F494279

General Info

Members Datasets Scaffolds Average Seq Length
1482 801 1133 365

Family's Representative Sequence

Representative Sequence 3300003382|JGI26139J50223_100054|JGI26139J50223_1000543
Length 399
Sequence MKQPFSFYKYGFSPNGITLGVIGGGQLGKMLGIEAKRMSMKLAYLDPDMNCPASTLADQMIVSDFKDEKSILELAEKVDVLTYEIELANSSVLKDLESRGHLIHPASGVLKTIQNKLRQKKFLKAKGIPVPAFEEVTSVEQIKKICKEFGYPSVLKACEDSYDGRGNFLIRSTSDVERGIKYFEGRRCMIEKYIHFTKEISVMVARNTHGQIVSFPVVQNIHTNGILDTTIVPSGENRRVESNAMSIAEKVVKSLRGVGIFGIEMFLKDNKIMINEIAPRPHNSGHYSIEACSVSQFEQHIRAILGLPLVEPRLLSPVVMMXILGXPDYSGEYSFRGIEKALSVPGLKLHFYGKRITKPQRKLGHFTVTAERIEEALSRARRVRKMLTIGKRNGDKQKK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
5 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2511231004 Pseudomonas sp. GM102 Isolate Nodule
8 2511231006 Pseudomonas sp. GM17 Isolate Nodule
9 2511231007 Pseudomonas sp. GM18 Isolate Nodule
10 2511231008 Pseudomonas sp. GM21 Isolate Nodule
11 2511231010 Pseudomonas sp. GM25 Isolate Nodule
12 2511231011 Pseudomonas sp. GM30 Isolate Nodule
13 2511231012 Pseudomonas sp. GM33 Isolate Nodule
14 2511231014 Pseudomonas sp. GM48 Isolate Nodule
15 2511231015 Pseudomonas sp. GM49 Isolate Nodule
16 2511231016 Pseudomonas sp. GM50 Isolate Nodule
17 2511231017 Pseudomonas sp. GM55 Isolate Nodule
18 2511231018 Pseudomonas sp. GM60 Isolate Nodule
19 2511231019 Pseudomonas sp. GM67 Isolate Nodule
20 2511231020 Pseudomonas sp. GM74 Isolate Nodule
21 2511231021 Pseudomonas sp. GM78 Isolate Nodule
22 2511231022 Pseudomonas sp. GM79 Isolate Nodule
23 2511231023 Pseudomonas sp. GM80 Isolate Nodule
24 2511231024 Pseudomonas sp. GM84 Isolate Nodule
25 2511231031 Pseudomonas sp. GM16 Isolate Nodule
26 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
27 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
28 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
29 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
30 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
31 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
32 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
33 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
34 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
35 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
36 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
37 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
38 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
39 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
40 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
41 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
42 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
43 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
44 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
45 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
46 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
47 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
48 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
49 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
50 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
51 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
52 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
53 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
54 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
55 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
56 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
57 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
58 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
59 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
60 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
61 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
62 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
63 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
64 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
65 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
66 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
67 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
68 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
69 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
70 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
71 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
72 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
73 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
74 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
75 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
76 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
77 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
78 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
79 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
80 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
81 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
82 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
83 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
84 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
85 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
86 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
87 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
88 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
89 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
90 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
91 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
92 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
93 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
94 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
95 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
96 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
97 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
98 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
99 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
100 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
101 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
102 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
103 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
104 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
105 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
106 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
107 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
108 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
109 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
110 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
111 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
112 2643221582 Rhizobium sp. Root651 Isolate Unclassified
113 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
114 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
115 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
116 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
117 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
118 2643221693 Rhizobium sp. Root491 Isolate Unclassified
119 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
120 2643221729 Bacillus sp. Root11 Isolate Unclassified
121 2643221730 Bacillus sp. Root131 Isolate Unclassified
122 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
123 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
124 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
125 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
126 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
127 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
128 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
129 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
130 2684622632 Bacillus cereus 905 Isolate Unclassified
131 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
132 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
133 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
134 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
135 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
136 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
137 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
138 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
139 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
140 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
141 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
142 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
143 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
144 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
145 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
146 2738541358 Bacillus sp. OV752 Isolate Unclassified
147 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
148 2738543006 Bacillus sp. OK077 Isolate Unclassified
149 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
150 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
151 2738543017 Bacillus sp. OV186 Isolate Unclassified
152 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
153 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
154 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
155 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
156 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
157 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
158 2765235841 Pseudomonas putida AA7 Isolate Unclassified
159 2773857670 Pseudomonas sp. 478 Isolate Unclassified
160 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
161 2773857673 Pseudomonas sp. 443 Isolate Unclassified
162 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
163 2784132063 Pseudomonas sp. 424 Isolate Unclassified
164 2784132072 Pseudomonas sp. 460 Isolate Unclassified
165 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
166 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
167 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
168 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
169 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
170 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
171 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
172 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
173 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
174 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
175 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
176 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
177 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
178 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
179 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
180 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
181 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
182 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
183 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
184 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
185 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
186 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
187 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
188 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
189 2818991441 Niallia circulans 3243 Isolate Rhizosphere
190 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
191 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
192 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
193 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
194 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
195 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
196 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
197 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
198 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
199 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
200 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
201 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
202 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
203 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
204 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
205 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
206 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
207 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
208 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
209 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
210 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
211 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
212 2842682962 Bacillus sp. R-72492 Isolate Unclassified
213 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
214 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
215 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
216 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
217 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
218 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
219 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
220 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
221 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
222 2849139964 Bacillus sp. R-71875 Isolate Unclassified
223 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
224 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
225 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
226 2857581216 Bacillus sp. R-71922 Isolate Unclassified
227 2857586860 Bacillus sp. R-71935 Isolate Unclassified
228 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
229 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
230 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
231 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
232 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
233 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
234 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
235 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
236 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
237 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
238 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
239 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
240 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
241 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
242 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
243 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
244 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
245 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
246 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
247 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
248 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
249 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
250 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
251 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
252 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
253 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
254 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
255 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
256 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
257 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
258 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
259 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
260 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
261 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
262 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
263 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
264 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
265 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
266 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
267 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
268 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
269 2938917290 Bacillus sp. CR71 Isolate Unclassified
270 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
271 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
272 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
273 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
274 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
275 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
276 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
277 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
278 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
279 2965761152 Bacillus sp. COPE52 Isolate Unclassified
280 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
281 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
282 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
283 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
284 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
285 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
286 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
287 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
288 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
289 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
290 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
291 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
292 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
293 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
294 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
295 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
296 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
297 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
298 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
299 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
300 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
301 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
302 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
303 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
304 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
305 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
306 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
