724933 | |||
| 1928 | Ga0154015_1274330 | |||
| 1929 | Ga0154015_1375022 | |||
| 1930 | Ga0213875_10266753 | |||
| 1931 | Ga0224712_10077111 | |||
| 1932 | Ga0224712_10094614 | |||
| 1933 | Ga0224712_10116741 | |||
| 1934 | Ga0224712_10119699 | |||
| 1935 | Ga0209646_1000088 | |||
| 1936 | Ga0207697_10015594 | |||
| 1937 | Ga0207655_1019276 | |||
| 1938 | Ga0207655_1067251 | |||
| 1939 | Ga0207682_10088748 | |||
| 1940 | Ga0207682_10136850 | |||
| 1941 | Ga0207642_10003527 | |||
| 1942 | Ga0207642_10015040 | |||
| 1943 | Ga0207642_10286385 | |||
| 1944 | Ga0207688_10011562 | |||
| 1945 | Ga0207688_10016175 | |||
| 1946 | Ga0207688_10016280 | |||
| 1947 | Ga0207688_10077374 | |||
| 1948 | Ga0207688_10101446 | |||
| 1949 | Ga0207688_10133551 | |||
| 1950 | Ga0207688_10160278 | |||
| 1951 | Ga0207688_10165895 | |||
| 1952 | Ga0207688_10334118 | |||
| 1953 | Ga0207647_10002961 | |||
| 1954 | Ga0207647_10020382 | |||
| 1955 | Ga0207647_10037728 | |||
| 1956 | Ga0207647_10192684 | |||
| 1957 | Ga0207647_10329880 | |||
| 1958 | Ga0207645_10149934 | |||
| 1959 | Ga0207643_10027402 | |||
| 1960 | Ga0207643_10287967 | |||
| 1961 | Ga0207643_10385005 | |||
| 1962 | Ga0207705_10000001 | |||
| 1963 | Ga0207705_10324895 | |||
| 1964 | Ga0207684_10392112 | |||
| 1965 | Ga0207654_10536722 | |||
| 1966 | Ga0207707_10269891 | |||
| 1967 | Ga0207707_10619305 | |||
| 1968 | Ga0207695_10000465 | |||
| 1969 | Ga0207671_10000128 | |||
| 1970 | Ga0207671_10274193 | |||
| 1971 | Ga0207660_10257186 | |||
| 1972 | Ga0207662_10039062 | |||
| 1973 | Ga0207662_10589718 | |||
| 1974 | Ga0207662_10765588 | |||
| 1975 | Ga0207657_10049317 | |||
| 1976 | Ga0207657_10059784 | |||
| 1977 | Ga0207657_10125259 | |||
| 1978 | Ga0207657_10161338 | |||
| 1979 | Ga0207657_10368056 | |||
| 1980 | Ga0207649_10045895 | |||
| 1981 | Ga0207649_10897042 | |||
| 1982 | Ga0207652_10205613 | |||
| 1983 | Ga0207652_10680977 | |||
| 1984 | Ga0207652_10826294 | |||
| 1985 | Ga0207681_10197991 | |||
| 1986 | Ga0207694_10002060 | |||
| 1987 | Ga0207694_10067314 | |||
| 1988 | Ga0207694_10110758 | |||
| 1989 | Ga0207694_10210072 | |||
| 1990 | Ga0207694_10224432 | |||
| 1991 | Ga0207694_10367392 | |||
| 1992 | Ga0207659_10114978 | |||
| 1993 | Ga0207659_10235885 | |||
| 1994 | Ga0207659_10257645 | |||
| 1995 | Ga0207659_11393469 | |||
| 1996 | Ga0207687_10042556 | |||
| 1997 | Ga0207687_10095826 | |||
| 1998 | Ga0207687_10167381 | |||
| 1999 | Ga0207687_10290339 | |||
| 2000 | Ga0207687_10342592 | |||
| 2001 | Ga0207644_10290383 | |||
| 2002 | Ga0207690_10016816 | |||
| 2003 | Ga0207690_10031073 | |||
| 2004 | Ga0207690_10053882 | |||
| 2005 | Ga0207690_10340464 | |||
| 2006 | Ga0207690_10411309 | |||
| 2007 | Ga0207690_10479034 | |||
| 2008 | Ga0207690_10569851 | |||
| 2009 | Ga0207706_10054631 | |||
| 2010 | Ga0207706_10287587 | |||
| 2011 | Ga0207706_10302366 | |||
| 2012 | Ga0207686_10022157 | |||
| 2013 | Ga0207686_10059204 | |||
| 2014 | Ga0207686_10369569 | |||
| 2015 | Ga0207709_10012343 | |||
| 2016 | Ga0207709_10018638 | |||
| 2017 | Ga0207709_10051293 | |||
| 2018 | Ga0207709_10070878 | |||
| 2019 | Ga0207709_10243460 | |||
| 2020 | Ga0207709_10253947 | |||
| 2021 | Ga0207709_10265417 | |||
| 2022 | Ga0207709_10927835 | |||
| 2023 | Ga0207670_10071964 | |||
| 2024 | Ga0207670_10258098 | |||
| 2025 | Ga0207669_10045971 | |||
| 2026 | Ga0207669_10126333 | |||
| 2027 | Ga0207669_10204167 | |||
| 2028 | Ga0207669_10401292 | |||
| 2029 | Ga0207669_10941574 | |||
| 2030 | Ga0207704_10007836 | |||
| 2031 | Ga0207704_10081281 | |||
| 2032 | Ga0207704_10091887 | |||
| 2033 | Ga0207704_10351830 | |||
| 2034 | Ga0207704_10773470 | |||
| 2035 | Ga0207691_10008019 | |||
| 2036 | Ga0207711_10072369 | |||
| 2037 | Ga0207711_10076921 | |||
| 2038 | Ga0207711_10960028 | |||
| 2039 | Ga0207689_10017470 | |||
| 2040 | Ga0207661_10001526 | |||
| 2041 | Ga0207661_10030791 | |||
| 2042 | Ga0207661_10039725 | |||
| 2043 | Ga0207661_10052916 | |||
| 2044 | Ga0207661_10081977 | |||
| 2045 | Ga0207661_10120502 | |||
| 2046 | Ga0207661_10181137 | |||
| 2047 | Ga0207679_10036798 | |||
| 2048 | Ga0207679_10317579 | |||
| 2049 | Ga0207679_10534095 | |||
| 2050 | Ga0207679_10802425 | |||
| 2051 | Ga0207679_10948305 | |||
| 2052 | Ga0207667_10012609 | |||
| 2053 | Ga0207667_10129929 | |||
| 2054 | Ga0207667_10359093 | |||
| 2055 | Ga0207667_10639209 | |||
| 2056 | Ga0207651_10010408 | |||
| 2057 | Ga0207712_10057085 | |||
| 2058 | Ga0207712_10116575 | |||
| 2059 | Ga0207712_10220021 | |||
| 2060 | Ga0207712_10466744 | |||
