F494308

General Info

Members Datasets Scaffolds Average Seq Length
1486 537 2972 168

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0409793|Ga0436364_0409793_2150_2686
Length 161
Sequence VADPTEAAKPAAEGSPADGPAGGAARPSRKPVVTGNGMGTGRRKEAIARVRIMPGTGKWQINERSLDEYFPNKVHQQLINEPFVTLGAEDSFDVVARITGGGVTGQAGALRLGLARALILVDPDSRSSLKRSGFLTRDARIKERKKAGLKKARKAPQYSKR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
123 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
124 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
125 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
126 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
127 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
128 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
149 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
219 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
220 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
238 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
239 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
240 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
251 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
255 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
256 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
257 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
258 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
264 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
267 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
268 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
269 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
270 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
271 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
272 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
273 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
282 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
283 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
328 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
329 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
340 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
378 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
416 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
417 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
418 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
419 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
432 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
433 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
434 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
435 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
436 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
437 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
438 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
439 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
440 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
441 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
442 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
445 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
446 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
447 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
448 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
449 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
452 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
453 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
480 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
481 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
482 2643221549 Agromyces sp. Root1464 Isolate Unclassified
483 2643221566 Microbacterium sp. Root166 Isolate Unclassified
484 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
485 2643221575 Microbacterium sp. Root61 Isolate Unclassified
486 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
487 2643221630 Microbacterium sp. Root322 Isolate Unclassified
488 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
489 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
490 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
491 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
492 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
493 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
494 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
495 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
496 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
497 2808606394 Promicromonospora sp. C35 Isolate Unclassified
498 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
499 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
500 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
501 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
502 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
503 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
504 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
505 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
506 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
507 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
508 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
509 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
510 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
511 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
512 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
513 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
514 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
515 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
516 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
517 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
518 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
519 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
520 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
521 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
522 2919395869 Microbacterium resistens 2980 Isolate Unclassified
523 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
524 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
525 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
526 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
527 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
528 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
529 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
530 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
531 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
532 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
533 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
534 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
535 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
536 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
537 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.75
Metatranscriptomes 15.41
Isolates 3.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 6.46
Rhizosphere 85.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0409793 3300037853 Bacteria 2978
2 JGI24740J21852_10019807 3300001979 Bacteria 2362
3 JGI24737J22298_10003968 3300001990 Bacteria 5182
4 JGI24735J21928_10075146 3300002067 Bacteria 967
5 JGI24735J21928_10156563 3300002067 Bacteria 658
6 JGI24738J21930_10002435 3300002075 Bacteria 4875
7 JGI24738J21930_10015599 3300002075 Bacteria 1614
8 JGI24749J21850_1012752 3300002076 Bacteria 1180
9 JGI24744J21845_10004165 3300002077 Bacteria 2981
10 JGI24034J26672_10007871 3300002239 Bacteria 1551
11 JGI24742J22300_10015362 3300002244 Bacteria 1288
12 JGI25154J39366_1001966 3300002738 Bacteria 6055
13 Ga0006778J45830_1011174 3300003162 Bacteria 1341
14 Ga0006759J45824_1013878 3300003163 Bacteria 1633
15 Ga0006759J45824_1025628 3300003163 Bacteria 1233
16 Ga0006777J48905_1019716 3300003308 Bacteria 1194
17 Ga0006777J48905_1020582 3300003308 Bacteria 1664
18 Ga0007417J51691_1011871 3300003544 Bacteria 1313
19 Ga0007427J51700_103286 3300003559 Bacteria 2485
20 Ga0006781J51513_1007583 3300003568 Bacteria 1850
21 Ga0006781J51513_1013434 3300003568 Bacteria 884
22 Ga0007410J51695_1015311 3300003574 Bacteria 1231
23 Ga0007409J51694_1017714 3300003575 Bacteria 1187
24 Ga0007409J51694_1018137 3300003575 Bacteria 1562
25 Ga0007429J51699_1011248 3300003579 Bacteria 1777
26 Ga0007429J51699_1016355 3300003579 Bacteria 1394
27 Ga0007429J51699_1027302 3300003579 Bacteria 1130
28 Ga0007429J51699_1030497 3300003579 Bacteria 1142
29 Ga0032354_1006492 3300003693 Bacteria 1209
30 Ga0032354_1009879 3300003693 Bacteria 2752
31 Ga0006780_1004588 3300003735 Bacteria 1234
32 Ga0006780_1006617 3300003735 Bacteria 1162
33 Ga0058858_1425716 3300004785 Bacteria 812
34 Ga0058861_10101139 3300004800 Bacteria 1143
35 Ga0070658_10356842 3300005327 Bacteria 1252
36 Ga0070676_10333614 3300005328 Bacteria 1038
37 Ga0070683_100027696 3300005329 Bacteria 5113
38 Ga0070683_100061434 3300005329 Bacteria 3494
39 Ga0070683_100154117 3300005329 Bacteria 2179
40 Ga0070683_100786439 3300005329 Bacteria 912
41 Ga0070690_100153667 3300005330 Bacteria 1572
42 Ga0070670_100327695 3300005331 Bacteria 1342
43 Ga0068869_100085285 3300005334 Bacteria 2365
44 Ga0070682_100005854 3300005337 Bacteria 6869
45 Ga0070682_100076528 3300005337 Bacteria 2154
46 Ga0070682_100078918 3300005337 Bacteria 2125
47 Ga0070682_100091754 3300005337 Bacteria 1989
48 Ga0070682_100121266 3300005337 Bacteria 1756
49 Ga0070682_100272134 3300005337 Bacteria 1231
50 Ga0070682_100471955 3300005337 Bacteria 966
51 Ga0068868_100328938 3300005338 Bacteria 1304
52 Ga0068868_100410141 3300005338 Bacteria 1171
53 Ga0070660_100011189 3300005339 Bacteria 6367
54 Ga0070660_100092118 3300005339 Bacteria 2392
55 Ga0070660_100127673 3300005339 Bacteria 2033
56 Ga0070660_100767913 3300005339 Bacteria 810
57 Ga0070687_100005482 3300005343 Bacteria 5141
58 Ga0070661_100041418 3300005344 Bacteria 3361
59 Ga0070692_10007791 3300005345 Bacteria 4744
60 Ga0070692_10236474 3300005345 Bacteria 1087
61 Ga0070668_100015860 3300005347 Bacteria 5636
62 Ga0070668_100028853 3300005347 Bacteria 4211
63 Ga0070668_100039258 3300005347 Bacteria 3621
64 Ga0070668_100124061 3300005347 Bacteria 2067
65 Ga0070668_100172522 3300005347 Bacteria 1762
66 Ga0070668_100314145 3300005347 Bacteria 1317
67 Ga0070668_100383429 3300005347 Bacteria 1197
68 Ga0070669_100237787 3300005353 Bacteria 1446
69 Ga0070675_100125997 3300005354 Bacteria 2179
70 Ga0070675_100506081 3300005354 Bacteria 1089
71 Ga0070671_100267938 3300005355 Bacteria 1452
72 Ga0070671_100704674 3300005355 Bacteria 876
73 Ga0070674_100031514 3300005356 Bacteria 3513
74 Ga0070674_100039323 3300005356 Bacteria 3193
75 Ga0070674_100046760 3300005356 Bacteria 2963
76 Ga0070674_100176996 3300005356 Bacteria 1631
77 Ga0070674_100186605 3300005356 Bacteria 1592
78 Ga0070674_100482961 3300005356 Bacteria 1029
79 Ga0070673_100049892 3300005364 Bacteria 3269
80 Ga0070673_101004101 3300005364 Bacteria 777
81 Ga0070688_100220705 3300005365 Bacteria 1336
82 Ga0070659_100036950 3300005366 Bacteria 3807
83 Ga0070659_100046370 3300005366 Bacteria 3407
84 Ga0070659_100072440 3300005366 Bacteria 2741
85 Ga0070659_100090530 3300005366 Bacteria 2452
86 Ga0070659_100286114 3300005366 Bacteria 1372
87 Ga0070667_100046939 3300005367 Bacteria 3634
88 Ga0070667_100217798 3300005367 Bacteria 1698
89 Ga0070667_100955330 3300005367 Bacteria 799
90 Ga0070714_100817971 3300005435 Bacteria 903
91 Ga0070701_10009437 3300005438 Bacteria 4274
92 Ga0070711_100848749 3300005439 Bacteria 777
93 Ga0070705_100013603 3300005440 Bacteria 4166
94 Ga0070700_100022153 3300005441 Bacteria 3701
95 Ga0070700_100074865 3300005441 Bacteria 2171
96 Ga0070700_100224108 3300005441 Bacteria 1334
97 Ga0070700_100258115 3300005441 Bacteria 1254
98 Ga0070663_100050083 3300005455 Bacteria 2969
99 Ga0070663_100167443 3300005455 Bacteria 1696
100 Ga0070663_100180785 3300005455 Bacteria 1636
101 Ga0070663_100205322 3300005455 Bacteria 1540
102 Ga0070663_100291292 3300005455 Bacteria 1304
103 Ga0070663_100295605 3300005455 Bacteria 1295
104 Ga0070678_100068714 3300005456 Bacteria 2642
105 Ga0070678_100224560 3300005456 Bacteria 1562
106 Ga0070678_100245588 3300005456 Bacteria 1499
107 Ga0070678_100357447 3300005456 Bacteria 1257
108 Ga0070678_100762382 3300005456 Bacteria 876
109 Ga0070678_101273192 3300005456 Bacteria 684
110 Ga0070662_100121384 3300005457 Bacteria 2003
111 Ga0070662_100131554 3300005457 Bacteria 1930
112 Ga0070681_10189399 3300005458 Bacteria 1977
113 Ga0070681_10341204 3300005458 Bacteria 1408
114 Ga0070681_10782795 3300005458 Bacteria 871
115 Ga0068867_100000784 3300005459 Bacteria 21484
116 Ga0068867_100117960 3300005459 Bacteria 2047
117 Ga0068867_100724788 3300005459 Bacteria 880
118 Ga0070685_10037258 3300005466 Bacteria 2754
119 Ga0070685_10038115 3300005466 Bacteria 2725
120 Ga0070685_10122794 3300005466 Bacteria 1615
121 Ga0070706_100899683 3300005467 Bacteria 818
122 Ga0070698_100010346 3300005471 Bacteria 9960
123 Ga0070679_100284160 3300005530 Bacteria 1607
124 Ga0070679_101277657 3300005530 Bacteria 679
125 Ga0070684_100002313 3300005535 Bacteria 14044
126 Ga0070684_100096172 3300005535 Bacteria 2640
127 Ga0070684_100108463 3300005535 Bacteria 2487
128 Ga0070684_100209837 3300005535 Bacteria 1775
129 Ga0070684_100299370 3300005535 Bacteria 1476
130 Ga0070684_100303011 3300005535 Bacteria 1466
131 Ga0070684_100315931 3300005535 Bacteria 1435
132 Ga0068853_100073776 3300005539 Bacteria 2976
133 Ga0068853_100112874 3300005539 Bacteria 2415
134 Ga0068853_100141854 3300005539 Bacteria 2157
135 Ga0068853_100193957 3300005539 Bacteria 1846
136 Ga0068853_100451793 3300005539 Bacteria 1209
137 Ga0070672_100021433 3300005543 Bacteria 4728
138 Ga0070672_100066444 3300005543 Bacteria 2856
139 Ga0070672_100457835 3300005543 Bacteria 1099
140 Ga0070672_101211483 3300005543 Bacteria 673
141 Ga0070686_100024753 3300005544 Bacteria 3601
142 Ga0070686_100211952 3300005544 Bacteria 1395
143 Ga0070696_100007791 3300005546 Bacteria 7147
144 Ga0070696_100077230 3300005546 Bacteria 2353
145 Ga0070693_100027117 3300005547 Bacteria 3100
146 Ga0070693_100753762 3300005547 Bacteria 718
147 Ga0070665_100011936 3300005548 Bacteria 8774
148 Ga0070665_100243480 3300005548 Bacteria 1799
149 Ga0068855_100043083 3300005563 Bacteria 5348