307 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
308 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
309 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
310 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
311 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
312 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
313 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
314 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
315 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
316 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
317 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
318 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
319 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
320 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
321 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
322 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
323 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
324 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
325 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
326 3300003391 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM Metagenome Rhizosphere
327 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
328 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
329 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
330 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
331 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
332 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
333 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
334 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
335 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
336 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
337 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
338 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
339 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
340 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
341 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
342 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
343 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
344 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
345 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
346 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
347 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
348 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
349 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
350 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
351 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
352 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
353 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
354 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
355 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
356 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
357 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
358 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
359 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
360 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
361 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
362 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
363 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
364 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
365 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
366 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
367 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
368 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
369 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
370 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
371 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
372 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
373 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
374 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
375 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
376 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
377 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
378 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
379 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
380 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
381 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
382 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
383 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
384 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
385 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
386 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
387 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
388 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
389 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
390 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
391 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
392 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
393 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
394 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
395 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
396 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
397 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
398 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
399 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
400 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
401 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
402 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
403 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
404 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
405 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
406 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
407 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
408 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
409 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
410 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
411 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
412 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
413 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
414 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
415 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
416 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
417 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
418 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
419 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
420 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
421 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
422 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
423 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
424 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
425 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
426 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
427 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
428 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
429 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
430 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
431 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
432 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
433 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
434 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
435 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
436 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
437 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
438 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
439 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
440 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
441 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
442 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
443 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
444 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
445 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
446 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
447 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
448 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
449 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
450 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
451 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
452 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
453 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
454 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
455 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
456 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
457 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
458 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
459 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
460 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
461 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
462 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
465 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
466 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
467 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
468 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
469 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
470 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
471 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
472 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
473 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
474 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
475 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
476 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
477 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
478 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
479 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
522 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
523 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
526 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
527 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
528 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
529 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
530 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
531 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
532 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
533 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
534 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
535 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
536 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
537 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
538 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
539 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
540 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
541 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
542 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
543 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
544 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
545 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
546 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
547 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
548 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
549 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
550 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
551 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
552 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
553 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
554 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
555 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
556 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
557 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
558 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
559 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
560 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
561 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
562 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
563 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
564 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
565 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
566 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
567 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
568 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
569 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
570 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
571 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
572 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
573 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
574 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
575 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
576 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
577 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
578 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
579 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
580 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
581 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
582 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
583 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
584 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
585 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
586 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
587 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
588 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
589 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
590 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
591 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
592 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
593 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
594 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
595 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
596 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
597 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
598 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
599 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
600 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
601 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
602 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
603 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
604 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
605 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
606 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
607 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
608 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
609 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
610 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
611 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
612 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
613 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
614 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
615 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
616 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
617 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
618 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
619 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
620 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
621 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
622 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
623 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
624 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
625 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
626 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
627 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
628 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
629 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
630 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
631 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
632 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
633 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
634 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
635 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
636 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
637 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
638 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
639 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
640 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
641 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
642 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
643 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
644 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
645 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
646 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
647 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
648 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
649 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
650 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
651 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
652 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
653 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
654 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
655 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
656 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
657 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
658 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
659 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
660 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