| 2061 | Ga0207712_10535551 | |||
| 2062 | Ga0207712_11062860 | |||
| 2063 | Ga0207712_11195608 | |||
| 2064 | Ga0207668_10118889 | |||
| 2065 | Ga0207668_10123305 | |||
| 2066 | Ga0207668_10606280 | |||
| 2067 | Ga0207668_10834844 | |||
| 2068 | Ga0207640_10005084 | |||
| 2069 | Ga0207640_10156829 | |||
| 2070 | Ga0207640_10342266 | |||
| 2071 | Ga0207640_10680714 | |||
| 2072 | Ga0207640_10827943 | |||
| 2073 | Ga0207658_10063520 | |||
| 2074 | Ga0207658_10469078 | |||
| 2075 | Ga0207658_11011336 | |||
| 2076 | Ga0207677_10098967 | |||
| 2077 | Ga0207677_10253451 | |||
| 2078 | Ga0207677_10810763 | |||
| 2079 | Ga0207677_10923858 | |||
| 2080 | Ga0207639_10035824 | |||
| 2081 | Ga0207639_10062063 | |||
| 2082 | Ga0207639_10062509 | |||
| 2083 | Ga0207639_10257158 | |||
| 2084 | Ga0207639_10557672 | |||
| 2085 | Ga0207639_10614819 | |||
| 2086 | Ga0207678_10045508 | |||
| 2087 | Ga0207678_10069737 | |||
| 2088 | Ga0207678_10224531 | |||
| 2089 | Ga0207678_10544054 | |||
| 2090 | Ga0207708_10001069 | |||
| 2091 | Ga0207708_10122988 | |||
| 2092 | Ga0207708_10630564 | |||
| 2093 | Ga0207708_10644253 | |||
| 2094 | Ga0207708_10696383 | |||
| 2095 | Ga0207702_10085444 | |||
| 2096 | Ga0207702_10581606 | |||
| 2097 | Ga0207702_11103980 | |||
| 2098 | Ga0207702_11277392 | |||
| 2099 | Ga0207641_10858749 | |||
| 2100 | Ga0207648_10185813 | |||
| 2101 | Ga0207676_10095535 | |||
| 2102 | Ga0207676_11708079 | |||
| 2103 | Ga0207674_10007103 | |||
| 2104 | Ga0207674_10040017 | |||
| 2105 | Ga0207674_10135959 | |||
| 2106 | Ga0207674_10518408 | |||
| 2107 | Ga0207674_10887166 | |||
| 2108 | Ga0207674_11300190 | |||
| 2109 | Ga0207675_100010022 | |||
| 2110 | Ga0207675_100053232 | |||
| 2111 | Ga0207675_100156720 | |||
| 2112 | Ga0207675_100215039 | |||
| 2113 | Ga0207675_100253106 | |||
| 2114 | Ga0207675_100588245 | |||
| 2115 | Ga0207683_10036960 | |||
| 2116 | Ga0207683_10043268 | |||
| 2117 | Ga0207683_10059593 | |||
| 2118 | Ga0207683_10069837 | |||
| 2119 | Ga0207683_10150972 | |||
| 2120 | Ga0207683_10167624 | |||
| 2121 | Ga0207683_10196077 | |||
| 2122 | Ga0207683_10242834 | |||
| 2123 | Ga0207683_10386925 | |||
| 2124 | Ga0207683_10673340 | |||
| 2125 | Ga0207683_11395983 | |||
| 2126 | Ga0207683_11649167 | |||
| 2127 | Ga0207698_10038296 | |||
| 2128 | Ga0207698_10093155 | |||
| 2129 | Ga0207698_10121155 | |||
| 2130 | Ga0207698_10199750 | |||
| 2131 | Ga0207698_10650438 | |||
| 2132 | Ga0207698_11090255 | |||
| 2133 | Ga0209974_10038742 | |||
| 2134 | Ga0207428_10000964 | |||
| 2135 | Ga0268266_10204244 | |||
| 2136 | Ga0268265_10765304 | |||
| 2137 | Ga0268264_10000716 | |||
| 2138 | Ga0268264_10375200 | |||
| 2139 | Ga0268264_10452867 | |||
| 2140 | Ga0307517_10177704 | |||
| 2141 | Ga0316183_1096233 | |||
| 2142 | Ga0316181_1110679 | |||
| 2143 | Ga0316181_1238547 | |||
| 2144 | Ga0316181_1251928 | |||
| 2145 | Ga0316182_1417880 | |||
| 2146 | Ga0307513_10139703 | |||
| 2147 | Ga0307408_100018661 | |||
| 2148 | Ga0307408_100125180 | |||
| 2149 | Ga0307408_100129335 | |||
| 2150 | Ga0307408_100249651 | |||
| 2151 | Ga0307408_100262927 | |||
| 2152 | Ga0316579_10045825 | |||
| 2153 | Ga0316576_10000044 | |||
| 2154 | Ga0316576_10043684 | |||
| 2155 | Ga0316578_10020590 | |||
| 2156 | Ga0307405_10001317 | |||
| 2157 | Ga0307405_10003937 | |||
| 2158 | Ga0307405_10087749 | |||
| 2159 | Ga0307405_10091114 | |||
| 2160 | Ga0307405_10106517 | |||
| 2161 | Ga0307405_10106930 | |||
| 2162 | Ga0307405_10224977 | |||
| 2163 | Ga0307405_10518794 | |||
| 2164 | Ga0307413_10000082 | |||
| 2165 | Ga0307413_10084647 | |||
| 2166 | Ga0307413_10100465 | |||
| 2167 | Ga0307413_10321596 | |||
| 2168 | Ga0307413_10331269 | |||
| 2169 | Ga0307410_10011148 | |||
| 2170 | Ga0307410_10017454 | |||
| 2171 | Ga0307410_10018360 | |||
| 2172 | Ga0307410_10061238 | |||
| 2173 | Ga0307410_10136142 | |||
| 2174 | Ga0307410_10197025 | |||
| 2175 | Ga0307410_10270233 | |||
| 2176 | Ga0307410_10403599 | |||
| 2177 | Ga0307406_10002332 | |||
| 2178 | Ga0307406_10004112 | |||
| 2179 | Ga0307406_10005754 | |||
| 2180 | Ga0307406_10026994 | |||
| 2181 | Ga0307406_10160376 | |||
| 2182 | Ga0307406_10294194 | |||
| 2183 | Ga0307406_10519179 | |||
| 2184 | Ga0307406_10744407 | |||
| 2185 | Ga0307406_10783431 | |||
| 2186 | Ga0307406_11282403 | |||
| 2187 | Ga0307407_10002766 | |||
| 2188 | Ga0307407_10031526 | |||
| 2189 | Ga0307407_10033737 | |||
| 2190 | Ga0307407_10055716 | |||
| 2191 | Ga0307407_10075247 | |||
| 2192 | Ga0307407_10109185 | |||
| 2193 | Ga0307407_10125730 | |||