150 Ga0068855_100341815 3300005563 Bacteria 1650
151 Ga0068855_100381020 3300005563 Bacteria 1549
152 Ga0068855_100712583 3300005563 Bacteria 1073
153 Ga0070664_100108586 3300005564 Bacteria 2420
154 Ga0070664_100534720 3300005564 Bacteria 1083
155 Ga0070664_101065513 3300005564 Bacteria 761
156 Ga0068857_100008605 3300005577 Bacteria 8830
157 Ga0068857_100577588 3300005577 Bacteria 1061
158 Ga0068857_100973544 3300005577 Bacteria 816
159 Ga0068854_100003214 3300005578 Bacteria 10192
160 Ga0068854_100179576 3300005578 Bacteria 1653
161 Ga0068854_100376948 3300005578 Bacteria 1168
162 Ga0068854_100469773 3300005578 Bacteria 1054
163 Ga0068854_100839667 3300005578 Bacteria 803
164 Ga0068856_100031115 3300005614 Bacteria 5220
165 Ga0068856_100133674 3300005614 Bacteria 2486
166 Ga0068856_100372162 3300005614 Bacteria 1448
167 Ga0070702_100000198 3300005615 Bacteria 19583
168 Ga0070702_100000960 3300005615 Bacteria 11338
169 Ga0070702_100027425 3300005615 Bacteria 3073
170 Ga0070702_100097787 3300005615 Bacteria 1794
171 Ga0070702_100315689 3300005615 Bacteria 1087
172 Ga0070702_100448041 3300005615 Bacteria 936
173 Ga0070702_100515872 3300005615 Bacteria 881
174 Ga0068852_100040899 3300005616 Bacteria 3915
175 Ga0068852_100219994 3300005616 Bacteria 1805
176 Ga0068852_100287987 3300005616 Bacteria 1586
177 Ga0068852_100924795 3300005616 Bacteria 890
178 Ga0068859_100771629 3300005617 Bacteria 1050
179 Ga0068859_101408252 3300005617 Bacteria 769
180 Ga0068859_101497231 3300005617 Bacteria 745
181 Ga0068864_100129089 3300005618 Bacteria 2269
182 Ga0068864_100365270 3300005618 Bacteria 1365
183 Ga0068864_101036297 3300005618 Bacteria 815
184 Ga0068866_10065526 3300005718 Bacteria 1900
185 Ga0068861_100003392 3300005719 Bacteria 10570
186 Ga0068861_100113242 3300005719 Bacteria 2176
187 Ga0068861_100147499 3300005719 Bacteria 1927
188 Ga0068861_100182599 3300005719 Bacteria 1747
189 Ga0068861_100822369 3300005719 Bacteria 873
190 Ga0068851_10193429 3300005834 Bacteria 1132
191 Ga0068851_10329431 3300005834 Bacteria 884
192 Ga0068870_10308961 3300005840 Bacteria 1001
193 Ga0068863_100472924 3300005841 Bacteria 1232
194 Ga0068858_100589602 3300005842 Bacteria 1078
195 Ga0068860_100161079 3300005843 Bacteria 2163
196 Ga0068860_100169410 3300005843 Bacteria 2109
197 Ga0068860_100219702 3300005843 Bacteria 1845
198 Ga0068860_100435859 3300005843 Bacteria 1301
199 Ga0068862_100442512 3300005844 Bacteria 1224
200 Ga0081455_10010056 3300005937 Bacteria 9658
201 Ga0081455_10128516 3300005937 Bacteria 1985
202 Ga0081455_10451870 3300005937 Bacteria 877
203 Ga0081538_10000264 3300005981 Bacteria 59881
204 Ga0081540_1130051 3300005983 Bacteria 1030
205 Ga0081539_10000238 3300005985 Bacteria 129119
206 Ga0075365_10006159 3300006038 Bacteria 6567
207 Ga0075365_10013835 3300006038 Bacteria 4841
208 Ga0075365_10086841 3300006038 Bacteria 2126
209 Ga0075368_10025746 3300006042 Bacteria 2258
210 Ga0075363_100015813 3300006048 Bacteria 3716
211 Ga0075363_100111268 3300006048 Bacteria 1522
212 Ga0075363_100233350 3300006048 Bacteria 1057
213 Ga0075364_10016481 3300006051 Bacteria 4598
214 Ga0075364_10026351 3300006051 Bacteria 3708
215 Ga0075364_10110319 3300006051 Bacteria 1835
216 Ga0075364_10128675 3300006051 Bacteria 1699
217 Ga0075364_10640723 3300006051 Bacteria 726
218 Ga0075432_10007355 3300006058 Bacteria 3749
219 Ga0075362_10019347 3300006177 Bacteria 2829
220 Ga0075369_10004944 3300006186 Bacteria 4958
221 Ga0075369_10010273 3300006186 Bacteria 3658
222 Ga0075427_10002551 3300006194 Bacteria 2454
223 Ga0097621_100923509 3300006237 Bacteria 814
224 Ga0068871_101051707 3300006358 Bacteria 760
225 Ga0075428_100016246 3300006844 Bacteria 8228
226 Ga0075428_100134859 3300006844 Bacteria 2685
227 Ga0075430_100003324 3300006846 Bacteria 13479
228 Ga0075431_100002859 3300006847 Bacteria 16699
229 Ga0075431_100054108 3300006847 Bacteria 4139
230 Ga0075431_100111155 3300006847 Bacteria 2828
231 Ga0075433_10001418 3300006852 Bacteria 17655
232 Ga0075434_100049988 3300006871 Bacteria 4153
233 Ga0075429_100033963 3300006880 Bacteria 4432
234 Ga0068865_100010755 3300006881 Bacteria 5705
235 Ga0068865_100012655 3300006881 Bacteria 5317
236 Ga0068865_100025829 3300006881 Bacteria 3867
237 Ga0068865_100772450 3300006881 Bacteria 827
238 Ga0075436_100097717 3300006914 Bacteria 2043
239 Ga0097620_100771677 3300006931 Bacteria 1050
240 Ga0097620_101408410 3300006931 Bacteria 769
241 Ga0097620_101497404 3300006931 Bacteria 745
242 Ga0075435_100002572 3300007076 Bacteria 12099
243 Ga0105244_10068218 3300009036 Bacteria 1777
244 Ga0105240_10093336 3300009093 Bacteria 3674
245 Ga0111539_10022754 3300009094 Bacteria 7697
246 Ga0111539_11623467 3300009094 Bacteria 750
247 Ga0111539_11711474 3300009094 Bacteria 729
248 Ga0105245_10016704 3300009098 Bacteria 6409
249 Ga0105245_10044869 3300009098 Bacteria 3946
250 Ga0105245_10070074 3300009098 Bacteria 3181
251 Ga0105245_10218504 3300009098 Bacteria 1838
252 Ga0105245_10251582 3300009098 Bacteria 1717
253 Ga0105245_10295747 3300009098 Bacteria 1587
254 Ga0105245_10931082 3300009098 Bacteria 911
255 Ga0105245_12459744 3300009098 Bacteria 574
256 Ga0105247_10532272 3300009101 Bacteria 861
257 Ga0105247_10585039 3300009101 Bacteria 826
258 Ga0114129_10000234 3300009147 Bacteria 61922
259 Ga0114129_10016860 3300009147 Bacteria 10400
260 Ga0105243_10003243 3300009148 Bacteria 13268
261 Ga0105243_10005983 3300009148 Bacteria 9422
262 Ga0105243_10009041 3300009148 Bacteria 7609
263 Ga0105243_10011327 3300009148 Bacteria 6747
264 Ga0105243_10062730 3300009148 Bacteria 2976
265 Ga0105243_10115080 3300009148 Bacteria 2258
266 Ga0105243_10145722 3300009148 Bacteria 2026
267 Ga0105243_10580052 3300009148 Bacteria 1076
268 Ga0105243_10877187 3300009148 Bacteria 891
269 Ga0105241_10002725 3300009174 Bacteria 13233
270 Ga0105241_10911232 3300009174 Bacteria 817
271 Ga0105241_11619442 3300009174 Bacteria 627
272 Ga0105242_10037768 3300009176 Bacteria 3881
273 Ga0105242_10060234 3300009176 Bacteria 3118
274 Ga0105242_10155997 3300009176 Bacteria 1994
275 Ga0105248_10011888 3300009177 Bacteria 9604
276 Ga0105248_10284292 3300009177 Bacteria 1862
277 Ga0105237_10024920 3300009545 Bacteria 6120
278 Ga0105237_10183011 3300009545 Bacteria 2095
279 Ga0105238_10019028 3300009551 Bacteria 6994
280 Ga0105238_10062025 3300009551 Bacteria 3740
281 Ga0105238_10104550 3300009551 Bacteria 2813
282 Ga0105238_10109326 3300009551 Bacteria 2746
283 Ga0105238_10410438 3300009551 Bacteria 1348
284 Ga0105249_10006314 3300009553 Bacteria 10299
285 Ga0105249_10008124 3300009553 Bacteria 9150
286 Ga0105249_10057570 3300009553 Bacteria 3561
287 Ga0105249_10061123 3300009553 Bacteria 3457
288 Ga0105249_10138118 3300009553 Bacteria 2335
289 Ga0105249_10268781 3300009553 Bacteria 1698
290 Ga0105249_10325220 3300009553 Bacteria 1550
291 Ga0105249_10377305 3300009553 Bacteria 1443
292 Ga0105249_10379376 3300009553 Bacteria 1439
293 Ga0105249_10509387 3300009553 Bacteria 1250
294 Ga0105239_10002486 3300010375 Bacteria 23478
295 Ga0105239_10088329 3300010375 Bacteria 3418
296 Ga0105239_10095783 3300010375 Bacteria 3279
297 Ga0105239_10127383 3300010375 Bacteria 2831
298 Ga0105239_10215527 3300010375 Bacteria 2152
299 Ga0105239_10248438 3300010375 Bacteria 1998
300 Ga0105239_10296559 3300010375 Bacteria 1820
301 Ga0105239_10325033 3300010375 Bacteria 1735
302 Ga0105239_10584119 3300010375 Bacteria 1274
303 Ga0105239_11127023 3300010375 Bacteria 903
304 Ga0105246_10000375 3300011119 Bacteria 23857
305 Ga0105246_10072522 3300011119 Bacteria 2428
306 Ga0105246_10094043 3300011119 Bacteria 2167
307 Ga0105246_10299301 3300011119 Bacteria 1298
308 Ga0105246_10465319 3300011119 Bacteria 1066
309 Ga0105246_10952920 3300011119 Bacteria 774
310 Ga0157325_1004475 3300012485 Bacteria 821
311 Ga0157321_1000406 3300012487 Bacteria 1953
312 Ga0157343_1008122 3300012488 Bacteria 748
313 Ga0157319_1004623 3300012497 Bacteria 912
314 Ga0157347_1003844 3300012502 Bacteria 1369
315 Ga0157313_1011957 3300012503 Bacteria 763
316 Ga0157342_1010297 3300012507 Bacteria 954
317 Ga0157373_10533853 3300013100 Bacteria 849
318 Ga0157371_10019390 3300013102 Bacteria 5017
319 Ga0157371_10079223 3300013102 Bacteria 2327
320 Ga0157371_10573597 3300013102 Bacteria 838
321 Ga0157370_10004788 3300013104 Bacteria 15386
322 Ga0157370_10006538 3300013104 Bacteria 12835
323 Ga0157370_10095226 3300013104 Bacteria 2793
324 Ga0157370_10355780 3300013104 Bacteria 1349
325 Ga0157370_10427220 3300013104 Bacteria 1219
326 Ga0157370_11139210 3300013104 Bacteria 704
327 Ga0157369_10010161 3300013105 Bacteria 10742
328 Ga0157369_10016634 3300013105 Bacteria 8270
329 Ga0157369_10105060 3300013105 Bacteria 3007
330 Ga0157369_10108064 3300013105 Bacteria 2959
331 Ga0157369_10272260 3300013105 Bacteria 1764
332 Ga0157369_10364067 3300013105 Bacteria 1501
333 Ga0157369_10408981 3300013105 Bacteria 1407
334 Ga0157369_10466027 3300013105 Bacteria 1308
335 Ga0157369_10590908 3300013105 Bacteria 1146
336 Ga0157369_10732029 3300013105 Bacteria 1018
337 Ga0157369_11191472 3300013105 Bacteria 777
338 Ga0157374_10475851 3300013296 Bacteria 1252
339 Ga0157378_10014969 3300013297 Bacteria 6792
340 Ga0163162_10092421 3300013306 Bacteria 3109
341 Ga0163162_10273040 3300013306 Bacteria 1823
342 Ga0163162_10380119 3300013306 Bacteria 1545
343 Ga0157372_10025059 3300013307 Bacteria 6482
344 Ga0157372_10057267 3300013307 Bacteria 4356
345 Ga0157372_10058284 3300013307 Bacteria 4316
346 Ga0157372_10094943 3300013307 Bacteria 3397
347 Ga0157372_10097076 3300013307 Bacteria 3360
348 Ga0157372_10114562 3300013307 Bacteria 3090
349 Ga0157372_10630238 3300013307 Bacteria 1249
350 Ga0157372_11321908 3300013307 Bacteria 832
351 Ga0157375_10026944 3300013308 Bacteria 5365
352 Ga0157375_10038724 3300013308 Bacteria 4580
353 Ga0157375_10079957 3300013308 Bacteria 3306
354 Ga0157375_10321322 3300013308 Bacteria 1712
355 Ga0157375_10385433 3300013308 Bacteria 1568
356 Ga0157375_10557045 3300013308 Bacteria 1308
357 Ga0157375_12297000 3300013308 Bacteria 643
358 Ga0163163_10030515 3300014325 Bacteria 5195
359 Ga0163163_10071780 3300014325 Bacteria 3451
360 Ga0163163_10185290 3300014325 Bacteria 2129
361 Ga0163163_10344432 3300014325 Bacteria 1546
362 Ga0163163_10394324 3300014325 Bacteria 1442
363 Ga0163163_10538988 3300014325 Bacteria 1229
364 Ga0157380_10015279 3300014326 Bacteria 5640
365 Ga0157380_10025399 3300014326 Bacteria 4493
366 Ga0157380_10220676 3300014326 Bacteria 1696
367 Ga0157380_10844187 3300014326 Bacteria 937
368 Ga0157380_11924008 3300014326 Bacteria 652
369 Ga0182008_10292172 3300014497 Bacteria 851
370 Ga0157377_10102324 3300014745 Bacteria 1709
371 Ga0157377_10172050 3300014745 Bacteria 1355
372 Ga0157377_10393549 3300014745 Bacteria 942
373 Ga0157377_10565305 3300014745 Bacteria 806
374 Ga0157379_10184052 3300014968 Bacteria 1887
375 Ga0157376_10465676 3300014969 Bacteria 1236
376 Ga0163161_10011013 3300017792 Bacteria 6266
377 Ga0163161_10020151 3300017792 Bacteria 4678
378 Ga0163161_10020682 3300017792 Bacteria 4621
379 Ga0163161_10098912 3300017792 Bacteria 2169
380 Ga0163161_10135758 3300017792 Bacteria 1859
381 Ga0163161_10193138 3300017792 Bacteria 1566
382 Ga0163161_10242480 3300017792 Bacteria 1402
383 Ga0163161_10314183 3300017792 Bacteria 1237
384 Ga0163161_10372918 3300017792 Bacteria 1139
385 Ga0197907_10126050 3300020069 Bacteria 1238
386 Ga0197907_10461269 3300020069 Bacteria 1795
387 Ga0197907_10816215 3300020069 Bacteria 1369
388 Ga0197907_10855188 3300020069 Bacteria 1139
389 Ga0197907_11033948 3300020069 Bacteria 818
390 Ga0206356_10575752 3300020070 Bacteria 1301
391 Ga0206356_11501797 3300020070 Bacteria 1252
392 Ga0206356_11683455 3300020070 Bacteria 1063
393 Ga0206349_1102446 3300020075 Bacteria 1404
394 Ga0206349_1236471 3300020075 Bacteria 1054
395 Ga0206349_1261242 3300020075 Bacteria 1091
396 Ga0206349_1263143 3300020075 Bacteria 1276
397 Ga0206349_1363221 3300020075 Bacteria 1179
398 Ga0206349_1695142 3300020075 Bacteria 701
399 Ga0206349_1741347 3300020075 Bacteria 1123
400 Ga0206349_1983558 3300020075 Bacteria 1454
401 Ga0206355_1045293 3300020076 Bacteria 1193
402 Ga0206355_1051652 3300020076 Bacteria 1216
403 Ga0206355_1375645 3300020076 Bacteria 1164
404 Ga0206351_10765091 3300020077 Bacteria 1080
405 Ga0206351_10824243 3300020077 Bacteria 1080
406 Ga0206351_10837268 3300020077 Bacteria 808
407 Ga0206352_10113150 3300020078 Bacteria 1115
408 Ga0206352_10950465 3300020078 Bacteria 1229
409 Ga0206352_10992946 3300020078 Bacteria 1134
410 Ga0206352_11057851 3300020078 Bacteria 1390
411 Ga0206350_10236030 3300020080 Bacteria 767
412 Ga0206350_10280180 3300020080 Bacteria 1237
413 Ga0206350_10362633 3300020080 Bacteria 1150
414 Ga0206350_11330323 3300020080 Bacteria 1201
415 Ga0206350_11372283 3300020080 Bacteria 718
416 Ga0206350_11527026 3300020080 Bacteria 1044
417 Ga0206354_10067382 3300020081 Bacteria 1198
418 Ga0206354_10159348 3300020081 Bacteria 1061
419 Ga0206354_10260975 3300020081 Bacteria 3019
420 Ga0206354_10278352 3300020081 Bacteria 1455
421 Ga0206354_10396242 3300020081 Bacteria 923
422 Ga0206354_10724352 3300020081 Bacteria 1592
423 Ga0206354_10782475 3300020081 Bacteria 1198
424 Ga0206354_10857587 3300020081 Bacteria 739
425 Ga0206354_11184045 3300020081 Bacteria 710
426 Ga0206354_11358127 3300020081 Bacteria 1274
427 Ga0206354_11505003 3300020081 Bacteria 1646
428 Ga0206354_11524798 3300020081 Bacteria 1231
429 Ga0206354_11570982 3300020081 Bacteria 1946
430 Ga0206353_10239144 3300020082 Bacteria 1519
431 Ga0206353_10481029 3300020082 Bacteria 3049
432 Ga0206353_10875366 3300020082 Bacteria 856
433 Ga0206353_11040760 3300020082 Bacteria 1010
434 Ga0206353_11142484 3300020082 Bacteria 1279
435 Ga0206353_11211517 3300020082 Bacteria 2437
436 Ga0206353_11277739 3300020082 Bacteria 1421
437 Ga0206353_11325172 3300020082 Bacteria 1659
438 Ga0206353_11334241 3300020082 Bacteria 1313
439 Ga0206353_11377281 3300020082 Bacteria 631
440 Ga0206353_11402636 3300020082 Bacteria 1224
441 Ga0206353_11724933 3300020082 Bacteria 1293
442 Ga0154015_1274330 3300020610 Bacteria 2016
443 Ga0154015_1375022 3300020610 Bacteria 1163
444 Ga0213875_10266753 3300021388 Bacteria 808
445 Ga0224712_10077111 3300022467 Bacteria 1367
446 Ga0224712_10094614 3300022467 Bacteria 1257