661 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
662 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
663 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
664 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
665 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
666 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
667 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
668 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
669 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
670 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
671 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
672 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
673 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
674 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
675 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
676 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
677 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
678 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
679 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
680 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
681 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
682 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
683 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
684 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
685 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
686 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
687 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
688 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
689 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
690 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
691 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
692 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
693 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
694 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
695 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
696 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
697 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
698 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
699 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
700 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
701 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
702 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
703 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
704 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
705 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
706 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
708 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
709 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
710 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
711 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
712 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
713 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
714 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
715 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
716 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
717 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
718 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
719 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
720 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
721 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
722 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
723 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
724 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
725 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
726 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
727 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
728 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
729 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
730 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
731 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
732 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
733 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
734 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
735 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
736 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
737 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
738 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
739 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
740 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
741 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
742 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
743 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
744 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
745 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
746 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
747 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
748 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
749 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
750 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
751 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
752 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
753 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
754 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
755 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
756 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
757 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
758 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
759 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
760 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
761 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
762 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
763 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
764 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
765 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
766 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
767 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
768 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
769 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
770 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
771 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
772 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
773 8022792930 Bacillus sp. Xin Isolate Rhizosphere
774 8023438354 Bacillus sp. BH2 Isolate Unclassified
775 8023444577 Bacillus sp. BH32 Isolate Unclassified
776 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
777 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
778 8052494512 Pseudomonas putida LD6 Isolate Unclassified
779 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
780 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
781 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
782 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
783 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
784 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
785 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
786 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
787 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
788 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
789 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
790 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
791 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
792 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
793 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
794 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
795 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
796 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
797 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
798 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
799 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
800 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
801 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.18
Metatranscriptomes 0.27
Isolates 23.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 5.67
Nodule 3.31
Rhizoplane 5.87
Rhizosphere 71.52
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_41 2124908027 Bacteria 51011
2 SwRhRL2b_contig_1813663 2162886007 Archaea 4811
3 2214767444 2209111006 Archaea 2735
4 ARSoilYngRDRAFT_c00058 3300000042 Archaea 18443
5 ARcpr5yngRDRAFT_c000667 3300000043 Unclassified 4288
6 ARCol0oldRDRAFT_c01097 3300000045 Unclassified 2003
7 ARCol0yngRDRAFT_1000156 3300000652 Archaea 12026
8 JGI24741J21665_1002517 3300001915 Bacteria 4736
9 JGI25162J39368_1000082 3300002737 Bacteria 112599
10 JGI25162J39368_1000282 3300002737 Bacteria 47984
11 JGI25163J39215_1002227 3300002771 Bacteria 2175
12 JGI25163J39215_1002252 3300002771 Bacteria 2132
13 JGI25164J39214_1000058 3300002772 Bacteria 112599
14 JGI25164J39214_1000212 3300002772 Bacteria 47984
15 JGI25151J46595_10032883 3300003187 Bacteria 2004
16 JGI25165J46597_1000154 3300003214 Bacteria 112599
17 JGI25165J46597_1000383 3300003214 Bacteria 47984
18 rootH1_10196566 3300003323 Bacteria 2082
19 JGI26139J50223_100054 3300003382 Archaea 5831
20 JGI26140J50224_100023 3300003383 Archaea 10005
21 JGI26135J50243_100037 3300003391 Archaea 3689
22 JGI26134J50242_100070 3300003392 Archaea 5465
23 JGI26137J50245_100034 3300003396 Archaea 7117
24 JGI26131J50246_100183 3300003400 Archaea 3089
25 JGI26141J51220_1000083 3300003503 Archaea 4317
26 Ga0006562J51391_1005474 3300003578 Bacteria 7544
27 Ga0006562J51391_1082126 3300003578 Bacteria 5446
28 Ga0055538_1000012 3300003751 Bacteria 353826
29 Ga0055539_1000017 3300003752 Bacteria 353873
30 Ga0055533_1000021 3300003756 Bacteria 353826
31 Ga0055532_1000020 3300003758 Bacteria 270853
32 Ga0055525_1000078 3300003759 Bacteria 165788
33 Ga0055536_1004543 3300003781 Bacteria 7053
34 Ga0055536_1009458 3300003781 Bacteria 4031
35 Ga0055530_10005470 3300003791 Bacteria 6021
36 Ga0055530_10008701 3300003791 Bacteria 4019
37 Ga0055540_1004724 3300003792 Bacteria 6021
38 Ga0055540_1007682 3300003792 Bacteria 4019
39 Ga0055540_1007709 3300003792 Bacteria 4009
40 Ga0055531_10018175 3300003794 Bacteria 2918
41 Ga0055541_1000012 3300003841 Bacteria 353826
42 Ga0058692_1002657 3300003856 Bacteria 5886
43 Ga0058692_1010554 3300003856 Bacteria 2278
44 Ga0065714_10000267 3300005288 Bacteria 6421
45 Ga0065714_10002271 3300005288 Bacteria 29440
46 Ga0065714_10079463 3300005288 Bacteria 2514
47 Ga0065714_10092917 3300005288 Bacteria 1862
48 Ga0065714_10094068 3300005288 Bacteria 1828
49 Ga0065714_10098654 3300005288 Bacteria 1705
50 Ga0065714_10115267 3300005288 Bacteria 1411
51 Ga0065704_10000453 3300005289 Archaea 26914
52 Ga0065704_10015230 3300005289 Bacteria 1992
53 Ga0065704_10075102 3300005289 Bacteria 5789
54 Ga0065704_10109318 3300005289 Bacteria 1991
55 Ga0065704_10137692 3300005289 Archaea 1537
56 Ga0065712_10067981 3300005290 Bacteria 18214
57 Ga0065715_10000311 3300005293 Archaea 15053
58 Ga0065707_10000468 3300005295 Archaea 35383
59 Ga0065707_10006314 3300005295 Archaea 3629
60 Ga0070658_10001239 3300005327 Bacteria 21882
61 Ga0070658_10011905 3300005327 Bacteria 6985
62 Ga0070676_10010547 3300005328 Archaea 5012
63 Ga0070670_100023631 3300005331 Archaea 5290
64 Ga0070670_100032384 3300005331 Bacteria 4502
65 Ga0070670_100090345 3300005331 Bacteria 2632
66 Ga0070670_100102136 3300005331 Unclassified 2469
67 Ga0070677_10000357 3300005333 Bacteria 15999
68 Ga0068869_100108529 3300005334 Archaea 2109
69 Ga0070680_100002694 3300005336 Bacteria 13171
70 Ga0070680_100021537 3300005336 Bacteria 5124
71 Ga0070680_100043723 3300005336 Archaea 3638
72 Ga0070680_100159948 3300005336 Archaea 1892
73 Ga0068868_100000090 3300005338 Bacteria 55967
74 Ga0068868_100024633 3300005338 Archaea 4569
75 Ga0070660_100000304 3300005339 Bacteria 32718
76 Ga0070660_100002009 3300005339 Bacteria 14025
77 Ga0070687_100001943 3300005343 Archaea 7543
78 Ga0070661_100004654 3300005344 Bacteria 9450
79 Ga0070669_100000186 3300005353 Bacteria 54020
80 Ga0070669_100005298 3300005353 Archaea 9312
81 Ga0070669_100005487 3300005353 Bacteria 9155
82 Ga0070675_100002894 3300005354 Archaea 12934
83 Ga0070675_100034536 3300005354 Bacteria 4105
84 Ga0070671_100125049 3300005355 Bacteria 2165
85 Ga0070673_100003226 3300005364 Archaea 10116
86 Ga0070659_100000017 3300005366 Bacteria 163966
87 Ga0070659_100176840 3300005366 Bacteria 1750
88 Ga0070667_100018360 3300005367 Archaea 5800
89 Ga0070714_100002598 3300005435 Bacteria 13311
90 Ga0070714_100106996 3300005435 Bacteria 2471
91 Ga0070701_10040588 3300005438 Archaea 2367
92 Ga0070705_100002795 3300005440 Archaea 8697
93 Ga0070700_100007831 3300005441 Archaea 5794
94 Ga0070694_100018613 3300005444 Archaea 4410
95 Ga0070694_100056352 3300005444 Archaea 2669
96 Ga0070694_100218124 3300005444 Archaea 1430
97 Ga0070663_100103032 3300005455 Bacteria 2132
98 Ga0070662_100039239 3300005457 Archaea 3368
99 Ga0068867_100003802 3300005459 Archaea 10616
100 Ga0068867_100012617 3300005459 Archaea 5976
101 Ga0068867_100012758 3300005459 Archaea 5945
102 Ga0070679_100017671 3300005530 Bacteria 6904
103 Ga0070679_100119369 3300005530 Archaea 2622
104 Ga0068853_100000102 3300005539 Bacteria 57320
105 Ga0070672_100009136 3300005543 Archaea 6820
106 Ga0070672_100020750 3300005543 Archaea 4796
107 Ga0070695_100004446 3300005545 Archaea 8235
108 Ga0070695_100009911 3300005545 Archaea 5677
109 Ga0070696_100008204 3300005546 Archaea 6989
110 Ga0070693_100001832 3300005547 Archaea 9703
111 Ga0070693_100047719 3300005547 Archaea 2437
112 Ga0070693_100128084 3300005547 Archaea 1583
113 Ga0070665_100009114 3300005548 Bacteria 10052
114 Ga0070665_100018309 3300005548 Bacteria 7021
115 Ga0070665_100268266 3300005548 Bacteria 1708
116 Ga0070704_100029590 3300005549 Archaea 3659
117 Ga0068855_100145236 3300005563 Bacteria 2701
118 Ga0068855_100193266 3300005563 Bacteria 2294
119 Ga0070664_100000292 3300005564 Bacteria 36276
120 Ga0070664_100069489 3300005564 Bacteria 3014
121 Ga0068857_100000202 3300005577 Bacteria 38628
122 Ga0068857_100087774 3300005577 Archaea 2782
123 Ga0070702_100005406 3300005615 Archaea 5943
124 Ga0068852_100000001 3300005616 Bacteria 716526
125 Ga0068859_100031931 3300005617 Bacteria 5290
126 Ga0068864_100050941 3300005618 Archaea 3565
127 Ga0068851_10000039 3300005834 Bacteria 93193
128 Ga0068870_10006861 3300005840 Archaea 5051
129 Ga0068860_100015622 3300005843 Archaea 7413
130 Ga0068862_100009539 3300005844 Archaea 8028
131 Ga0081455_10001563 3300005937 Archaea 28124
132 Ga0081455_10091056 3300005937 Archaea 2471
133 Ga0081539_10009797 3300005985 Bacteria 7921
134 Ga0075365_10032862 3300006038 Bacteria 3339
135 Ga0075368_10008012 3300006042 Bacteria 3747
136 Ga0075363_100000028 3300006048 Bacteria 28528
137 Ga0075432_10005388 3300006058 Bacteria 4361
138 Ga0075432_10007561 3300006058 Bacteria 3702
139 Ga0075432_10011898 3300006058 Bacteria 2957
140 Ga0075432_10066334 3300006058 Bacteria 1291
141 Ga0075362_10000123 3300006177 Bacteria 21730
142 Ga0075427_10001751 3300006194 Unclassified 2827
143 Ga0075366_10002286 3300006195 Bacteria 9788
144 Ga0097621_100039789 3300006237 Archaea 3778
145 Ga0075428_100031193 3300006844 Archaea 5894
146 Ga0075428_100061051 3300006844 Unclassified 4127
147 Ga0075430_100019455 3300006846 Bacteria 5774
148 Ga0075431_100052886 3300006847 Bacteria 4187
149 Ga0075433_10001199 3300006852 Archaea 18871
150 Ga0075433_10304420 3300006852 Archaea 1411
151 Ga0075434_100013393 3300006871 Archaea 7802
152 Ga0075434_100042060 3300006871 Bacteria 4529
153 Ga0075429_100021754 3300006880 Archaea 5561
154 Ga0075429_100037148 3300006880 Archaea 4239
155 Ga0068865_100011657 3300006881 Archaea 5507
156 Ga0068865_100194332 3300006881 Archaea 1571
157 Ga0075436_100001494 3300006914 Archaea 15938
158 Ga0097620_100031931 3300006931 Bacteria 5290
159 Ga0099823_1033941 3300006944 Bacteria 4068
160 Ga0079104_1000783 3300006946 Bacteria 26990
161 Ga0079104_1001850 3300006946 Bacteria 12887
162 Ga0079104_1007967 3300006946 Bacteria 3769
163 Ga0079104_1025604 3300006946 Bacteria 1538
164 Ga0099826_10018325 3300006948 Bacteria 5285
165 Ga0099826_10022778 3300006948 Bacteria 4677
166 Ga0075435_100001664 3300007076 Archaea 14421
167 Ga0075435_100027360 3300007076 Bacteria 4459
168 Ga0105251_10000089 3300009011 Bacteria 88101
169 Ga0105251_10000309 3300009011 Bacteria 48873
170 Ga0105251_10001733 3300009011 Bacteria 18202
171 Ga0105251_10002983 3300009011 Bacteria 12666
172 Ga0105251_10008371 3300009011 Bacteria 6235
173 Ga0105251_10008769 3300009011 Bacteria 6063
174 Ga0105251_10008839 3300009011 Bacteria 6032
175 Ga0105251_10011986 3300009011 Bacteria 4922
176 Ga0105251_10016631 3300009011 Bacteria 3967
177 Ga0105251_10031611 3300009011 Bacteria 2647
178 Ga0105251_10060729 3300009011 Bacteria 1779
179 Ga0105244_10000073 3300009036 Bacteria 115279
180 Ga0105244_10008948 3300009036 Bacteria 6199
181 Ga0105244_10019839 3300009036 Bacteria 3742
182 Ga0105244_10026498 3300009036 Bacteria 3136
183 Ga0105244_10040778 3300009036 Bacteria 2408
184 Ga0105244_10053285 3300009036 Bacteria 2056
185 Ga0105244_10056111 3300009036 Bacteria 1994
186 Ga0105244_10069855 3300009036 Bacteria 1753
187 Ga0105244_10074858 3300009036 Bacteria 1683
188 Ga0105244_10081426 3300009036 Bacteria 1602
189 Ga0105244_10134339 3300009036 Bacteria 1193
190 Ga0105250_10001135 3300009092 Bacteria 15004
191 Ga0105250_10004905 3300009092 Bacteria 6080
192 Ga0105250_10006294 3300009092 Bacteria 5202
193 Ga0105250_10012182 3300009092 Bacteria 3556
194 Ga0105250_10023887 3300009092 Bacteria 2465
195 Ga0105250_10054760 3300009092 Bacteria 1600
196 Ga0105240_10011111 3300009093 Bacteria 12585
197 Ga0105240_10235193 3300009093 Bacteria 2127
198 Ga0105240_10404324 3300009093 Archaea 1537