| 2194 | Ga0307407_10196173 | |||
| 2195 | Ga0307407_10419247 | |||
| 2196 | Ga0307407_11167375 | |||
| 2197 | Ga0307412_10023822 | |||
| 2198 | Ga0307412_10031696 | |||
| 2199 | Ga0307412_10082524 | |||
| 2200 | Ga0307412_10189789 | |||
| 2201 | Ga0307412_10257670 | |||
| 2202 | Ga0307412_10495138 | |||
| 2203 | Ga0307412_10827502 | |||
| 2204 | Ga0307409_100000050 | |||
| 2205 | Ga0307409_100008307 | |||
| 2206 | Ga0307409_100040626 | |||
| 2207 | Ga0307409_100046691 | |||
| 2208 | Ga0307409_100070481 | |||
| 2209 | Ga0307409_100071899 | |||
| 2210 | Ga0307409_101316939 | |||
| 2211 | Ga0307416_100000150 | |||
| 2212 | Ga0307416_100023522 | |||
| 2213 | Ga0307416_100078718 | |||
| 2214 | Ga0307416_100094006 | |||
| 2215 | Ga0307416_100126118 | |||
| 2216 | Ga0307416_100221560 | |||
| 2217 | Ga0307416_100366011 | |||
| 2218 | Ga0307416_100576308 | |||
| 2219 | Ga0307416_100761619 | |||
| 2220 | Ga0307416_101175456 | |||
| 2221 | Ga0307414_10002253 | |||
| 2222 | Ga0307414_10146268 | |||
| 2223 | Ga0307414_10176030 | |||
| 2224 | Ga0307414_10270642 | |||
| 2225 | Ga0307414_10287591 | |||
| 2226 | Ga0307414_10305081 | |||
| 2227 | Ga0307414_10951889 | |||
| 2228 | Ga0307414_10991117 | |||
| 2229 | Ga0307411_10019042 | |||
| 2230 | Ga0307411_10037214 | |||
| 2231 | Ga0307411_10040253 | |||
| 2232 | Ga0307411_10352240 | |||
| 2233 | Ga0307411_10480043 | |||
| 2234 | Ga0307415_100031578 | |||
| 2235 | Ga0307415_100146442 | |||
| 2236 | Ga0307415_100158736 | |||
| 2237 | Ga0307415_100167957 | |||
| 2238 | Ga0307415_100206740 | |||
| 2239 | Ga0307415_100280796 | |||
| 2240 | Ga0316583_10023709 | |||
| 2241 | Ga0316585_10017855 | |||
| 2242 | Ga0316580_10060057 | |||
| 2243 | Ga0316588_1033508 | |||
| 2244 | Ga0316596_1053502 | |||
| 2245 | Ga0373931_0053018 | |||
| 2246 | Ga0373937_0537888 | |||
| 2247 | Ga0316584_0036284 | |||
| 2248 | Ga0316584_0492845 | |||
| 2249 | Ga0395899_0179802 | |||
| 2250 | Ga0395899_0283766 | |||
| 2251 | Ga0395899_0351035 | |||
| 2252 | Ga0395900_0147607 | |||
| 2253 | Ga0395900_0209282 | |||
| 2254 | Ga0395900_0957769 | |||
| 2255 | Ga0395898_0116077 | |||
| 2256 | Ga0395898_0356157 | |||
| 2257 | Ga0316581_0000918 | |||
| 2258 | Ga0436364_0980202 | |||
| 2259 | Ga0395901_0257689 | |||
| 2260 | Ga0395901_0426330 | |||
| 2261 | Ga0395901_0556527 | |||
| 2262 | Ga0395901_0991661 | |||
| 2263 | Ga0400488_11281 | |||
| 2264 | Ga0400486_03564 | |||
| 2265 | Ga0436365_1705036 | |||
| 2266 | Ga0439436_0010622 | |||
| 2267 | Ga0439436_0140863 | |||
| 2268 | Ga0439465_0031175 | |||
| 2269 | Ga0439465_0185367 | |||
| 2270 | Ga0451791_1478727 | |||
| 2271 | Ga0451793_1618369 | |||
| 2272 | Ga0451800_0512413 | |||
| 2273 | Ga0451806_586639 | |||
| 2274 | Ga0451807_2174170 | |||
| 2275 | Ga0451837_1113271 | |||
| 2276 | Ga0439448_0011573 | |||
| 2277 | Ga0439448_0146839 | |||
| 2278 | Ga0439432_025491 | |||
| 2279 | Ga0439450_032831 | |||
| 2280 | Ga0439462_0036390 | |||
| 2281 | Ga0439463_002858 | |||
| 2282 | Ga0439463_128134 | |||
| 2283 | Ga0450912_011710 | |||
| 2284 | Ga0450920_060584 | |||
| 2285 | Ga0439446_0151778 | |||
| 2286 | Ga0439435_0004572 | |||
| 2287 | Ga0439444_0001270 | |||
| 2288 | Ga0439464_0010535 | |||
| 2289 | Ga0439464_0067924 | |||
| 2290 | Ga0450918_096169 | |||
| 2291 | Ga0439440_0004003 | |||
| 2292 | Ga0439440_0019724 | |||
| 2293 | Ga0466969_0026550 | |||
| 2294 | Ga0466969_0031800 | |||
| 2295 | Ga0466969_0044386 | |||
| 2296 | Ga0466972_0205735 | |||
| 2297 | Ga0466965_0063382 | |||
| 2298 | Ga0466965_0134546 | |||
| 2299 | Ga0466965_0135622 | |||
| 2300 | Ga0466965_0159769 | |||
| 2301 | Ga0466965_0239806 | |||
| 2302 | Ga0466966_0007159 | |||
| 2303 | Ga0466966_0015403 | |||
| 2304 | Ga0466966_0028371 | |||
| 2305 | Ga0466966_0419245 | |||
| 2306 | Ga0466961_0019337 | |||
| 2307 | Ga0466961_0037545 | |||
| 2308 | Ga0466961_0064101 | |||
| 2309 | Ga0466961_0096221 | |||
| 2310 | Ga0466961_0201734 | |||
| 2311 | Ga0466961_0263842 | |||
| 2312 | Ga0466961_0707591 | |||
| 2313 | Ga0466963_0013682 | |||
| 2314 | Ga0466963_0041521 | |||
| 2315 | Ga0466963_0272509 | |||
| 2316 | Ga0466963_0361708 | |||
| 2317 | Ga0466963_0809494 | |||
| 2318 | Ga0466963_1071301 | |||
| 2319 | Ga0466964_0006978 | |||
| 2320 | Ga0466964_0019416 | |||
| 2321 | Ga0466971_0012855 | |||
| 2322 | Ga0466971_0018447 | |||
| 2323 | Ga0466968_0165165 | |||
| 2324 | Ga0466970_0000027 | |||
| 2325 | Ga0466970_0001734 | |||
| 2326 | Ga0466970_0058140 | |||
| 2327 | Ga0466970_0064028 | |||
| 2328 | Ga0466970_0093046 | |||