447 Ga0224712_10116741 3300022467 Bacteria 1151
448 Ga0224712_10119699 3300022467 Bacteria 1139
449 Ga0209646_1000088 3300025246 Bacteria 192345
450 Ga0207697_10015594 3300025315 Bacteria 3137
451 Ga0207655_1019276 3300025728 Bacteria 3575
452 Ga0207655_1067251 3300025728 Bacteria 1350
453 Ga0207682_10088748 3300025893 Bacteria 1337
454 Ga0207682_10136850 3300025893 Bacteria 1097
455 Ga0207642_10003527 3300025899 Bacteria 4952
456 Ga0207642_10015040 3300025899 Bacteria 2873
457 Ga0207642_10286385 3300025899 Bacteria 950
458 Ga0207688_10011562 3300025901 Bacteria 4803
459 Ga0207688_10016175 3300025901 Bacteria 4045
460 Ga0207688_10016280 3300025901 Bacteria 4032
461 Ga0207688_10077374 3300025901 Bacteria 1896
462 Ga0207688_10101446 3300025901 Bacteria 1662
463 Ga0207688_10133551 3300025901 Bacteria 1456
464 Ga0207688_10160278 3300025901 Bacteria 1333
465 Ga0207688_10165895 3300025901 Bacteria 1311
466 Ga0207688_10334118 3300025901 Bacteria 931
467 Ga0207647_10002961 3300025904 Bacteria 12781
468 Ga0207647_10020382 3300025904 Bacteria 4447
469 Ga0207647_10037728 3300025904 Bacteria 3061
470 Ga0207647_10192684 3300025904 Bacteria 1181
471 Ga0207647_10329880 3300025904 Bacteria 866
472 Ga0207645_10149934 3300025907 Bacteria 1522
473 Ga0207643_10027402 3300025908 Bacteria 3159
474 Ga0207643_10287967 3300025908 Bacteria 1020
475 Ga0207643_10385005 3300025908 Bacteria 885
476 Ga0207705_10000001 3300025909 Bacteria 2061880
477 Ga0207705_10324895 3300025909 Bacteria 1183
478 Ga0207684_10392112 3300025910 Bacteria 1194
479 Ga0207654_10536722 3300025911 Bacteria 829
480 Ga0207707_10269891 3300025912 Bacteria 1474
481 Ga0207707_10619305 3300025912 Bacteria 915
482 Ga0207695_10000465 3300025913 Bacteria 87928
483 Ga0207671_10000128 3300025914 Bacteria 117836
484 Ga0207671_10274193 3300025914 Bacteria 1329
485 Ga0207660_10257186 3300025917 Bacteria 1380
486 Ga0207662_10039062 3300025918 Bacteria 2783
487 Ga0207662_10589718 3300025918 Bacteria 772
488 Ga0207662_10765588 3300025918 Bacteria 679
489 Ga0207657_10049317 3300025919 Bacteria 3670
490 Ga0207657_10059784 3300025919 Bacteria 3272
491 Ga0207657_10125259 3300025919 Bacteria 2110
492 Ga0207657_10161338 3300025919 Bacteria 1821
493 Ga0207657_10368056 3300025919 Bacteria 1132
494 Ga0207649_10045895 3300025920 Bacteria 2681
495 Ga0207649_10897042 3300025920 Bacteria 695
496 Ga0207652_10205613 3300025921 Bacteria 1772
497 Ga0207652_10680977 3300025921 Bacteria 918
498 Ga0207652_10826294 3300025921 Bacteria 822
499 Ga0207681_10197991 3300025923 Bacteria 1541
500 Ga0207694_10002060 3300025924 Bacteria 16621
501 Ga0207694_10067314 3300025924 Bacteria 2796
502 Ga0207694_10110758 3300025924 Bacteria 2184
503 Ga0207694_10210072 3300025924 Bacteria 1585
504 Ga0207694_10224432 3300025924 Bacteria 1533
505 Ga0207694_10367392 3300025924 Bacteria 1193
506 Ga0207659_10114978 3300025926 Bacteria 2052
507 Ga0207659_10235885 3300025926 Bacteria 1478
508 Ga0207659_10257645 3300025926 Bacteria 1418
509 Ga0207659_11393469 3300025926 Bacteria 601
510 Ga0207687_10042556 3300025927 Bacteria 3126
511 Ga0207687_10095826 3300025927 Bacteria 2174
512 Ga0207687_10167381 3300025927 Bacteria 1692
513 Ga0207687_10290339 3300025927 Bacteria 1314
514 Ga0207687_10342592 3300025927 Bacteria 1216
515 Ga0207644_10290383 3300025931 Bacteria 1315
516 Ga0207690_10016816 3300025932 Bacteria 4457
517 Ga0207690_10031073 3300025932 Bacteria 3414
518 Ga0207690_10053882 3300025932 Bacteria 2701
519 Ga0207690_10340464 3300025932 Bacteria 1184
520 Ga0207690_10411309 3300025932 Bacteria 1080
521 Ga0207690_10479034 3300025932 Bacteria 1004
522 Ga0207690_10569851 3300025932 Bacteria 922
523 Ga0207706_10054631 3300025933 Bacteria 3524
524 Ga0207706_10287587 3300025933 Bacteria 1433
525 Ga0207706_10302366 3300025933 Bacteria 1394
526 Ga0207686_10022157 3300025934 Bacteria 3656
527 Ga0207686_10059204 3300025934 Bacteria 2419
528 Ga0207686_10369569 3300025934 Bacteria 1085
529 Ga0207709_10012343 3300025935 Bacteria 4708
530 Ga0207709_10018638 3300025935 Bacteria 3890
531 Ga0207709_10051293 3300025935 Bacteria 2528
532 Ga0207709_10070878 3300025935 Bacteria 2211
533 Ga0207709_10243460 3300025935 Bacteria 1310
534 Ga0207709_10253947 3300025935 Bacteria 1286
535 Ga0207709_10265417 3300025935 Bacteria 1261
536 Ga0207709_10927835 3300025935 Bacteria 709
537 Ga0207670_10071964 3300025936 Bacteria 2392
538 Ga0207670_10258098 3300025936 Bacteria 1350
539 Ga0207669_10045971 3300025937 Bacteria 2576
540 Ga0207669_10126333 3300025937 Bacteria 1748
541 Ga0207669_10204167 3300025937 Bacteria 1437
542 Ga0207669_10401292 3300025937 Bacteria 1074
543 Ga0207669_10941574 3300025937 Bacteria 723
544 Ga0207704_10007836 3300025938 Bacteria 5068
545 Ga0207704_10081281 3300025938 Bacteria 2095
546 Ga0207704_10091887 3300025938 Bacteria 1996
547 Ga0207704_10351830 3300025938 Bacteria 1147
548 Ga0207704_10773470 3300025938 Bacteria 800
549 Ga0207691_10008019 3300025940 Bacteria 10151
550 Ga0207711_10072369 3300025941 Bacteria 2995
551 Ga0207711_10076921 3300025941 Bacteria 2908
552 Ga0207711_10960028 3300025941 Bacteria 794
553 Ga0207689_10017470 3300025942 Bacteria 6070
554 Ga0207661_10001526 3300025944 Bacteria 15727
555 Ga0207661_10030791 3300025944 Bacteria 4137
556 Ga0207661_10039725 3300025944 Bacteria 3695
557 Ga0207661_10052916 3300025944 Bacteria 3246
558 Ga0207661_10081977 3300025944 Bacteria 2666
559 Ga0207661_10120502 3300025944 Bacteria 2233
560 Ga0207661_10181137 3300025944 Bacteria 1841
561 Ga0207679_10036798 3300025945 Bacteria 3474
562 Ga0207679_10317579 3300025945 Bacteria 1348
563 Ga0207679_10534095 3300025945 Bacteria 1050
564 Ga0207679_10802425 3300025945 Bacteria 858
565 Ga0207679_10948305 3300025945 Bacteria 788
566 Ga0207667_10012609 3300025949 Bacteria 9718
567 Ga0207667_10129929 3300025949 Bacteria 2594
568 Ga0207667_10359093 3300025949 Bacteria 1486
569 Ga0207667_10639209 3300025949 Bacteria 1070
570 Ga0207651_10010408 3300025960 Bacteria 5156
571 Ga0207712_10057085 3300025961 Bacteria 2753
572 Ga0207712_10116575 3300025961 Bacteria 2013
573 Ga0207712_10220021 3300025961 Bacteria 1517
574 Ga0207712_10466744 3300025961 Bacteria 1073
575 Ga0207712_10535551 3300025961 Bacteria 1006
576 Ga0207712_11062860 3300025961 Bacteria 720
577 Ga0207712_11195608 3300025961 Bacteria 678
578 Ga0207668_10118889 3300025972 Bacteria 1997
579 Ga0207668_10123305 3300025972 Bacteria 1966
580 Ga0207668_10606280 3300025972 Bacteria 954
581 Ga0207668_10834844 3300025972 Bacteria 817
582 Ga0207640_10005084 3300025981 Bacteria 7154
583 Ga0207640_10156829 3300025981 Bacteria 1679
584 Ga0207640_10342266 3300025981 Bacteria 1198
585 Ga0207640_10680714 3300025981 Bacteria 880
586 Ga0207640_10827943 3300025981 Bacteria 804
587 Ga0207658_10063520 3300025986 Bacteria 2767
588 Ga0207658_10469078 3300025986 Bacteria 1117
589 Ga0207658_11011336 3300025986 Bacteria 758
590 Ga0207677_10098967 3300026023 Bacteria 2140
591 Ga0207677_10253451 3300026023 Bacteria 1431
592 Ga0207677_10810763 3300026023 Bacteria 839
593 Ga0207677_10923858 3300026023 Bacteria 788
594 Ga0207639_10035824 3300026041 Bacteria 3674
595 Ga0207639_10062063 3300026041 Bacteria 2888
596 Ga0207639_10062509 3300026041 Bacteria 2880
597 Ga0207639_10257158 3300026041 Bacteria 1525
598 Ga0207639_10557672 3300026041 Bacteria 1052
599 Ga0207639_10614819 3300026041 Bacteria 1003
600 Ga0207678_10045508 3300026067 Bacteria 3795
601 Ga0207678_10069737 3300026067 Bacteria 3014
602 Ga0207678_10224531 3300026067 Bacteria 1608
603 Ga0207678_10544054 3300026067 Bacteria 1015
604 Ga0207708_10001069 3300026075 Bacteria 20541
605 Ga0207708_10122988 3300026075 Bacteria 2023
606 Ga0207708_10630564 3300026075 Bacteria 911
607 Ga0207708_10644253 3300026075 Bacteria 901
608 Ga0207708_10696383 3300026075 Bacteria 868
609 Ga0207702_10085444 3300026078 Bacteria 2750
610 Ga0207702_10581606 3300026078 Bacteria 1098
611 Ga0207702_11103980 3300026078 Bacteria 787
612 Ga0207702_11277392 3300026078 Bacteria 728
613 Ga0207641_10858749 3300026088 Bacteria 900
614 Ga0207648_10185813 3300026089 Bacteria 1841
615 Ga0207676_10095535 3300026095 Bacteria 2451
616 Ga0207676_11708079 3300026095 Bacteria 628
617 Ga0207674_10007103 3300026116 Bacteria 13086
618 Ga0207674_10040017 3300026116 Bacteria 4858
619 Ga0207674_10135959 3300026116 Bacteria 2420
620 Ga0207674_10518408 3300026116 Bacteria 1151
621 Ga0207674_10887166 3300026116 Bacteria 860
622 Ga0207674_11300190 3300026116 Bacteria 697
623 Ga0207675_100010022 3300026118 Bacteria 8881
624 Ga0207675_100053232 3300026118 Bacteria 3776
625 Ga0207675_100156720 3300026118 Bacteria 2170
626 Ga0207675_100215039 3300026118 Bacteria 1850
627 Ga0207675_100253106 3300026118 Bacteria 1705
628 Ga0207675_100588245 3300026118 Bacteria 1115
629 Ga0207683_10036960 3300026121 Bacteria 4252
630 Ga0207683_10043268 3300026121 Bacteria 3936
631 Ga0207683_10059593 3300026121 Bacteria 3353
632 Ga0207683_10069837 3300026121 Bacteria 3102
633 Ga0207683_10150972 3300026121 Bacteria 2097
634 Ga0207683_10167624 3300026121 Bacteria 1988
635 Ga0207683_10196077 3300026121 Bacteria 1835
636 Ga0207683_10242834 3300026121 Bacteria 1643
637 Ga0207683_10386925 3300026121 Bacteria 1286
638 Ga0207683_10673340 3300026121 Bacteria 959
639 Ga0207683_11395983 3300026121 Bacteria 648
640 Ga0207683_11649167 3300026121 Bacteria 591
641 Ga0207698_10038296 3300026142 Bacteria 3541
642 Ga0207698_10093155 3300026142 Bacteria 2472
643 Ga0207698_10121155 3300026142 Bacteria 2214
644 Ga0207698_10199750 3300026142 Bacteria 1789
645 Ga0207698_10650438 3300026142 Bacteria 1044
646 Ga0207698_11090255 3300026142 Bacteria 811
647 Ga0209974_10038742 3300027876 Bacteria 1584
648 Ga0207428_10000964 3300027907 Bacteria 31921
649 Ga0268266_10204244 3300028379 Bacteria 1809
650 Ga0268265_10765304 3300028380 Bacteria 938
651 Ga0268264_10000716 3300028381 Bacteria 38128
652 Ga0268264_10375200 3300028381 Bacteria 1361
653 Ga0268264_10452867 3300028381 Bacteria 1244
654 Ga0307517_10177704 3300028786 Bacteria 1382
655 Ga0316183_1096233 3300030742 Bacteria 1779
656 Ga0316181_1110679 3300030744 Bacteria 1818
657 Ga0316181_1238547 3300030744 Bacteria 4374
658 Ga0316181_1251928 3300030744 Bacteria 1492
659 Ga0316182_1417880 3300030745 Bacteria 3090
660 Ga0307513_10139703 3300031456 Bacteria 2351
661 Ga0307408_100018661 3300031548 Bacteria 4660
662 Ga0307408_100125180 3300031548 Bacteria 1997
663 Ga0307408_100129335 3300031548 Bacteria 1968
664 Ga0307408_100249651 3300031548 Bacteria 1463
665 Ga0307408_100262927 3300031548 Bacteria 1429
666 Ga0316579_10045825 3300031691 Bacteria 2039
667 Ga0316576_10000044 3300031727 Bacteria 38025
668 Ga0316576_10043684 3300031727 Bacteria 3234
669 Ga0316578_10020590 3300031728 Bacteria 3647
670 Ga0307405_10001317 3300031731 Bacteria 10385
671 Ga0307405_10003937 3300031731 Bacteria 6944
672 Ga0307405_10087749 3300031731 Bacteria 2051
673 Ga0307405_10091114 3300031731 Bacteria 2019
674 Ga0307405_10106517 3300031731 Bacteria 1891
675 Ga0307405_10106930 3300031731 Bacteria 1888
676 Ga0307405_10224977 3300031731 Bacteria 1379
677 Ga0307405_10518794 3300031731 Bacteria 958
678 Ga0307413_10000082 3300031824 Bacteria 23658
679 Ga0307413_10084647 3300031824 Bacteria 2045
680 Ga0307413_10100465 3300031824 Bacteria 1910
681 Ga0307413_10321596 3300031824 Bacteria 1182
682 Ga0307413_10331269 3300031824 Bacteria 1167
683 Ga0307410_10011148 3300031852 Bacteria 5127
684 Ga0307410_10017454 3300031852 Bacteria 4310
685 Ga0307410_10018360 3300031852 Bacteria 4226
686 Ga0307410_10061238 3300031852 Bacteria 2575
687 Ga0307410_10136142 3300031852 Bacteria 1811
688 Ga0307410_10197025 3300031852 Bacteria 1535
689 Ga0307410_10270233 3300031852 Bacteria 1329
690 Ga0307410_10403599 3300031852 Bacteria 1105
691 Ga0307406_10002332 3300031901 Bacteria 10314
692 Ga0307406_10004112 3300031901 Bacteria 7924
693 Ga0307406_10005754 3300031901 Bacteria 6793
694 Ga0307406_10026994 3300031901 Bacteria 3454
695 Ga0307406_10160376 3300031901 Bacteria 1616
696 Ga0307406_10294194 3300031901 Bacteria 1244
697 Ga0307406_10519179 3300031901 Bacteria 969
698 Ga0307406_10744407 3300031901 Bacteria 822
699 Ga0307406_10783431 3300031901 Bacteria 803
700 Ga0307406_11282403 3300031901 Bacteria 639
701 Ga0307407_10002766 3300031903 Bacteria 6986
702 Ga0307407_10031526 3300031903 Bacteria 2871
703 Ga0307407_10033737 3300031903 Bacteria 2795
704 Ga0307407_10055716 3300031903 Bacteria 2286
705 Ga0307407_10075247 3300031903 Bacteria 2023
706 Ga0307407_10109185 3300031903 Bacteria 1734
707 Ga0307407_10125730 3300031903 Bacteria 1633
708 Ga0307407_10196173 3300031903 Bacteria 1349
709 Ga0307407_10419247 3300031903 Bacteria 964
710 Ga0307407_11167375 3300031903 Bacteria 601
711 Ga0307412_10023822 3300031911 Bacteria 3772
712 Ga0307412_10031696 3300031911 Bacteria 3341
713 Ga0307412_10082524 3300031911 Bacteria 2226
714 Ga0307412_10189789 3300031911 Bacteria 1553
715 Ga0307412_10257670 3300031911 Bacteria 1358
716 Ga0307412_10495138 3300031911 Bacteria 1016
717 Ga0307412_10827502 3300031911 Bacteria 806
718 Ga0307409_100000050 3300031995 Bacteria 42042
719 Ga0307409_100008307 3300031995 Bacteria 6291
720 Ga0307409_100040626 3300031995 Bacteria 3465
721 Ga0307409_100046691 3300031995 Bacteria 3281
722 Ga0307409_100070481 3300031995 Bacteria 2775
723 Ga0307409_100071899 3300031995 Bacteria 2752
724 Ga0307409_101316939 3300031995 Bacteria 748
725 Ga0307416_100000150 3300032002 Bacteria 41366
726 Ga0307416_100023522 3300032002 Bacteria 4473
727 Ga0307416_100078718 3300032002 Bacteria 2775
728 Ga0307416_100094006 3300032002 Bacteria 2584
729 Ga0307416_100126118 3300032002 Bacteria 2293
730 Ga0307416_100221560 3300032002 Bacteria 1815
731 Ga0307416_100366011 3300032002 Bacteria 1466
732 Ga0307416_100576308 3300032002 Bacteria 1202
733 Ga0307416_100761619 3300032002 Bacteria 1061
734 Ga0307416_101175456 3300032002 Bacteria 872
735 Ga0307414_10002253 3300032004 Bacteria 10077
736 Ga0307414_10146268 3300032004 Bacteria 1857
737 Ga0307414_10176030 3300032004 Bacteria 1716
738 Ga0307414_10270642 3300032004 Bacteria 1422
739 Ga0307414_10287591 3300032004 Bacteria 1384
740 Ga0307414_10305081 3300032004 Bacteria 1349
741 Ga0307414_10951889 3300032004 Bacteria 789
742 Ga0307414_10991117 3300032004 Bacteria 773
743 Ga0307411_10019042 3300032005 Bacteria 3955
744 Ga0307411_10037214 3300032005 Bacteria 3057