199 Ga0111539_10017218 3300009094 Archaea 8944
200 Ga0105245_10000001 3300009098 Bacteria 939270
201 Ga0105245_10014262 3300009098 Bacteria 6924
202 Ga0114129_10067799 3300009147 Archaea 4975
203 Ga0105243_10005333 3300009148 Bacteria 10041
204 Ga0105243_10005730 3300009148 Bacteria 9649
205 Ga0105243_10006305 3300009148 Bacteria 9166
206 Ga0105243_10013497 3300009148 Bacteria 6179
207 Ga0105243_10013630 3300009148 Bacteria 6149
208 Ga0105243_10118135 3300009148 Bacteria 2231
209 Ga0105241_10013723 3300009174 Bacteria 5935
210 Ga0105242_10001069 3300009176 Bacteria 21506
211 Ga0105242_10076312 3300009176 Bacteria 2793
212 Ga0105248_10006628 3300009177 Bacteria 12693
213 Ga0105237_10000002 3300009545 Bacteria 702357
214 Ga0105237_10000737 3300009545 Bacteria 45119
215 Ga0105237_10001100 3300009545 Bacteria 36161
216 Ga0105237_10036109 3300009545 Bacteria 5000
217 Ga0105237_10064979 3300009545 Archaea 3645
218 Ga0105238_10012550 3300009551 Bacteria 8551
219 Ga0105238_10069303 3300009551 Bacteria 3527
220 Ga0105238_10213913 3300009551 Bacteria 1904
221 Ga0105249_10007620 3300009553 Bacteria 9443
222 Ga0105239_10001737 3300010375 Bacteria 28726
223 Ga0105239_10038118 3300010375 Archaea 5266
224 Ga0105246_10002522 3300011119 Bacteria 11069
225 Ga0105246_10006273 3300011119 Bacteria 7256
226 Ga0105246_10007597 3300011119 Archaea 6648
227 Ga0105246_10012251 3300011119 Bacteria 5345
228 Ga0105246_10028338 3300011119 Bacteria 3678
229 Ga0105246_10054082 3300011119 Bacteria 2765
230 Ga0105246_10061654 3300011119 Bacteria 2611
231 Ga0157340_1000098 3300012473 Archaea 2784
232 Ga0157317_1000264 3300012475 Archaea 1979
233 Ga0157320_1000028 3300012481 Archaea 3405
234 Ga0157325_1000443 3300012485 Unclassified 1717
235 Ga0157335_1000211 3300012492 Archaea 2441
236 Ga0157323_1000034 3300012495 Archaea 6189
237 Ga0157345_1000325 3300012498 Archaea 5770
238 Ga0157339_1000142 3300012505 Archaea 3328
239 Ga0157342_1001355 3300012507 Archaea 1791
240 Ga0157315_1000364 3300012508 Archaea 2038
241 Ga0157326_1000169 3300012513 Archaea 7147
242 Ga0157338_1000083 3300012515 Archaea 4088
243 Ga0157373_10010689 3300013100 Bacteria 6751
244 Ga0157373_10014293 3300013100 Bacteria 5822
245 Ga0157373_10014510 3300013100 Bacteria 5775
246 Ga0157373_10015065 3300013100 Bacteria 5655
247 Ga0157373_10015661 3300013100 Bacteria 5539
248 Ga0157373_10066263 3300013100 Bacteria 2555
249 Ga0157373_10226937 3300013100 Bacteria 1318
250 Ga0157371_10000002 3300013102 Bacteria 665040
251 Ga0157371_10000109 3300013102 Bacteria 124990
252 Ga0157371_10007309 3300013102 Bacteria 8969
253 Ga0157371_10009858 3300013102 Bacteria 7486
254 Ga0157371_10010875 3300013102 Archaea 7059
255 Ga0157371_10036088 3300013102 Bacteria 3540
256 Ga0157371_10075062 3300013102 Bacteria 2394
257 Ga0157371_10132087 3300013102 Bacteria 1777
258 Ga0157370_10000246 3300013104 Bacteria 69424
259 Ga0157370_10009550 3300013104 Bacteria 10342
260 Ga0157370_10027707 3300013104 Bacteria 5586
261 Ga0157370_10037357 3300013104 Bacteria 4708
262 Ga0157370_10039769 3300013104 Bacteria 4543
263 Ga0157370_10063353 3300013104 Bacteria 3503
264 Ga0157370_10215823 3300013104 Bacteria 1777
265 Ga0157369_10001968 3300013105 Bacteria 24775
266 Ga0157369_10028227 3300013105 Bacteria 6212
267 Ga0157369_10031841 3300013105 Bacteria 5803
268 Ga0157374_10008870 3300013296 Archaea 8612
269 Ga0157378_10002128 3300013297 Archaea 17615
270 Ga0163162_10015186 3300013306 Bacteria 7522
271 Ga0157372_10003284 3300013307 Bacteria 17473
272 Ga0157372_10004085 3300013307 Bacteria 15649
273 Ga0157372_10018767 3300013307 Bacteria 7441
274 Ga0157372_10028128 3300013307 Bacteria 6133
275 Ga0157372_10406229 3300013307 Archaea 1587
276 Ga0157372_10491938 3300013307 Bacteria 1430
277 Ga0163163_10147343 3300014325 Bacteria 2398
278 Ga0157380_10019720 3300014326 Archaea 5029
279 Ga0157380_10136915 3300014326 Archaea 2097
280 Ga0182008_10007384 3300014497 Bacteria 6071
281 Ga0182008_10007985 3300014497 Bacteria 5801
282 Ga0182008_10009595 3300014497 Bacteria 5212
283 Ga0182008_10009942 3300014497 Bacteria 5114
284 Ga0182008_10141110 3300014497 Bacteria 1205
285 Ga0182006_1004027 3300015261 Bacteria 7334
286 Ga0182006_1004263 3300015261 Bacteria 7077
287 Ga0182006_1005362 3300015261 Bacteria 6133
288 Ga0182006_1006516 3300015261 Bacteria 5417
289 Ga0182006_1026738 3300015261 Bacteria 2360
290 Ga0182006_1044443 3300015261 Bacteria 1732
291 Ga0182007_10005678 3300015262 Bacteria 5445
292 Ga0182005_1002764 3300015265 Bacteria 6119
293 Ga0182005_1003401 3300015265 Bacteria 5412
294 Ga0163161_10032067 3300017792 Bacteria 3748
295 Ga0163161_10056408 3300017792 Bacteria 2853
296 Ga0163161_10090452 3300017792 Archaea 2265
297 Ga0163161_10247925 3300017792 Bacteria 1387
298 Ga0206354_10094784 3300020081 Bacteria 2262
299 Ga0206353_10636536 3300020082 Bacteria 6502
300 Ga0213876_10003358 3300021384 Bacteria 9163
301 Ga0213876_10008931 3300021384 Bacteria 5405
302 Ga0213876_10079825 3300021384 Bacteria 1729
303 Ga0209435_100579 3300025206 Bacteria 6870
304 Ga0209760_100160 3300025207 Bacteria 40397
305 Ga0209760_100475 3300025207 Bacteria 8673
306 Ga0209784_100007 3300025224 Bacteria 747715
307 Ga0209566_100009 3300025225 Bacteria 554018
308 Ga0209674_100021 3300025226 Bacteria 629811
309 Ga0209147_100009 3300025229 Bacteria 747409
310 Ga0209147_101522 3300025229 Bacteria 8107
311 Ga0209563_100018 3300025230 Bacteria 747850
312 Ga0209563_100368 3300025230 Bacteria 16599
313 Ga0207427_100005 3300025231 Bacteria 797999
314 Ga0207427_100006 3300025231 Bacteria 785415
315 Ga0209437_100013 3300025233 Bacteria 785457
316 Ga0209437_100018 3300025233 Bacteria 694400
317 Ga0209437_105686 3300025233 Bacteria 2114
318 Ga0209258_100321 3300025242 Bacteria 72995
319 Ga0209646_1000787 3300025246 Bacteria 10866
320 Ga0209677_100012 3300025253 Bacteria 554018
321 Ga0209233_1000021 3300025261 Bacteria 798078
322 Ga0209233_1000022 3300025261 Bacteria 785415
323 Ga0209130_1005357 3300025284 Bacteria 4482
324 Ga0209676_1000015 3300025292 Bacteria 784458
325 Ga0209676_1000030 3300025292 Bacteria 506421
326 Ga0209676_1000278 3300025292 Bacteria 106516
327 Ga0209676_1020849 3300025292 Bacteria 2213
328 Ga0209025_1000043 3300025294 Bacteria 350458
329 Ga0209025_1000255 3300025294 Bacteria 125764
330 Ga0209025_1001401 3300025294 Bacteria 32001
331 Ga0209025_1004446 3300025294 Bacteria 12175
332 Ga0209025_1016363 3300025294 Bacteria 4385
333 Ga0209025_1016783 3300025294 Bacteria 4285
334 Ga0209025_1032565 3300025294 Bacteria 2432
335 Ga0209050_1000030 3300025298 Bacteria 463381
336 Ga0209050_1000061 3300025298 Bacteria 321435
337 Ga0209050_1000241 3300025298 Bacteria 118446
338 Ga0209050_1007643 3300025298 Bacteria 5991
339 Ga0209051_1000012 3300025303 Bacteria 595474
340 Ga0209051_1000519 3300025303 Bacteria 48314
341 Ga0209051_1000572 3300025303 Bacteria 44529
342 Ga0209257_1000143 3300025304 Bacteria 199975
343 Ga0209257_1008653 3300025304 Bacteria 5705
344 Ga0207697_10006971 3300025315 Archaea 5067
345 Ga0207656_10000009 3300025321 Bacteria 245637
346 Ga0207696_1000055 3300025711 Bacteria 258289
347 Ga0207696_1000078 3300025711 Bacteria 207623
348 Ga0207696_1000080 3300025711 Bacteria 199217
349 Ga0207696_1000204 3300025711 Bacteria 90602
350 Ga0207696_1000694 3300025711 Bacteria 23220
351 Ga0207696_1009751 3300025711 Bacteria 3564
352 Ga0207696_1019315 3300025711 Bacteria 2222
353 Ga0207696_1027305 3300025711 Bacteria 1760
354 Ga0207696_1030235 3300025711 Bacteria 1648
355 Ga0207655_1000033 3300025728 Bacteria 377066
356 Ga0207655_1000116 3300025728 Bacteria 161950
357 Ga0207655_1000541 3300025728 Bacteria 47787
358 Ga0207655_1002134 3300025728 Bacteria 16488
359 Ga0207655_1003636 3300025728 Bacteria 11389
360 Ga0207655_1003780 3300025728 Bacteria 11076
361 Ga0207655_1003858 3300025728 Bacteria 10912
362 Ga0207655_1004732 3300025728 Bacteria 9511
363 Ga0207655_1006294 3300025728 Bacteria 7894
364 Ga0207655_1014070 3300025728 Bacteria 4546
365 Ga0207655_1016130 3300025728 Bacteria 4107
366 Ga0207655_1020062 3300025728 Bacteria 3459
367 Ga0207655_1029363 3300025728 Bacteria 2576
368 Ga0207655_1030510 3300025728 Bacteria 2505
369 Ga0207655_1031354 3300025728 Bacteria 2451
370 Ga0207655_1031805 3300025728 Bacteria 2424
371 Ga0207655_1075271 3300025728 Bacteria 1239
372 Ga0207713_1000010 3300025735 Bacteria 528374
373 Ga0207713_1000707 3300025735 Bacteria 31256
374 Ga0207713_1000912 3300025735 Bacteria 26556
375 Ga0207713_1001898 3300025735 Bacteria 15844
376 Ga0207713_1002747 3300025735 Bacteria 12500
377 Ga0207713_1004151 3300025735 Bacteria 9518
378 Ga0207713_1004464 3300025735 Bacteria 9062
379 Ga0207713_1004468 3300025735 Bacteria 9059
380 Ga0207713_1005294 3300025735 Bacteria 8115
381 Ga0207713_1005979 3300025735 Bacteria 7507
382 Ga0207713_1025432 3300025735 Bacteria 2734
383 Ga0207682_10000578 3300025893 Bacteria 16958
384 Ga0207688_10000774 3300025901 Archaea 15921
385 Ga0207688_10018685 3300025901 Archaea 3770
386 Ga0207647_10000815 3300025904 Archaea 24206
387 Ga0207647_10009414 3300025904 Archaea 6942
388 Ga0207645_10000612 3300025907 Archaea 29556
389 Ga0207645_10132985 3300025907 Unclassified 1619
390 Ga0207643_10000173 3300025908 Archaea 44225
391 Ga0207643_10000239 3300025908 Archaea 38264
392 Ga0207643_10174993 3300025908 Archaea 1297
393 Ga0207705_10012562 3300025909 Bacteria 6113
394 Ga0207705_10020971 3300025909 Bacteria 4661
395 Ga0207654_10008653 3300025911 Bacteria 5157
396 Ga0207707_10296908 3300025912 Archaea 1398
397 Ga0207671_10000008 3300025914 Bacteria 798229
398 Ga0207671_10000027 3300025914 Bacteria 264907
399 Ga0207660_10001420 3300025917 Bacteria 16075
400 Ga0207662_10016717 3300025918 Archaea 4143
401 Ga0207657_10001623 3300025919 Bacteria 24212
402 Ga0207657_10021483 3300025919 Bacteria 6071
403 Ga0207649_10000007 3300025920 Bacteria 334217
404 Ga0207652_10003166 3300025921 Bacteria 13705
405 Ga0207681_10000059 3300025923 Bacteria 104079
406 Ga0207681_10004468 3300025923 Archaea 8607
407 Ga0207681_10031926 3300025923 Bacteria 3443
408 Ga0207694_10043789 3300025924 Bacteria 3455
409 Ga0207650_10000044 3300025925 Bacteria 183146
410 Ga0207650_10000089 3300025925 Bacteria 120962
411 Ga0207659_10017853 3300025926 Bacteria 4643
412 Ga0207687_10000004 3300025927 Bacteria 841177
413 Ga0207664_10082292 3300025929 Bacteria 2622
414 Ga0207690_10000035 3300025932 Bacteria 149201
415 Ga0207690_10032776 3300025932 Archaea 3336
416 Ga0207690_10040392 3300025932 Bacteria 3050
417 Ga0207706_10002297 3300025933 Bacteria 18648
418 Ga0207706_10002726 3300025933 Archaea 17210
419 Ga0207706_10015147 3300025933 Archaea 6978
420 Ga0207706_10121407 3300025933 Bacteria 2298
421 Ga0207706_10138548 3300025933 Archaea 2140
422 Ga0207686_10003528 3300025934 Bacteria 8397
423 Ga0207686_10060840 3300025934 Bacteria 2392
424 Ga0207686_10154773 3300025934 Archaea 1600
425 Ga0207709_10000061 3300025935 Bacteria 199097
426 Ga0207709_10000063 3300025935 Bacteria 191397
427 Ga0207709_10000545 3300025935 Bacteria 32259
428 Ga0207709_10006915 3300025935 Bacteria 6348
429 Ga0207709_10011028 3300025935 Bacteria 4983
430 Ga0207704_10039841 3300025938 Archaea 2740
431 Ga0207691_10003733 3300025940 Archaea 14777
432 Ga0207691_10043182 3300025940 Archaea 4155
433 Ga0207691_10044409 3300025940 Archaea 4092
434 Ga0207689_10002546 3300025942 Archaea 16921
435 Ga0207689_10010938 3300025942 Bacteria 7801
436 Ga0207689_10218388 3300025942 Unclassified 1575
437 Ga0207679_10000013 3300025945 Bacteria 334197
438 Ga0207679_10019106 3300025945 Bacteria 4599
439 Ga0207679_10119247 3300025945 Archaea 2097
440 Ga0207712_10010121 3300025961 Archaea 5980
441 Ga0207712_10010833 3300025961 Bacteria 5801
442 Ga0207668_10181931 3300025972 Bacteria 1659
443 Ga0207640_10006138 3300025981 Bacteria 6574
444 Ga0207640_10019529 3300025981 Bacteria 4006
445 Ga0207658_10031857 3300025986 Archaea 3748
446 Ga0207677_10000224 3300026023 Bacteria 44846
447 Ga0207639_10000091 3300026041 Bacteria 76122
448 Ga0207639_10130395 3300026041 Bacteria 2080
449 Ga0207678_10048930 3300026067 Bacteria 3653
450 Ga0207678_10057508 3300026067 Bacteria 3347
451 Ga0207708_10000131 3300026075 Archaea 58894
452 Ga0207708_10010892 3300026075 Archaea 6764
453 Ga0207708_10012565 3300026075 Archaea 6313
454 Ga0207708_10080588 3300026075 Bacteria 2501
455 Ga0207648_10001723 3300026089 Archaea 23938
456 Ga0207648_10016819 3300026089 Archaea 6669
457 Ga0207648_10018497 3300026089 Archaea 6306
458 Ga0207676_10054383 3300026095 Archaea 3138
459 Ga0207674_10000866 3300026116 Bacteria 39599
460 Ga0207674_10033629 3300026116 Bacteria 5366
461 Ga0207674_10055650 3300026116 Archaea 4021
462 Ga0207683_10416755 3300026121 Bacteria 1237
463 Ga0207698_10000001 3300026142 Bacteria 625389
464 Ga0209281_1000016 3300027111 Bacteria 588107
465 Ga0209281_1000019 3300027111 Bacteria 576164
466 Ga0209281_1006992 3300027111 Bacteria 2866
467 Ga0209389_1000036 3300027296 Bacteria 126146
468 Ga0209371_1000003 3300027312 Bacteria 1122971
469 Ga0209371_1000066 3300027312 Bacteria 212660
470 Ga0209371_1000632 3300027312 Bacteria 31121
471 Ga0209371_1000729 3300027312 Bacteria 27629
472 Ga0209969_1002764 3300027360 Bacteria 2431
473 Ga0209967_1000089 3300027364 Archaea 11945
474 Ga0209981_1000714 3300027378 Archaea 4212
475 Ga0209981_1006009 3300027378 Bacteria 1621
476 Ga0209996_1000471 3300027395 Archaea 4839
477 Ga0209996_1001591 3300027395 Bacteria 2764
478 Ga0210000_1000394 3300027462 Archaea 6105
479 Ga0209995_1000026 3300027471 Archaea 22671
480 Ga0209999_1000072 3300027543 Archaea 11637
481 Ga0209999_1006028 3300027543 Archaea 2178
482 Ga0209982_1000121 3300027552 Archaea 8453
483 Ga0209970_1000189 3300027614 Archaea 9784
484 Ga0209970_1010631 3300027614 Unclassified 1507
485 Ga0210002_1000451 3300027617 Archaea 5553
486 Ga0210002_1002809 3300027617 Unclassified 2534
487 Ga0209983_1001713 3300027665 Bacteria 4849
488 Ga0209282_1005146 3300027666 Bacteria 7997
489 Ga0209971_1001594 3300027682 Archaea 5620
490 Ga0209971_1009875 3300027682 Bacteria 2258
491 Ga0209966_1000473 3300027695 Archaea 10944
492 Ga0209998_10001230 3300027717 Archaea 6303
493 Ga0209974_10000647 3300027876 Archaea 11770
494 Ga0209974_10005170 3300027876 Archaea 4606
495 Ga0209974_10007695 3300027876 Bacteria 3706
496 Ga0207428_10000363 3300027907 Archaea 58405
497 Ga0207428_10000499 3300027907 Archaea 46861
498 Ga0207428_10004175 3300027907 Archaea 13841
499 Ga0207428_10008051 3300027907 Bacteria 9566
500 Ga0207428_10010019 3300027907 Bacteria 8481
501 Ga0207428_10034796 3300027907 Bacteria 4124
502 Ga0207428_10136120 3300027907 Bacteria 1878
503 Ga0268266_10004829 3300028379 Bacteria 12797
504 Ga0268265_10028394 3300028380 Archaea 4004
505 Ga0307517_10097154 3300028786 Bacteria 2354
506 Ga0307515_10017677 3300028794 Bacteria 12968
507 Ga0265338_10000189 3300028800 Bacteria 115979
508 Ga0265338_10013602 3300028800 Bacteria 9168
509 Ga0265338_10053664 3300028800 Bacteria 3603
510 Ga0265338_10080128 3300028800 Bacteria 2745
511 Ga0265338_10083893 3300028800 Bacteria 2663
512 Ga0237817_10467 3300030083 Bacteria 5832
513 Ga0268256_1000004 3300030500 Bacteria 1122967
514 Ga0268256_1000063 3300030500 Bacteria 212660
515 Ga0268256_1000247 3300030500 Bacteria 57439
516 Ga0307511_10125920 3300030521 Bacteria 1563
517 Ga0316179_1002654 3300030734 Bacteria 6862
518 Ga0316178_1047147 3300030735 Bacteria 102800
519 Ga0316183_1059891 3300030742 Bacteria 1982
520 Ga0316181_1001658 3300030744 Bacteria 5430
521 Ga0316181_1260236 3300030744 Bacteria 3871
522 Ga0307513_10113714 3300031456 Bacteria 2694
523 Ga0307408_100000002 3300031548 Bacteria 827227
524 Ga0307408_100013164 3300031548 Bacteria 5490
525 Ga0307408_100030241 3300031548 Bacteria 3759
526 Ga0307405_10014813 3300031731 Bacteria 4204
527 Ga0307405_10021164 3300031731 Bacteria 3651
528 Ga0307405_10139706 3300031731 Bacteria 1687
529 Ga0307405_10167710 3300031731 Bacteria 1562
530 Ga0307413_10001990 3300031824 Bacteria 8115
531 Ga0307413_10069955 3300031824 Bacteria 2204
532 Ga0307410_10002976 3300031852 Bacteria 8360
533 Ga0307409_100326381 3300031995 Bacteria 1438
534 Ga0307416_100014760 3300032002 Bacteria 5368
535 Ga0307416_100032296 3300032002 Bacteria 3953
536 Ga0307416_100081686 3300032002 Bacteria 2734
537 Ga0307414_10015714 3300032004 Bacteria 4577
538 Ga0307414_10144956 3300032004 Bacteria 1864
539 Ga0307415_100008349 3300032126 Bacteria 5730
540 Ga0307415_100062049 3300032126 Bacteria 2590
541 Ga0307510_10024600 3300033180 Bacteria 6955
542 Ga0307510_10126867 3300033180 Bacteria 2238
543 Ga0373939_0009240 3300035114 Archaea 2441
544 Ga0373962_0004103 3300035242 Archaea 3513
545 Ga0395899_0000052 3300037312 Bacteria 221643
546 Ga0395900_0000002 3300037418 Bacteria 671103
547 Ga0395900_0052744 3300037418 Bacteria 4186
548 Ga0395900_0110410 3300037418 Bacteria 2825
549 Ga0395900_0471790 3300037418 Bacteria 1208
550 Ga0395898_0050393 3300037466 Bacteria 4074
551 Ga0395901_0000013 3300038443 Bacteria 375733
552 Ga0395901_0004300 3300038443 Bacteria 14365
553 Ga0237819_00416 3300038705 Bacteria 14684
554 Ga0237819_01945 3300038705 Bacteria 4682
555 Ga0237819_02348 3300038705 Bacteria 3867
556 Ga0436365_0478409 3300039437 Bacteria 9475
557 Ga0436365_0516586 3300039437 Bacteria 13777
558 Ga0436365_1729816 3300039437 Bacteria 4249
559 Ga0436360_0114333 3300039438 Bacteria 1304
560 Ga0439436_0000094 3300041404 Bacteria 20995
561 Ga0439438_002010 3300041405 Bacteria 8866
562 Ga0439438_003391 3300041405 Bacteria 6452
563 Ga0439438_003796 3300041405 Bacteria 5971
564 Ga0439438_004810 3300041405 Bacteria 5091
565 Ga0439438_024700 3300041405 Bacteria 1644
566 Ga0439438_026050 3300041405 Bacteria 1587
567 Ga0439447_007063 3300041407 Bacteria 3595
568 Ga0439447_010462 3300041407 Bacteria 2751
569 Ga0439447_011576 3300041407 Bacteria 2567
570 Ga0439447_023361 3300041407 Bacteria 1611
571 Ga0439466_0002316 3300041411 Bacteria 7474
572 Ga0439466_0003713 3300041411 Bacteria 5893