| 2329 | Ga0466970_0161057 | |||
| 2330 | Ga0466970_0270609 | |||
| 2331 | Ga0466970_0370452 | |||
| 2332 | Ga0466957_0068291 | |||
| 2333 | Ga0466957_0223574 | |||
| 2334 | Ga0466957_0368680 | |||
| 2335 | Ga0466957_0651528 | |||
| 2336 | Ga0466957_0839109 | |||
| 2337 | Ga0466960_0012073 | |||
| 2338 | Ga0466960_0024128 | |||
| 2339 | Ga0466960_0034018 | |||
| 2340 | Ga0466960_0041643 | |||
| 2341 | Ga0466960_0053836 | |||
| 2342 | Ga0466960_0254480 | |||
| 2343 | Ga0466960_0400834 | |||
| 2344 | Ga0466959_0022475 | |||
| 2345 | Ga0466959_0050657 | |||
| 2346 | Ga0466959_0089417 | |||
| 2347 | Ga0466959_0214515 | |||
| 2348 | Ga0466959_0328588 | |||
| 2349 | Ga0451576_0165085 | |||
| 2350 | Ga0466958_0127343 | |||
| 2351 | Ga0466958_0271336 | |||
| 2352 | Ga0466958_0781369 | |||
| 2353 | Ga0466967_0019414 | |||
| 2354 | Ga0466967_0025932 | |||
| 2355 | Ga0466967_0058636 | |||
| 2356 | Ga0466967_0228547 | |||
| 2357 | Ga0466967_0381743 | |||
| 2358 | Ga0466967_0575945 | |||
| 2359 | Ga0466967_0670159 | |||
| 2360 | Ga0466967_0780758 | |||
| 2361 | Ga0466967_0856091 | |||
| 2362 | Ga0495627_000366 | |||
| 2363 | Ga0495627_073803 | |||
| 2364 | Ga0495627_076911 | |||
| 2365 | Ga0495592_0015950 | |||
| 2366 | Ga0495603_0271340 | |||
| 2367 | Ga0495603_0354456 | |||
| 2368 | Ga0495638_0071684 | |||
| 2369 | Ga0495641_0067371 | |||
| 2370 | Ga0495651_0002063 | |||
| 2371 | Ga0495651_0002864 | |||
| 2372 | Ga0495651_0037156 | |||
| 2373 | Ga0495651_0100669 | |||
| 2374 | Ga0495653_0013086 | |||
| 2375 | Ga0495653_0053217 | |||
| 2376 | Ga0495653_0409546 | |||
| 2377 | Ga0495650_0286394 | |||
| 2378 | Ga0495580_0005827 | |||
| 2379 | Ga0495582_0548271 | |||
| 2380 | Ga0495662_0000390 | |||
| 2381 | Ga0495664_0003456 | |||
| 2382 | Ga0495596_0167194 | |||
| 2383 | Ga0495608_0006616 | |||
| 2384 | Ga0495608_0098578 | |||
| 2385 | Ga0495608_0288386 | |||
| 2386 | Ga0495618_0081028 | |||
| 2387 | Ga0495620_0040118 | |||
| 2388 | Ga0495628_0036245 | |||
| 2389 | Ga0495628_0100147 | |||
| 2390 | Ga0495630_0038944 | |||
| 2391 | Ga0495630_0409753 | |||
| 2392 | Ga0495631_0083179 | |||
| 2393 | Ga0495631_0205127 | |||
| 2394 | Ga0495631_0244585 | |||
| 2395 | Ga0495632_0224480 | |||
| 2396 | Ga0495666_0018682 | |||
| 2397 | Ga0495652_0005073 | |||
| 2398 | Ga0495652_0030673 | |||
| 2399 | Ga0495665_0011264 | |||
| 2400 | Ga0495640_0010828 | |||
| 2401 | Ga0495586_0016566 | |||
| 2402 | Ga0495587_0005716 | |||
| 2403 | Ga0495587_0099437 | |||
| 2404 | Ga0495598_0084838 | |||
| 2405 | Ga0495597_0123881 | |||
| 2406 | Ga0495645_0003715 | |||
| 2407 | Ga0495645_0021561 | |||
| 2408 | Ga0495622_0028293 | |||
| 2409 | Ga0495667_0008797 | |||
| 2410 | Ga0495667_0476054 | |||
| 2411 | Ga0495656_0276568 | |||
| 2412 | Ga0495656_0306878 | |||
| 2413 | Ga0495656_0494259 | |||
| 2414 | Ga0495611_0038558 | |||
| 2415 | Ga0495625_0106558 | |||
| 2416 | Ga0495635_0012485 | |||
| 2417 | Ga0495599_0005565 | |||
| 2418 | Ga0495623_0007953 | |||
| 2419 | Ga0495646_0008190 | |||
| 2420 | Ga0495646_0071459 | |||
| 2421 | Ga0495647_0099843 | |||
| 2422 | Ga0495647_0216796 | |||
| 2423 | Ga0495647_0310652 | |||
| 2424 | Ga0495658_0006908 | |||
| 2425 | Ga0495658_0231664 | |||
| 2426 | Ga0495658_0253129 | |||
| 2427 | Ga0495658_0311014 | |||
| 2428 | Ga0495658_0373709 | |||
| 2429 | Ga0495658_0537296 | |||
| 2430 | Ga0495613_0018672 | |||
| 2431 | Ga0495613_0242161 | |||
| 2432 | Ga0495624_0333751 | |||
| 2433 | Ga0495670_0120949 | |||
| 2434 | Ga0495600_0002560 | |||
| 2435 | Ga0495600_0078541 | |||
| 2436 | Ga0495581_0012598 | |||
| 2437 | Ga0495581_0063337 | |||
| 2438 | Ga0495581_0170093 | |||
| 2439 | Ga0495604_0000113 | |||
| 2440 | Ga0495604_0073835 | |||
| 2441 | Ga0495604_0424629 | |||
| 2442 | Ga0495674_0014322 | |||
| 2443 | Ga0495674_0172173 | |||
| 2444 | Ga0495672_0011090 | |||
| 2445 | Ga0495672_0043999 | |||
| 2446 | Ga0495676_0108581 | |||
| 2447 | Ga0495676_0233635 | |||
| 2448 | Ga0495676_0309627 | |||
| 2449 | Ga0495676_0722909 | |||
| 2450 | Ga0495675_0002112 | |||
| 2451 | Ga0495681_0168170 | |||
| 2452 | Ga0495684_0011762 | |||
| 2453 | Ga0495593_0003677 | |||
| 2454 | Ga0495602_0015786 | |||
| 2455 | Ga0495615_0145115 | |||
| 2456 | Ga0496100_0155095 | |||
| 2457 | Ga0496100_0236947 | |||
| 2458 | Ga0496100_0490988 | |||
| 2459 | Ga0496101_0108207 | |||
| 2460 | Ga0496101_0161065 | |||
| 2461 | Ga0496101_0420515 | |||
| 2462 | Ga0496101_0494603 | |||
| 2463 | Ga0496101_0531927 | |||
| 2464 | Ga0496101_0666531 | |||
| 2465 | Ga0496101_1103318 | |||