745 Ga0307411_10040253 3300032005 Bacteria 2963
746 Ga0307411_10352240 3300032005 Bacteria 1201
747 Ga0307411_10480043 3300032005 Bacteria 1046
748 Ga0307415_100031578 3300032126 Bacteria 3414
749 Ga0307415_100146442 3300032126 Bacteria 1811
750 Ga0307415_100158736 3300032126 Bacteria 1750
751 Ga0307415_100167957 3300032126 Bacteria 1708
752 Ga0307415_100206740 3300032126 Bacteria 1562
753 Ga0307415_100280796 3300032126 Bacteria 1369
754 Ga0316583_10023709 3300032133 Bacteria 2190
755 Ga0316585_10017855 3300032137 Bacteria 2147
756 Ga0316580_10060057 3300032139 Bacteria 1168
757 Ga0316588_1033508 3300033528 Bacteria 1211
758 Ga0316596_1053502 3300033541 Bacteria 1070
759 Ga0373931_0053018 3300035691 Bacteria 2164
760 Ga0373937_0537888 3300036401 Bacteria 1110
761 Ga0316584_0036284 3300036712 Bacteria 3657
762 Ga0316584_0492845 3300036712 Bacteria 862
763 Ga0395899_0179802 3300037312 Bacteria 1486
764 Ga0395899_0283766 3300037312 Bacteria 1126
765 Ga0395899_0351035 3300037312 Bacteria 987
766 Ga0395900_0147607 3300037418 Bacteria 2404
767 Ga0395900_0209282 3300037418 Bacteria 1970
768 Ga0395900_0957769 3300037418 Bacteria 777
769 Ga0395898_0116077 3300037466 Bacteria 2565
770 Ga0395898_0356157 3300037466 Bacteria 1395
771 Ga0316581_0000918 3300037588 Bacteria 6259
772 Ga0436364_0980202 3300037853 Bacteria 1129
773 Ga0395901_0257689 3300038443 Bacteria 1816
774 Ga0395901_0426330 3300038443 Bacteria 1359
775 Ga0395901_0556527 3300038443 Bacteria 1162
776 Ga0395901_0991661 3300038443 Bacteria 816
777 Ga0400488_11281 3300038741 Bacteria 7659
778 Ga0400486_03564 3300038742 Bacteria 38786
779 Ga0436365_1705036 3300039437 Bacteria 653
780 Ga0439436_0010622 3300041404 Bacteria 2806
781 Ga0439436_0140863 3300041404 Bacteria 678
782 Ga0439465_0031175 3300041413 Bacteria 1698
783 Ga0439465_0185367 3300041413 Bacteria 754
784 Ga0451791_1478727 3300041451 Bacteria 1821
785 Ga0451793_1618369 3300041452 Bacteria 1367
786 Ga0451800_0512413 3300041459 Bacteria 647
787 Ga0451806_586639 3300041462 Bacteria 958
788 Ga0451807_2174170 3300041486 Bacteria 1949
789 Ga0451837_1113271 3300041494 Bacteria 863
790 Ga0439448_0011573 3300042005 Bacteria 2631
791 Ga0439448_0146839 3300042005 Bacteria 817
792 Ga0439432_025491 3300042006 Bacteria 1940
793 Ga0439450_032831 3300042008 Bacteria 1174
794 Ga0439462_0036390 3300042015 Bacteria 1310
795 Ga0439463_002858 3300042016 Bacteria 4378
796 Ga0439463_128134 3300042016 Bacteria 657
797 Ga0450912_011710 3300042116 Bacteria 766
798 Ga0450920_060584 3300042122 Bacteria 764
799 Ga0439446_0151778 3300042156 Bacteria 762
800 Ga0439435_0004572 3300042436 Bacteria 2994
801 Ga0439444_0001270 3300042437 Bacteria 3218
802 Ga0439464_0010535 3300042439 Bacteria 2441
803 Ga0439464_0067924 3300042439 Bacteria 1051
804 Ga0450918_096169 3300042531 Bacteria 576
805 Ga0439440_0004003 3300042993 Bacteria 2878
806 Ga0439440_0019724 3300042993 Bacteria 1507
807 Ga0466969_0026550 3300044656 Bacteria 2969
808 Ga0466969_0031800 3300044656 Bacteria 2685
809 Ga0466969_0044386 3300044656 Bacteria 2211
810 Ga0466972_0205735 3300044658 Bacteria 922
811 Ga0466965_0063382 3300044683 Bacteria 1850
812 Ga0466965_0134546 3300044683 Bacteria 1284
813 Ga0466965_0135622 3300044683 Bacteria 1278
814 Ga0466965_0159769 3300044683 Bacteria 1181
815 Ga0466965_0239806 3300044683 Bacteria 970
816 Ga0466966_0007159 3300044684 Bacteria 7393
817 Ga0466966_0015403 3300044684 Bacteria 5055
818 Ga0466966_0028371 3300044684 Bacteria 3646
819 Ga0466966_0419245 3300044684 Bacteria 804
820 Ga0466961_0019337 3300044693 Bacteria 4382
821 Ga0466961_0037545 3300044693 Bacteria 3107
822 Ga0466961_0064101 3300044693 Bacteria 2335
823 Ga0466961_0096221 3300044693 Bacteria 1867
824 Ga0466961_0201734 3300044693 Bacteria 1230
825 Ga0466961_0263842 3300044693 Bacteria 1056
826 Ga0466961_0707591 3300044693 Bacteria 603
827 Ga0466963_0013682 3300044694 Bacteria 4989
828 Ga0466963_0041521 3300044694 Bacteria 3017
829 Ga0466963_0272509 3300044694 Bacteria 1189
830 Ga0466963_0361708 3300044694 Bacteria 1022
831 Ga0466963_0809494 3300044694 Bacteria 661
832 Ga0466963_1071301 3300044694 Bacteria 567
833 Ga0466964_0006978 3300044706 Bacteria 4221
834 Ga0466964_0019416 3300044706 Bacteria 2612
835 Ga0466971_0012855 3300044719 Bacteria 3670
836 Ga0466971_0018447 3300044719 Bacteria 3090
837 Ga0466968_0165165 3300044735 Bacteria 1023
838 Ga0466970_0000027 3300044765 Bacteria 56103
839 Ga0466970_0001734 3300044765 Bacteria 10509
840 Ga0466970_0058140 3300044765 Bacteria 2069
841 Ga0466970_0064028 3300044765 Bacteria 1971
842 Ga0466970_0093046 3300044765 Bacteria 1637
843 Ga0466970_0161057 3300044765 Bacteria 1241
844 Ga0466970_0270609 3300044765 Bacteria 954
845 Ga0466970_0370452 3300044765 Bacteria 814
846 Ga0466957_0068291 3300044842 Bacteria 2194
847 Ga0466957_0223574 3300044842 Bacteria 1244
848 Ga0466957_0368680 3300044842 Bacteria 977
849 Ga0466957_0651528 3300044842 Bacteria 740
850 Ga0466957_0839109 3300044842 Bacteria 654
851 Ga0466960_0012073 3300044901 Bacteria 3635
852 Ga0466960_0024128 3300044901 Bacteria 2740
853 Ga0466960_0034018 3300044901 Bacteria 2372
854 Ga0466960_0041643 3300044901 Bacteria 2177
855 Ga0466960_0053836 3300044901 Bacteria 1951
856 Ga0466960_0254480 3300044901 Bacteria 976
857 Ga0466960_0400834 3300044901 Bacteria 790
858 Ga0466959_0022475 3300045049 Bacteria 4663
859 Ga0466959_0050657 3300045049 Bacteria 3048
860 Ga0466959_0089417 3300045049 Bacteria 2212
861 Ga0466959_0214515 3300045049 Bacteria 1336
862 Ga0466959_0328588 3300045049 Bacteria 1044
863 Ga0451576_0165085 3300045051 Bacteria 2311
864 Ga0466958_0127343 3300045836 Bacteria 1597
865 Ga0466958_0271336 3300045836 Bacteria 1086
866 Ga0466958_0781369 3300045836 Bacteria 622
867 Ga0466967_0019414 3300045976 Bacteria 5465
868 Ga0466967_0025932 3300045976 Bacteria 4843
869 Ga0466967_0058636 3300045976 Bacteria 3404
870 Ga0466967_0228547 3300045976 Bacteria 1770
871 Ga0466967_0381743 3300045976 Bacteria 1368
872 Ga0466967_0575945 3300045976 Bacteria 1109
873 Ga0466967_0670159 3300045976 Bacteria 1026
874 Ga0466967_0780758 3300045976 Bacteria 948
875 Ga0466967_0856091 3300045976 Bacteria 903
876 Ga0495627_000366 3300046453 Bacteria 42078
877 Ga0495627_073803 3300046453 Bacteria 994
878 Ga0495627_076911 3300046453 Bacteria 970
879 Ga0495592_0015950 3300046454 Bacteria 5699
880 Ga0495603_0271340 3300046455 Bacteria 976
881 Ga0495603_0354456 3300046455 Bacteria 842
882 Ga0495638_0071684 3300046460 Bacteria 2119
883 Ga0495641_0067371 3300046461 Bacteria 1610
884 Ga0495651_0002063 3300046462 Bacteria 15529
885 Ga0495651_0002864 3300046462 Bacteria 13360
886 Ga0495651_0037156 3300046462 Bacteria 3791
887 Ga0495651_0100669 3300046462 Bacteria 2152
888 Ga0495653_0013086 3300046463 Bacteria 6764
889 Ga0495653_0053217 3300046463 Bacteria 3098
890 Ga0495653_0409546 3300046463 Bacteria 860
891 Ga0495650_0286394 3300046471 Bacteria 554
892 Ga0495580_0005827 3300046472 Bacteria 10107
893 Ga0495582_0548271 3300046473 Bacteria 669
894 Ga0495662_0000390 3300046476 Bacteria 19590
895 Ga0495664_0003456 3300046477 Bacteria 8593
896 Ga0495596_0167194 3300046500 Bacteria 855
897 Ga0495608_0006616 3300046511 Bacteria 8228
898 Ga0495608_0098578 3300046511 Bacteria 1886
899 Ga0495608_0288386 3300046511 Bacteria 1018
900 Ga0495618_0081028 3300046514 Bacteria 2072
901 Ga0495620_0040118 3300046515 Bacteria 2063
902 Ga0495628_0036245 3300046516 Bacteria 3960
903 Ga0495628_0100147 3300046516 Bacteria 2237
904 Ga0495630_0038944 3300046517 Bacteria 3555
905 Ga0495630_0409753 3300046517 Bacteria 1039
906 Ga0495631_0083179 3300046518 Bacteria 1380
907 Ga0495631_0205127 3300046518 Bacteria 843
908 Ga0495631_0244585 3300046518 Bacteria 765
909 Ga0495632_0224480 3300046519 Bacteria 849
910 Ga0495666_0018682 3300046526 Bacteria 3444
911 Ga0495652_0005073 3300046529 Bacteria 12464
912 Ga0495652_0030673 3300046529 Bacteria 4712
913 Ga0495665_0011264 3300046531 Bacteria 4842
914 Ga0495640_0010828 3300046533 Bacteria 7035
915 Ga0495586_0016566 3300046535 Bacteria 3921
916 Ga0495587_0005716 3300046536 Bacteria 8104
917 Ga0495587_0099437 3300046536 Bacteria 1676
918 Ga0495598_0084838 3300046537 Bacteria 1023
919 Ga0495597_0123881 3300046542 Bacteria 1076
920 Ga0495645_0003715 3300046543 Bacteria 10377
921 Ga0495645_0021561 3300046543 Bacteria 4655
922 Ga0495622_0028293 3300046557 Bacteria 2617
923 Ga0495667_0008797 3300046559 Bacteria 6864
924 Ga0495667_0476054 3300046559 Bacteria 783
925 Ga0495656_0276568 3300046615 Bacteria 855
926 Ga0495656_0306878 3300046615 Bacteria 815
927 Ga0495656_0494259 3300046615 Bacteria 648
928 Ga0495611_0038558 3300046648 Bacteria 2126
929 Ga0495625_0106558 3300046660 Bacteria 1919
930 Ga0495635_0012485 3300046663 Bacteria 5950
931 Ga0495599_0005565 3300046678 Bacteria 7556
932 Ga0495623_0007953 3300046679 Bacteria 6891
933 Ga0495646_0008190 3300046680 Bacteria 6642
934 Ga0495646_0071459 3300046680 Bacteria 2042
935 Ga0495647_0099843 3300046681 Bacteria 1201
936 Ga0495647_0216796 3300046681 Bacteria 844
937 Ga0495647_0310652 3300046681 Bacteria 712
938 Ga0495658_0006908 3300046683 Bacteria 5596
939 Ga0495658_0231664 3300046683 Bacteria 1158
940 Ga0495658_0253129 3300046683 Bacteria 1108
941 Ga0495658_0311014 3300046683 Bacteria 997
942 Ga0495658_0373709 3300046683 Bacteria 907
943 Ga0495658_0537296 3300046683 Bacteria 748
944 Ga0495613_0018672 3300046689 Bacteria 5170
945 Ga0495613_0242161 3300046689 Bacteria 1261
946 Ga0495624_0333751 3300046690 Bacteria 912
947 Ga0495670_0120949 3300046691 Bacteria 1360
948 Ga0495600_0002560 3300046809 Bacteria 10482
949 Ga0495600_0078541 3300046809 Bacteria 2155
950 Ga0495581_0012598 3300047315 Bacteria 4900
951 Ga0495581_0063337 3300047315 Bacteria 2137
952 Ga0495581_0170093 3300047315 Bacteria 1274
953 Ga0495604_0000113 3300047317 Bacteria 68389
954 Ga0495604_0073835 3300047317 Bacteria 2572
955 Ga0495604_0424629 3300047317 Bacteria 872
956 Ga0495674_0014322 3300047319 Bacteria 7426
957 Ga0495674_0172173 3300047319 Bacteria 1806
958 Ga0495672_0011090 3300047320 Bacteria 6380
959 Ga0495672_0043999 3300047320 Bacteria 2681
960 Ga0495676_0108581 3300047321 Bacteria 2041
961 Ga0495676_0233635 3300047321 Bacteria 1262
962 Ga0495676_0309627 3300047321 Bacteria 1063
963 Ga0495676_0722909 3300047321 Bacteria 643
964 Ga0495675_0002112 3300047444 Bacteria 11852
965 Ga0495681_0168170 3300047470 Bacteria 909
966 Ga0495684_0011762 3300047471 Bacteria 6755
967 Ga0495593_0003677 3300047673 Bacteria 9157
968 Ga0495602_0015786 3300048088 Bacteria 7606
969 Ga0495615_0145115 3300048090 Bacteria 703
970 Ga0496100_0155095 3300048903 Bacteria 1637
971 Ga0496100_0236947 3300048903 Bacteria 1345
972 Ga0496100_0490988 3300048903 Bacteria 945
973 Ga0496101_0108207 3300048904 Bacteria 2089
974 Ga0496101_0161065 3300048904 Bacteria 1721
975 Ga0496101_0420515 3300048904 Bacteria 1053
976 Ga0496101_0494603 3300048904 Bacteria 966
977 Ga0496101_0531927 3300048904 Bacteria 929
978 Ga0496101_0666531 3300048904 Bacteria 822
979 Ga0496101_1103318 3300048904 Bacteria 623
980 Ga0496102_0009934 3300048905 Bacteria 8186
981 Ga0496102_0028027 3300048905 Bacteria 5032
982 Ga0496102_0239967 3300048905 Bacteria 1709
983 Ga0496102_0617350 3300048905 Bacteria 1007
984 Ga0496103_0034233 3300048906 Bacteria 3106
985 Ga0496104_0316126 3300048907 Bacteria 1475
986 Ga0496104_0435768 3300048907 Bacteria 1222
987 Ga0496104_0899131 3300048907 Bacteria 790
988 Ga0496105_0357227 3300048908 Bacteria 1166
989 Ga0496105_0432883 3300048908 Bacteria 1040
990 Ga0496105_0440495 3300048908 Bacteria 1029
991 Ga0496105_0866846 3300048908 Bacteria 682
992 Ga0496105_1023298 3300048908 Bacteria 617
993 Ga0496106_0006764 3300048909 Bacteria 8490
994 Ga0496106_0135921 3300048909 Bacteria 1931
995 Ga0496106_0249673 3300048909 Bacteria 1418
996 Ga0496106_0383805 3300048909 Bacteria 1129
997 Ga0496107_0209976 3300048910 Bacteria 1448
998 Ga0496107_0275723 3300048910 Bacteria 1252
999 Ga0496107_0913733 3300048910 Bacteria 639
1000 Ga0496108_0016525 3300048911 Bacteria 6023
1001 Ga0496108_0032449 3300048911 Bacteria 4338
1002 Ga0496108_0080994 3300048911 Bacteria 2751
1003 Ga0496108_0145139 3300048911 Bacteria 2046
1004 Ga0496108_0277932 3300048911 Bacteria 1458
1005 Ga0496108_0305004 3300048911 Bacteria 1387
1006 Ga0496108_0636755 3300048911 Bacteria 927
1007 Ga0496108_0902018 3300048911 Bacteria 759
1008 Ga0496108_1004936 3300048911 Bacteria 712
1009 Ga0496108_1050387 3300048911 Bacteria 694
1010 Ga0496109_0004619 3300048912 Bacteria 11495
1011 Ga0496109_0010829 3300048912 Bacteria 7808
1012 Ga0496109_0026873 3300048912 Bacteria 5133
1013 Ga0496109_0156938 3300048912 Bacteria 2131
1014 Ga0496109_0256958 3300048912 Bacteria 1645
1015 Ga0496109_0332801 3300048912 Bacteria 1434
1016 Ga0496109_0372274 3300048912 Bacteria 1349
1017 Ga0496109_0538290 3300048912 Bacteria 1102
1018 Ga0496109_0603304 3300048912 Bacteria 1034
1019 Ga0496109_0612320 3300048912 Bacteria 1025
1020 Ga0496109_0782719 3300048912 Bacteria 892
1021 Ga0496109_1033756 3300048912 Bacteria 759
1022 Ga0496109_1213135 3300048912 Bacteria 691
1023 Ga0496109_1500909 3300048912 Bacteria 609
1024 Ga0496110_0003002 3300048913 Bacteria 12801
1025 Ga0496110_0009432 3300048913 Bacteria 7905
1026 Ga0496110_0102021 3300048913 Bacteria 2573
1027 Ga0496110_0135817 3300048913 Bacteria 2222
1028 Ga0496110_0224581 3300048913 Bacteria 1708
1029 Ga0496110_0241567 3300048913 Bacteria 1643
1030 Ga0496110_0411080 3300048913 Bacteria 1234
1031 Ga0496110_0429112 3300048913 Bacteria 1205
1032 Ga0496110_0661898 3300048913 Bacteria 944
1033 Ga0496110_0721746 3300048913 Bacteria 899
1034 Ga0496110_0947279 3300048913 Bacteria 768
1035 Ga0496111_0047733 3300048914 Bacteria 3083
1036 Ga0496111_0166218 3300048914 Bacteria 1638
1037 Ga0496111_0362966 3300048914 Bacteria 1072
1038 Ga0496112_0164633 3300048915 Bacteria 2184
1039 Ga0496112_0580270 3300048915 Bacteria 1054
1040 Ga0496113_0065187 3300048916 Bacteria 2756
1041 Ga0496113_0163409 3300048916 Bacteria 1761
1042 Ga0496113_0234387 3300048916 Bacteria 1464
1043 Ga0496113_1250241 3300048916 Bacteria 578
1044 Ga0496114_0014209 3300048917 Bacteria 6386
1045 Ga0496114_0021729 3300048917 Bacteria 5223
1046 Ga0496114_0037958 3300048917 Bacteria 3985
1047 Ga0496114_0045393 3300048917 Bacteria 3650
1048 Ga0496114_0046928 3300048917 Bacteria 3591