573 Ga0439466_0006210 3300041411 Bacteria 4548
574 Ga0439466_0008448 3300041411 Bacteria 3882
575 Ga0439466_0015260 3300041411 Bacteria 2791
576 Ga0439466_0020320 3300041411 Bacteria 2366
577 Ga0439466_0038106 3300041411 Bacteria 1615
578 Ga0439437_000861 3300042000 Bacteria 3153
579 Ga0439441_006439 3300042001 Unclassified 1864
580 Ga0439432_000735 3300042006 Bacteria 12268
581 Ga0439432_000757 3300042006 Bacteria 12078
582 Ga0439432_001455 3300042006 Bacteria 8885
583 Ga0439432_003124 3300042006 Bacteria 6169
584 Ga0439432_011915 3300042006 Bacteria 2988
585 Ga0439432_038536 3300042006 Bacteria 1522
586 Ga0439450_015473 3300042008 Bacteria 1562
587 Ga0439451_010195 3300042009 Bacteria 1895
588 Ga0439452_002183 3300042010 Bacteria 7391
589 Ga0439452_002265 3300042010 Bacteria 7191
590 Ga0439452_002419 3300042010 Bacteria 6905
591 Ga0439452_003104 3300042010 Bacteria 5888
592 Ga0439452_007546 3300042010 Bacteria 3329
593 Ga0439452_017343 3300042010 Bacteria 1937
594 Ga0439454_000032 3300042011 Archaea 8781
595 Ga0439456_000080 3300042013 Bacteria 33226
596 Ga0439456_006404 3300042013 Bacteria 2403
597 Ga0439456_006694 3300042013 Bacteria 2357
598 Ga0439456_008594 3300042013 Archaea 2109
599 Ga0439456_017964 3300042013 Bacteria 1483
600 Ga0439463_000261 3300042016 Bacteria 14483
601 Ga0439463_000477 3300042016 Bacteria 11171
602 Ga0439463_000765 3300042016 Archaea 8906
603 Ga0439463_002267 3300042016 Bacteria 4929
604 Ga0450911_000011 3300042115 Bacteria 130739
605 Ga0450911_001296 3300042115 Bacteria 5940
606 Ga0450920_000286 3300042122 Bacteria 7648
607 Ga0450922_000446 3300042124 Bacteria 4426
608 Ga0450902_003051 3300042137 Bacteria 2419
609 Ga0450902_004332 3300042137 Bacteria 2106
610 Ga0450903_001699 3300042138 Bacteria 4059
611 Ga0450903_002152 3300042138 Bacteria 3526
612 Ga0450904_000115 3300042139 Bacteria 17804
613 Ga0450906_000355 3300042145 Bacteria 9282
614 Ga0450906_000517 3300042145 Bacteria 8109
615 Ga0450907_000520 3300042146 Bacteria 10559
616 Ga0450907_000867 3300042146 Bacteria 7244
617 Ga0450907_003664 3300042146 Bacteria 2712
618 Ga0450910_000137 3300042147 Bacteria 7861
619 Ga0439446_0001927 3300042156 Bacteria 4888
620 Ga0439446_0003287 3300042156 Bacteria 3990
621 Ga0439446_0003992 3300042156 Bacteria 3712
622 Ga0439446_0021049 3300042156 Unclassified 1841
623 Ga0450908_000962 3300042184 Bacteria 5546
624 Ga0450909_007054 3300042185 Bacteria 1623
625 Ga0439434_0001117 3300042435 Bacteria 7759
626 Ga0439434_0001196 3300042435 Bacteria 7472
627 Ga0439444_0000025 3300042437 Archaea 11315
628 Ga0439459_0006118 3300042438 Bacteria 1998
629 Ga0439464_0000769 3300042439 Archaea 6981
630 Ga0439464_0006763 3300042439 Bacteria 2989
631 Ga0439460_0000568 3300042461 Bacteria 8092
632 Ga0439460_0002486 3300042461 Archaea 4448
633 Ga0439460_0004700 3300042461 Bacteria 3331
634 Ga0439460_0027644 3300042461 Bacteria 1594
635 Ga0450918_001120 3300042531 Bacteria 5501
636 Ga0450901_002321 3300042533 Bacteria 2066
637 Ga0451577_0038790 3300042876 Bacteria 4283
638 Ga0451577_0045908 3300042876 Archaea 3910
639 Ga0439440_0002803 3300042993 Archaea 3315
640 Ga0439440_0008586 3300042993 Bacteria 2100
641 Ga0439440_0027586 3300042993 Archaea 1321
642 Ga0466969_0031750 3300044656 Bacteria 2687
643 Ga0466966_0010386 3300044684 Bacteria 6182
644 Ga0466963_0002599 3300044694 Bacteria 10128
645 Ga0466957_0007862 3300044842 Bacteria 6046
646 Ga0451576_0015887 3300045051 Archaea 8322
647 Ga0466958_0002591 3300045836 Bacteria 9127
648 Ga0466967_0020054 3300045976 Bacteria 5392
649 Ga0495617_002371 3300046452 Bacteria 7525
650 Ga0495617_006750 3300046452 Bacteria 4014
651 Ga0495617_007712 3300046452 Bacteria 3722
652 Ga0495617_040143 3300046452 Bacteria 1565
653 Ga0495627_000115 3300046453 Bacteria 99960
654 Ga0495627_002716 3300046453 Bacteria 8271
655 Ga0495627_014628 3300046453 Bacteria 2732
656 Ga0495627_024550 3300046453 Bacteria 1963
657 Ga0495627_036336 3300046453 Bacteria 1531
658 Ga0495603_0104203 3300046455 Bacteria 1655
659 Ga0495590_0001555 3300046457 Bacteria 9846
660 Ga0495590_0013497 3300046457 Bacteria 3000
661 Ga0495590_0015791 3300046457 Bacteria 2734
662 Ga0495591_000061 3300046458 Bacteria 126594
663 Ga0495591_000769 3300046458 Bacteria 23170
664 Ga0495591_004633 3300046458 Bacteria 6623
665 Ga0495591_005294 3300046458 Bacteria 6008
666 Ga0495591_006081 3300046458 Bacteria 5424
667 Ga0495591_007208 3300046458 Bacteria 4761
668 Ga0495591_008860 3300046458 Bacteria 4064
669 Ga0495591_009117 3300046458 Bacteria 3973
670 Ga0495591_013638 3300046458 Bacteria 2959
671 Ga0495591_020715 3300046458 Bacteria 2164
672 Ga0495591_050135 3300046458 Bacteria 1144
673 Ga0495638_0015492 3300046460 Bacteria 5117
674 Ga0495638_0023151 3300046460 Bacteria 4067
675 Ga0495638_0024593 3300046460 Bacteria 3925
676 Ga0495638_0038782 3300046460 Bacteria 3025
677 Ga0495653_0028233 3300046463 Bacteria 4487
678 Ga0495653_0032916 3300046463 Bacteria 4111
679 Ga0495653_0049907 3300046463 Bacteria 3220
680 Ga0495653_0091619 3300046463 Bacteria 2222
681 Ga0495650_0001411 3300046471 Bacteria 23439
682 Ga0495650_0003915 3300046471 Bacteria 10508
683 Ga0495650_0006927 3300046471 Bacteria 6940
684 Ga0495650_0030700 3300046471 Bacteria 2429
685 Ga0495650_0040440 3300046471 Bacteria 2001
686 Ga0495605_0000079 3300046474 Bacteria 126756
687 Ga0495605_0000441 3300046474 Bacteria 37414
688 Ga0495605_0002193 3300046474 Bacteria 12204
689 Ga0495605_0002696 3300046474 Bacteria 10871
690 Ga0495605_0010405 3300046474 Bacteria 5204
691 Ga0495605_0019206 3300046474 Bacteria 3656
692 Ga0495605_0024924 3300046474 Bacteria 3122
693 Ga0495605_0026038 3300046474 Bacteria 3042
694 Ga0495605_0039963 3300046474 Bacteria 2346
695 Ga0495605_0040798 3300046474 Bacteria 2315
696 Ga0495605_0073007 3300046474 Bacteria 1617
697 Ga0495605_0097812 3300046474 Bacteria 1352
698 Ga0495639_0004422 3300046475 Bacteria 6026
699 Ga0495584_0006922 3300046491 Bacteria 5925
700 Ga0495584_0006997 3300046491 Bacteria 5892
701 Ga0495584_0007121 3300046491 Bacteria 5843
702 Ga0495584_0007934 3300046491 Bacteria 5521
703 Ga0495584_0008019 3300046491 Bacteria 5489
704 Ga0495584_0008025 3300046491 Bacteria 5487
705 Ga0495584_0016043 3300046491 Bacteria 3822
706 Ga0495585_0009311 3300046492 Bacteria 5899
707 Ga0495585_0133382 3300046492 Bacteria 1305
708 Ga0495594_0018026 3300046499 Bacteria 3738
709 Ga0495594_0100082 3300046499 Bacteria 1630
710 Ga0495596_0000257 3300046500 Bacteria 35407
711 Ga0495596_0007840 3300046500 Bacteria 4785
712 Ga0495607_0000113 3300046501 Bacteria 84993
713 Ga0495607_0000147 3300046501 Bacteria 74197
714 Ga0495607_0001158 3300046501 Bacteria 23891
715 Ga0495607_0003466 3300046501 Bacteria 12081
716 Ga0495607_0007687 3300046501 Bacteria 7428
717 Ga0495607_0007858 3300046501 Bacteria 7342
718 Ga0495607_0073243 3300046501 Bacteria 1904
719 Ga0495607_0109322 3300046501 Bacteria 1468
720 Ga0495583_0000763 3300046506 Bacteria 40467
721 Ga0495583_0002078 3300046506 Bacteria 18068
722 Ga0495583_0002814 3300046506 Bacteria 14231
723 Ga0495583_0002975 3300046506 Bacteria 13598
724 Ga0495583_0007538 3300046506 Bacteria 6811
725 Ga0495583_0009278 3300046506 Bacteria 5894
726 Ga0495583_0032210 3300046506 Bacteria 2532
727 Ga0495606_0000139 3300046507 Bacteria 124493
728 Ga0495606_0001158 3300046507 Bacteria 37308
729 Ga0495606_0005994 3300046507 Bacteria 11392
730 Ga0495606_0009824 3300046507 Bacteria 8036
731 Ga0495606_0018173 3300046507 Bacteria 5283
732 Ga0495606_0021237 3300046507 Bacteria 4759
733 Ga0495606_0050347 3300046507 Bacteria 2725
734 Ga0495610_0011258 3300046512 Bacteria 5482
735 Ga0495610_0019562 3300046512 Bacteria 3784
736 Ga0495610_0020042 3300046512 Bacteria 3723
737 Ga0495610_0023220 3300046512 Bacteria 3376
738 Ga0495610_0057660 3300046512 Bacteria 1861
739 Ga0495610_0067114 3300046512 Bacteria 1687
740 Ga0495616_0005952 3300046513 Bacteria 7439
741 Ga0495616_0019034 3300046513 Bacteria 3753
742 Ga0495616_0032604 3300046513 Bacteria 2719
743 Ga0495616_0043199 3300046513 Bacteria 2290
744 Ga0495616_0052465 3300046513 Bacteria 2030
745 Ga0495616_0073767 3300046513 Bacteria 1645
746 Ga0495620_0000044 3300046515 Bacteria 110431
747 Ga0495620_0000270 3300046515 Bacteria 38032
748 Ga0495620_0000538 3300046515 Bacteria 24158
749 Ga0495620_0000724 3300046515 Bacteria 20326
750 Ga0495620_0006866 3300046515 Bacteria 6221
751 Ga0495620_0015829 3300046515 Bacteria 3798
752 Ga0495620_0017505 3300046515 Bacteria 3570
753 Ga0495630_0023231 3300046517 Bacteria 4583
754 Ga0495630_0066550 3300046517 Bacteria 2708
755 Ga0495631_0006682 3300046518 Bacteria 5928
756 Ga0495631_0010667 3300046518 Bacteria 4541
757 Ga0495632_0001693 3300046519 Bacteria 18034
758 Ga0495632_0006009 3300046519 Bacteria 7897
759 Ga0495632_0006158 3300046519 Bacteria 7769
760 Ga0495632_0006308 3300046519 Bacteria 7652
761 Ga0495632_0009750 3300046519 Bacteria 5757
762 Ga0495632_0010862 3300046519 Bacteria 5356
763 Ga0495632_0013427 3300046519 Bacteria 4674
764 Ga0495632_0046623 3300046519 Bacteria 2152
765 Ga0495632_0057560 3300046519 Bacteria 1897
766 Ga0495637_0000066 3300046520 Bacteria 89139
767 Ga0495637_0000239 3300046520 Bacteria 42753
768 Ga0495637_0007048 3300046520 Bacteria 5598
769 Ga0495637_0014187 3300046520 Bacteria 3762
770 Ga0495637_0014325 3300046520 Bacteria 3740
771 Ga0495637_0019951 3300046520 Bacteria 3090
772 Ga0495637_0026021 3300046520 Bacteria 2632
773 Ga0495637_0044385 3300046520 Bacteria 1892
774 Ga0495637_0046621 3300046520 Bacteria 1832
775 Ga0495637_0055494 3300046520 Bacteria 1642
776 Ga0495643_0000763 3300046522 Bacteria 36080
777 Ga0495643_0001974 3300046522 Bacteria 17209
778 Ga0495643_0002637 3300046522 Bacteria 13917
779 Ga0495643_0008586 3300046522 Bacteria 6452
780 Ga0495643_0032256 3300046522 Bacteria 2908
781 Ga0495643_0040785 3300046522 Bacteria 2533
782 Ga0495643_0145759 3300046522 Bacteria 1176
783 Ga0495644_0000476 3300046523 Bacteria 17339
784 Ga0495644_0008526 3300046523 Bacteria 3948
785 Ga0495648_0002285 3300046524 Bacteria 17885
786 Ga0495648_0007380 3300046524 Bacteria 8803
787 Ga0495648_0008468 3300046524 Bacteria 8091
788 Ga0495648_0013321 3300046524 Bacteria 6085
789 Ga0495648_0020185 3300046524 Bacteria 4658
790 Ga0495648_0025964 3300046524 Bacteria 3954
791 Ga0495648_0088112 3300046524 Bacteria 1745
792 Ga0495648_0139033 3300046524 Bacteria 1280
793 Ga0495666_0054702 3300046526 Bacteria 1913
794 Ga0495666_0098701 3300046526 Bacteria 1376
795 Ga0495642_0003701 3300046528 Bacteria 5997
796 Ga0495642_0003845 3300046528 Bacteria 5883
797 Ga0495654_0001913 3300046530 Bacteria 13821
798 Ga0495654_0007275 3300046530 Bacteria 6200
799 Ga0495654_0008103 3300046530 Bacteria 5826
800 Ga0495654_0009176 3300046530 Bacteria 5423
801 Ga0495654_0014487 3300046530 Bacteria 4196
802 Ga0495654_0019319 3300046530 Bacteria 3564
803 Ga0495654_0021353 3300046530 Bacteria 3368
804 Ga0495654_0062522 3300046530 Bacteria 1784
805 Ga0495654_0071585 3300046530 Bacteria 1642
806 Ga0495654_0077161 3300046530 Bacteria 1568
807 Ga0495587_0079919 3300046536 Bacteria 1895
808 Ga0495609_0000098 3300046538 Bacteria 103106
809 Ga0495609_0000323 3300046538 Bacteria 42572
810 Ga0495609_0000398 3300046538 Bacteria 36528
811 Ga0495597_0000137 3300046542 Bacteria 65550
812 Ga0495597_0019474 3300046542 Bacteria 3175
813 Ga0495597_0022178 3300046542 Bacteria 2947
814 Ga0495597_0022986 3300046542 Bacteria 2886
815 Ga0495622_0005353 3300046557 Bacteria 5958
816 Ga0495622_0006837 3300046557 Bacteria 5294
817 Ga0495622_0019242 3300046557 Bacteria 3179
818 Ga0495633_0000440 3300046558 Bacteria 42906
819 Ga0495633_0004409 3300046558 Bacteria 8961
820 Ga0495633_0020892 3300046558 Bacteria 3284
821 Ga0495668_0033998 3300046616 Bacteria 2862
822 Ga0495668_0040891 3300046616 Bacteria 2584
823 Ga0495668_0041083 3300046616 Bacteria 2578
824 Ga0495668_0058460 3300046616 Bacteria 2127
825 Ga0495634_0037677 3300046642 Bacteria 3303
826 Ga0495611_0001266 3300046648 Bacteria 13018
827 Ga0495611_0004728 3300046648 Bacteria 5848
828 Ga0495611_0010879 3300046648 Bacteria 3854
829 Ga0495611_0016386 3300046648 Bacteria 3168
830 Ga0495611_0031597 3300046648 Bacteria 2331
831 Ga0495625_0000113 3300046660 Bacteria 124185
832 Ga0495625_0013708 3300046660 Bacteria 6498
833 Ga0495625_0027708 3300046660 Bacteria 4258
834 Ga0495625_0039549 3300046660 Bacteria 3442
835 Ga0495625_0075893 3300046660 Bacteria 2351
836 Ga0495635_0014354 3300046663 Bacteria 5541
837 Ga0495659_0001791 3300046664 Bacteria 7127
838 Ga0495661_0000050 3300046665 Bacteria 143435
839 Ga0495661_0000112 3300046665 Bacteria 96840
840 Ga0495661_0000237 3300046665 Bacteria 63564
841 Ga0495661_0000633 3300046665 Bacteria 35712
842 Ga0495661_0006107 3300046665 Bacteria 8486
843 Ga0495661_0016928 3300046665 Bacteria 4817
844 Ga0495661_0102617 3300046665 Bacteria 1607
845 Ga0495661_0171753 3300046665 Bacteria 1155
846 Ga0495588_0025085 3300046674 Bacteria 2967
847 Ga0495588_0079410 3300046674 Bacteria 1712
848 Ga0495623_0010236 3300046679 Bacteria 6066
849 Ga0495669_0002201 3300046684 Bacteria 8004
850 Ga0495613_0103782 3300046689 Bacteria 2052
851 Ga0495624_0013052 3300046690 Bacteria 5664
852 Ga0495670_0003539 3300046691 Bacteria 7669
853 Ga0495670_0007472 3300046691 Bacteria 5368
854 Ga0495670_0023021 3300046691 Bacteria 3075
855 Ga0495670_0024154 3300046691 Bacteria 3003
856 Ga0495671_0001137 3300046692 Bacteria 18324
857 Ga0495671_0007515 3300046692 Bacteria 6205
858 Ga0495671_0008147 3300046692 Bacteria 5912
859 Ga0495671_0028508 3300046692 Bacteria 2874
860 Ga0495671_0029779 3300046692 Bacteria 2800
861 Ga0495671_0045586 3300046692 Bacteria 2194
862 Ga0495671_0071760 3300046692 Bacteria 1700
863 Ga0495671_0087557 3300046692 Bacteria 1525
864 Ga0495671_0099779 3300046692 Bacteria 1419
865 Ga0495649_0001815 3300046694 Bacteria 15676
866 Ga0495649_0002055 3300046694 Bacteria 14487
867 Ga0495649_0009532 3300046694 Bacteria 5761
868 Ga0495649_0010872 3300046694 Bacteria 5359
869 Ga0495649_0011731 3300046694 Bacteria 5128
870 Ga0495649_0021128 3300046694 Bacteria 3649
871 Ga0495649_0022205 3300046694 Bacteria 3550
872 Ga0495649_0031256 3300046694 Bacteria 2936
873 Ga0495649_0040018 3300046694 Bacteria 2568
874 Ga0495649_0096761 3300046694 Bacteria 1570
875 Ga0495589_0004591 3300046794 Bacteria 7344
876 Ga0495589_0038319 3300046794 Bacteria 2400
877 Ga0495600_0018130 3300046809 Bacteria 4482
878 Ga0495660_0000190 3300046810 Bacteria 64685
879 Ga0495660_0021050 3300046810 Bacteria 3736
880 Ga0495660_0049616 3300046810 Bacteria 2289
881 Ga0495660_0088728 3300046810 Bacteria 1610
882 Ga0495660_0096705 3300046810 Bacteria 1525
883 Ga0495604_0023499 3300047317 Bacteria 4918
884 Ga0495672_0008328 3300047320 Bacteria 7674
885 Ga0495672_0009503 3300047320 Bacteria 7039
886 Ga0495672_0010702 3300047320 Bacteria 6513
887 Ga0495672_0011678 3300047320 Bacteria 6181
888 Ga0495672_0011796 3300047320 Bacteria 6139
889 Ga0495672_0013936 3300047320 Bacteria 5526
890 Ga0495672_0019532 3300047320 Bacteria 4467
891 Ga0495672_0024934 3300047320 Bacteria 3840
892 Ga0495672_0033191 3300047320 Bacteria 3200
893 Ga0495672_0094640 3300047320 Bacteria 1633
894 Ga0495676_0000032 3300047321 Bacteria 131215
895 Ga0495676_0013185 3300047321 Bacteria 7434
896 Ga0495680_0022986 3300047322 Bacteria 5189
897 Ga0495680_0084248 3300047322 Bacteria 2395
898 Ga0495683_0000055 3300047323 Bacteria 119199
899 Ga0495683_0000236 3300047323 Bacteria 50369
900 Ga0495683_0004276 3300047323 Bacteria 8140
901 Ga0495683_0007387 3300047323 Bacteria 5952
902 Ga0495683_0008977 3300047323 Bacteria 5334
903 Ga0495683_0011955 3300047323 Bacteria 4560
904 Ga0495687_009435 3300047443 Bacteria 5452
905 Ga0495687_013719 3300047443 Bacteria 4209
906 Ga0495687_021505 3300047443 Bacteria 3118
907 Ga0495687_090065 3300047443 Bacteria 1176
908 Ga0495675_0007905 3300047444 Bacteria 6570
909 Ga0495679_030775 3300047446 Bacteria 1738
910 Ga0495679_043940 3300047446 Bacteria 1370
911 Ga0495673_0001256 3300047469 Bacteria 20933
912 Ga0495673_0002288 3300047469 Bacteria 13723
913 Ga0495673_0005066 3300047469 Bacteria 8066
914 Ga0495673_0014221 3300047469 Bacteria 4144
915 Ga0495673_0022036 3300047469 Bacteria 3130
916 Ga0495673_0024272 3300047469 Bacteria 2933
917 Ga0495673_0026466 3300047469 Bacteria 2772
918 Ga0495673_0030031 3300047469 Bacteria 2558
919 Ga0495673_0039165 3300047469 Bacteria 2151
920 Ga0495673_0061992 3300047469 Bacteria 1599
921 Ga0495673_0073270 3300047469 Bacteria 1435
922 Ga0495673_0081441 3300047469 Bacteria 1340
923 Ga0495673_0086996 3300047469 Bacteria 1283
924 Ga0495673_0105190 3300047469 Bacteria 1135
925 Ga0495681_0009856 3300047470 Bacteria 5842
926 Ga0495681_0013570 3300047470 Bacteria 4718
927 Ga0495681_0020409 3300047470 Bacteria 3596
928 Ga0495681_0029047 3300047470 Bacteria 2835
929 Ga0495681_0109114 3300047470 Bacteria 1200
930 Ga0495684_0038420 3300047471 Bacteria 3670
931 Ga0495686_0000834 3300047472 Bacteria 39641
932 Ga0495686_0012681 3300047472 Bacteria 5890
933 Ga0495686_0024290 3300047472 Bacteria 3985
934 Ga0495686_0047370 3300047472 Bacteria 2714
935 Ga0495593_0013908 3300047673 Bacteria 4584
936 Ga0495593_0052038 3300047673 Bacteria 2165
937 Ga0495593_0085127 3300047673 Bacteria 1632
938 Ga0495626_0000024 3300048091 Bacteria 214179
939 Ga0495626_0004732 3300048091 Bacteria 8236
940 Ga0495626_0005414 3300048091 Bacteria 7482
941 Ga0495626_0007792 3300048091 Bacteria 5931
942 Ga0495626_0016287 3300048091 Bacteria 3779
943 Ga0495626_0022666 3300048091 Bacteria 3099
944 Ga0495626_0027792 3300048091 Bacteria 2748
945 Ga0496100_0101817 3300048903 Archaea 1981
946 Ga0496102_0005400 3300048905 Archaea 10852
947 Ga0496102_0020156 3300048905 Bacteria 5887
948 Ga0496104_0046163 3300048907 Bacteria 4101
949 Ga0496107_0035808 3300048910 Archaea 3559
950 Ga0496109_0396407 3300048912 Bacteria 1304
951 Ga0496110_0000254 3300048913 Bacteria 34664
952 Ga0496110_0048183 3300048913 Bacteria 3735