| 2466 | Ga0496102_0009934 | |||
| 2467 | Ga0496102_0028027 | |||
| 2468 | Ga0496102_0239967 | |||
| 2469 | Ga0496102_0617350 | |||
| 2470 | Ga0496103_0034233 | |||
| 2471 | Ga0496104_0316126 | |||
| 2472 | Ga0496104_0435768 | |||
| 2473 | Ga0496104_0899131 | |||
| 2474 | Ga0496105_0357227 | |||
| 2475 | Ga0496105_0432883 | |||
| 2476 | Ga0496105_0440495 | |||
| 2477 | Ga0496105_0866846 | |||
| 2478 | Ga0496105_1023298 | |||
| 2479 | Ga0496106_0006764 | |||
| 2480 | Ga0496106_0135921 | |||
| 2481 | Ga0496106_0249673 | |||
| 2482 | Ga0496106_0383805 | |||
| 2483 | Ga0496107_0209976 | |||
| 2484 | Ga0496107_0275723 | |||
| 2485 | Ga0496107_0913733 | |||
| 2486 | Ga0496108_0016525 | |||
| 2487 | Ga0496108_0032449 | |||
| 2488 | Ga0496108_0080994 | |||
| 2489 | Ga0496108_0145139 | |||
| 2490 | Ga0496108_0277932 | |||
| 2491 | Ga0496108_0305004 | |||
| 2492 | Ga0496108_0636755 | |||
| 2493 | Ga0496108_0902018 | |||
| 2494 | Ga0496108_1004936 | |||
| 2495 | Ga0496108_1050387 | |||
| 2496 | Ga0496109_0004619 | |||
| 2497 | Ga0496109_0010829 | |||
| 2498 | Ga0496109_0026873 | |||
| 2499 | Ga0496109_0156938 | |||
| 2500 | Ga0496109_0256958 | |||
| 2501 | Ga0496109_0332801 | |||
| 2502 | Ga0496109_0372274 | |||
| 2503 | Ga0496109_0538290 | |||
| 2504 | Ga0496109_0603304 | |||
| 2505 | Ga0496109_0612320 | |||
| 2506 | Ga0496109_0782719 | |||
| 2507 | Ga0496109_1033756 | |||
| 2508 | Ga0496109_1213135 | |||
| 2509 | Ga0496109_1500909 | |||
| 2510 | Ga0496110_0003002 | |||
| 2511 | Ga0496110_0009432 | |||
| 2512 | Ga0496110_0102021 | |||
| 2513 | Ga0496110_0135817 | |||
| 2514 | Ga0496110_0224581 | |||
| 2515 | Ga0496110_0241567 | |||
| 2516 | Ga0496110_0411080 | |||
| 2517 | Ga0496110_0429112 | |||
| 2518 | Ga0496110_0661898 | |||
| 2519 | Ga0496110_0721746 | |||
| 2520 | Ga0496110_0947279 | |||
| 2521 | Ga0496111_0047733 | |||
| 2522 | Ga0496111_0166218 | |||
| 2523 | Ga0496111_0362966 | |||
| 2524 | Ga0496112_0164633 | |||
| 2525 | Ga0496112_0580270 | |||
| 2526 | Ga0496113_0065187 | |||
| 2527 | Ga0496113_0163409 | |||
| 2528 | Ga0496113_0234387 | |||
| 2529 | Ga0496113_1250241 | |||
| 2530 | Ga0496114_0014209 | |||
| 2531 | Ga0496114_0021729 | |||
| 2532 | Ga0496114_0037958 | |||
| 2533 | Ga0496114_0045393 | |||
| 2534 | Ga0496114_0046928 | |||
| 2535 | Ga0496114_0099311 | |||
| 2536 | Ga0496114_0100486 | |||
| 2537 | Ga0496114_0164138 | |||
| 2538 | Ga0496114_0226403 | |||
| 2539 | Ga0496114_0329099 | |||
| 2540 | Ga0496114_0369396 | |||
| 2541 | Ga0496114_0482584 | |||
| 2542 | Ga0496114_0492402 | |||
| 2543 | Ga0496114_0735405 | |||
| 2544 | Ga0496114_0794512 | |||
| 2545 | Ga0496114_1155620 | |||
| 2546 | Ga0496114_1225007 | |||
| 2547 | Ga0496116_0179449 | |||
| 2548 | Ga0496117_0000651 | |||
| 2549 | Ga0496117_0001417 | |||
| 2550 | Ga0496117_0001865 | |||
| 2551 | Ga0496117_0006565 | |||
| 2552 | Ga0496117_0361887 | |||
| 2553 | Ga0496118_0004583 | |||
| 2554 | Ga0496118_0040541 | |||
| 2555 | Ga0496119_0002760 | |||
| 2556 | Ga0496119_0010799 | |||
| 2557 | Ga0496119_0015791 | |||
| 2558 | Ga0496119_0255209 | |||
| 2559 | Ga0496120_0003180 | |||
| 2560 | Ga0496120_0006039 | |||
| 2561 | Ga0496120_0008033 | |||
| 2562 | Ga0496120_0347590 | |||
| 2563 | Ga0496122_0001412 | |||
| 2564 | Ga0496122_0001962 | |||
| 2565 | Ga0496122_0003791 | |||
| 2566 | Ga0496122_0011371 | |||
| 2567 | Ga0496122_0016759 | |||
| 2568 | Ga0496122_0022308 | |||
| 2569 | Ga0496123_0000009 | |||
| 2570 | Ga0496123_0002420 | |||
| 2571 | Ga0496123_0165602 | |||
| 2572 | Ga0496124_0016122 | |||
| 2573 | Ga0496124_0120964 | |||
| 2574 | Ga0496124_0255380 | |||
| 2575 | Ga0496124_0434039 | |||
| 2576 | Ga0496125_0000086 | |||
| 2577 | Ga0496125_0005854 | |||
| 2578 | Ga0496125_0012271 | |||
| 2579 | Ga0496125_0019618 | |||
| 2580 | Ga0496125_0050862 | |||
| 2581 | Ga0496125_0051614 | |||
| 2582 | Ga0496126_0001361 | |||
| 2583 | Ga0496126_0004955 | |||
| 2584 | Ga0496126_0072850 | |||
| 2585 | Ga0496126_0079413 | |||
| 2586 | Ga0496126_0130003 | |||
| 2587 | Ga0496126_0562656 | |||
| 2588 | Ga0501306_005444 | |||
| 2589 | Ga0501306_005481 | |||
| 2590 | Ga0501306_009793 | |||
| 2591 | Ga0501306_009840 | |||
| 2592 | Ga0501306_013272 | |||
| 2593 | Ga0501306_017558 | |||
| 2594 | Ga0501306_018175 | |||
| 2595 | Ga0501306_020788 | |||
| 2596 | Ga0501306_038680 | |||
| 2597 | Ga0501308_003250 | |||
| 2598 | Ga0501308_008813 | |||
| 2599 | Ga0501308_016950 | |||
| 2600 | Ga0501308_028109 | |||
| 2601 | Ga0501309_007448 | |||
| 2602 | Ga0501309_010739 | |||