1049 Ga0496114_0099311 3300048917 Bacteria 2483
1050 Ga0496114_0100486 3300048917 Bacteria 2468
1051 Ga0496114_0164138 3300048917 Bacteria 1933
1052 Ga0496114_0226403 3300048917 Bacteria 1642
1053 Ga0496114_0329099 3300048917 Bacteria 1350
1054 Ga0496114_0369396 3300048917 Bacteria 1269
1055 Ga0496114_0482584 3300048917 Bacteria 1097
1056 Ga0496114_0492402 3300048917 Bacteria 1084
1057 Ga0496114_0735405 3300048917 Bacteria 863
1058 Ga0496114_0794512 3300048917 Bacteria 825
1059 Ga0496114_1155620 3300048917 Bacteria 660
1060 Ga0496114_1225007 3300048917 Bacteria 637
1061 Ga0496116_0179449 3300048919 Bacteria 1136
1062 Ga0496117_0000651 3300048920 Bacteria 55785
1063 Ga0496117_0001417 3300048920 Bacteria 34751
1064 Ga0496117_0001865 3300048920 Bacteria 28449
1065 Ga0496117_0006565 3300048920 Bacteria 11704
1066 Ga0496117_0361887 3300048920 Bacteria 745
1067 Ga0496118_0004583 3300048921 Bacteria 16257
1068 Ga0496118_0040541 3300048921 Bacteria 3701
1069 Ga0496119_0002760 3300048922 Bacteria 18892
1070 Ga0496119_0010799 3300048922 Bacteria 7642
1071 Ga0496119_0015791 3300048922 Bacteria 5785
1072 Ga0496119_0255209 3300048922 Bacteria 882
1073 Ga0496120_0003180 3300048923 Bacteria 15284
1074 Ga0496120_0006039 3300048923 Bacteria 9417
1075 Ga0496120_0008033 3300048923 Bacteria 7762
1076 Ga0496120_0347590 3300048923 Bacteria 667
1077 Ga0496122_0001412 3300048925 Bacteria 38911
1078 Ga0496122_0001962 3300048925 Bacteria 30783
1079 Ga0496122_0003791 3300048925 Bacteria 19486
1080 Ga0496122_0011371 3300048925 Bacteria 9022
1081 Ga0496122_0016759 3300048925 Bacteria 6904
1082 Ga0496122_0022308 3300048925 Bacteria 5633
1083 Ga0496123_0000009 3300048926 Bacteria 509486
1084 Ga0496123_0002420 3300048926 Bacteria 23276
1085 Ga0496123_0165602 3300048926 Bacteria 1173
1086 Ga0496124_0016122 3300048927 Bacteria 7128
1087 Ga0496124_0120964 3300048927 Bacteria 2092
1088 Ga0496124_0255380 3300048927 Bacteria 1293
1089 Ga0496124_0434039 3300048927 Bacteria 901
1090 Ga0496125_0000086 3300048928 Bacteria 216489
1091 Ga0496125_0005854 3300048928 Bacteria 13496
1092 Ga0496125_0012271 3300048928 Bacteria 8519
1093 Ga0496125_0019618 3300048928 Bacteria 6369
1094 Ga0496125_0050862 3300048928 Bacteria 3425
1095 Ga0496125_0051614 3300048928 Bacteria 3390
1096 Ga0496126_0001361 3300048929 Bacteria 38739
1097 Ga0496126_0004955 3300048929 Bacteria 15529
1098 Ga0496126_0072850 3300048929 Bacteria 3055
1099 Ga0496126_0079413 3300048929 Bacteria 2904
1100 Ga0496126_0130003 3300048929 Bacteria 2177
1101 Ga0496126_0562656 3300048929 Bacteria 903
1102 Ga0501306_005444 3300049127 Bacteria 1460
1103 Ga0501306_005481 3300049127 Bacteria 1456
1104 Ga0501306_009793 3300049127 Bacteria 1194
1105 Ga0501306_009840 3300049127 Bacteria 1192
1106 Ga0501306_013272 3300049127 Bacteria 1072
1107 Ga0501306_017558 3300049127 Bacteria 972
1108 Ga0501306_018175 3300049127 Bacteria 960
1109 Ga0501306_020788 3300049127 Bacteria 915
1110 Ga0501306_038680 3300049127 Bacteria 733
1111 Ga0501308_003250 3300049128 Bacteria 1494
1112 Ga0501308_008813 3300049128 Bacteria 1088
1113 Ga0501308_016950 3300049128 Bacteria 877
1114 Ga0501308_028109 3300049128 Bacteria 742
1115 Ga0501309_007448 3300049129 Bacteria 1357
1116 Ga0501309_010739 3300049129 Bacteria 1185
1117 Ga0501309_030598 3300049129 Bacteria 793
1118 Ga0501309_064581 3300049129 Bacteria 594
1119 Ga0501310_000203 3300049130 Bacteria 5643
1120 Ga0501310_004679 3300049130 Bacteria 1382
1121 Ga0501310_011248 3300049130 Bacteria 1010
1122 Ga0501310_013202 3300049130 Bacteria 956
1123 Ga0501310_019314 3300049130 Bacteria 838
1124 Ga0501310_021706 3300049130 Bacteria 805
1125 Ga0501310_043217 3300049130 Bacteria 633
1126 Ga0501310_054264 3300049130 Bacteria 586
1127 Ga0501304_005285 3300049160 Bacteria 1008
1128 Ga0501304_006590 3300049160 Bacteria 940
1129 Ga0501304_035168 3300049160 Bacteria 545
1130 Ga0501305_009438 3300049161 Bacteria 1282
1131 Ga0501305_011341 3300049161 Bacteria 1202
1132 Ga0501305_013752 3300049161 Bacteria 1123
1133 Ga0501305_017779 3300049161 Bacteria 1024
1134 Ga0501305_021051 3300049161 Bacteria 962
1135 Ga0501305_022577 3300049161 Bacteria 937
1136 Ga0501305_039732 3300049161 Bacteria 762
1137 Ga0501307_001336 3300049162 Bacteria 2053
1138 Ga0501307_007043 3300049162 Bacteria 1231
1139 Ga0501307_008681 3300049162 Bacteria 1147
1140 Ga0501307_008773 3300049162 Bacteria 1143
1141 Ga0501307_008990 3300049162 Bacteria 1134
1142 Ga0501307_009302 3300049162 Bacteria 1121
1143 Ga0501291_003463 3300049514 Bacteria 1962
1144 Ga0501311_002733 3300049527 Bacteria 1722
1145 Ga0501311_006387 3300049527 Bacteria 1326
1146 Ga0501311_006689 3300049527 Bacteria 1307
1147 Ga0501311_007519 3300049527 Bacteria 1256
1148 Ga0501311_009584 3300049527 Bacteria 1159
1149 Ga0501311_012613 3300049527 Bacteria 1057
1150 Ga0501311_015533 3300049527 Bacteria 984
1151 Ga0501311_016867 3300049527 Bacteria 956
1152 Ga0501311_024585 3300049527 Bacteria 840
1153 Ga0501311_070326 3300049527 Bacteria 580
1154 Ga0501312_008978 3300049528 Bacteria 1309
1155 Ga0501312_010973 3300049528 Bacteria 1223
1156 Ga0501312_013905 3300049528 Bacteria 1125
1157 Ga0501312_014606 3300049528 Bacteria 1105
1158 Ga0501312_033162 3300049528 Bacteria 818
1159 Ga0501312_053797 3300049528 Bacteria 684
1160 Ga0501312_077440 3300049528 Bacteria 598
1161 Ga0501313_004416 3300049529 Bacteria 1444
1162 Ga0501313_007160 3300049529 Bacteria 1225
1163 Ga0501313_008814 3300049529 Bacteria 1129
1164 Ga0501314_005361 3300049530 Bacteria 1089
1165 Ga0501314_016981 3300049530 Bacteria 730
1166 Ga0501315_004377 3300049531 Bacteria 1474
1167 Ga0501315_007175 3300049531 Bacteria 1264
1168 Ga0501315_007980 3300049531 Bacteria 1220
1169 Ga0501315_012376 3300049531 Bacteria 1054
1170 Ga0501315_012540 3300049531 Bacteria 1050
1171 Ga0501315_013901 3300049531 Bacteria 1014
1172 Ga0501315_024447 3300049531 Bacteria 836
1173 Ga0501315_035972 3300049531 Bacteria 733
1174 Ga0501316_010829 3300049532 Bacteria 1043
1175 Ga0501316_013105 3300049532 Bacteria 977
1176 Ga0501316_016456 3300049532 Bacteria 899
1177 Ga0501316_022147 3300049532 Bacteria 808
1178 Ga0501316_035199 3300049532 Bacteria 683
1179 Ga0501317_000644 3300049533 Bacteria 2598
1180 Ga0501317_005272 3300049533 Bacteria 1378
1181 Ga0501317_005710 3300049533 Bacteria 1344
1182 Ga0501317_014600 3300049533 Bacteria 997
1183 Ga0501317_016193 3300049533 Bacteria 964
1184 Ga0501317_024164 3300049533 Bacteria 844
1185 Ga0501317_034421 3300049533 Bacteria 750
1186 Ga0501317_071509 3300049533 Bacteria 586
1187 Ga0501318_000479 3300049534 Bacteria 2560
1188 Ga0501318_001868 3300049534 Bacteria 1741
1189 Ga0501318_004917 3300049534 Bacteria 1303
1190 Ga0501318_005596 3300049534 Bacteria 1253
1191 Ga0501318_007572 3300049534 Bacteria 1139
1192 Ga0501318_008705 3300049534 Bacteria 1091
1193 Ga0501318_009413 3300049534 Bacteria 1065
1194 Ga0501318_009609 3300049534 Bacteria 1058
1195 Ga0501318_011015 3300049534 Bacteria 1015
1196 Ga0501318_020431 3300049534 Bacteria 834
1197 Ga0501319_003021 3300049535 Bacteria 1102
1198 Ga0501320_001217 3300049536 Bacteria 1820
1199 Ga0501320_004125 3300049536 Bacteria 1265
1200 Ga0501320_008104 3300049536 Bacteria 1027
1201 Ga0501320_008184 3300049536 Bacteria 1023
1202 Ga0501320_053653 3300049536 Bacteria 554
1203 Ga0501321_000742 3300049537 Bacteria 2282
1204 Ga0501321_000877 3300049537 Bacteria 2172
1205 Ga0501321_001896 3300049537 Bacteria 1742
1206 Ga0501321_010063 3300049537 Bacteria 1031
1207 Ga0501321_013390 3300049537 Bacteria 942
1208 Ga0501321_022531 3300049537 Bacteria 793
1209 Ga0501322_002959 3300049538 Bacteria 1074
1210 Ga0501323_001151 3300049539 Bacteria 2257
1211 Ga0501323_024076 3300049539 Bacteria 821
1212 Ga0501324_001175 3300049540 Bacteria 1689
1213 Ga0501324_007700 3300049540 Bacteria 935
1214 Ga0501324_010748 3300049540 Bacteria 838
1215 Ga0501325_001878 3300049541 Bacteria 1365
1216 Ga0501325_007953 3300049541 Bacteria 909
1217 Ga0501031_0001904 3300049568 Bacteria 13145
1218 Ga0501031_0003864 3300049568 Bacteria 9636
1219 Ga0501031_0004771 3300049568 Bacteria 8806
1220 Ga0501031_0012109 3300049568 Bacteria 5623
1221 Ga0501031_0167765 3300049568 Bacteria 1434
1222 Ga0501032_0021323 3300049569 Bacteria 4505
1223 Ga0501032_0084511 3300049569 Bacteria 2110
1224 Ga0501032_0085575 3300049569 Bacteria 2095
1225 Ga0501032_0349515 3300049569 Bacteria 953
1226 Ga0501032_0699600 3300049569 Bacteria 642
1227 Ga0501033_0018229 3300049570 Bacteria 5304
1228 Ga0501033_0035975 3300049570 Bacteria 3711
1229 Ga0501034_0112724 3300049571 Bacteria 2709
1230 Ga0501034_0301751 3300049571 Bacteria 1538
1231 Ga0501034_0345444 3300049571 Bacteria 1417
1232 Ga0501036_0002252 3300049572 Bacteria 15060
1233 Ga0501036_0009602 3300049572 Bacteria 7957
1234 Ga0501036_0050131 3300049572 Bacteria 3535
1235 Ga0501036_0055279 3300049572 Bacteria 3362
1236 Ga0501036_0510300 3300049572 Bacteria 1000
1237 Ga0501036_0598772 3300049572 Bacteria 914
1238 Ga0501037_0023238 3300049573 Bacteria 4585
1239 Ga0501037_0028258 3300049573 Bacteria 4143
1240 Ga0501037_0070320 3300049573 Bacteria 2546
1241 Ga0501037_0122037 3300049573 Bacteria 1873
1242 Ga0501037_0469845 3300049573 Bacteria 856
1243 Ga0501038_0025278 3300049574 Bacteria 5295
1244 Ga0501038_0030416 3300049574 Bacteria 4779
1245 Ga0501038_0054600 3300049574 Bacteria 3436
1246 Ga0501038_0059870 3300049574 Bacteria 3260
1247 Ga0501038_0136034 3300049574 Bacteria 2013
1248 Ga0501039_0006886 3300049575 Bacteria 8646
1249 Ga0501039_0012457 3300049575 Bacteria 6492
1250 Ga0501039_0048864 3300049575 Bacteria 3270
1251 Ga0501039_0064077 3300049575 Bacteria 2848
1252 Ga0501039_0271708 3300049575 Bacteria 1332
1253 Ga0501039_0323047 3300049575 Bacteria 1213
1254 Ga0501040_0006842 3300049576 Bacteria 7390
1255 Ga0501040_0028375 3300049576 Bacteria 3772
1256 Ga0501040_0204015 3300049576 Bacteria 1404
1257 Ga0501040_0267132 3300049576 Bacteria 1221
1258 Ga0501040_0519211 3300049576 Bacteria 859
1259 Ga0501040_0824722 3300049576 Bacteria 671
1260 Ga0501041_0003749 3300049577 Bacteria 8744
1261 Ga0501041_0030801 3300049577 Bacteria 3239
1262 Ga0501041_0054720 3300049577 Bacteria 2435
1263 Ga0501042_0002441 3300049578 Bacteria 11407
1264 Ga0501042_0022916 3300049578 Bacteria 4363
1265 Ga0501042_0045764 3300049578 Bacteria 3119
1266 Ga0501043_0002200 3300049579 Bacteria 16615
1267 Ga0501043_0305605 3300049579 Bacteria 1215
1268 Ga0501046_0013207 3300049580 Bacteria 7002
1269 Ga0501046_0032560 3300049580 Bacteria 4221
1270 Ga0501046_0090343 3300049580 Bacteria 2357
1271 Ga0501048_0022554 3300049582 Bacteria 4603
1272 Ga0501048_0031363 3300049582 Bacteria 3844
1273 Ga0501048_0131984 3300049582 Bacteria 1765
1274 Ga0501048_0149903 3300049582 Bacteria 1649
1275 Ga0501048_0211903 3300049582 Bacteria 1374
1276 Ga0501067_0030199 3300049583 Bacteria 3006
1277 Ga0501067_0100591 3300049583 Bacteria 1606
1278 Ga0501068_0034975 3300049584 Bacteria 2998
1279 Ga0501068_0039920 3300049584 Bacteria 2816
1280 Ga0501068_0075443 3300049584 Bacteria 2063
1281 Ga0501069_0000273 3300049585 Bacteria 23416
1282 Ga0501069_0079871 3300049585 Bacteria 1841
1283 Ga0501070_0015859 3300049586 Bacteria 6335
1284 Ga0501071_0019237 3300049587 Bacteria 4737
1285 Ga0501071_0038154 3300049587 Bacteria 3432
1286 Ga0501071_0069590 3300049587 Bacteria 2563
1287 Ga0501071_0170372 3300049587 Bacteria 1630
1288 Ga0501072_0006470 3300049588 Bacteria 8920
1289 Ga0501072_0125162 3300049588 Bacteria 2047
1290 Ga0501072_0235125 3300049588 Bacteria 1459
1291 Ga0501072_0507509 3300049588 Bacteria 954
1292 Ga0501073_0038561 3300049589 Bacteria 3388
1293 Ga0501073_0113814 3300049589 Bacteria 1876
1294 Ga0501074_0010467 3300049590 Bacteria 6732
1295 Ga0501074_0012517 3300049590 Bacteria 6168
1296 Ga0501074_0054490 3300049590 Bacteria 2884
1297 Ga0501074_0080968 3300049590 Bacteria 2329
1298 Ga0501074_0526723 3300049590 Bacteria 837
1299 Ga0501075_0016824 3300049591 Bacteria 5273
1300 Ga0501075_0298517 3300049591 Bacteria 1227
1301 Ga0501075_0779902 3300049591 Bacteria 727
1302 Ga0501076_0022797 3300049592 Bacteria 4816
1303 Ga0501076_0029017 3300049592 Bacteria 4300
1304 Ga0501077_0017885 3300049593 Bacteria 4480
1305 Ga0501077_0063158 3300049593 Bacteria 2349
1306 Ga0501077_0284565 3300049593 Bacteria 1052
1307 Ga0501235_096090 3300049669 Bacteria 720
1308 Ga0501225_0043477 3300049705 Bacteria 1242
1309 Ga0501079_0002786 3300049741 Bacteria 12749
1310 Ga0501079_0525365 3300049741 Bacteria 930
1311 Ga0501080_0000473 3300049742 Bacteria 31252
1312 Ga0501080_0038075 3300049742 Bacteria 4491
1313 Ga0501080_0061686 3300049742 Bacteria 3490
1314 Ga0501081_0001282 3300049743 Bacteria 15279
1315 Ga0501081_0047474 3300049743 Bacteria 2954
1316 Ga0501081_0059287 3300049743 Bacteria 2649
1317 Ga0501081_0377431 3300049743 Bacteria 1047
1318 Ga0501083_0003730 3300049744 Bacteria 10699
1319 Ga0501083_0220023 3300049744 Bacteria 1237
1320 Ga0501083_0543400 3300049744 Bacteria 756
1321 Ga0501035_0002239 3300049822 Bacteria 19166
1322 Ga0501035_0155006 3300049822 Bacteria 1986
1323 Ga0501035_0266777 3300049822 Bacteria 1450
1324 Ga0501035_0467391 3300049822 Bacteria 1042
1325 Ga0501044_0337356 3300049823 Bacteria 1429
1326 Ga0501045_0017260 3300049824 Bacteria 5123
1327 Ga0501045_0051860 3300049824 Bacteria 2994
1328 Ga0501045_0096947 3300049824 Bacteria 2182
1329 Ga0501045_0654372 3300049824 Bacteria 776
1330 nmdc:mga03683_24840_c1 3300050489 Bacteria 2347
1331 nmdc:mga03n38_199879_c1 3300050490 Bacteria 1034
1332 nmdc:mga03n38_277943_c1 3300050490 Bacteria 893
1333 nmdc:mga00v17_116578_c1 3300050491 Bacteria 1698
1334 nmdc:mga00v17_165046_c1 3300050491 Bacteria 1427
1335 nmdc:mga00v17_35494_c1 3300050491 Bacteria 2968
1336 nmdc:mga00v17_54795_c1 3300050491 Bacteria 2433
1337 nmdc:mga00v17_574884_c1 3300050491 Bacteria 728
1338 nmdc:mga00v17_6495_c1 3300050491 Bacteria 6205
1339 nmdc:mga0yw44_103044_c1 3300050492 Bacteria 1820
1340 nmdc:mga0yw44_106706_c1 3300050492 Bacteria 1791
1341 nmdc:mga0yw44_306043_c1 3300050492 Bacteria 1065
1342 nmdc:mga0yw44_515124_c1 3300050492 Bacteria 812
1343 nmdc:mga0yw44_7451_c1 3300050492 Bacteria 5386
1344 nmdc:mga06z11_125951_c1 3300050494 Bacteria 1434
1345 nmdc:mga06z11_871932_c1 3300050494 Bacteria 548
1346 nmdc:mga07m45_625818_c1 3300050496 Bacteria 621
1347 nmdc:mga05p37_168329_c1 3300050507 Bacteria 2674