953 Ga0496110_0120635 3300048913 Bacteria 2362
954 Ga0496110_0164361 3300048913 Bacteria 2012
955 Ga0496111_0170923 3300048914 Bacteria 1615
956 Ga0496113_0028490 3300048916 Bacteria 4018
957 Ga0496114_0143955 3300048917 Bacteria 2065
958 Ga0496116_0001725 3300048919 Bacteria 23879
959 Ga0496116_0011675 3300048919 Bacteria 7240
960 Ga0496116_0019776 3300048919 Bacteria 5144
961 Ga0496116_0025706 3300048919 Bacteria 4323
962 Ga0496117_0000052 3300048920 Bacteria 280463
963 Ga0496117_0006500 3300048920 Bacteria 11789
964 Ga0496117_0007309 3300048920 Bacteria 10841
965 Ga0496117_0008713 3300048920 Bacteria 9585
966 Ga0496117_0009017 3300048920 Bacteria 9382
967 Ga0496117_0017029 3300048920 Bacteria 6088
968 Ga0496117_0018515 3300048920 Bacteria 5762
969 Ga0496117_0030449 3300048920 Bacteria 4141
970 Ga0496117_0098658 3300048920 Bacteria 1856
971 Ga0496117_0125530 3300048920 Bacteria 1567
972 Ga0496118_0000709 3300048921 Bacteria 53670
973 Ga0496118_0028798 3300048921 Bacteria 4670
974 Ga0496118_0031832 3300048921 Bacteria 4362
975 Ga0496118_0033154 3300048921 Bacteria 4243
976 Ga0496118_0042110 3300048921 Bacteria 3607
977 Ga0496118_0065533 3300048921 Bacteria 2658
978 Ga0496118_0075233 3300048921 Bacteria 2409
979 Ga0496119_0000506 3300048922 Bacteria 53174
980 Ga0496119_0071609 3300048922 Bacteria 2028
981 Ga0496120_0000019 3300048923 Bacteria 260115
982 Ga0496120_0001362 3300048923 Bacteria 29974
983 Ga0496120_0040962 3300048923 Bacteria 2718
984 Ga0496121_0005168 3300048924 Bacteria 16939
985 Ga0496121_0006488 3300048924 Bacteria 14486
986 Ga0496121_0007935 3300048924 Bacteria 12686
987 Ga0496121_0014652 3300048924 Bacteria 8290
988 Ga0496121_0022108 3300048924 Bacteria 6188
989 Ga0496121_0096953 3300048924 Bacteria 2286
990 Ga0496121_0153909 3300048924 Bacteria 1689
991 Ga0496122_0000053 3300048925 Bacteria 260120
992 Ga0496122_0001565 3300048925 Bacteria 36130
993 Ga0496122_0007408 3300048925 Bacteria 12214
994 Ga0496122_0021592 3300048925 Bacteria 5756
995 Ga0496122_0088032 3300048925 Bacteria 2131
996 Ga0496123_0000038 3300048926 Bacteria 260120
997 Ga0496123_0001258 3300048926 Bacteria 36442
998 Ga0496123_0005881 3300048926 Bacteria 12133
999 Ga0496123_0024029 3300048926 Bacteria 4646
1000 Ga0496123_0031632 3300048926 Bacteria 3846
1001 Ga0496124_0000279 3300048927 Bacteria 97488
1002 Ga0496124_0003507 3300048927 Bacteria 19104
1003 Ga0496124_0006802 3300048927 Bacteria 12347
1004 Ga0496124_0007177 3300048927 Bacteria 11908
1005 Ga0496124_0012008 3300048927 Bacteria 8609
1006 Ga0496124_0013149 3300048927 Bacteria 8103
1007 Ga0496124_0035067 3300048927 Bacteria 4393
1008 Ga0496124_0041751 3300048927 Bacteria 3955
1009 Ga0496124_0105578 3300048927 Bacteria 2275
1010 Ga0496124_0121323 3300048927 Bacteria 2088
1011 Ga0496124_0173428 3300048927 Bacteria 1667
1012 Ga0496125_0014065 3300048928 Bacteria 7821
1013 Ga0496125_0015865 3300048928 Bacteria 7258
1014 Ga0496125_0015902 3300048928 Bacteria 7249
1015 Ga0496125_0040690 3300048928 Bacteria 3983
1016 Ga0496125_0087462 3300048928 Bacteria 2353
1017 Ga0496126_0043641 3300048929 Bacteria 4134
1018 Ga0496126_0056657 3300048929 Bacteria 3541
1019 Ga0496126_0160922 3300048929 Bacteria 1918
1020 Ga0495678_000054 3300049459 Bacteria 153487
1021 Ga0495678_000078 3300049459 Bacteria 123666
1022 Ga0495678_005003 3300049459 Bacteria 7467
1023 Ga0495678_006344 3300049459 Bacteria 6305
1024 Ga0495678_007286 3300049459 Bacteria 5754
1025 Ga0495678_011543 3300049459 Bacteria 4224
1026 Ga0495678_061005 3300049459 Bacteria 1416
1027 Ga0495682_0001399 3300049460 Bacteria 13150
1028 Ga0495682_0001713 3300049460 Bacteria 11116
1029 Ga0495682_0030254 3300049460 Bacteria 2003
1030 Ga0495682_0069278 3300049460 Bacteria 1269
1031 Ga0501031_0017408 3300049568 Unclassified 4670
1032 Ga0501032_0011796 3300049569 Bacteria 6264
1033 Ga0501033_0000913 3300049570 Bacteria 26962
1034 Ga0501033_0051844 3300049570 Bacteria 3042
1035 Ga0501034_0000136 3300049571 Bacteria 136835
1036 Ga0501034_0026829 3300049571 Bacteria 5860
1037 Ga0501036_0001043 3300049572 Archaea 20923
1038 Ga0501036_0009992 3300049572 Bacteria 7817
1039 Ga0501036_0190882 3300049572 Bacteria 1724
1040 Ga0501037_0049888 3300049573 Bacteria 3064
1041 Ga0501038_0071186 3300049574 Bacteria 2950
1042 Ga0501039_0003061 3300049575 Archaea 12507
1043 Ga0501039_0073825 3300049575 Unclassified 2650
1044 Ga0501039_0097948 3300049575 Bacteria 2287
1045 Ga0501040_0013555 3300049576 Archaea 5360
1046 Ga0501040_0057152 3300049576 Archaea 2678
1047 Ga0501041_0000144 3300049577 Archaea 31221
1048 Ga0501041_0024012 3300049577 Unclassified 3658
1049 Ga0501041_0056225 3300049577 Bacteria 2403
1050 Ga0501041_0114148 3300049577 Unclassified 1677
1051 Ga0501041_0135961 3300049577 Archaea 1532
1052 Ga0501042_0017772 3300049578 Archaea 4910
1053 Ga0501042_0152935 3300049578 Unclassified 1664
1054 Ga0501043_0211676 3300049579 Bacteria 1502
1055 Ga0501046_0034659 3300049580 Bacteria 4072
1056 Ga0501047_0215307 3300049581 Bacteria 1778
1057 Ga0501048_0007809 3300049582 Archaea 8106
1058 Ga0501048_0116063 3300049582 Archaea 1891
1059 Ga0501067_0132694 3300049583 Bacteria 1386
1060 Ga0501069_0130391 3300049585 Archaea 1439
1061 Ga0501071_0000772 3300049587 Archaea 16990
1062 Ga0501071_0005028 3300049587 Bacteria 8454
1063 Ga0501072_0001871 3300049588 Archaea 15678
1064 Ga0501072_0117024 3300049588 Bacteria 2123
1065 Ga0501075_0000617 3300049591 Archaea 21811
1066 Ga0501075_0076397 3300049591 Archaea 2533
1067 Ga0501076_0000085 3300049592 Archaea 49144
1068 Ga0501076_0008106 3300049592 Archaea 7680
1069 Ga0501076_0062357 3300049592 Archaea 2969
1070 Ga0501076_0065277 3300049592 Unclassified 2902
1071 Ga0501077_0004394 3300049593 Archaea 8549
1072 Ga0501077_0049460 3300049593 Unclassified 2672
1073 Ga0501079_0031309 3300049741 Archaea 4088
1074 Ga0501079_0046665 3300049741 Unclassified 3343
1075 Ga0501079_0134653 3300049741 Archaea 1924
1076 Ga0501080_0006827 3300049742 Archaea 10295
1077 Ga0501080_0022050 3300049742 Bacteria 5900
1078 Ga0501081_0000813 3300049743 Archaea 18427
1079 Ga0501081_0058623 3300049743 Unclassified 2664
1080 Ga0501081_0065196 3300049743 Bacteria 2531
1081 Ga0501083_0020728 3300049744 Bacteria 4571
1082 Ga0501044_0030111 3300049823 Bacteria 5721
1083 Ga0501044_0075054 3300049823 Bacteria 3433
1084 Ga0501045_0005143 3300049824 Archaea 9054
1085 Ga0501045_0015034 3300049824 Bacteria 5493
1086 Ga0501226_000060 3300049853 Bacteria 36795
1087 nmdc:mga03683_124_c1 3300050489 Bacteria 25785
1088 nmdc:mga03n38_164_c1 3300050490 Bacteria 14773
1089 nmdc:mga00v17_19984_c1 3300050491 Unclassified 3831
1090 nmdc:mga00v17_55_c1 3300050491 Bacteria 72029
1091 nmdc:mga0k408_36195_c1 3300050493 Bacteria 2833
1092 nmdc:mga05p37_87590_c1 3300050507 Archaea 3838
1093 nmdc:mga05p37_9333_c1 3300050507 Archaea 11607
1094 nmdc:mga09592_26389_c1 3300050508 Bacteria 4812
1095 nmdc:mga09592_4347_c1 3300050508 Archaea 11459
1096 nmdc:mga09592_77020_c1 3300050508 Bacteria 2837
1097 nmdc:mga09592_91436_c1 3300050508 Archaea 2601
1098 nmdc:mga0qj67_118804_c1 3300050509 Bacteria 2138
1099 nmdc:mga0qj67_162225_c1 3300050509 Archaea 1814
1100 nmdc:mga06r32_8751_c1 3300050510 Archaea 9119
1101 nmdc:mga06r32_97194_c1 3300050510 Archaea 2885
1102 nmdc:mga08y16_119701_c1 3300050511 Archaea 2741
1103 nmdc:mga08y16_2858_c1 3300050511 Archaea 17759
1104 nmdc:mga08y16_4552_c1 3300050511 Archaea 14454
1105 nmdc:mga08y16_85361_c1 3300050511 Bacteria 3290
1106 nmdc:mga0n895_155450_c1 3300050512 Archaea 1416
1107 nmdc:mga0n895_193307_c1 3300050512 Bacteria 2066
1108 nmdc:mga0n895_287948_c1 3300050512 Archaea 1666
1109 nmdc:mga0n895_75_c1 3300050512 Archaea 57220
1110 nmdc:mga0rr50_7249_c1 3300050513 Archaea 6821
1111 nmdc:mga08x19_848_c1 3300050514 Archaea 19414
1112 nmdc:mga0a205_352601_c1 3300050515 Archaea 1339
1113 nmdc:mga0a205_8161_c1 3300050515 Archaea 9513
1114 nmdc:mga0sz30_827_c1 3300050516 Bacteria 11186
1115 Ga0500583_0029764 3300053092 Bacteria 2384
1116 Ga0500651_0108059 3300053093 Bacteria 1700
1117 Ga0500641_0048344 3300053096 Bacteria 1742
1118 Ga0500650_0000224 3300053098 Bacteria 13852
1119 Ga0500560_001971 3300053107 Bacteria 3775
1120 Ga0500564_007906 3300053138 Bacteria 4536
1121 Ga0500604_0000055 3300053151 Bacteria 41071
1122 Ga0500622_0013825 3300053156 Bacteria 4349
1123 Ga0500624_000234 3300053157 Bacteria 20148
1124 Ga0500634_0026692 3300053161 Bacteria 3146
1125 Ga0501084_0006079 3300054114 Bacteria 9930
1126 Ga0501084_0010109 3300054114 Archaea 7798
1127 Ga0501084_0014674 3300054114 Archaea 6496
1128 Ga0501084_0032036 3300054114 Bacteria 4397
1129 Ga0500661_012745 3300055283 Bacteria 1517
1130 Ga0501082_0000374 3300060353 Archaea 39553
1131 Ga0530510_0003739 3300061734 Archaea 10476
1132 Ga0530510_0012586 3300061734 Bacteria 5947
1133 Ga0530510_0017902 3300061734 Archaea 5024

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0098658 Ga0496117_0098658_342_1250 283
2 3300046474 Ga0495605_0019206 Ga0495605_0019206_585_1478 297
3 3300005435 Ga0070714_100106996 Ga0070714_1001069963 310
4 3300025929 Ga0207664_10082292 Ga0207664_100822923 310
5 3300050510 nmdc:mga06r32_97194_c1 nmdc:mga06r32_97194_c1_17_1039 313
6 3300005455 Ga0070663_100103032 Ga0070663_1001030322 319
7 3300005563 Ga0068855_100145236 Ga0068855_1001452362 319
8 3300026067 Ga0207678_10057508 Ga0207678_100575082 319
9 3300026116 Ga0207674_10033629 Ga0207674_100336295 319
10 3300042006 Ga0439432_011915 Ga0439432_011915_1993_2958 321
11 3300046458 Ga0495591_050135 Ga0495591_050135_144_1109 321
12 3300046474 Ga0495605_0073007 Ga0495605_0073007_623_1588 321
13 3300046491 Ga0495584_0008019 Ga0495584_0008019_4510_5475 321
14 3300046499 Ga0495594_0100082 Ga0495594_0100082_26_991 321
15 3300046520 Ga0495637_0014187 Ga0495637_0014187_35_1000 321
16 3300046520 Ga0495637_0026021 Ga0495637_0026021_1639_2604 321
17 3300046523 Ga0495644_0008526 Ga0495644_0008526_22_987 321
18 3300046691 Ga0495670_0007472 Ga0495670_0007472_4387_5352 321
19 3300047320 Ga0495672_0009503 Ga0495672_0009503_6046_7011 321
20 3300047320 Ga0495672_0024934 Ga0495672_0024934_2848_3813 321
21 3300047443 Ga0495687_021505 Ga0495687_021505_35_1000 321
22 3300048927 Ga0496124_0173428 Ga0496124_0173428_26_991 321
23 3300005354 Ga0070675_100034536 Ga0070675_1000345363 322
24 3300005338 Ga0068868_100000090 Ga0068868_1000000903 323
25 3300005339 Ga0070660_100000304 Ga0070660_1000003042 323
26 3300005366 Ga0070659_100000017 Ga0070659_10000001763 323
27 3300025919 Ga0207657_10021483 Ga0207657_100214833 323
28 3300025932 Ga0207690_10000035 Ga0207690_1000003564 323
29 3300026023 Ga0207677_10000224 Ga0207677_1000022423 323
30 3300026075 Ga0207708_10080588 Ga0207708_100805882 323
31 3300046665 Ga0495661_0000050 Ga0495661_0000050_79580_80662 323
32 3300021384 Ga0213876_10003358 Ga0213876_100033582 325
33 3300039437 Ga0436365_0478409 Ga0436365_0478409_2330_3397 325
34 3300025926 Ga0207659_10017853 Ga0207659_100178536 326
35 3300025933 Ga0207706_10121407 Ga0207706_101214072 326
36 3300031731 Ga0307405_10021164 Ga0307405_100211642 326
37 3300031824 Ga0307413_10001990 Ga0307413_100019907 326
38 3300031852 Ga0307410_10002976 Ga0307410_100029767 326
39 3300032002 Ga0307416_100014760 Ga0307416_1000147603 326
40 3300046660 Ga0495625_0075893 Ga0495625_0075893_1309_2313 327
41 3300032126 Ga0307415_100008349 Ga0307415_1000083492 329
42 3300049572 Ga0501036_0009992 Ga0501036_0009992_979_1992 330
43 3300049574 Ga0501038_0071186 Ga0501038_0071186_235_1248 330
44 3300049575 Ga0501039_0097948 Ga0501039_0097948_491_1504 330
45 3300049577 Ga0501041_0056225 Ga0501041_0056225_749_1762 330
46 3300049579 Ga0501043_0211676 Ga0501043_0211676_389_1402 330
47 3300049580 Ga0501046_0034659 Ga0501046_0034659_1970_2983 330
48 3300049587 Ga0501071_0005028 Ga0501071_0005028_6660_7673 330
49 3300049743 Ga0501081_0065196 Ga0501081_0065196_711_1724 330
50 3300049824 Ga0501045_0015034 Ga0501045_0015034_4246_5259 330
51 3300054114 Ga0501084_0006079 Ga0501084_0006079_1280_2293 330
52 3300061734 Ga0530510_0012586 Ga0530510_0012586_856_1869 330
53 3300048912 Ga0496109_0396407 Ga0496109_0396407_52_1131 331
54 3300049585 Ga0501069_0130391 Ga0501069_0130391_358_1428 332
55 3300049592 Ga0501076_0065277 Ga0501076_0065277_1348_2544 335
56 3300047469 Ga0495673_0022036 Ga0495673_0022036_1124_2188 336
57 3300047472 Ga0495686_0000834 Ga0495686_0000834_33849_34913 336
58 3300005548 Ga0070665_100009114 Ga0070665_1000091144 337
59 3300028379 Ga0268266_10004829 Ga0268266_100048296 337
60 3300046453 Ga0495627_036336 Ga0495627_036336_13_1026 337
61 3300046515 Ga0495620_0017505 Ga0495620_0017505_2534_3547 337
62 3300046694 Ga0495649_0096761 Ga0495649_0096761_13_1026 337
63 3300048916 Ga0496113_0028490 Ga0496113_0028490_1097_2179 337
64 3300048919 Ga0496116_0019776 Ga0496116_0019776_4030_5112 337
65 3300048920 Ga0496117_0000052 Ga0496117_0000052_70672_71754 337
66 3300048921 Ga0496118_0000709 Ga0496118_0000709_20557_21639 337
67 3300048923 Ga0496120_0000019 Ga0496120_0000019_70672_71754 337
68 3300048925 Ga0496122_0000053 Ga0496122_0000053_70672_71754 337
69 3300048926 Ga0496123_0000038 Ga0496123_0000038_70672_71754 337
70 3300025932 Ga0207690_10040392 Ga0207690_100403923 338
71 3300031548 Ga0307408_100013164 Ga0307408_1000131646 338
72 3300031995 Ga0307409_100326381 Ga0307409_1003263812 338
73 3300032004 Ga0307414_10144956 Ga0307414_101449561 338
74 3300032126 Ga0307415_100062049 Ga0307415_1000620492 338
75 3300037418 Ga0395900_0052744 Ga0395900_0052744_2645_3700 338
76 3300037418 Ga0395900_0110410 Ga0395900_0110410_221_1276 338
77 3300037418 Ga0395900_0471790 Ga0395900_0471790_143_1198 338
78 3300038443 Ga0395901_0004300 Ga0395901_0004300_11328_12383 338
79 3300044656 Ga0466969_0031750 Ga0466969_0031750_440_1498 338
80 3300003578 Ga0006562J51391_1005474 Ga0006562J51391_10054742 339
81 3300013102 Ga0157371_10007309 Ga0157371_100073097 339
82 3300025294 Ga0209025_1004446 Ga0209025_100444610 339
83 3300025909 Ga0207705_10020971 Ga0207705_100209713 339
84 3300009545 Ga0105237_10036109 Ga0105237_100361093 340
85 3300053151 Ga0500604_0000055 Ga0500604_0000055_29235_30296 340
86 iso_pu_bacteria 2791355253 2793281684 340
87 iso_pu_bacteria 2891048133 2891048296 340
88 iso_pu_bacteria 8005658619 8005658621 340
89 3300005327 Ga0070658_10001239 Ga0070658_1000123911 341
90 3300005336 Ga0070680_100021537 Ga0070680_1000215373 341
91 3300006038 Ga0075365_10032862 Ga0075365_100328623 341
92 3300006871 Ga0075434_100042060 Ga0075434_1000420605 341
93 3300009098 Ga0105245_10014262 Ga0105245_100142622 341
94 3300009545 Ga0105237_10000737 Ga0105237_1000073742 341
95 3300010375 Ga0105239_10001737 Ga0105239_1000173715 341
96 3300013307 Ga0157372_10491938 Ga0157372_104919382 341
97 3300020081 Ga0206354_10094784 Ga0206354_100947841 341
98 3300020082 Ga0206353_10636536 Ga0206353_106365362 341
99 3300021384 Ga0213876_10079825 Ga0213876_100798252 341
100 3300039437 Ga0436365_1729816 Ga0436365_1729816_938_2011 341
101 3300048924 Ga0496121_0007935 Ga0496121_0007935_4262_5326 341
102 3300049570 Ga0501033_0051844 Ga0501033_0051844_1075_2139 341
103 3300049823 Ga0501044_0030111 Ga0501044_0030111_4635_5699 341
104 3300050512 nmdc:mga0n895_193307_c1 nmdc:mga0n895_193307_c1_53_1120 341
105 3300005333 Ga0070677_10000357 Ga0070677_100003579 342
106 3300005355 Ga0070671_100125049 Ga0070671_1001250492 342
107 3300009093 Ga0105240_10235193 Ga0105240_102351931 342
108 3300025893 Ga0207682_10000578 Ga0207682_100005789 342
109 3300025981 Ga0207640_10019529 Ga0207640_100195293 342
110 3300026041 Ga0207639_10130395 Ga0207639_101303952 342
111 3300049577 Ga0501041_0135961 Ga0501041_0135961_394_1497 342
112 3300009093 Ga0105240_10011111 Ga0105240_100111118 343
113 3300009551 Ga0105238_10012550 Ga0105238_1001255010 343
114 3300014325 Ga0163163_10147343 Ga0163163_101473432 343
115 3300026121 Ga0207683_10416755 Ga0207683_104167552 343
116 3300037312 Ga0395899_0000052 Ga0395899_0000052_176919_177998 343
117 3300037418 Ga0395900_0000002 Ga0395900_0000002_524469_525548 343
118 3300037466 Ga0395898_0050393 Ga0395898_0050393_1146_2225 343
119 3300038443 Ga0395901_0000013 Ga0395901_0000013_178237_179316 343
120 3300039438 Ga0436360_0114333 Ga0436360_0114333_48_1124 343
121 iso_pu_bacteria 2558860983 2561468127 343
122 iso_pu_bacteria 2643221598 2644001492 343
123 3300003578 Ga0006562J51391_1082126 Ga0006562J51391_10821265 344
124 3300005331 Ga0070670_100102136 Ga0070670_1001021363 344
125 3300005617 Ga0068859_100031931 Ga0068859_1000319312 344
126 3300006931 Ga0097620_100031931 Ga0097620_1000319314 344
127 3300009176 Ga0105242_10076312 Ga0105242_100763122 344
128 3300009551 Ga0105238_10213913 Ga0105238_102139132 344
129 3300013102 Ga0157371_10075062 Ga0157371_100750622 344
130 3300013104 Ga0157370_10063353 Ga0157370_100633535 344
131 3300025908 Ga0207643_10000239 Ga0207643_1000023928 344
132 3300028800 Ga0265338_10083893 Ga0265338_100838933 344
133 3300046501 Ga0495607_0000113 Ga0495607_0000113_70580_71662 344
134 3300005985 Ga0081539_10009797 Ga0081539_100097973 345
135 3300009011 Ga0105251_10060729 Ga0105251_100607292 345
136 3300009092 Ga0105250_10006294 Ga0105250_100062942 345
137 3300009148 Ga0105243_10118135 Ga0105243_101181352 345
138 3300025711 Ga0207696_1000694 Ga0207696_100069421 345
139 3300049570 Ga0501033_0000913 Ga0501033_0000913_16954_18039 345
140 3300049571 Ga0501034_0026829 Ga0501034_0026829_997_2082 345
141 3300049573 Ga0501037_0049888 Ga0501037_0049888_589_1674 345
142 3300049823 Ga0501044_0075054 Ga0501044_0075054_587_1672 345
143 3300003856 Ga0058692_1010554 Ga0058692_10105544 346
144 3300006948 Ga0099826_10022778 Ga0099826_100227786 346
145 3300025294 Ga0209025_1000255 Ga0209025_100025570 346
146 3300025972 Ga0207668_10181931 Ga0207668_101819313 346
147 3300025981 Ga0207640_10006138 Ga0207640_100061384 346
148 3300027312 Ga0209371_1000003 Ga0209371_1000003786 346
149 3300027312 Ga0209371_1000729 Ga0209371_100072911 346
150 3300027666 Ga0209282_1005146 Ga0209282_10051467 346