| 2603 | Ga0501309_030598 | |||
| 2604 | Ga0501309_064581 | |||
| 2605 | Ga0501310_000203 | |||
| 2606 | Ga0501310_004679 | |||
| 2607 | Ga0501310_011248 | |||
| 2608 | Ga0501310_013202 | |||
| 2609 | Ga0501310_019314 | |||
| 2610 | Ga0501310_021706 | |||
| 2611 | Ga0501310_043217 | |||
| 2612 | Ga0501310_054264 | |||
| 2613 | Ga0501304_005285 | |||
| 2614 | Ga0501304_006590 | |||
| 2615 | Ga0501304_035168 | |||
| 2616 | Ga0501305_009438 | |||
| 2617 | Ga0501305_011341 | |||
| 2618 | Ga0501305_013752 | |||
| 2619 | Ga0501305_017779 | |||
| 2620 | Ga0501305_021051 | |||
| 2621 | Ga0501305_022577 | |||
| 2622 | Ga0501305_039732 | |||
| 2623 | Ga0501307_001336 | |||
| 2624 | Ga0501307_007043 | |||
| 2625 | Ga0501307_008681 | |||
| 2626 | Ga0501307_008773 | |||
| 2627 | Ga0501307_008990 | |||
| 2628 | Ga0501307_009302 | |||
| 2629 | Ga0501291_003463 | |||
| 2630 | Ga0501311_002733 | |||
| 2631 | Ga0501311_006387 | |||
| 2632 | Ga0501311_006689 | |||
| 2633 | Ga0501311_007519 | |||
| 2634 | Ga0501311_009584 | |||
| 2635 | Ga0501311_012613 | |||
| 2636 | Ga0501311_015533 | |||
| 2637 | Ga0501311_016867 | |||
| 2638 | Ga0501311_024585 | |||
| 2639 | Ga0501311_070326 | |||
| 2640 | Ga0501312_008978 | |||
| 2641 | Ga0501312_010973 | |||
| 2642 | Ga0501312_013905 | |||
| 2643 | Ga0501312_014606 | |||
| 2644 | Ga0501312_033162 | |||
| 2645 | Ga0501312_053797 | |||
| 2646 | Ga0501312_077440 | |||
| 2647 | Ga0501313_004416 | |||
| 2648 | Ga0501313_007160 | |||
| 2649 | Ga0501313_008814 | |||
| 2650 | Ga0501314_005361 | |||
| 2651 | Ga0501314_016981 | |||
| 2652 | Ga0501315_004377 | |||
| 2653 | Ga0501315_007175 | |||
| 2654 | Ga0501315_007980 | |||
| 2655 | Ga0501315_012376 | |||
| 2656 | Ga0501315_012540 | |||
| 2657 | Ga0501315_013901 | |||
| 2658 | Ga0501315_024447 | |||
| 2659 | Ga0501315_035972 | |||
| 2660 | Ga0501316_010829 | |||
| 2661 | Ga0501316_013105 | |||
| 2662 | Ga0501316_016456 | |||
| 2663 | Ga0501316_022147 | |||
| 2664 | Ga0501316_035199 | |||
| 2665 | Ga0501317_000644 | |||
| 2666 | Ga0501317_005272 | |||
| 2667 | Ga0501317_005710 | |||
| 2668 | Ga0501317_014600 | |||
| 2669 | Ga0501317_016193 | |||
| 2670 | Ga0501317_024164 | |||
| 2671 | Ga0501317_034421 | |||
| 2672 | Ga0501317_071509 | |||
| 2673 | Ga0501318_000479 | |||
| 2674 | Ga0501318_001868 | |||
| 2675 | Ga0501318_004917 | |||
| 2676 | Ga0501318_005596 | |||
| 2677 | Ga0501318_007572 | |||
| 2678 | Ga0501318_008705 | |||
| 2679 | Ga0501318_009413 | |||
| 2680 | Ga0501318_009609 | |||
| 2681 | Ga0501318_011015 | |||
| 2682 | Ga0501318_020431 | |||
| 2683 | Ga0501319_003021 | |||
| 2684 | Ga0501320_001217 | |||
| 2685 | Ga0501320_004125 | |||
| 2686 | Ga0501320_008104 | |||
| 2687 | Ga0501320_008184 | |||
| 2688 | Ga0501320_053653 | |||
| 2689 | Ga0501321_000742 | |||
| 2690 | Ga0501321_000877 | |||
| 2691 | Ga0501321_001896 | |||
| 2692 | Ga0501321_010063 | |||
| 2693 | Ga0501321_013390 | |||
| 2694 | Ga0501321_022531 | |||
| 2695 | Ga0501322_002959 | |||
| 2696 | Ga0501323_001151 | |||
| 2697 | Ga0501323_024076 | |||
| 2698 | Ga0501324_001175 | |||
| 2699 | Ga0501324_007700 | |||
| 2700 | Ga0501324_010748 | |||
| 2701 | Ga0501325_001878 | |||
| 2702 | Ga0501325_007953 | |||
| 2703 | Ga0501031_0001904 | |||
| 2704 | Ga0501031_0003864 | |||
| 2705 | Ga0501031_0004771 | |||
| 2706 | Ga0501031_0012109 | |||
| 2707 | Ga0501031_0167765 | |||
| 2708 | Ga0501032_0021323 | |||
| 2709 | Ga0501032_0084511 | |||
| 2710 | Ga0501032_0085575 | |||
| 2711 | Ga0501032_0349515 | |||
| 2712 | Ga0501032_0699600 | |||
| 2713 | Ga0501033_0018229 | |||
| 2714 | Ga0501033_0035975 | |||
| 2715 | Ga0501034_0112724 | |||
| 2716 | Ga0501034_0301751 | |||
| 2717 | Ga0501034_0345444 | |||
| 2718 | Ga0501036_0002252 | |||
| 2719 | Ga0501036_0009602 | |||
| 2720 | Ga0501036_0050131 | |||
| 2721 | Ga0501036_0055279 | |||
| 2722 | Ga0501036_0510300 | |||
| 2723 | Ga0501036_0598772 | |||
| 2724 | Ga0501037_0023238 | |||
| 2725 | Ga0501037_0028258 | |||
| 2726 | Ga0501037_0070320 | |||
| 2727 | Ga0501037_0122037 | |||
| 2728 | Ga0501037_0469845 | |||
| 2729 | Ga0501038_0025278 | |||
| 2730 | Ga0501038_0030416 | |||
| 2731 | Ga0501038_0054600 | |||
| 2732 | Ga0501038_0059870 | |||
| 2733 | Ga0501038_0136034 | |||
| 2734 | Ga0501039_0006886 | |||
| 2735 | Ga0501039_0012457 | |||
| 2736 | Ga0501039_0048864 | |||
| 2737 | Ga0501039_0064077 | |||
| 2738 | Ga0501039_0271708 | |||
| 2739 | Ga0501039_0323047 | |||
| 2740 | Ga0501040_0006842 | |||
| 2741 | Ga0501040_0028375 | |||
| 2742 | Ga0501040_0204015 | |||