1348 nmdc:mga05p37_4106_c1 3300050507 Bacteria 17020
1349 nmdc:mga09592_20670_c1 3300050508 Bacteria 5418
1350 nmdc:mga0qj67_115114_c1 3300050509 Bacteria 2172
1351 nmdc:mga0qj67_4474_c1 3300050509 Bacteria 10127
1352 nmdc:mga06r32_51858_c1 3300050510 Bacteria 3927
1353 nmdc:mga06r32_5549_c1 3300050510 Bacteria 11370
1354 nmdc:mga08y16_23474_c1 3300050511 Bacteria 6516
1355 nmdc:mga0n895_24811_c1 3300050512 Bacteria 5657
1356 nmdc:mga0rr50_14624_c1 3300050513 Bacteria 5154
1357 nmdc:mga08x19_85717_c1 3300050514 Bacteria 2073
1358 nmdc:mga0a205_18368_c1 3300050515 Bacteria 6574
1359 nmdc:mga0sz30_6024_c1 3300050516 Bacteria 4479
1360 Ga0495601_0001806 3300053077 Bacteria 11880
1361 Ga0495601_0005598 3300053077 Bacteria 7326
1362 Ga0495612_0008090 3300053078 Bacteria 4281
1363 Ga0495612_0220906 3300053078 Bacteria 839
1364 Ga0495612_0326289 3300053078 Bacteria 691
1365 Ga0495655_0085274 3300053083 Bacteria 910
1366 Ga0495655_0195219 3300053083 Bacteria 659
1367 Ga0495595_0093034 3300053084 Bacteria 1448
1368 Ga0495595_0119311 3300053084 Bacteria 1284
1369 Ga0495619_0011061 3300053085 Bacteria 5677
1370 Ga0495619_0133782 3300053085 Bacteria 1705
1371 Ga0495619_0166497 3300053085 Bacteria 1523
1372 Ga0495619_0181164 3300053085 Bacteria 1458
1373 Ga0500566_0269698 3300053094 Bacteria 817
1374 Ga0500573_0026341 3300053140 Bacteria 3342
1375 Ga0501084_0006859 3300054114 Bacteria 9376
1376 Ga0501084_0017067 3300054114 Bacteria 6031
1377 Ga0501084_0038500 3300054114 Bacteria 3997
1378 Ga0501084_0069026 3300054114 Bacteria 2958
1379 Ga0501084_0252010 3300054114 Bacteria 1490
1380 Ga0501084_1097914 3300054114 Bacteria 668
1381 Ga0590075_009505 3300059424 Bacteria 2331
1382 Ga0590077_031510 3300059426 Bacteria 1159
1383 Ga0587084_000583 3300059477 Bacteria 2990
1384 Ga0587070_016923 3300059491 Bacteria 1174
1385 Ga0587070_088211 3300059491 Bacteria 693
1386 Ga0587077_015691 3300059493 Bacteria 1265
1387 Ga0587082_014163 3300059504 Bacteria 1213
1388 Ga0587083_0016325 3300059505 Bacteria 1312
1389 Ga0587088_015149 3300059508 Bacteria 1211
1390 Ga0587089_010078 3300059509 Bacteria 1171
1391 Ga0587092_003462 3300059512 Bacteria 1796
1392 Ga0587094_011500 3300059513 Bacteria 1166
1393 Ga0587106_010468 3300059605 Bacteria 1202
1394 Ga0587106_011255 3300059605 Bacteria 1176
1395 Ga0587129_002032 3300059608 Bacteria 1163
1396 Ga0587099_003208 3300059622 Bacteria 1344
1397 Ga0587101_000649 3300059623 Bacteria 2599
1398 Ga0587109_021552 3300059624 Bacteria 1153
1399 Ga0587115_001523 3300059626 Bacteria 2148
1400 Ga0587117_009121 3300059627 Bacteria 1180
1401 Ga0587122_003478 3300059628 Bacteria 1218
1402 Ga0587122_006539 3300059628 Bacteria 1010
1403 Ga0587128_030836 3300059630 Bacteria 887
1404 Ga0587069_012198 3300059642 Bacteria 1162
1405 Ga0587072_054887 3300059643 Bacteria 807
1406 Ga0587100_002541 3300059648 Bacteria 1186
1407 Ga0587110_018867 3300059654 Bacteria 765
1408 Ga0587119_001968 3300059658 Bacteria 1788
1409 Ga0587124_003438 3300059660 Bacteria 1175
1410 Ga0587111_0002409 3300060346 Bacteria 2487
1411 Ga0501082_0005074 3300060353 Bacteria 11478
1412 Ga0501082_0053946 3300060353 Bacteria 3465
1413 Ga0501082_0070496 3300060353 Bacteria 3009
1414 Ga0501082_0103067 3300060353 Bacteria 2468
1415 Ga0501082_0362276 3300060353 Bacteria 1265
1416 Ga0501082_0472208 3300060353 Bacteria 1096
1417 Ga0501082_0969902 3300060353 Bacteria 743
1418 Ga0466962_0010205 3300061719 Bacteria 4511
1419 Ga0466962_0032219 3300061719 Bacteria 2509
1420 Ga0466962_0063964 3300061719 Bacteria 1756
1421 Ga0466962_0066884 3300061719 Bacteria 1716
1422 Ga0466962_0317566 3300061719 Bacteria 772
1423 Ga0466962_0341716 3300061719 Bacteria 745
1424 Ga0466962_0373690 3300061719 Bacteria 711
1425 Ga0530510_0018929 3300061734 Bacteria 4883
1426 Ga0530510_0037945 3300061734 Bacteria 3476
1427 Ga0530510_0060257 3300061734 Bacteria 2746
1428 Ga0530510_0402199 3300061734 Bacteria 1032
1429 Ga0530510_0762549 3300061734 Bacteria 738
1430 2643734775 2643221542 Bacteria 3563959
1431 2643768589 2643221549 Bacteria 4042819
1432 2643847815 2643221566 Bacteria 3460379
1433 2643851144 2643221567 Bacteria 4163945
1434 2643888167 2643221575 Bacteria 4022601
1435 2644134933 2643221624 Bacteria 4384879
1436 2644172935 2643221630 Bacteria 3601215
1437 2644197876 2643221635 Bacteria 2632343
1438 2644502872 2643221690 Bacteria 4654705
1439 2644525232 2643221694 Bacteria 4392972
1440 2644669320 2643221722 Bacteria 4247614
1441 2676476355 2675903058 Bacteria 6822861
1442 2723643124 2721755702 Bacteria 4373124
1443 2739607397 2739367654 Bacteria 6049412
1444 2747951865 2747842429 Bacteria 3914386
1445 2760304695 2758568522 Bacteria 5953541
1446 2809026277 2808606394 Bacteria 6248540
1447 2809226479 2808606447 Bacteria 3572005
1448 2810363380 2808606700 Bacteria 3482157
1449 2812364396 2811994880 Bacteria 4147780
1450 2812373752 2811994882 Bacteria 4688362
1451 2816421112 2816332119 Bacteria 8120218
1452 2819665408 2818991458 Bacteria 4794049
1453 2819691388 2818991462 Bacteria 4320267
1454 2819727576 2818991469 Bacteria 4644110
1455 2827632163 2827628540 Bacteria 6858585
1456 2848553212 2848551377 Bacteria 3720646
1457 2852632730 2852632344 Bacteria 3463163
1458 2852648356 2852646457 Bacteria 3408613
1459 2852665910 2852663356 Bacteria 4090475
1460 2852678607 2852677369 Bacteria 3768884
1461 2857712608 2857710386 Bacteria 3186771
1462 2857722324 2857720070 Bacteria 3189373
1463 2857724603 2857723135 Bacteria 4217853
1464 2857730635 2857729791 Bacteria 4040535
1465 2862993602 2862993130 Bacteria 3860849
1466 2883823179 2883821847 Bacteria 5121194
1467 2887444587 2887443736 Bacteria 4426037
1468 2893685172 2893684298 Bacteria 2897960
1469 2897562451 2897561785 Bacteria 3256946
1470 2905927996 2905926851 Bacteria 4423176
1471 2919397727 2919395869 Bacteria 3704152
1472 2928090913 2928090899 Bacteria 3158267
1473 2928121441 2928121344 Bacteria 3972376
1474 2946005578 2946003308 Bacteria 3857229
1475 2946034818 2946033335 Bacteria 3835514
1476 2946081869 2946080515 Bacteria 4310960
1477 2984577126 2984576629 Bacteria 4248407
1478 2984582345 2984580707 Bacteria 3351387
1479 2984592263 2984592036 Bacteria 3670284
1480 2990260447 2990256926 Bacteria 4252839
1481 2995728382 2995726249 Bacteria 3470435
1482 3001890625 3001889506 Bacteria 2975194
1483 8004021569 8004021418 Bacteria 4313954
1484 8004028569 8004025490 Bacteria 4327753
1485 8004183484 8004182704 Bacteria 3391155
1486 8055035331 8055034563 Bacteria 3562128
1487 Ga0436364_0409793
1488 JGI24740J21852_10019807
1489 JGI24737J22298_10003968
1490 JGI24735J21928_10075146
1491 JGI24735J21928_10156563
1492 JGI24738J21930_10002435
1493 JGI24738J21930_10015599
1494 JGI24749J21850_1012752
1495 JGI24744J21845_10004165
1496 JGI24034J26672_10007871
1497 JGI24742J22300_10015362
1498 JGI25154J39366_1001966
1499 Ga0006778J45830_1011174
1500 Ga0006759J45824_1013878
1501 Ga0006759J45824_1025628
1502 Ga0006777J48905_1019716
1503 Ga0006777J48905_1020582
1504 Ga0007417J51691_1011871
1505 Ga0007427J51700_103286
1506 Ga0006781J51513_1007583
1507 Ga0006781J51513_1013434
1508 Ga0007410J51695_1015311
1509 Ga0007409J51694_1017714
1510 Ga0007409J51694_1018137
1511 Ga0007429J51699_1011248
1512 Ga0007429J51699_1016355
1513 Ga0007429J51699_1027302
1514 Ga0007429J51699_1030497
1515 Ga0032354_1006492
1516 Ga0032354_1009879
1517 Ga0006780_1004588
1518 Ga0006780_1006617
1519 Ga0058858_1425716
1520 Ga0058861_10101139
1521 Ga0070658_10356842
1522 Ga0070676_10333614
1523 Ga0070683_100027696
1524 Ga0070683_100061434
1525 Ga0070683_100154117
1526 Ga0070683_100786439
1527 Ga0070690_100153667
1528 Ga0070670_100327695
1529 Ga0068869_100085285
1530 Ga0070682_100005854
1531 Ga0070682_100076528
1532 Ga0070682_100078918
1533 Ga0070682_100091754
1534 Ga0070682_100121266
1535 Ga0070682_100272134
1536 Ga0070682_100471955
1537 Ga0068868_100328938
1538 Ga0068868_100410141
1539 Ga0070660_100011189
1540 Ga0070660_100092118
1541 Ga0070660_100127673
1542 Ga0070660_100767913
1543 Ga0070687_100005482
1544 Ga0070661_100041418
1545 Ga0070692_10007791
1546 Ga0070692_10236474
1547 Ga0070668_100015860
1548 Ga0070668_100028853
1549 Ga0070668_100039258
1550 Ga0070668_100124061
1551 Ga0070668_100172522
1552 Ga0070668_100314145
1553 Ga0070668_100383429
1554 Ga0070669_100237787
1555 Ga0070675_100125997
1556 Ga0070675_100506081
1557 Ga0070671_100267938
1558 Ga0070671_100704674
1559 Ga0070674_100031514
1560 Ga0070674_100039323
1561 Ga0070674_100046760
1562 Ga0070674_100176996
1563 Ga0070674_100186605
1564 Ga0070674_100482961
1565 Ga0070673_100049892
1566 Ga0070673_101004101
1567 Ga0070688_100220705
1568 Ga0070659_100036950
1569 Ga0070659_100046370
1570 Ga0070659_100072440
1571 Ga0070659_100090530
1572 Ga0070659_100286114
1573 Ga0070667_100046939
1574 Ga0070667_100217798
1575 Ga0070667_100955330
1576 Ga0070714_100817971
1577 Ga0070701_10009437
1578 Ga0070711_100848749
1579 Ga0070705_100013603
1580 Ga0070700_100022153
1581 Ga0070700_100074865
1582 Ga0070700_100224108
1583 Ga0070700_100258115
1584 Ga0070663_100050083
1585 Ga0070663_100167443
1586 Ga0070663_100180785
1587 Ga0070663_100205322
1588 Ga0070663_100291292
1589 Ga0070663_100295605
1590 Ga0070678_100068714
1591 Ga0070678_100224560
1592 Ga0070678_100245588
1593 Ga0070678_100357447
1594 Ga0070678_100762382
1595 Ga0070678_101273192
1596 Ga0070662_100121384
1597 Ga0070662_100131554
1598 Ga0070681_10189399
1599 Ga0070681_10341204
1600 Ga0070681_10782795
1601 Ga0068867_100000784
1602 Ga0068867_100117960
1603 Ga0068867_100724788
1604 Ga0070685_10037258
1605 Ga0070685_10038115
1606 Ga0070685_10122794
1607 Ga0070706_100899683
1608 Ga0070698_100010346
1609 Ga0070679_100284160
1610 Ga0070679_101277657
1611 Ga0070684_100002313
1612 Ga0070684_100096172
1613 Ga0070684_100108463
1614 Ga0070684_100209837
1615 Ga0070684_100299370
1616 Ga0070684_100303011
1617 Ga0070684_100315931
1618 Ga0068853_100073776
1619 Ga0068853_100112874
1620 Ga0068853_100141854
1621 Ga0068853_100193957
1622 Ga0068853_100451793
1623 Ga0070672_100021433
1624 Ga0070672_100066444
1625 Ga0070672_100457835
1626 Ga0070672_101211483
1627 Ga0070686_100024753
1628 Ga0070686_100211952
1629 Ga0070696_100007791
1630 Ga0070696_100077230
1631 Ga0070693_100027117
1632 Ga0070693_100753762
1633 Ga0070665_100011936
1634 Ga0070665_100243480
1635 Ga0068855_100043083
1636 Ga0068855_100341815
1637 Ga0068855_100381020
1638 Ga0068855_100712583
1639 Ga0070664_100108586
1640 Ga0070664_100534720
1641 Ga0070664_101065513
1642 Ga0068857_100008605
1643 Ga0068857_100577588
1644 Ga0068857_100973544
1645 Ga0068854_100003214
1646 Ga0068854_100179576
1647 Ga0068854_100376948
1648 Ga0068854_100469773
1649 Ga0068854_100839667
1650 Ga0068856_100031115
1651 Ga0068856_100133674
1652 Ga0068856_100372162
1653 Ga0070702_100000198
1654 Ga0070702_100000960
1655 Ga0070702_100027425
1656 Ga0070702_100097787
1657 Ga0070702_100315689
1658 Ga0070702_100448041
1659 Ga0070702_100515872
1660 Ga0068852_100040899
1661 Ga0068852_100219994
1662 Ga0068852_100287987
1663 Ga0068852_100924795
1664 Ga0068859_100771629
1665 Ga0068859_101408252
1666 Ga0068859_101497231
1667 Ga0068864_100129089
1668 Ga0068864_100365270
1669 Ga0068864_101036297
1670 Ga0068866_10065526
1671 Ga0068861_100003392
1672 Ga0068861_100113242
1673 Ga0068861_100147499
1674 Ga0068861_100182599
1675 Ga0068861_100822369
1676 Ga0068851_10193429
1677 Ga0068851_10329431
1678 Ga0068870_10308961
1679 Ga0068863_100472924
1680 Ga0068858_100589602
1681 Ga0068860_100161079
1682 Ga0068860_100169410
1683 Ga0068860_100219702
1684 Ga0068860_100435859
1685 Ga0068862_100442512
1686 Ga0081455_10010056
1687 Ga0081455_10128516
1688 Ga0081455_10451870
1689 Ga0081538_10000264
1690 Ga0081540_1130051
1691 Ga0081539_10000238
1692 Ga0075365_10006159
1693 Ga0075365_10013835
1694 Ga0075365_10086841
1695 Ga0075368_10025746
1696 Ga0075363_100015813
1697 Ga0075363_100111268
1698 Ga0075363_100233350
1699 Ga0075364_10016481
1700 Ga0075364_10026351
1701 Ga0075364_10110319
1702 Ga0075364_10128675
1703 Ga0075364_10640723
1704 Ga0075432_10007355
1705 Ga0075362_10019347
1706 Ga0075369_10004944
1707 Ga0075369_10010273
1708 Ga0075427_10002551
1709 Ga0097621_100923509
1710 Ga0068871_101051707
1711 Ga0075428_100016246
1712 Ga0075428_100134859
1713 Ga0075430_100003324
1714 Ga0075431_100002859
1715 Ga0075431_100054108
1716 Ga0075431_100111155
1717 Ga0075433_10001418
1718 Ga0075434_100049988
1719 Ga0075429_100033963
1720 Ga0068865_100010755
1721 Ga0068865_100012655
1722 Ga0068865_100025829
1723 Ga0068865_100772450
1724 Ga0075436_100097717
1725 Ga0097620_100771677
1726 Ga0097620_101408410
1727 Ga0097620_101497404
1728 Ga0075435_100002572
1729 Ga0105244_10068218
1730 Ga0105240_10093336
1731 Ga0111539_10022754
1732 Ga0111539_11623467
1733 Ga0111539_11711474
1734 Ga0105245_10016704
1735 Ga0105245_10044869
1736 Ga0105245_10070074
1737 Ga0105245_10218504
1738 Ga0105245_10251582
1739 Ga0105245_10295747
1740 Ga0105245_10931082
1741 Ga0105245_12459744
1742 Ga0105247_10532272
1743 Ga0105247_10585039
1744 Ga0114129_10000234
1745 Ga0114129_10016860
1746 Ga0105243_10003243
1747 Ga0105243_10005983
1748 Ga0105243_10009041
1749 Ga0105243_10011327
1750 Ga0105243_10062730
1751 Ga0105243_10115080
1752 Ga0105243_10145722
1753 Ga0105243_10580052
1754 Ga0105243_10877187
1755 Ga0105241_10002725
1756 Ga0105241_10911232
1757 Ga0105241_11619442
1758 Ga0105242_10037768
1759 Ga0105242_10060234
1760 Ga0105242_10155997
1761 Ga0105248_10011888
1762 Ga0105248_10284292
1763 Ga0105237_10024920
1764 Ga0105237_10183011
1765 Ga0105238_10019028
1766 Ga0105238_10062025
1767 Ga0105238_10104550
1768 Ga0105238_10109326
1769 Ga0105238_10410438
1770 Ga0105249_10006314
1771 Ga0105249_10008124
1772 Ga0105249_10057570
1773 Ga0105249_10061123
1774 Ga0105249_10138118
1775 Ga0105249_10268781
1776 Ga0105249_10325220
1777 Ga0105249_10377305
1778 Ga0105249_10379376
1779 Ga0105249_10509387
1780 Ga0105239_10002486
1781 Ga0105239_10088329
1782 Ga0105239_10095783
1783 Ga0105239_10127383
1784 Ga0105239_10215527
1785 Ga0105239_10248438
1786 Ga0105239_10296559
1787 Ga0105239_10325033
1788 Ga0105239_10584119
1789 Ga0105239_11127023
1790 Ga0105246_10000375
1791 Ga0105246_10072522
1792 Ga0105246_10094043
1793 Ga0105246_10299301
1794 Ga0105246_10465319
1795 Ga0105246_10952920
1796 Ga0157325_1004475
1797 Ga0157321_1000406
1798 Ga0157343_1008122
1799 Ga0157319_1004623
1800 Ga0157347_1003844