151 3300030500 Ga0268256_1000004 Ga0268256_1000004264 346
152 3300030744 Ga0316181_1260236 Ga0316181_12602363 346
153 3300048907 Ga0496104_0046163 Ga0496104_0046163_2221_3297 346
154 3300048921 Ga0496118_0065533 Ga0496118_0065533_752_1843 346
155 3300048923 Ga0496120_0040962 Ga0496120_0040962_1178_2254 346
156 3300048924 Ga0496121_0153909 Ga0496121_0153909_589_1665 346
157 3300048928 Ga0496125_0015902 Ga0496125_0015902_2344_3420 346
158 iso_pu_bacteria 2537561587 2537873697 346
159 iso_pu_bacteria 2599185210 2599604672 346
160 iso_pu_bacteria 2600255279 2601611182 346
161 iso_pu_bacteria 2600255308 2601747955 346
162 iso_pu_bacteria 2818991439 2819557196 346
163 iso_pu_bacteria 2838675328 2838678264 346
164 iso_pu_bacteria 2838714209 2838716830 346
165 iso_pu_bacteria 2838719591 2838722560 346
166 iso_pu_bacteria 2838724970 2838727579 346
167 iso_pu_bacteria 2841846520 2841849185 346
168 iso_pu_bacteria 2841859092 2841861755 346
169 iso_pu_bacteria 2842124991 2842128066 346
170 iso_pu_bacteria 2842130223 2842133157 346
171 iso_pu_bacteria 2842152218 2842155151 346
172 iso_pu_bacteria 2842170452 2842173650 346
173 iso_pu_bacteria 2842175837 2842178772 346
174 iso_pu_bacteria 2842187318 2842189937 346
175 iso_pu_bacteria 2842211629 2842214251 346
176 iso_pu_bacteria 2842224351 2842226970 346
177 iso_pu_bacteria 2842515876 2842517979 346
178 iso_pu_bacteria 2899792073 2899792844 346
179 iso_pu_bacteria 2919114240 2919117021 346
180 iso_pu_bacteria 2926754445 2926758534 346
181 iso_pu_bacteria 2933006813 2933009470 346
182 iso_pu_bacteria 2933011516 2933013608 346
183 iso_pu_bacteria 2933594066 2933598139 346
184 iso_pu_bacteria 2979100975 2979102228 346
185 iso_pu_bacteria 2984509177 2984509824 346
186 iso_pu_bacteria 2984518228 2984519479 346
187 iso_pu_bacteria 2984537506 2984538163 346
188 iso_pu_bacteria 2984601300 2984604915 346
189 3300005328 Ga0070676_10010547 Ga0070676_100105476 347
190 3300005334 Ga0068869_100108529 Ga0068869_1001085292 347
191 3300005459 Ga0068867_100012617 Ga0068867_1000126177 347
192 3300005840 Ga0068870_10006861 Ga0068870_100068612 347
193 3300025907 Ga0207645_10132985 Ga0207645_101329852 347
194 3300025942 Ga0207689_10218388 Ga0207689_102183882 347
195 3300026075 Ga0207708_10012565 Ga0207708_100125656 347
196 3300026089 Ga0207648_10016819 Ga0207648_100168195 347
197 3300027543 Ga0209999_1006028 Ga0209999_10060282 347
198 3300027614 Ga0209970_1010631 Ga0209970_10106311 347
199 3300027617 Ga0210002_1002809 Ga0210002_10028091 347
200 3300027717 Ga0209998_10001230 Ga0209998_100012306 347
201 3300027876 Ga0209974_10000647 Ga0209974_100006476 347
202 3300041405 Ga0439438_004810 Ga0439438_004810_294_1337 347
203 3300041407 Ga0439447_010462 Ga0439447_010462_479_1522 347
204 3300042001 Ga0439441_006439 Ga0439441_006439_502_1698 347
205 3300042006 Ga0439432_000735 Ga0439432_000735_7471_8514 347
206 3300042010 Ga0439452_017343 Ga0439452_017343_472_1515 347
207 3300042013 Ga0439456_006694 Ga0439456_006694_601_1644 347
208 3300042138 Ga0450903_002152 Ga0450903_002152_476_1519 347
209 3300042145 Ga0450906_000517 Ga0450906_000517_3846_4889 347
210 3300042146 Ga0450907_003664 Ga0450907_003664_1210_2253 347
211 3300042185 Ga0450909_007054 Ga0450909_007054_455_1498 347
212 3300042461 Ga0439460_0000568 Ga0439460_0000568_4594_5637 347
213 3300042531 Ga0450918_001120 Ga0450918_001120_258_1301 347
214 3300042533 Ga0450901_002321 Ga0450901_002321_1012_2055 347
215 3300046458 Ga0495591_006081 Ga0495591_006081_23_1066 347
216 3300046492 Ga0495585_0133382 Ga0495585_0133382_20_1063 347
217 3300046512 Ga0495610_0067114 Ga0495610_0067114_21_1064 347
218 3300046530 Ga0495654_0009176 Ga0495654_0009176_4368_5411 347
219 3300046690 Ga0495624_0013052 Ga0495624_0013052_4610_5653 347
220 3300046692 Ga0495671_0001137 Ga0495671_0001137_17248_18291 347
221 3300046810 Ga0495660_0021050 Ga0495660_0021050_21_1064 347
222 3300047320 Ga0495672_0094640 Ga0495672_0094640_572_1615 347
223 3300047446 Ga0495679_030775 Ga0495679_030775_12_1055 347
224 3300047469 Ga0495673_0026466 Ga0495673_0026466_15_1058 347
225 3300047469 Ga0495673_0105190 Ga0495673_0105190_21_1064 347
226 3300047472 Ga0495686_0024290 Ga0495686_0024290_36_1079 347
227 3300047673 Ga0495593_0085127 Ga0495593_0085127_572_1615 347
228 3300048091 Ga0495626_0022666 Ga0495626_0022666_21_1064 347
229 3300013307 Ga0157372_10018767 Ga0157372_100187678 348
230 3300006042 Ga0075368_10008012 Ga0075368_100080126 349
231 3300006048 Ga0075363_100000028 Ga0075363_10000002817 349
232 3300006177 Ga0075362_10000123 Ga0075362_1000012313 349
233 3300006195 Ga0075366_10002286 Ga0075366_100022863 349
234 3300011119 Ga0105246_10054082 Ga0105246_100540823 349
235 3300013100 Ga0157373_10010689 Ga0157373_100106898 349
236 3300013102 Ga0157371_10000002 Ga0157371_1000000277 349
237 3300013104 Ga0157370_10000246 Ga0157370_1000024629 349
238 3300028800 Ga0265338_10053664 Ga0265338_100536642 349
239 3300046558 Ga0495633_0020892 Ga0495633_0020892_1785_2867 349
240 3300046674 Ga0495588_0025085 Ga0495588_0025085_1863_2951 349
241 3300048927 Ga0496124_0012008 Ga0496124_0012008_3497_4579 349
242 3300049578 Ga0501042_0017772 Ga0501042_0017772_570_1766 349
243 3300049593 Ga0501077_0049460 Ga0501077_0049460_380_1576 349
244 3300050489 nmdc:mga03683_124_c1 nmdc:mga03683_124_c1_17267_18355 349
245 3300050490 nmdc:mga03n38_164_c1 nmdc:mga03n38_164_c1_1659_2747 349
246 3300050491 nmdc:mga00v17_55_c1 nmdc:mga00v17_55_c1_30050_31132 349
247 3300050493 nmdc:mga0k408_36195_c1 nmdc:mga0k408_36195_c1_694_1782 349
248 3300050516 nmdc:mga0sz30_827_c1 nmdc:mga0sz30_827_c1_2529_3617 349
249 3300053107 Ga0500560_001971 Ga0500560_001971_58_1140 349
250 3300053157 Ga0500624_000234 Ga0500624_000234_17373_18455 349
251 3300053161 Ga0500634_0026692 Ga0500634_0026692_1857_2939 349
252 iso_pu_bacteria 2554235003 2554245199 349
253 iso_pu_bacteria 2558860242 2559296971 349
254 iso_pu_bacteria 2643221582 2643916923 349
255 iso_pu_bacteria 2643221693 2644521213 349
256 iso_pu_bacteria 2808606387 2808989069 349
257 iso_pu_bacteria 2899845264 2899845431 349
258 iso_pu_bacteria 2926760298 2926763934 349
259 iso_pu_bacteria 2979089926 2979090968 349
260 iso_pu_bacteria 2979095461 2979096494 349
261 iso_pu_bacteria 650716007 650843392 349
262 iso_pu_bacteria 8003570095 8003572989 349
263 3300028800 Ga0265338_10000189 Ga0265338_10000189125 351
264 iso_pu_bacteria 651053060 651174133 352
265 3300049577 Ga0501041_0114148 Ga0501041_0114148_484_1632 353
266 iso_pu_bacteria 2671180330 2672333857 353
267 iso_pu_bacteria 3006969106 3006972755 353
268 iso_pu_bacteria 3006984091 3006988108 353
269 3300009098 Ga0105245_10000001 Ga0105245_10000001183 354
270 3300021384 Ga0213876_10008931 Ga0213876_100089314 354
271 3300025927 Ga0207687_10000004 Ga0207687_1000000484 354
272 3300039437 Ga0436365_0516586 Ga0436365_0516586_2348_3478 354
273 3300049572 Ga0501036_0190882 Ga0501036_0190882_266_1372 354
274 3300049583 Ga0501067_0132694 Ga0501067_0132694_103_1233 354
275 3300049588 Ga0501072_0117024 Ga0501072_0117024_910_2040 354
276 3300049742 Ga0501080_0022050 Ga0501080_0022050_1805_2944 354
277 3300049744 Ga0501083_0020728 Ga0501083_0020728_1804_2934 354
278 2162886007 SwRhRL2b_contig_1813663 SwRhRL2b_0072.00001290 355
279 2209111006 2214767444 2213785301 355
280 3300000042 ARSoilYngRDRAFT_c00058 ARSoilYngRDRAFT_000586 355
281 3300000043 ARcpr5yngRDRAFT_c000667 ARcpr5yngRDRAFT_0006672 355
282 3300000045 ARCol0oldRDRAFT_c01097 ARCol0oldRDRAFT_010972 355
283 3300000652 ARCol0yngRDRAFT_1000156 ARCol0yngRDRAFT_10001564 355
284 3300003382 JGI26139J50223_100054 JGI26139J50223_1000543 355
285 3300003383 JGI26140J50224_100023 JGI26140J50224_1000235 355
286 3300003391 JGI26135J50243_100037 JGI26135J50243_1000373 355
287 3300003392 JGI26134J50242_100070 JGI26134J50242_1000706 355
288 3300003396 JGI26137J50245_100034 JGI26137J50245_1000346 355
289 3300003400 JGI26131J50246_100183 JGI26131J50246_1001834 355
290 3300003503 JGI26141J51220_1000083 JGI26141J51220_10000834 355
291 3300005289 Ga0065704_10000453 Ga0065704_1000045325 355
292 3300005289 Ga0065704_10137692 Ga0065704_101376922 355
293 3300005293 Ga0065715_10000311 Ga0065715_100003117 355
294 3300005295 Ga0065707_10000468 Ga0065707_1000046812 355
295 3300005295 Ga0065707_10006314 Ga0065707_100063143 355
296 3300005327 Ga0070658_10011905 Ga0070658_100119056 355
297 3300005331 Ga0070670_100023631 Ga0070670_1000236315 355
298 3300005336 Ga0070680_100002694 Ga0070680_10000269412 355
299 3300005336 Ga0070680_100043723 Ga0070680_1000437233 355
300 3300005336 Ga0070680_100159948 Ga0070680_1001599482 355
301 3300005338 Ga0068868_100024633 Ga0068868_1000246333 355
302 3300005339 Ga0070660_100002009 Ga0070660_1000020097 355
303 3300005343 Ga0070687_100001943 Ga0070687_1000019436 355
304 3300005353 Ga0070669_100005298 Ga0070669_1000052984 355
305 3300005354 Ga0070675_100002894 Ga0070675_10000289411 355
306 3300005364 Ga0070673_100003226 Ga0070673_1000032261 355
307 3300005367 Ga0070667_100018360 Ga0070667_1000183606 355
308 3300005438 Ga0070701_10040588 Ga0070701_100405883 355
309 3300005440 Ga0070705_100002795 Ga0070705_10000279510 355
310 3300005441 Ga0070700_100007831 Ga0070700_1000078316 355
311 3300005444 Ga0070694_100018613 Ga0070694_1000186133 355
312 3300005444 Ga0070694_100056352 Ga0070694_1000563523 355
313 3300005444 Ga0070694_100218124 Ga0070694_1002181241 355
314 3300005457 Ga0070662_100039239 Ga0070662_1000392392 355
315 3300005459 Ga0068867_100003802 Ga0068867_1000038025 355
316 3300005459 Ga0068867_100012758 Ga0068867_1000127585 355
317 3300005530 Ga0070679_100017671 Ga0070679_1000176714 355
318 3300005530 Ga0070679_100119369 Ga0070679_1001193693 355
319 3300005543 Ga0070672_100009136 Ga0070672_1000091366 355
320 3300005543 Ga0070672_100020750 Ga0070672_1000207503 355
321 3300005545 Ga0070695_100004446 Ga0070695_1000044468 355
322 3300005545 Ga0070695_100009911 Ga0070695_1000099113 355
323 3300005546 Ga0070696_100008204 Ga0070696_1000082044 355
324 3300005547 Ga0070693_100001832 Ga0070693_1000018327 355
325 3300005547 Ga0070693_100047719 Ga0070693_1000477192 355
326 3300005547 Ga0070693_100128084 Ga0070693_1001280842 355
327 3300005549 Ga0070704_100029590 Ga0070704_1000295904 355
328 3300005563 Ga0068855_100193266 Ga0068855_1001932662 355
329 3300005577 Ga0068857_100000202 Ga0068857_10000020221 355
330 3300005577 Ga0068857_100087774 Ga0068857_1000877742 355
331 3300005615 Ga0070702_100005406 Ga0070702_1000054066 355
332 3300005616 Ga0068852_100000001 Ga0068852_100000001677 355
333 3300005618 Ga0068864_100050941 Ga0068864_1000509411 355
334 3300005843 Ga0068860_100015622 Ga0068860_1000156225 355
335 3300005844 Ga0068862_100009539 Ga0068862_1000095395 355
336 3300005937 Ga0081455_10001563 Ga0081455_100015637 355
337 3300005937 Ga0081455_10091056 Ga0081455_100910563 355
338 3300006194 Ga0075427_10001751 Ga0075427_100017512 355
339 3300006237 Ga0097621_100039789 Ga0097621_1000397895 355
340 3300006844 Ga0075428_100031193 Ga0075428_1000311933 355
341 3300006844 Ga0075428_100061051 Ga0075428_1000610513 355
342 3300006846 Ga0075430_100019455 Ga0075430_1000194555 355
343 3300006847 Ga0075431_100052886 Ga0075431_1000528863 355
344 3300006852 Ga0075433_10001199 Ga0075433_100011999 355
345 3300006852 Ga0075433_10304420 Ga0075433_103044202 355
346 3300006871 Ga0075434_100013393 Ga0075434_1000133937 355
347 3300006880 Ga0075429_100021754 Ga0075429_1000217546 355
348 3300006880 Ga0075429_100037148 Ga0075429_1000371483 355
349 3300006881 Ga0068865_100011657 Ga0068865_1000116576 355
350 3300006881 Ga0068865_100194332 Ga0068865_1001943321 355
351 3300006914 Ga0075436_100001494 Ga0075436_10000149411 355
352 3300007076 Ga0075435_100001664 Ga0075435_1000016648 355
353 3300007076 Ga0075435_100027360 Ga0075435_1000273602 355
354 3300009093 Ga0105240_10404324 Ga0105240_104043242 355
355 3300009094 Ga0111539_10017218 Ga0111539_100172185 355
356 3300009147 Ga0114129_10067799 Ga0114129_100677992 355
357 3300009174 Ga0105241_10013723 Ga0105241_100137234 355
358 3300009545 Ga0105237_10000002 Ga0105237_10000002570 355
359 3300009545 Ga0105237_10064979 Ga0105237_100649792 355
360 3300009551 Ga0105238_10069303 Ga0105238_100693033 355
361 3300010375 Ga0105239_10038118 Ga0105239_100381182 355
362 3300011119 Ga0105246_10007597 Ga0105246_100075974 355
363 3300012473 Ga0157340_1000098 Ga0157340_10000981 355
364 3300012475 Ga0157317_1000264 Ga0157317_10002643 355
365 3300012481 Ga0157320_1000028 Ga0157320_10000283 355
366 3300012485 Ga0157325_1000443 Ga0157325_10004431 355
367 3300012492 Ga0157335_1000211 Ga0157335_10002112 355
368 3300012495 Ga0157323_1000034 Ga0157323_10000342 355
369 3300012498 Ga0157345_1000325 Ga0157345_10003256 355
370 3300012505 Ga0157339_1000142 Ga0157339_10001423 355
371 3300012507 Ga0157342_1001355 Ga0157342_10013552 355
372 3300012508 Ga0157315_1000364 Ga0157315_10003642 355
373 3300012513 Ga0157326_1000169 Ga0157326_10001699 355
374 3300012515 Ga0157338_1000083 Ga0157338_10000833 355
375 3300013102 Ga0157371_10010875 Ga0157371_100108756 355
376 3300013296 Ga0157374_10008870 Ga0157374_100088706 355
377 3300013297 Ga0157378_10002128 Ga0157378_1000212818 355
378 3300013307 Ga0157372_10004085 Ga0157372_1000408510 355
379 3300013307 Ga0157372_10406229 Ga0157372_104062292 355
380 3300014326 Ga0157380_10019720 Ga0157380_100197202 355
381 3300014326 Ga0157380_10136915 Ga0157380_101369152 355
382 3300017792 Ga0163161_10090452 Ga0163161_100904521 355
383 3300025294 Ga0209025_1000043 Ga0209025_1000043305 355
384 3300025315 Ga0207697_10006971 Ga0207697_100069714 355
385 3300025901 Ga0207688_10000774 Ga0207688_100007745 355
386 3300025901 Ga0207688_10018685 Ga0207688_100186852 355
387 3300025904 Ga0207647_10000815 Ga0207647_1000081520 355
388 3300025904 Ga0207647_10009414 Ga0207647_100094146 355
389 3300025907 Ga0207645_10000612 Ga0207645_1000061215 355
390 3300025908 Ga0207643_10000173 Ga0207643_100001737 355
391 3300025908 Ga0207643_10174993 Ga0207643_101749932 355
392 3300025909 Ga0207705_10012562 Ga0207705_100125627 355
393 3300025911 Ga0207654_10008653 Ga0207654_100086533 355
394 3300025912 Ga0207707_10296908 Ga0207707_102969081 355
395 3300025914 Ga0207671_10000008 Ga0207671_10000008675 355
396 3300025917 Ga0207660_10001420 Ga0207660_1000142011 355
397 3300025918 Ga0207662_10016717 Ga0207662_100167175 355
398 3300025919 Ga0207657_10001623 Ga0207657_1000162324 355
399 3300025921 Ga0207652_10003166 Ga0207652_1000316610 355
400 3300025923 Ga0207681_10004468 Ga0207681_100044686 355
401 3300025924 Ga0207694_10043789 Ga0207694_100437893 355
402 3300025932 Ga0207690_10032776 Ga0207690_100327762 355
403 3300025933 Ga0207706_10002726 Ga0207706_1000272612 355
404 3300025933 Ga0207706_10015147 Ga0207706_100151473 355
405 3300025933 Ga0207706_10138548 Ga0207706_101385483 355
406 3300025934 Ga0207686_10154773 Ga0207686_101547732 355
407 3300025938 Ga0207704_10039841 Ga0207704_100398413 355
408 3300025940 Ga0207691_10003733 Ga0207691_1000373314 355
409 3300025940 Ga0207691_10043182 Ga0207691_100431825 355
410 3300025940 Ga0207691_10044409 Ga0207691_100444092 355
411 3300025942 Ga0207689_10002546 Ga0207689_100025465 355
412 3300025942 Ga0207689_10010938 Ga0207689_100109382 355
413 3300025945 Ga0207679_10119247 Ga0207679_101192473 355
414 3300025961 Ga0207712_10010121 Ga0207712_100101213 355
415 3300025986 Ga0207658_10031857 Ga0207658_100318573 355
416 3300026075 Ga0207708_10000131 Ga0207708_1000013145 355
417 3300026075 Ga0207708_10010892 Ga0207708_100108923 355
418 3300026089 Ga0207648_10001723 Ga0207648_100017235 355
419 3300026089 Ga0207648_10018497 Ga0207648_100184974 355
420 3300026095 Ga0207676_10054383 Ga0207676_100543832 355
421 3300026116 Ga0207674_10000866 Ga0207674_1000086621 355
422 3300026116 Ga0207674_10055650 Ga0207674_100556502 355
423 3300026142 Ga0207698_10000001 Ga0207698_10000001628 355
424 3300027364 Ga0209967_1000089 Ga0209967_100008912 355
425 3300027378 Ga0209981_1000714 Ga0209981_10007144 355
426 3300027395 Ga0209996_1000471 Ga0209996_10004715 355
427 3300027462 Ga0210000_1000394 Ga0210000_10003943 355
428 3300027471 Ga0209995_1000026 Ga0209995_100002616 355
429 3300027543 Ga0209999_1000072 Ga0209999_100007210 355
430 3300027552 Ga0209982_1000121 Ga0209982_10001217 355
431 3300027614 Ga0209970_1000189 Ga0209970_10001896 355
432 3300027617 Ga0210002_1000451 Ga0210002_10004515 355
433 3300027682 Ga0209971_1001594 Ga0209971_10015945 355
434 3300027695 Ga0209966_1000473 Ga0209966_100047311 355
435 3300027876 Ga0209974_10005170 Ga0209974_100051704 355
436 3300027907 Ga0207428_10000363 Ga0207428_1000036324 355
437 3300027907 Ga0207428_10000499 Ga0207428_1000049941 355
438 3300027907 Ga0207428_10004175 Ga0207428_1000417516 355
439 3300028380 Ga0268265_10028394 Ga0268265_100283942 355
440 3300028800 Ga0265338_10013602 Ga0265338_100136026 355
441 3300028800 Ga0265338_10080128 Ga0265338_100801282 355
442 3300035114 Ga0373939_0009240 Ga0373939_0009240_657_1841 355
443 3300035242 Ga0373962_0004103 Ga0373962_0004103_93_1277 355
444 3300042008 Ga0439450_015473 Ga0439450_015473_121_1314 355
445 3300042011 Ga0439454_000032 Ga0439454_000032_698_1891 355
446 3300042013 Ga0439456_008594 Ga0439456_008594_622_1815 355
447 3300042016 Ga0439463_000765 Ga0439463_000765_628_1821 355
448 3300042156 Ga0439446_0021049 Ga0439446_0021049_176_1372 355
449 3300042437 Ga0439444_0000025 Ga0439444_0000025_2498_3691 355
450 3300042439 Ga0439464_0000769 Ga0439464_0000769_2888_4081 355
451 3300042461 Ga0439460_0002486 Ga0439460_0002486_3100_4293 355
452 3300042876 Ga0451577_0045908 Ga0451577_0045908_1308_2492 355
453 3300042993 Ga0439440_0002803 Ga0439440_0002803_350_1549 355
454 3300042993 Ga0439440_0008586 Ga0439440_0008586_237_1430 355
455 3300042993 Ga0439440_0027586 Ga0439440_0027586_97_1281 355
456 3300045051 Ga0451576_0015887 Ga0451576_0015887_5132_6316 355
457 3300048903 Ga0496100_0101817 Ga0496100_0101817_469_1653 355