| 2743 | Ga0501040_0267132 | |||
| 2744 | Ga0501040_0519211 | |||
| 2745 | Ga0501040_0824722 | |||
| 2746 | Ga0501041_0003749 | |||
| 2747 | Ga0501041_0030801 | |||
| 2748 | Ga0501041_0054720 | |||
| 2749 | Ga0501042_0002441 | |||
| 2750 | Ga0501042_0022916 | |||
| 2751 | Ga0501042_0045764 | |||
| 2752 | Ga0501043_0002200 | |||
| 2753 | Ga0501043_0305605 | |||
| 2754 | Ga0501046_0013207 | |||
| 2755 | Ga0501046_0032560 | |||
| 2756 | Ga0501046_0090343 | |||
| 2757 | Ga0501048_0022554 | |||
| 2758 | Ga0501048_0031363 | |||
| 2759 | Ga0501048_0131984 | |||
| 2760 | Ga0501048_0149903 | |||
| 2761 | Ga0501048_0211903 | |||
| 2762 | Ga0501067_0030199 | |||
| 2763 | Ga0501067_0100591 | |||
| 2764 | Ga0501068_0034975 | |||
| 2765 | Ga0501068_0039920 | |||
| 2766 | Ga0501068_0075443 | |||
| 2767 | Ga0501069_0000273 | |||
| 2768 | Ga0501069_0079871 | |||
| 2769 | Ga0501070_0015859 | |||
| 2770 | Ga0501071_0019237 | |||
| 2771 | Ga0501071_0038154 | |||
| 2772 | Ga0501071_0069590 | |||
| 2773 | Ga0501071_0170372 | |||
| 2774 | Ga0501072_0006470 | |||
| 2775 | Ga0501072_0125162 | |||
| 2776 | Ga0501072_0235125 | |||
| 2777 | Ga0501072_0507509 | |||
| 2778 | Ga0501073_0038561 | |||
| 2779 | Ga0501073_0113814 | |||
| 2780 | Ga0501074_0010467 | |||
| 2781 | Ga0501074_0012517 | |||
| 2782 | Ga0501074_0054490 | |||
| 2783 | Ga0501074_0080968 | |||
| 2784 | Ga0501074_0526723 | |||
| 2785 | Ga0501075_0016824 | |||
| 2786 | Ga0501075_0298517 | |||
| 2787 | Ga0501075_0779902 | |||
| 2788 | Ga0501076_0022797 | |||
| 2789 | Ga0501076_0029017 | |||
| 2790 | Ga0501077_0017885 | |||
| 2791 | Ga0501077_0063158 | |||
| 2792 | Ga0501077_0284565 | |||
| 2793 | Ga0501235_096090 | |||
| 2794 | Ga0501225_0043477 | |||
| 2795 | Ga0501079_0002786 | |||
| 2796 | Ga0501079_0525365 | |||
| 2797 | Ga0501080_0000473 | |||
| 2798 | Ga0501080_0038075 | |||
| 2799 | Ga0501080_0061686 | |||
| 2800 | Ga0501081_0001282 | |||
| 2801 | Ga0501081_0047474 | |||
| 2802 | Ga0501081_0059287 | |||
| 2803 | Ga0501081_0377431 | |||
| 2804 | Ga0501083_0003730 | |||
| 2805 | Ga0501083_0220023 | |||
| 2806 | Ga0501083_0543400 | |||
| 2807 | Ga0501035_0002239 | |||
| 2808 | Ga0501035_0155006 | |||
| 2809 | Ga0501035_0266777 | |||
| 2810 | Ga0501035_0467391 | |||
| 2811 | Ga0501044_0337356 | |||
| 2812 | Ga0501045_0017260 | |||
| 2813 | Ga0501045_0051860 | |||
| 2814 | Ga0501045_0096947 | |||
| 2815 | Ga0501045_0654372 | |||
| 2816 | nmdc:mga03683_24840_c1 | |||
| 2817 | nmdc:mga03n38_199879_c1 | |||
| 2818 | nmdc:mga03n38_277943_c1 | |||
| 2819 | nmdc:mga00v17_116578_c1 | |||
| 2820 | nmdc:mga00v17_165046_c1 | |||
| 2821 | nmdc:mga00v17_35494_c1 | |||
| 2822 | nmdc:mga00v17_54795_c1 | |||
| 2823 | nmdc:mga00v17_574884_c1 | |||
| 2824 | nmdc:mga00v17_6495_c1 | |||
| 2825 | nmdc:mga0yw44_103044_c1 | |||
| 2826 | nmdc:mga0yw44_106706_c1 | |||
| 2827 | nmdc:mga0yw44_306043_c1 | |||
| 2828 | nmdc:mga0yw44_515124_c1 | |||
| 2829 | nmdc:mga0yw44_7451_c1 | |||
| 2830 | nmdc:mga06z11_125951_c1 | |||
| 2831 | nmdc:mga06z11_871932_c1 | |||
| 2832 | nmdc:mga07m45_625818_c1 | |||
| 2833 | nmdc:mga05p37_168329_c1 | |||
| 2834 | nmdc:mga05p37_4106_c1 | |||
| 2835 | nmdc:mga09592_20670_c1 | |||
| 2836 | nmdc:mga0qj67_115114_c1 | |||
| 2837 | nmdc:mga0qj67_4474_c1 | |||
| 2838 | nmdc:mga06r32_51858_c1 | |||
| 2839 | nmdc:mga06r32_5549_c1 | |||
| 2840 | nmdc:mga08y16_23474_c1 | |||
| 2841 | nmdc:mga0n895_24811_c1 | |||
| 2842 | nmdc:mga0rr50_14624_c1 | |||
| 2843 | nmdc:mga08x19_85717_c1 | |||
| 2844 | nmdc:mga0a205_18368_c1 | |||
| 2845 | nmdc:mga0sz30_6024_c1 | |||
| 2846 | Ga0495601_0001806 | |||
| 2847 | Ga0495601_0005598 | |||
| 2848 | Ga0495612_0008090 | |||
| 2849 | Ga0495612_0220906 | |||
| 2850 | Ga0495612_0326289 | |||
| 2851 | Ga0495655_0085274 | |||
| 2852 | Ga0495655_0195219 | |||
| 2853 | Ga0495595_0093034 | |||
| 2854 | Ga0495595_0119311 | |||
| 2855 | Ga0495619_0011061 | |||
| 2856 | Ga0495619_0133782 | |||
| 2857 | Ga0495619_0166497 | |||
| 2858 | Ga0495619_0181164 | |||
| 2859 | Ga0500566_0269698 | |||
| 2860 | Ga0500573_0026341 | |||
| 2861 | Ga0501084_0006859 | |||
| 2862 | Ga0501084_0017067 | |||
| 2863 | Ga0501084_0038500 | |||
| 2864 | Ga0501084_0069026 | |||
| 2865 | Ga0501084_0252010 | |||
| 2866 | Ga0501084_1097914 | |||
| 2867 | Ga0590075_009505 | |||
| 2868 | Ga0590077_031510 | |||
| 2869 | Ga0587084_000583 | |||
| 2870 | Ga0587070_016923 | |||
| 2871 | Ga0587070_088211 | |||
| 2872 | Ga0587077_015691 | |||
| 2873 | Ga0587082_014163 | |||
| 2874 | Ga0587083_0016325 | |||
| 2875 | Ga0587088_015149 | |||