1801 Ga0157313_1011957
1802 Ga0157342_1010297
1803 Ga0157373_10533853
1804 Ga0157371_10019390
1805 Ga0157371_10079223
1806 Ga0157371_10573597
1807 Ga0157370_10004788
1808 Ga0157370_10006538
1809 Ga0157370_10095226
1810 Ga0157370_10355780
1811 Ga0157370_10427220
1812 Ga0157370_11139210
1813 Ga0157369_10010161
1814 Ga0157369_10016634
1815 Ga0157369_10105060
1816 Ga0157369_10108064
1817 Ga0157369_10272260
1818 Ga0157369_10364067
1819 Ga0157369_10408981
1820 Ga0157369_10466027
1821 Ga0157369_10590908
1822 Ga0157369_10732029
1823 Ga0157369_11191472
1824 Ga0157374_10475851
1825 Ga0157378_10014969
1826 Ga0163162_10092421
1827 Ga0163162_10273040
1828 Ga0163162_10380119
1829 Ga0157372_10025059
1830 Ga0157372_10057267
1831 Ga0157372_10058284
1832 Ga0157372_10094943
1833 Ga0157372_10097076
1834 Ga0157372_10114562
1835 Ga0157372_10630238
1836 Ga0157372_11321908
1837 Ga0157375_10026944
1838 Ga0157375_10038724
1839 Ga0157375_10079957
1840 Ga0157375_10321322
1841 Ga0157375_10385433
1842 Ga0157375_10557045
1843 Ga0157375_12297000
1844 Ga0163163_10030515
1845 Ga0163163_10071780
1846 Ga0163163_10185290
1847 Ga0163163_10344432
1848 Ga0163163_10394324
1849 Ga0163163_10538988
1850 Ga0157380_10015279
1851 Ga0157380_10025399
1852 Ga0157380_10220676
1853 Ga0157380_10844187
1854 Ga0157380_11924008
1855 Ga0182008_10292172
1856 Ga0157377_10102324
1857 Ga0157377_10172050
1858 Ga0157377_10393549
1859 Ga0157377_10565305
1860 Ga0157379_10184052
1861 Ga0157376_10465676
1862 Ga0163161_10011013
1863 Ga0163161_10020151
1864 Ga0163161_10020682
1865 Ga0163161_10098912
1866 Ga0163161_10135758
1867 Ga0163161_10193138
1868 Ga0163161_10242480
1869 Ga0163161_10314183
1870 Ga0163161_10372918
1871 Ga0197907_10126050
1872 Ga0197907_10461269
1873 Ga0197907_10816215
1874 Ga0197907_10855188
1875 Ga0197907_11033948
1876 Ga0206356_10575752
1877 Ga0206356_11501797
1878 Ga0206356_11683455
1879 Ga0206349_1102446
1880 Ga0206349_1236471
1881 Ga0206349_1261242
1882 Ga0206349_1263143
1883 Ga0206349_1363221
1884 Ga0206349_1695142
1885 Ga0206349_1741347
1886 Ga0206349_1983558
1887 Ga0206355_1045293
1888 Ga0206355_1051652
1889 Ga0206355_1375645
1890 Ga0206351_10765091
1891 Ga0206351_10824243
1892 Ga0206351_10837268
1893 Ga0206352_10113150
1894 Ga0206352_10950465
1895 Ga0206352_10992946
1896 Ga0206352_11057851
1897 Ga0206350_10236030
1898 Ga0206350_10280180
1899 Ga0206350_10362633
1900 Ga0206350_11330323
1901 Ga0206350_11372283
1902 Ga0206350_11527026
1903 Ga0206354_10067382
1904 Ga0206354_10159348
1905 Ga0206354_10260975
1906 Ga0206354_10278352
1907 Ga0206354_10396242
1908 Ga0206354_10724352
1909 Ga0206354_10782475
1910 Ga0206354_10857587
1911 Ga0206354_11184045
1912 Ga0206354_11358127
1913 Ga0206354_11505003
1914 Ga0206354_11524798
1915 Ga0206354_11570982
1916 Ga0206353_10239144
1917 Ga0206353_10481029
1918 Ga0206353_10875366
1919 Ga0206353_11040760
1920 Ga0206353_11142484
1921 Ga0206353_11211517
1922 Ga0206353_11277739
1923 Ga0206353_11325172
1924 Ga0206353_11334241
1925 Ga0206353_11377281
1926 Ga0206353_11402636
1927 Ga0206353_11724933
1928 Ga0154015_1274330
1929 Ga0154015_1375022
1930 Ga0213875_10266753
1931 Ga0224712_10077111
1932 Ga0224712_10094614
1933 Ga0224712_10116741
1934 Ga0224712_10119699
1935 Ga0209646_1000088
1936 Ga0207697_10015594
1937 Ga0207655_1019276
1938 Ga0207655_1067251
1939 Ga0207682_10088748
1940 Ga0207682_10136850
1941 Ga0207642_10003527
1942 Ga0207642_10015040
1943 Ga0207642_10286385
1944 Ga0207688_10011562
1945 Ga0207688_10016175
1946 Ga0207688_10016280
1947 Ga0207688_10077374
1948 Ga0207688_10101446
1949 Ga0207688_10133551
1950 Ga0207688_10160278
1951 Ga0207688_10165895
1952 Ga0207688_10334118
1953 Ga0207647_10002961
1954 Ga0207647_10020382
1955 Ga0207647_10037728
1956 Ga0207647_10192684
1957 Ga0207647_10329880
1958 Ga0207645_10149934
1959 Ga0207643_10027402
1960 Ga0207643_10287967
1961 Ga0207643_10385005
1962 Ga0207705_10000001
1963 Ga0207705_10324895
1964 Ga0207684_10392112
1965 Ga0207654_10536722
1966 Ga0207707_10269891
1967 Ga0207707_10619305
1968 Ga0207695_10000465
1969 Ga0207671_10000128
1970 Ga0207671_10274193
1971 Ga0207660_10257186
1972 Ga0207662_10039062
1973 Ga0207662_10589718
1974 Ga0207662_10765588
1975 Ga0207657_10049317
1976 Ga0207657_10059784
1977 Ga0207657_10125259
1978 Ga0207657_10161338
1979 Ga0207657_10368056
1980 Ga0207649_10045895
1981 Ga0207649_10897042
1982 Ga0207652_10205613
1983 Ga0207652_10680977
1984 Ga0207652_10826294
1985 Ga0207681_10197991
1986 Ga0207694_10002060
1987 Ga0207694_10067314
1988 Ga0207694_10110758
1989 Ga0207694_10210072
1990 Ga0207694_10224432
1991 Ga0207694_10367392
1992 Ga0207659_10114978
1993 Ga0207659_10235885
1994 Ga0207659_10257645
1995 Ga0207659_11393469
1996 Ga0207687_10042556
1997 Ga0207687_10095826
1998 Ga0207687_10167381
1999 Ga0207687_10290339
2000 Ga0207687_10342592
2001 Ga0207644_10290383
2002 Ga0207690_10016816
2003 Ga0207690_10031073
2004 Ga0207690_10053882
2005 Ga0207690_10340464
2006 Ga0207690_10411309
2007 Ga0207690_10479034
2008 Ga0207690_10569851
2009 Ga0207706_10054631
2010 Ga0207706_10287587
2011 Ga0207706_10302366
2012 Ga0207686_10022157
2013 Ga0207686_10059204
2014 Ga0207686_10369569
2015 Ga0207709_10012343
2016 Ga0207709_10018638
2017 Ga0207709_10051293
2018 Ga0207709_10070878
2019 Ga0207709_10243460
2020 Ga0207709_10253947
2021 Ga0207709_10265417
2022 Ga0207709_10927835
2023 Ga0207670_10071964
2024 Ga0207670_10258098
2025 Ga0207669_10045971
2026 Ga0207669_10126333
2027 Ga0207669_10204167
2028 Ga0207669_10401292
2029 Ga0207669_10941574
2030 Ga0207704_10007836
2031 Ga0207704_10081281
2032 Ga0207704_10091887
2033 Ga0207704_10351830
2034 Ga0207704_10773470
2035 Ga0207691_10008019
2036 Ga0207711_10072369
2037 Ga0207711_10076921
2038 Ga0207711_10960028
2039 Ga0207689_10017470
2040 Ga0207661_10001526
2041 Ga0207661_10030791
2042 Ga0207661_10039725
2043 Ga0207661_10052916
2044 Ga0207661_10081977
2045 Ga0207661_10120502
2046 Ga0207661_10181137
2047 Ga0207679_10036798
2048 Ga0207679_10317579
2049 Ga0207679_10534095
2050 Ga0207679_10802425
2051 Ga0207679_10948305
2052 Ga0207667_10012609
2053 Ga0207667_10129929
2054 Ga0207667_10359093
2055 Ga0207667_10639209
2056 Ga0207651_10010408
2057 Ga0207712_10057085
2058 Ga0207712_10116575
2059 Ga0207712_10220021
2060 Ga0207712_10466744
2061 Ga0207712_10535551
2062 Ga0207712_11062860
2063 Ga0207712_11195608
2064 Ga0207668_10118889
2065 Ga0207668_10123305
2066 Ga0207668_10606280
2067 Ga0207668_10834844
2068 Ga0207640_10005084
2069 Ga0207640_10156829
2070 Ga0207640_10342266
2071 Ga0207640_10680714
2072 Ga0207640_10827943
2073 Ga0207658_10063520
2074 Ga0207658_10469078
2075 Ga0207658_11011336
2076 Ga0207677_10098967
2077 Ga0207677_10253451
2078 Ga0207677_10810763
2079 Ga0207677_10923858
2080 Ga0207639_10035824
2081 Ga0207639_10062063
2082 Ga0207639_10062509
2083 Ga0207639_10257158
2084 Ga0207639_10557672
2085 Ga0207639_10614819
2086 Ga0207678_10045508
2087 Ga0207678_10069737
2088 Ga0207678_10224531
2089 Ga0207678_10544054
2090 Ga0207708_10001069
2091 Ga0207708_10122988
2092 Ga0207708_10630564
2093 Ga0207708_10644253
2094 Ga0207708_10696383
2095 Ga0207702_10085444
2096 Ga0207702_10581606
2097 Ga0207702_11103980
2098 Ga0207702_11277392
2099 Ga0207641_10858749
2100 Ga0207648_10185813
2101 Ga0207676_10095535
2102 Ga0207676_11708079
2103 Ga0207674_10007103
2104 Ga0207674_10040017
2105 Ga0207674_10135959
2106 Ga0207674_10518408
2107 Ga0207674_10887166
2108 Ga0207674_11300190
2109 Ga0207675_100010022
2110 Ga0207675_100053232
2111 Ga0207675_100156720
2112 Ga0207675_100215039
2113 Ga0207675_100253106
2114 Ga0207675_100588245
2115 Ga0207683_10036960
2116 Ga0207683_10043268
2117 Ga0207683_10059593
2118 Ga0207683_10069837
2119 Ga0207683_10150972
2120 Ga0207683_10167624
2121 Ga0207683_10196077
2122 Ga0207683_10242834
2123 Ga0207683_10386925
2124 Ga0207683_10673340
2125 Ga0207683_11395983
2126 Ga0207683_11649167
2127 Ga0207698_10038296
2128 Ga0207698_10093155
2129 Ga0207698_10121155
2130 Ga0207698_10199750
2131 Ga0207698_10650438
2132 Ga0207698_11090255
2133 Ga0209974_10038742
2134 Ga0207428_10000964
2135 Ga0268266_10204244
2136 Ga0268265_10765304
2137 Ga0268264_10000716
2138 Ga0268264_10375200
2139 Ga0268264_10452867
2140 Ga0307517_10177704
2141 Ga0316183_1096233
2142 Ga0316181_1110679
2143 Ga0316181_1238547
2144 Ga0316181_1251928
2145 Ga0316182_1417880
2146 Ga0307513_10139703
2147 Ga0307408_100018661
2148 Ga0307408_100125180
2149 Ga0307408_100129335
2150 Ga0307408_100249651
2151 Ga0307408_100262927
2152 Ga0316579_10045825
2153 Ga0316576_10000044
2154 Ga0316576_10043684
2155 Ga0316578_10020590
2156 Ga0307405_10001317
2157 Ga0307405_10003937
2158 Ga0307405_10087749
2159 Ga0307405_10091114
2160 Ga0307405_10106517
2161 Ga0307405_10106930
2162 Ga0307405_10224977
2163 Ga0307405_10518794
2164 Ga0307413_10000082
2165 Ga0307413_10084647
2166 Ga0307413_10100465
2167 Ga0307413_10321596
2168 Ga0307413_10331269
2169 Ga0307410_10011148
2170 Ga0307410_10017454
2171 Ga0307410_10018360
2172 Ga0307410_10061238
2173 Ga0307410_10136142
2174 Ga0307410_10197025
2175 Ga0307410_10270233
2176 Ga0307410_10403599
2177 Ga0307406_10002332
2178 Ga0307406_10004112
2179 Ga0307406_10005754
2180 Ga0307406_10026994
2181 Ga0307406_10160376
2182 Ga0307406_10294194
2183 Ga0307406_10519179
2184 Ga0307406_10744407
2185 Ga0307406_10783431
2186 Ga0307406_11282403
2187 Ga0307407_10002766
2188 Ga0307407_10031526
2189 Ga0307407_10033737
2190 Ga0307407_10055716
2191 Ga0307407_10075247
2192 Ga0307407_10109185
2193 Ga0307407_10125730
2194 Ga0307407_10196173
2195 Ga0307407_10419247
2196 Ga0307407_11167375
2197 Ga0307412_10023822
2198 Ga0307412_10031696
2199 Ga0307412_10082524
2200 Ga0307412_10189789
2201 Ga0307412_10257670
2202 Ga0307412_10495138
2203 Ga0307412_10827502
2204 Ga0307409_100000050
2205 Ga0307409_100008307
2206 Ga0307409_100040626
2207 Ga0307409_100046691
2208 Ga0307409_100070481
2209 Ga0307409_100071899
2210 Ga0307409_101316939
2211 Ga0307416_100000150
2212 Ga0307416_100023522
2213 Ga0307416_100078718
2214 Ga0307416_100094006
2215 Ga0307416_100126118
2216 Ga0307416_100221560
2217 Ga0307416_100366011
2218 Ga0307416_100576308
2219 Ga0307416_100761619
2220 Ga0307416_101175456
2221 Ga0307414_10002253
2222 Ga0307414_10146268
2223 Ga0307414_10176030
2224 Ga0307414_10270642
2225 Ga0307414_10287591
2226 Ga0307414_10305081
2227 Ga0307414_10951889
2228 Ga0307414_10991117
2229 Ga0307411_10019042
2230 Ga0307411_10037214
2231 Ga0307411_10040253
2232 Ga0307411_10352240
2233 Ga0307411_10480043
2234 Ga0307415_100031578
2235 Ga0307415_100146442
2236 Ga0307415_100158736
2237 Ga0307415_100167957
2238 Ga0307415_100206740
2239 Ga0307415_100280796
2240 Ga0316583_10023709
2241 Ga0316585_10017855
2242 Ga0316580_10060057
2243 Ga0316588_1033508
2244 Ga0316596_1053502
2245 Ga0373931_0053018
2246 Ga0373937_0537888
2247 Ga0316584_0036284
2248 Ga0316584_0492845
2249 Ga0395899_0179802
2250 Ga0395899_0283766
2251 Ga0395899_0351035
2252 Ga0395900_0147607
2253 Ga0395900_0209282
2254 Ga0395900_0957769
2255 Ga0395898_0116077
2256 Ga0395898_0356157
2257 Ga0316581_0000918
2258 Ga0436364_0980202
2259 Ga0395901_0257689
2260 Ga0395901_0426330
2261 Ga0395901_0556527
2262 Ga0395901_0991661
2263 Ga0400488_11281
2264 Ga0400486_03564
2265 Ga0436365_1705036
2266 Ga0439436_0010622
2267 Ga0439436_0140863
2268 Ga0439465_0031175
2269 Ga0439465_0185367
2270 Ga0451791_1478727
2271 Ga0451793_1618369
2272 Ga0451800_0512413
2273 Ga0451806_586639
2274 Ga0451807_2174170
2275 Ga0451837_1113271
2276 Ga0439448_0011573
2277 Ga0439448_0146839
2278 Ga0439432_025491
2279 Ga0439450_032831
2280 Ga0439462_0036390
2281 Ga0439463_002858
2282 Ga0439463_128134
2283 Ga0450912_011710
2284 Ga0450920_060584
2285 Ga0439446_0151778
2286 Ga0439435_0004572
2287 Ga0439444_0001270
2288 Ga0439464_0010535
2289 Ga0439464_0067924
2290 Ga0450918_096169
2291 Ga0439440_0004003
2292 Ga0439440_0019724
2293 Ga0466969_0026550
2294 Ga0466969_0031800
2295 Ga0466969_0044386
2296 Ga0466972_0205735
2297 Ga0466965_0063382
2298 Ga0466965_0134546
2299 Ga0466965_0135622
2300 Ga0466965_0159769
2301 Ga0466965_0239806
2302 Ga0466966_0007159
2303 Ga0466966_0015403
2304 Ga0466966_0028371
2305 Ga0466966_0419245
2306 Ga0466961_0019337
2307 Ga0466961_0037545
2308 Ga0466961_0064101
2309 Ga0466961_0096221
2310 Ga0466961_0201734
2311 Ga0466961_0263842
2312 Ga0466961_0707591
2313 Ga0466963_0013682
2314 Ga0466963_0041521
2315 Ga0466963_0272509
2316 Ga0466963_0361708
2317 Ga0466963_0809494
2318 Ga0466963_1071301
2319 Ga0466964_0006978
2320 Ga0466964_0019416
2321 Ga0466971_0012855
2322 Ga0466971_0018447
2323 Ga0466968_0165165
2324 Ga0466970_0000027
2325 Ga0466970_0001734
2326 Ga0466970_0058140
2327 Ga0466970_0064028
2328 Ga0466970_0093046
2329 Ga0466970_0161057
2330 Ga0466970_0270609
2331 Ga0466970_0370452
2332 Ga0466957_0068291
2333 Ga0466957_0223574
2334 Ga0466957_0368680
2335 Ga0466957_0651528
2336 Ga0466957_0839109
2337 Ga0466960_0012073
2338 Ga0466960_0024128
2339 Ga0466960_0034018
2340 Ga0466960_0041643
2341 Ga0466960_0053836
2342 Ga0466960_0254480
2343 Ga0466960_0400834
2344 Ga0466959_0022475
2345 Ga0466959_0050657
2346 Ga0466959_0089417
2347 Ga0466959_0214515
2348 Ga0466959_0328588
2349 Ga0451576_0165085
2350 Ga0466958_0127343
2351 Ga0466958_0271336
2352 Ga0466958_0781369
2353 Ga0466967_0019414
2354 Ga0466967_0025932
2355 Ga0466967_0058636
2356 Ga0466967_0228547
2357 Ga0466967_0381743
2358 Ga0466967_0575945
2359 Ga0466967_0670159
2360 Ga0466967_0780758
2361 Ga0466967_0856091
2362 Ga0495627_000366
2363 Ga0495627_073803
2364 Ga0495627_076911
2365 Ga0495592_0015950
2366 Ga0495603_0271340
2367 Ga0495603_0354456
2368 Ga0495638_0071684
2369 Ga0495641_0067371
2370 Ga0495651_0002063
2371 Ga0495651_0002864
2372 Ga0495651_0037156
2373 Ga0495651_0100669
2374 Ga0495653_0013086
2375 Ga0495653_0053217
2376 Ga0495653_0409546
2377 Ga0495650_0286394
2378 Ga0495580_0005827
2379 Ga0495582_0548271
2380 Ga0495662_0000390
2381 Ga0495664_0003456
2382 Ga0495596_0167194
2383 Ga0495608_0006616
2384 Ga0495608_0098578
2385 Ga0495608_0288386
2386 Ga0495618_0081028
2387 Ga0495620_0040118
2388 Ga0495628_0036245
2389 Ga0495628_0100147
2390 Ga0495630_0038944
2391 Ga0495630_0409753
2392 Ga0495631_0083179
2393 Ga0495631_0205127
2394 Ga0495631_0244585
2395 Ga0495632_0224480
2396 Ga0495666_0018682
2397 Ga0495652_0005073
2398 Ga0495652_0030673
2399 Ga0495665_0011264
2400 Ga0495640_0010828
2401 Ga0495586_0016566
2402 Ga0495587_0005716
2403 Ga0495587_0099437
2404 Ga0495598_0084838
2405 Ga0495597_0123881
2406 Ga0495645_0003715
2407 Ga0495645_0021561
2408 Ga0495622_0028293
2409 Ga0495667_0008797
2410 Ga0495667_0476054
2411 Ga0495656_0276568
2412 Ga0495656_0306878
2413 Ga0495656_0494259
2414 Ga0495611_0038558
2415 Ga0495625_0106558
2416 Ga0495635_0012485
2417 Ga0495599_0005565
2418 Ga0495623_0007953
2419 Ga0495646_0008190
2420 Ga0495646_0071459
2421 Ga0495647_0099843
2422 Ga0495647_0216796
2423 Ga0495647_0310652
2424 Ga0495658_0006908
2425 Ga0495658_0231664
2426 Ga0495658_0253129
2427 Ga0495658_0311014
2428 Ga0495658_0373709
2429 Ga0495658_0537296
2430 Ga0495613_0018672
2431 Ga0495613_0242161
2432 Ga0495624_0333751
2433 Ga0495670_0120949
2434 Ga0495600_0002560
2435 Ga0495600_0078541
2436 Ga0495581_0012598
2437 Ga0495581_0063337
2438 Ga0495581_0170093
2439 Ga0495604_0000113
2440 Ga0495604_0073835
2441 Ga0495604_0424629
2442 Ga0495674_0014322
2443 Ga0495674_0172173
2444 Ga0495672_0011090
2445 Ga0495672_0043999
2446 Ga0495676_0108581
2447 Ga0495676_0233635
2448 Ga0495676_0309627
2449 Ga0495676_0722909
2450 Ga0495675_0002112
2451 Ga0495681_0168170
2452 Ga0495684_0011762
2453 Ga0495593_0003677
2454 Ga0495602_0015786
2455 Ga0495615_0145115
2456 Ga0496100_0155095
2457 Ga0496100_0236947
2458 Ga0496100_0490988
2459 Ga0496101_0108207
2460 Ga0496101_0161065
2461 Ga0496101_0420515
2462 Ga0496101_0494603
2463 Ga0496101_0531927
2464 Ga0496101_0666531
2465 Ga0496101_1103318
2466 Ga0496102_0009934
2467 Ga0496102_0028027
2468 Ga0496102_0239967
2469 Ga0496102_0617350
2470 Ga0496103_0034233
2471 Ga0496104_0316126
2472 Ga0496104_0435768
2473 Ga0496104_0899131
2474 Ga0496105_0357227
2475 Ga0496105_0432883
2476 Ga0496105_0440495
2477 Ga0496105_0866846
2478 Ga0496105_1023298
2479 Ga0496106_0006764
2480 Ga0496106_0135921
2481 Ga0496106_0249673
2482 Ga0496106_0383805
2483 Ga0496107_0209976
2484 Ga0496107_0275723
2485 Ga0496107_0913733
2486 Ga0496108_0016525
2487 Ga0496108_0032449
2488 Ga0496108_0080994
2489 Ga0496108_0145139
2490 Ga0496108_0277932
2491 Ga0496108_0305004
2492 Ga0496108_0636755
2493 Ga0496108_0902018
2494 Ga0496108_1004936
2495 Ga0496108_1050387
2496 Ga0496109_0004619
2497 Ga0496109_0010829
2498 Ga0496109_0026873
2499 Ga0496109_0156938
2500 Ga0496109_0256958
2501 Ga0496109_0332801
2502 Ga0496109_0372274
2503 Ga0496109_0538290
2504 Ga0496109_0603304
2505 Ga0496109_0612320
2506 Ga0496109_0782719
2507 Ga0496109_1033756
2508 Ga0496109_1213135
2509 Ga0496109_1500909
2510 Ga0496110_0003002
2511 Ga0496110_0009432
2512 Ga0496110_0102021
2513 Ga0496110_0135817
2514 Ga0496110_0224581
2515 Ga0496110_0241567
2516 Ga0496110_0411080
2517 Ga0496110_0429112
2518 Ga0496110_0661898
2519 Ga0496110_0721746
2520 Ga0496110_0947279
2521 Ga0496111_0047733
2522 Ga0496111_0166218
2523 Ga0496111_0362966
2524 Ga0496112_0164633
2525 Ga0496112_0580270
2526 Ga0496113_0065187
2527 Ga0496113_0163409
2528 Ga0496113_0234387
2529 Ga0496113_1250241
2530 Ga0496114_0014209
2531 Ga0496114_0021729
2532 Ga0496114_0037958
2533 Ga0496114_0045393
2534 Ga0496114_0046928
2535 Ga0496114_0099311
2536 Ga0496114_0100486
2537 Ga0496114_0164138
2538 Ga0496114_0226403
2539 Ga0496114_0329099
2540 Ga0496114_0369396
2541 Ga0496114_0482584
2542 Ga0496114_0492402
2543 Ga0496114_0735405
2544 Ga0496114_0794512
2545 Ga0496114_1155620
2546 Ga0496114_1225007
2547 Ga0496116_0179449
2548 Ga0496117_0000651
2549 Ga0496117_0001417
2550 Ga0496117_0001865
2551 Ga0496117_0006565
2552 Ga0496117_0361887
2553 Ga0496118_0004583
2554 Ga0496118_0040541
2555 Ga0496119_0002760
2556 Ga0496119_0010799
2557 Ga0496119_0015791
2558 Ga0496119_0255209
2559 Ga0496120_0003180
2560 Ga0496120_0006039
2561 Ga0496120_0008033
2562 Ga0496120_0347590
2563 Ga0496122_0001412
2564 Ga0496122_0001962
2565 Ga0496122_0003791
2566 Ga0496122_0011371
2567 Ga0496122_0016759
2568 Ga0496122_0022308
2569 Ga0496123_0000009
2570 Ga0496123_0002420
2571 Ga0496123_0165602
2572 Ga0496124_0016122
2573 Ga0496124_0120964
2574 Ga0496124_0255380
2575 Ga0496124_0434039
2576 Ga0496125_0000086
2577 Ga0496125_0005854
2578 Ga0496125_0012271
2579 Ga0496125_0019618
2580 Ga0496125_0050862
2581 Ga0496125_0051614
2582 Ga0496126_0001361
2583 Ga0496126_0004955
2584 Ga0496126_0072850
2585 Ga0496126_0079413
2586 Ga0496126_0130003
2587 Ga0496126_0562656
2588 Ga0501306_005444
2589 Ga0501306_005481
2590 Ga0501306_009793
2591 Ga0501306_009840
2592 Ga0501306_013272
2593 Ga0501306_017558
2594 Ga0501306_018175
2595 Ga0501306_020788
2596 Ga0501306_038680
2597 Ga0501308_003250
2598 Ga0501308_008813
2599 Ga0501308_016950
2600 Ga0501308_028109
2601 Ga0501309_007448
2602 Ga0501309_010739
2603 Ga0501309_030598
2604 Ga0501309_064581
2605 Ga0501310_000203
2606 Ga0501310_004679
2607 Ga0501310_011248
2608 Ga0501310_013202
2609 Ga0501310_019314
2610 Ga0501310_021706
2611 Ga0501310_043217
2612 Ga0501310_054264
2613 Ga0501304_005285
2614 Ga0501304_006590
2615 Ga0501304_035168
2616 Ga0501305_009438
2617 Ga0501305_011341
2618 Ga0501305_013752
2619 Ga0501305_017779
2620 Ga0501305_021051
2621 Ga0501305_022577
2622 Ga0501305_039732
2623 Ga0501307_001336
2624 Ga0501307_007043
2625 Ga0501307_008681
2626 Ga0501307_008773
2627 Ga0501307_008990
2628 Ga0501307_009302
2629 Ga0501291_003463
2630 Ga0501311_002733
2631 Ga0501311_006387
2632 Ga0501311_006689
2633 Ga0501311_007519
2634 Ga0501311_009584
2635 Ga0501311_012613
2636 Ga0501311_015533
2637 Ga0501311_016867
2638 Ga0501311_024585
2639 Ga0501311_070326
2640 Ga0501312_008978
2641 Ga0501312_010973
2642 Ga0501312_013905
2643 Ga0501312_014606
2644 Ga0501312_033162
2645 Ga0501312_053797
2646 Ga0501312_077440
2647 Ga0501313_004416
2648 Ga0501313_007160
2649 Ga0501313_008814
2650 Ga0501314_005361
2651 Ga0501314_016981
2652 Ga0501315_004377
2653 Ga0501315_007175
2654 Ga0501315_007980
2655 Ga0501315_012376
2656 Ga0501315_012540
2657 Ga0501315_013901
2658 Ga0501315_024447
2659 Ga0501315_035972
2660 Ga0501316_010829
2661 Ga0501316_013105
2662 Ga0501316_016456
2663 Ga0501316_022147
2664 Ga0501316_035199
2665 Ga0501317_000644
2666 Ga0501317_005272
2667 Ga0501317_005710
2668 Ga0501317_014600
2669 Ga0501317_016193
2670 Ga0501317_024164
2671 Ga0501317_034421
2672 Ga0501317_071509
2673 Ga0501318_000479
2674 Ga0501318_001868
2675 Ga0501318_004917
2676 Ga0501318_005596
2677 Ga0501318_007572
2678 Ga0501318_008705
2679 Ga0501318_009413
2680 Ga0501318_009609
2681 Ga0501318_011015
2682 Ga0501318_020431
2683 Ga0501319_003021
2684 Ga0501320_001217
2685 Ga0501320_004125
2686 Ga0501320_008104
2687 Ga0501320_008184
2688 Ga0501320_053653
2689 Ga0501321_000742
2690 Ga0501321_000877
2691 Ga0501321_001896
2692 Ga0501321_010063
2693 Ga0501321_013390
2694 Ga0501321_022531
2695 Ga0501322_002959
2696 Ga0501323_001151
2697 Ga0501323_024076
2698 Ga0501324_001175
2699 Ga0501324_007700
2700 Ga0501324_010748
2701 Ga0501325_001878
2702 Ga0501325_007953
2703 Ga0501031_0001904
2704 Ga0501031_0003864
2705 Ga0501031_0004771
2706 Ga0501031_0012109
2707 Ga0501031_0167765
2708 Ga0501032_0021323
2709 Ga0501032_0084511
2710 Ga0501032_0085575
2711 Ga0501032_0349515
2712 Ga0501032_0699600
2713 Ga0501033_0018229
2714 Ga0501033_0035975
2715 Ga0501034_0112724
2716 Ga0501034_0301751
2717 Ga0501034_0345444
2718 Ga0501036_0002252
2719 Ga0501036_0009602
2720 Ga0501036_0050131
2721 Ga0501036_0055279
2722 Ga0501036_0510300
2723 Ga0501036_0598772
2724 Ga0501037_0023238
2725 Ga0501037_0028258
2726 Ga0501037_0070320
2727 Ga0501037_0122037
2728 Ga0501037_0469845
2729 Ga0501038_0025278
2730 Ga0501038_0030416
2731 Ga0501038_0054600
2732 Ga0501038_0059870
2733 Ga0501038_0136034
2734 Ga0501039_0006886
2735 Ga0501039_0012457
2736 Ga0501039_0048864
2737 Ga0501039_0064077
2738 Ga0501039_0271708
2739 Ga0501039_0323047
2740 Ga0501040_0006842
2741 Ga0501040_0028375
2742 Ga0501040_0204015
2743 Ga0501040_0267132
2744 Ga0501040_0519211
2745 Ga0501040_0824722
2746 Ga0501041_0003749
2747 Ga0501041_0030801
2748 Ga0501041_0054720
2749 Ga0501042_0002441
2750 Ga0501042_0022916
2751 Ga0501042_0045764
2752 Ga0501043_0002200
2753 Ga0501043_0305605
2754 Ga0501046_0013207
2755 Ga0501046_0032560
2756 Ga0501046_0090343
2757 Ga0501048_0022554
2758 Ga0501048_0031363
2759 Ga0501048_0131984
2760 Ga0501048_0149903
2761 Ga0501048_0211903
2762 Ga0501067_0030199
2763 Ga0501067_0100591
2764 Ga0501068_0034975
2765 Ga0501068_0039920
2766 Ga0501068_0075443
2767 Ga0501069_0000273
2768 Ga0501069_0079871
2769 Ga0501070_0015859
2770 Ga0501071_0019237
2771 Ga0501071_0038154
2772 Ga0501071_0069590
2773 Ga0501071_0170372
2774 Ga0501072_0006470
2775 Ga0501072_0125162
2776 Ga0501072_0235125
2777 Ga0501072_0507509
2778 Ga0501073_0038561
2779 Ga0501073_0113814
2780 Ga0501074_0010467
2781 Ga0501074_0012517
2782 Ga0501074_0054490
2783 Ga0501074_0080968
2784 Ga0501074_0526723
2785 Ga0501075_0016824
2786 Ga0501075_0298517
2787 Ga0501075_0779902
2788 Ga0501076_0022797
2789 Ga0501076_0029017
2790 Ga0501077_0017885
2791 Ga0501077_0063158
2792 Ga0501077_0284565
2793 Ga0501235_096090
2794 Ga0501225_0043477
2795 Ga0501079_0002786
2796 Ga0501079_0525365
2797 Ga0501080_0000473
2798 Ga0501080_0038075
2799 Ga0501080_0061686
2800 Ga0501081_0001282
2801 Ga0501081_0047474
2802 Ga0501081_0059287
2803 Ga0501081_0377431
2804 Ga0501083_0003730
2805 Ga0501083_0220023
2806 Ga0501083_0543400
2807 Ga0501035_0002239
2808 Ga0501035_0155006
2809 Ga0501035_0266777
2810 Ga0501035_0467391
2811 Ga0501044_0337356
2812 Ga0501045_0017260
2813 Ga0501045_0051860
2814 Ga0501045_0096947
2815 Ga0501045_0654372
2816 nmdc:mga03683_24840_c1
2817 nmdc:mga03n38_199879_c1
2818 nmdc:mga03n38_277943_c1
2819 nmdc:mga00v17_116578_c1
2820 nmdc:mga00v17_165046_c1
2821 nmdc:mga00v17_35494_c1
2822 nmdc:mga00v17_54795_c1
2823 nmdc:mga00v17_574884_c1
2824 nmdc:mga00v17_6495_c1
2825 nmdc:mga0yw44_103044_c1
2826 nmdc:mga0yw44_106706_c1
2827 nmdc:mga0yw44_306043_c1
2828 nmdc:mga0yw44_515124_c1
2829 nmdc:mga0yw44_7451_c1
2830 nmdc:mga06z11_125951_c1
2831 nmdc:mga06z11_871932_c1
2832 nmdc:mga07m45_625818_c1
2833 nmdc:mga05p37_168329_c1
2834 nmdc:mga05p37_4106_c1
2835 nmdc:mga09592_20670_c1
2836 nmdc:mga0qj67_115114_c1
2837 nmdc:mga0qj67_4474_c1
2838 nmdc:mga06r32_51858_c1
2839 nmdc:mga06r32_5549_c1
2840 nmdc:mga08y16_23474_c1
2841 nmdc:mga0n895_24811_c1
2842 nmdc:mga0rr50_14624_c1
2843 nmdc:mga08x19_85717_c1
2844 nmdc:mga0a205_18368_c1
2845 nmdc:mga0sz30_6024_c1
2846 Ga0495601_0001806
2847 Ga0495601_0005598
2848 Ga0495612_0008090
2849 Ga0495612_0220906
2850 Ga0495612_0326289
2851 Ga0495655_0085274
2852 Ga0495655_0195219
2853 Ga0495595_0093034
2854 Ga0495595_0119311
2855 Ga0495619_0011061
2856 Ga0495619_0133782
2857 Ga0495619_0166497
2858 Ga0495619_0181164
2859 Ga0500566_0269698
2860 Ga0500573_0026341
2861 Ga0501084_0006859
2862 Ga0501084_0017067
2863 Ga0501084_0038500
2864 Ga0501084_0069026
2865 Ga0501084_0252010
2866 Ga0501084_1097914
2867 Ga0590075_009505
2868 Ga0590077_031510
2869 Ga0587084_000583
2870 Ga0587070_016923
2871 Ga0587070_088211
2872 Ga0587077_015691
2873 Ga0587082_014163
2874 Ga0587083_0016325
2875 Ga0587088_015149
2876 Ga0587089_010078
2877 Ga0587092_003462
2878 Ga0587094_011500
2879 Ga0587106_010468
2880 Ga0587106_011255
2881 Ga0587129_002032
2882 Ga0587099_003208
2883 Ga0587101_000649
2884 Ga0587109_021552
2885 Ga0587115_001523
2886 Ga0587117_009121
2887 Ga0587122_003478
2888 Ga0587122_006539
2889 Ga0587128_030836
2890 Ga0587069_012198
2891 Ga0587072_054887
2892 Ga0587100_002541
2893 Ga0587110_018867
2894 Ga0587119_001968
2895 Ga0587124_003438
2896 Ga0587111_0002409
2897 Ga0501082_0005074
2898 Ga0501082_0053946
2899 Ga0501082_0070496
2900 Ga0501082_0103067
2901 Ga0501082_0362276
2902 Ga0501082_0472208
2903 Ga0501082_0969902
2904 Ga0466962_0010205
2905 Ga0466962_0032219
2906 Ga0466962_0063964
2907 Ga0466962_0066884
2908 Ga0466962_0317566
2909 Ga0466962_0341716
2910 Ga0466962_0373690
2911 Ga0530510_0018929
2912 Ga0530510_0037945
2913 Ga0530510_0060257
2914 Ga0530510_0402199
2915 Ga0530510_0762549
2916 2643734775
2917 2643768589
2918 2643847815
2919 2643851144
2920 2643888167
2921 2644134933
2922 2644172935
2923 2644197876
2924 2644502872
2925 2644525232
2926 2644669320
2927 2676476355
2928 2723643124
2929 2739607397
2930 2747951865
2931 2760304695
2932 2809026277
2933 2809226479
2934 2810363380
2935 2812364396
2936 2812373752
2937 2816421112
2938 2819665408
2939 2819691388
2940 2819727576
2941 2827632163
2942 2848553212
2943 2852632730
2944 2852648356
2945 2852665910
2946 2852678607
2947 2857712608
2948 2857722324
2949 2857724603
2950 2857730635
2951 2862993602
2952 2883823179
2953 2887444587
2954 2893685172
2955 2897562451
2956 2905927996
2957 2919397727
2958 2928090913
2959 2928121441
2960 2946005578
2961 2946034818
2962 2946081869
2963 2984577126
2964 2984582345
2965 2984592263
2966 2990260447
2967 2995728382
2968 3001890625
2969 8004021569
2970 8004028569
2971 8004183484
2972 8055035331

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

41

161

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8k-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 2) 0.9723 34 139
8d8l-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 3) 0.9716 34 139
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9628 35 133
8csu-assembly1.cif.gz_G human mitochondrial small subunit assembly intermediate (state c*) 0.9537 36 143
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9493 33 138
ID Description Score Start End Superfamily
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9835 35 139 3.30.230.10
af_Q8IHZ4_170_300_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9694 34 139 3.30.230.10
af_Q8SXF0_266_395_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9314 33 139 3.30.230.10
af_P34388_249_392_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9247 33 139 3.30.230.10
af_Q4DEW9_314_445_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9058 42 139 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A2S8NBD5-F1-model_v4 deleted 1.001 37 116
AF-A0A537LS56-F1-model_v4 30S ribosomal protein S9 0.9935 35 121 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A7J7NB59-F1-model_v4 30S ribosomal protein S9 0.9922 36 103 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A6V7PQR4-F1-model_v4 30S ribosomal protein S9 0.9878 34 140 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A7S0MG20-F1-model_v4 30S ribosomal protein S9, chloroplastic 0.9872 34 139 GO:0003723
GO:0003735
GO:0005763
GO:0006412

Map