| 2876 | Ga0587089_010078 | |||
| 2877 | Ga0587092_003462 | |||
| 2878 | Ga0587094_011500 | |||
| 2879 | Ga0587106_010468 | |||
| 2880 | Ga0587106_011255 | |||
| 2881 | Ga0587129_002032 | |||
| 2882 | Ga0587099_003208 | |||
| 2883 | Ga0587101_000649 | |||
| 2884 | Ga0587109_021552 | |||
| 2885 | Ga0587115_001523 | |||
| 2886 | Ga0587117_009121 | |||
| 2887 | Ga0587122_003478 | |||
| 2888 | Ga0587122_006539 | |||
| 2889 | Ga0587128_030836 | |||
| 2890 | Ga0587069_012198 | |||
| 2891 | Ga0587072_054887 | |||
| 2892 | Ga0587100_002541 | |||
| 2893 | Ga0587110_018867 | |||
| 2894 | Ga0587119_001968 | |||
| 2895 | Ga0587124_003438 | |||
| 2896 | Ga0587111_0002409 | |||
| 2897 | Ga0501082_0005074 | |||
| 2898 | Ga0501082_0053946 | |||
| 2899 | Ga0501082_0070496 | |||
| 2900 | Ga0501082_0103067 | |||
| 2901 | Ga0501082_0362276 | |||
| 2902 | Ga0501082_0472208 | |||
| 2903 | Ga0501082_0969902 | |||
| 2904 | Ga0466962_0010205 | |||
| 2905 | Ga0466962_0032219 | |||
| 2906 | Ga0466962_0063964 | |||
| 2907 | Ga0466962_0066884 | |||
| 2908 | Ga0466962_0317566 | |||
| 2909 | Ga0466962_0341716 | |||
| 2910 | Ga0466962_0373690 | |||
| 2911 | Ga0530510_0018929 | |||
| 2912 | Ga0530510_0037945 | |||
| 2913 | Ga0530510_0060257 | |||
| 2914 | Ga0530510_0402199 | |||
| 2915 | Ga0530510_0762549 | |||
| 2916 | 2643734775 | |||
| 2917 | 2643768589 | |||
| 2918 | 2643847815 | |||
| 2919 | 2643851144 | |||
| 2920 | 2643888167 | |||
| 2921 | 2644134933 | |||
| 2922 | 2644172935 | |||
| 2923 | 2644197876 | |||
| 2924 | 2644502872 | |||
| 2925 | 2644525232 | |||
| 2926 | 2644669320 | |||
| 2927 | 2676476355 | |||
| 2928 | 2723643124 | |||
| 2929 | 2739607397 | |||
| 2930 | 2747951865 | |||
| 2931 | 2760304695 | |||
| 2932 | 2809026277 | |||
| 2933 | 2809226479 | |||
| 2934 | 2810363380 | |||
| 2935 | 2812364396 | |||
| 2936 | 2812373752 | |||
| 2937 | 2816421112 | |||
| 2938 | 2819665408 | |||
| 2939 | 2819691388 | |||
| 2940 | 2819727576 | |||
| 2941 | 2827632163 | |||
| 2942 | 2848553212 | |||
| 2943 | 2852632730 | |||
| 2944 | 2852648356 | |||
| 2945 | 2852665910 | |||
| 2946 | 2852678607 | |||
| 2947 | 2857712608 | |||
| 2948 | 2857722324 | |||
| 2949 | 2857724603 | |||
| 2950 | 2857730635 | |||
| 2951 | 2862993602 | |||
| 2952 | 2883823179 | |||
| 2953 | 2887444587 | |||
| 2954 | 2893685172 | |||
| 2955 | 2897562451 | |||
| 2956 | 2905927996 | |||
| 2957 | 2919397727 | |||
| 2958 | 2928090913 | |||
| 2959 | 2928121441 | |||
| 2960 | 2946005578 | |||
| 2961 | 2946034818 | |||
| 2962 | 2946081869 | |||
| 2963 | 2984577126 | |||
| 2964 | 2984582345 | |||
| 2965 | 2984592263 | |||
| 2966 | 2990260447 | |||
| 2967 | 2995728382 | |||
| 2968 | 3001890625 | |||
| 2969 | 8004021569 | |||
| 2970 | 8004028569 | |||
| 2971 | 8004183484 | |||
| 2972 | 8055035331 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8d8k-assembly1.cif.gz_I | yeast mitochondrial small subunit assembly intermediate (state 2) | 0.9723 | 34 | 139 |
| 8d8l-assembly1.cif.gz_I | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9716 | 34 | 139 |
| 4v48-assembly1.cif.gz_BI | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9628 | 35 | 133 |
| 8csu-assembly1.cif.gz_G | human mitochondrial small subunit assembly intermediate (state c*) | 0.9537 | 36 | 143 |
| 6osi-assembly1.cif.gz_QI | unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) | 0.9493 | 33 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54CK4_214_339_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9835 | 35 | 139 | 3.30.230.10 |
| af_Q8IHZ4_170_300_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9694 | 34 | 139 | 3.30.230.10 |
| af_Q8SXF0_266_395_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9314 | 33 | 139 | 3.30.230.10 |
| af_P34388_249_392_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9247 | 33 | 139 | 3.30.230.10 |
| af_Q4DEW9_314_445_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9058 | 42 | 139 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8NBD5-F1-model_v4 | deleted | 1.001 | 37 | 116 |
|
| AF-A0A537LS56-F1-model_v4 | 30S ribosomal protein S9 | 0.9935 | 35 | 121 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A7J7NB59-F1-model_v4 | 30S ribosomal protein S9 | 0.9922 | 36 | 103 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A6V7PQR4-F1-model_v4 | 30S ribosomal protein S9 | 0.9878 | 34 | 140 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A7S0MG20-F1-model_v4 | 30S ribosomal protein S9, chloroplastic | 0.9872 | 34 | 139 |
GO:0003723
GO:0003735 GO:0005763 GO:0006412 |