458 3300048905 Ga0496102_0005400 Ga0496102_0005400_3507_4691 355
459 3300048910 Ga0496107_0035808 Ga0496107_0035808_1715_2899 355
460 3300049568 Ga0501031_0017408 Ga0501031_0017408_485_1681 355
461 3300049572 Ga0501036_0001043 Ga0501036_0001043_17221_18414 355
462 3300049575 Ga0501039_0003061 Ga0501039_0003061_7180_8373 355
463 3300049575 Ga0501039_0073825 Ga0501039_0073825_806_2002 355
464 3300049576 Ga0501040_0013555 Ga0501040_0013555_1546_2739 355
465 3300049576 Ga0501040_0057152 Ga0501040_0057152_1052_2248 355
466 3300049577 Ga0501041_0000144 Ga0501041_0000144_4408_5601 355
467 3300049577 Ga0501041_0024012 Ga0501041_0024012_1647_2843 355
468 3300049578 Ga0501042_0152935 Ga0501042_0152935_35_1231 355
469 3300049582 Ga0501048_0007809 Ga0501048_0007809_3506_4702 355
470 3300049582 Ga0501048_0116063 Ga0501048_0116063_140_1333 355
471 3300049587 Ga0501071_0000772 Ga0501071_0000772_988_2181 355
472 3300049588 Ga0501072_0001871 Ga0501072_0001871_13498_14691 355
473 3300049591 Ga0501075_0000617 Ga0501075_0000617_6807_8000 355
474 3300049591 Ga0501075_0076397 Ga0501075_0076397_93_1289 355
475 3300049592 Ga0501076_0000085 Ga0501076_0000085_12444_13637 355
476 3300049592 Ga0501076_0008106 Ga0501076_0008106_3047_4243 355
477 3300049592 Ga0501076_0062357 Ga0501076_0062357_35_1231 355
478 3300049593 Ga0501077_0004394 Ga0501077_0004394_2220_3413 355
479 3300049741 Ga0501079_0031309 Ga0501079_0031309_2590_3783 355
480 3300049741 Ga0501079_0046665 Ga0501079_0046665_945_2141 355
481 3300049741 Ga0501079_0134653 Ga0501079_0134653_298_1482 355
482 3300049742 Ga0501080_0006827 Ga0501080_0006827_4077_5273 355
483 3300049743 Ga0501081_0000813 Ga0501081_0000813_4942_6135 355
484 3300049743 Ga0501081_0058623 Ga0501081_0058623_806_2002 355
485 3300049824 Ga0501045_0005143 Ga0501045_0005143_7274_8467 355
486 3300050491 nmdc:mga00v17_19984_c1 nmdc:mga00v17_19984_c1_421_1554 355
487 3300050507 nmdc:mga05p37_87590_c1 nmdc:mga05p37_87590_c1_1179_2378 355
488 3300050507 nmdc:mga05p37_9333_c1 nmdc:mga05p37_9333_c1_6672_7856 355
489 3300050508 nmdc:mga09592_26389_c1 nmdc:mga09592_26389_c1_1386_2579 355
490 3300050508 nmdc:mga09592_4347_c1 nmdc:mga09592_4347_c1_2661_3860 355
491 3300050508 nmdc:mga09592_77020_c1 nmdc:mga09592_77020_c1_649_1833 355
492 3300050508 nmdc:mga09592_91436_c1 nmdc:mga09592_91436_c1_446_1630 355
493 3300050509 nmdc:mga0qj67_118804_c1 nmdc:mga0qj67_118804_c1_748_1941 355
494 3300050509 nmdc:mga0qj67_162225_c1 nmdc:mga0qj67_162225_c1_14_1198 355
495 3300050510 nmdc:mga06r32_8751_c1 nmdc:mga06r32_8751_c1_7286_8470 355
496 3300050511 nmdc:mga08y16_119701_c1 nmdc:mga08y16_119701_c1_650_1834 355
497 3300050511 nmdc:mga08y16_2858_c1 nmdc:mga08y16_2858_c1_2694_3893 355
498 3300050511 nmdc:mga08y16_4552_c1 nmdc:mga08y16_4552_c1_5143_6327 355
499 3300050511 nmdc:mga08y16_85361_c1 nmdc:mga08y16_85361_c1_1366_2559 355
500 3300050512 nmdc:mga0n895_155450_c1 nmdc:mga0n895_155450_c1_124_1308 355
501 3300050512 nmdc:mga0n895_287948_c1 nmdc:mga0n895_287948_c1_465_1649 355
502 3300050512 nmdc:mga0n895_75_c1 nmdc:mga0n895_75_c1_15960_17144 355
503 3300050513 nmdc:mga0rr50_7249_c1 nmdc:mga0rr50_7249_c1_3948_5132 355
504 3300050514 nmdc:mga08x19_848_c1 nmdc:mga08x19_848_c1_4254_5438 355
505 3300050515 nmdc:mga0a205_352601_c1 nmdc:mga0a205_352601_c1_37_1221 355
506 3300050515 nmdc:mga0a205_8161_c1 nmdc:mga0a205_8161_c1_4076_5260 355
507 3300054114 Ga0501084_0010109 Ga0501084_0010109_2044_3237 355
508 3300054114 Ga0501084_0014674 Ga0501084_0014674_811_2007 355
509 3300054114 Ga0501084_0032036 Ga0501084_0032036_1738_2919 355
510 3300060353 Ga0501082_0000374 Ga0501082_0000374_19032_20225 355
511 3300061734 Ga0530510_0003739 Ga0530510_0003739_988_2181 355
512 3300061734 Ga0530510_0017902 Ga0530510_0017902_2197_3393 355
513 iso_pu_bacteria 2738543017 2739271253 355
514 iso_pu_bacteria 2757320391 2757567746 355
515 iso_pu_bacteria 2775507192 2777837994 355
516 iso_pu_bacteria 2808606364 2808871439 355
517 iso_pu_bacteria 2842805378 2842807646 355
518 iso_pu_bacteria 2857586860 2857590219 355
519 iso_pu_bacteria 2936340661 2936345374 355
520 iso_pu_bacteria 3006826541 3006831205 355
521 3300003187 JGI25151J46595_10032883 JGI25151J46595_100328832 356
522 3300009036 Ga0105244_10074858 Ga0105244_100748582 356
523 3300025229 Ga0209147_101522 Ga0209147_1015224 356
524 3300025284 Ga0209130_1005357 Ga0209130_10053573 356
525 3300025294 Ga0209025_1001401 Ga0209025_10014014 356
526 3300025294 Ga0209025_1016363 Ga0209025_10163633 356
527 3300025294 Ga0209025_1016783 Ga0209025_10167834 356
528 3300025294 Ga0209025_1032565 Ga0209025_10325653 356
529 3300025711 Ga0207696_1027305 Ga0207696_10273052 356
530 3300025728 Ga0207655_1020062 Ga0207655_10200622 356
531 3300030083 Ga0237817_10467 Ga0237817_104676 356
532 3300032002 Ga0307416_100032296 Ga0307416_1000322964 356
533 3300038705 Ga0237819_01945 Ga0237819_01945_2433_3584 356
534 3300038705 Ga0237819_02348 Ga0237819_02348_1392_2543 356
535 3300045976 Ga0466967_0020054 Ga0466967_0020054_2853_4004 356
536 3300048913 Ga0496110_0000254 Ga0496110_0000254_1676_2836 356
537 3300048913 Ga0496110_0120635 Ga0496110_0120635_852_2003 356
538 iso_pu_bacteria 2510065053 2510282657 356
539 iso_pu_bacteria 2510065055 2510295311 356
540 iso_pu_bacteria 2510065058 2510311063 356
541 iso_pu_bacteria 2511231004 2511253529 356
542 iso_pu_bacteria 2511231006 2511266971 356
543 iso_pu_bacteria 2511231007 2511269894 356
544 iso_pu_bacteria 2511231008 2511275283 356
545 iso_pu_bacteria 2511231010 2511289812 356
546 iso_pu_bacteria 2511231011 2511294314 356
547 iso_pu_bacteria 2511231012 2511300107 356
548 iso_pu_bacteria 2511231014 2511317022 356
549 iso_pu_bacteria 2511231015 2511318899 356
550 iso_pu_bacteria 2511231016 2511325134 356
551 iso_pu_bacteria 2511231017 2511332128 356
552 iso_pu_bacteria 2511231018 2511339230 356
553 iso_pu_bacteria 2511231019 2511343215 356
554 iso_pu_bacteria 2511231020 2511347902 356
555 iso_pu_bacteria 2511231021 2511359072 356
556 iso_pu_bacteria 2511231022 2511364317 356
557 iso_pu_bacteria 2511231023 2511367434 356
558 iso_pu_bacteria 2511231024 2511376590 356
559 iso_pu_bacteria 2511231031 2511416433 356
560 iso_pu_bacteria 2511231156 2511822084 356
561 iso_pu_bacteria 2512047018 2512326483 356
562 iso_pu_bacteria 2551306519 2553396048 356
563 iso_pu_bacteria 2554235132 2554818545 356
564 iso_pu_bacteria 2554235231 2555246466 356
565 iso_pu_bacteria 2554235341 2555673030 356
566 iso_pu_bacteria 2554235469 2556065507 356
567 iso_pu_bacteria 2582580891 2583795532 356
568 iso_pu_bacteria 2597489887 2597861085 356
569 iso_pu_bacteria 2597489888 2597866819 356
570 iso_pu_bacteria 2597489889 2597872677 356
571 iso_pu_bacteria 2599185155 2599327913 356
572 iso_pu_bacteria 2599185160 2599355765 356
573 iso_pu_bacteria 2599185161 2599362833 356
574 iso_pu_bacteria 2599185162 2599368861 356
575 iso_pu_bacteria 2599185163 2599375942 356
576 iso_pu_bacteria 2599185164 2599380871 356
577 iso_pu_bacteria 2599185165 2599387613 356
578 iso_pu_bacteria 2599185166 2599394800 356
579 iso_pu_bacteria 2599185167 2599400984 356
580 iso_pu_bacteria 2599185168 2599406565 356
581 iso_pu_bacteria 2599185179 2599449671 356
582 iso_pu_bacteria 2599185181 2599462599 356
583 iso_pu_bacteria 2599185182 2599467979 356
584 iso_pu_bacteria 2599185185 2599487208 356
585 iso_pu_bacteria 2599185186 2599491616 356
586 iso_pu_bacteria 2599185188 2599503663 356
587 iso_pu_bacteria 2599185189 2599505936 356
588 iso_pu_bacteria 2599185190 2599511743 356
589 iso_pu_bacteria 2599185191 2599516729 356
590 iso_pu_bacteria 2599185212 2599616115 356
591 iso_pu_bacteria 2599185248 2599767730 356
592 iso_pu_bacteria 2599185257 2599804466 356
593 iso_pu_bacteria 2599185288 2599879225 356
594 iso_pu_bacteria 2599185289 2599887956 356
595 iso_pu_bacteria 2599185290 2599893246 356
596 iso_pu_bacteria 2599185291 2599899353 356
597 iso_pu_bacteria 2599185300 2599933092 356
598 iso_pu_bacteria 2599185302 2599942158 356
599 iso_pu_bacteria 2599185303 2599948827 356
600 iso_pu_bacteria 2599185304 2599955138 356
601 iso_pu_bacteria 2599185305 2599963683 356
602 iso_pu_bacteria 2599185306 2599968744 356
603 iso_pu_bacteria 2599185307 2599972032 356
604 iso_pu_bacteria 2599185308 2599979887 356
605 iso_pu_bacteria 2599185309 2599984470 356
606 iso_pu_bacteria 2599185310 2599990749 356
607 iso_pu_bacteria 2599185311 2599997255 356
608 iso_pu_bacteria 2599185312 2600000672 356
609 iso_pu_bacteria 2599185313 2600007415 356
610 iso_pu_bacteria 2599185314 2600013706 356
611 iso_pu_bacteria 2599185315 2600021298 356
612 iso_pu_bacteria 2599185316 2600026780 356
613 iso_pu_bacteria 2599185317 2600032257 356
614 iso_pu_bacteria 2599185318 2600038594 356
615 iso_pu_bacteria 2599185319 2600043995 356
616 iso_pu_bacteria 2599185320 2600049733 356
617 iso_pu_bacteria 2599185321 2600056370 356
618 iso_pu_bacteria 2599185322 2600062441 356
619 iso_pu_bacteria 2599185323 2600065249 356
620 iso_pu_bacteria 2599185324 2600074327 356
621 iso_pu_bacteria 2599185325 2600080455 356
622 iso_pu_bacteria 2599185356 2600215223 356
623 iso_pu_bacteria 2600254930 2600361617 356
624 iso_pu_bacteria 2600254931 2600363352 356
625 iso_pu_bacteria 2600254954 2600444355 356
626 iso_pu_bacteria 2600255283 2601627607 356
627 iso_pu_bacteria 2600255296 2601693181 356
628 iso_pu_bacteria 2600255313 2601775389 356
629 iso_pu_bacteria 2600255318 2601798346 356
630 iso_pu_bacteria 2600255389 2602008166 356
631 iso_pu_bacteria 2603880185 2606077240 356
632 iso_pu_bacteria 2603880199 2606129514 356
633 iso_pu_bacteria 2606217733 2608384211 356
634 iso_pu_bacteria 2619619299 2621296655 356
635 iso_pu_bacteria 2623620443 2624483620 356
636 iso_pu_bacteria 2623620446 2624495198 356
637 iso_pu_bacteria 2643221565 2643843293 356
638 iso_pu_bacteria 2643221571 2643873404 356
639 iso_pu_bacteria 2643221589 2643956143 356
640 iso_pu_bacteria 2643221602 2644020265 356
641 iso_pu_bacteria 2643221633 2644184276 356
642 iso_pu_bacteria 2643221650 2644282803 356
643 iso_pu_bacteria 2643221713 2644621236 356
644 iso_pu_bacteria 2643221729 2644703706 356
645 iso_pu_bacteria 2643221730 2644712721 356
646 iso_pu_bacteria 2651869719 2652548806 356
647 iso_pu_bacteria 2667528170 2671091857 356
648 iso_pu_bacteria 2667528171 2671099474 356
649 iso_pu_bacteria 2667528176 2671129566 356
650 iso_pu_bacteria 2671180172 2671771474 356
651 iso_pu_bacteria 2675903420 2677900561 356
652 iso_pu_bacteria 2675903515 2678266564 356
653 iso_pu_bacteria 2684622632 2685148245 356
654 iso_pu_bacteria 2695420987 2698319483 356
655 iso_pu_bacteria 2695420987 2698324915 356
656 iso_pu_bacteria 2703719227 2705992182 356
657 iso_pu_bacteria 2711768088 2712197965 356
658 iso_pu_bacteria 2713897148 2715749625 356
659 iso_pu_bacteria 2713897149 2715754635 356
660 iso_pu_bacteria 2718217725 2718636817 356
661 iso_pu_bacteria 2718218445 2721503625 356
662 iso_pu_bacteria 2721755607 2723251550 356
663 iso_pu_bacteria 2728369097 2729148436 356
664 iso_pu_bacteria 2738541265 2738673590 356
665 iso_pu_bacteria 2738541271 2738690508 356
666 iso_pu_bacteria 2738541282 2738751983 356
667 iso_pu_bacteria 2738541294 2738807443 356
668 iso_pu_bacteria 2738541303 2738861024 356
669 iso_pu_bacteria 2738541309 2738894803 356
670 iso_pu_bacteria 2738541358 2739158725 356
671 iso_pu_bacteria 2738543004 2739201061 356
672 iso_pu_bacteria 2738543006 2739211563 356
673 iso_pu_bacteria 2738543015 2739260576 356
674 iso_pu_bacteria 2738543016 2739266282 356
675 iso_pu_bacteria 2738543020 2739285931 356
676 iso_pu_bacteria 2738543021 2739291244 356
677 iso_pu_bacteria 2738543025 2739312292 356
678 iso_pu_bacteria 2740892503 2743740624 356
679 iso_pu_bacteria 2744054620 2745007794 356
680 iso_pu_bacteria 2765235841 2765586736 356
681 iso_pu_bacteria 2773857670 2774118147 356
682 iso_pu_bacteria 2773857672 2774129144 356
683 iso_pu_bacteria 2773857673 2774136394 356
684 iso_pu_bacteria 2784132063 2784261610 356
685 iso_pu_bacteria 2784132072 2784316915 356
686 iso_pu_bacteria 2791355520 2794598973 356
687 iso_pu_bacteria 2806310737 2807410930 356
688 iso_pu_bacteria 2806310745 2807459271 356
689 iso_pu_bacteria 2808606361 2808856658 356
690 iso_pu_bacteria 2808606373 2808906097 356
691 iso_pu_bacteria 2808606376 2808925808 356
692 iso_pu_bacteria 2808606377 2808928239 356
693 iso_pu_bacteria 2808606378 2808936624 356
694 iso_pu_bacteria 2808606379 2808940233 356
695 iso_pu_bacteria 2808606380 2808947951 356
696 iso_pu_bacteria 2808606381 2808950579 356
697 iso_pu_bacteria 2808606382 2808961430 356
698 iso_pu_bacteria 2808606383 2808965083 356
699 iso_pu_bacteria 2808606385 2808976346 356
700 iso_pu_bacteria 2808606388 2808994194 356
701 iso_pu_bacteria 2808606389 2808999975 356
702 iso_pu_bacteria 2808606445 2809217430 356
703 iso_pu_bacteria 2811994881 2812369878 356
704 iso_pu_bacteria 2816332186 2816866139 356
705 iso_pu_bacteria 2816332298 2817494232 356
706 iso_pu_bacteria 2818991441 2819568248 356
707 iso_pu_bacteria 2818991443 2819584932 356
708 iso_pu_bacteria 2818991456 2819655338 356
709 iso_pu_bacteria 2818991464 2819704620 356
710 iso_pu_bacteria 2823421272 2823426009 356
711 iso_pu_bacteria 2825651385 2825654646 356
712 iso_pu_bacteria 2826581358 2826581624 356
713 iso_pu_bacteria 2834028612 2834031139 356
714 iso_pu_bacteria 2842682962 2842686229 356
715 iso_pu_bacteria 2842815866 2842817193 356
716 iso_pu_bacteria 2842826826 2842828583 356
717 iso_pu_bacteria 2842832357 2842833665 356
718 iso_pu_bacteria 2842837860 2842838083 356
719 iso_pu_bacteria 2842843487 2842845897 356
720 iso_pu_bacteria 2842849001 2842851922 356
721 iso_pu_bacteria 2842854478 2842855824 356
722 iso_pu_bacteria 2844665904 2844667298 356
723 iso_pu_bacteria 2849139964 2849141754 356
724 iso_pu_bacteria 2852612431 2852616541 356
725 iso_pu_bacteria 2852657418 2852660018 356
726 iso_pu_bacteria 2852667396 2852671509 356
727 iso_pu_bacteria 2857581216 2857585391 356
728 iso_pu_bacteria 2860339153 2860341922 356
729 iso_pu_bacteria 2860867994 2860873212 356
730 iso_pu_bacteria 2878029506 2878029624 356
731 iso_pu_bacteria 2880230671 2880236204 356
732 iso_pu_bacteria 2904518522 2904518748 356
733 iso_pu_bacteria 2904550169 2904553510 356
734 iso_pu_bacteria 2908446538 2908452809 356
735 iso_pu_bacteria 2912963787 2912969054 356
736 iso_pu_bacteria 2913036834 2913042751 356
737 iso_pu_bacteria 2917070673 2917076929 356
738 iso_pu_bacteria 2917832318 2917833271 356
739 iso_pu_bacteria 2919063839 2919068170 356
740 iso_pu_bacteria 2919125081 2919126189 356
741 iso_pu_bacteria 2919155634 2919156045 356
742 iso_pu_bacteria 2919385768 2919388986 356
743 iso_pu_bacteria 2919456309 2919457781 356
744 iso_pu_bacteria 2919481497 2919487169 356
745 iso_pu_bacteria 2919487758 2919487915 356
746 iso_pu_bacteria 2919501602 2919502754 356
747 iso_pu_bacteria 2919697872 2919702525 356
748 iso_pu_bacteria 2923153595 2923159720 356
749 iso_pu_bacteria 2923519811 2923523964 356
750 iso_pu_bacteria 2923586266 2923589420 356
751 iso_pu_bacteria 2926063275 2926064427 356
752 iso_pu_bacteria 2929144301 2929144428 356
753 iso_pu_bacteria 2929189879 2929195339 356
754 iso_pu_bacteria 2929233124 2929233485 356
755 iso_pu_bacteria 2931369376 2931372225 356
756 iso_pu_bacteria 2931390751 2931390853 356
757 iso_pu_bacteria 2931396565 2931398319 356
758 iso_pu_bacteria 2935353572 2935358104 356
759 iso_pu_bacteria 2938917290 2938917664 356
760 iso_pu_bacteria 2939636861 2939640635 356
761 iso_pu_bacteria 2939651529 2939654315 356
762 iso_pu_bacteria 2945928738 2945930724 356
763 iso_pu_bacteria 2945961074 2945967059 356
764 iso_pu_bacteria 2946006987 2946013069 356
765 iso_pu_bacteria 2946027586 2946028090 356
766 iso_pu_bacteria 2947233263 2947234618 356
767 iso_pu_bacteria 2947426588 2947426950 356
768 iso_pu_bacteria 2956897341 2956902187 356
769 iso_pu_bacteria 2965761152 2965761580 356
770 iso_pu_bacteria 2969304461 2969310424 356
771 iso_pu_bacteria 2974289157 2974293875 356
772 iso_pu_bacteria 2974298342 2974302412 356
773 iso_pu_bacteria 2979083700 2979083964 356
774 iso_pu_bacteria 2984286254 2984286397 356
775 iso_pu_bacteria 2984499530 2984500035 356
776 iso_pu_bacteria 2984504281 2984506587 356
777 iso_pu_bacteria 2988728565 2988731682 356
778 iso_pu_bacteria 2990196909 2990199852 356
779 iso_pu_bacteria 2998139840 2998139954 356
780 iso_pu_bacteria 3007252601 3007255052 356
781 iso_pu_bacteria 3007315729 3007316365 356
782 iso_pu_bacteria 3007395558 3007399199 356
783 iso_pu_bacteria 3007419365 3007419476 356
784 iso_pu_bacteria 3007511990 3007517380 356
785 iso_pu_bacteria 3007614139 3007615816 356
786 iso_pu_bacteria 3007619802 3007622659 356
787 iso_pu_bacteria 3007718800 3007723078 356
788 iso_pu_bacteria 3007803356 3007805915 356
789 iso_pu_bacteria 3007855910 3007859400 356
790 iso_pu_bacteria 3007861166 3007864891 356
791 iso_pu_bacteria 3007866637 3007871555 356
792 iso_pu_bacteria 3007872151 3007873167 356
793 iso_pu_bacteria 637000220 637323460 356
794 iso_pu_bacteria 640427133 640486159 356
795 iso_pu_bacteria 8011350971 8011354540 356
796 iso_pu_bacteria 8015687852 8015693813 356
797 iso_pu_bacteria 8019769354 8019769578 356
798 iso_pu_bacteria 8019775933 8019779747 356
799 iso_pu_bacteria 8022792930 8022793786 356
800 iso_pu_bacteria 8023438354 8023438560 356
801 iso_pu_bacteria 8023444577 8023450112 356
802 iso_pu_bacteria 8029995093 8029995299 356
803 iso_pu_bacteria 8034962539 8034965328 356
804 iso_pu_bacteria 8052494512 8052494688 356
805 iso_pu_bacteria 8054285046 8054287146 356
806 iso_pu_bacteria 8054347763 8054349399 356
807 iso_pu_bacteria 8054503363 8054503460 356
808 iso_pu_bacteria 8054929484 8054929734 356
809 iso_pu_bacteria 8055770955 8055777075 356
810 iso_pu_bacteria 8055817908 8055824097 356
811 iso_pu_bacteria 8055878733 8055881722 356
812 iso_pu_bacteria 8056115690 8056116386 356
813 iso_pu_bacteria 8056120720 8056125845 356
814 iso_pu_bacteria 8056125926 8056125990 356
815 iso_pu_bacteria 8056131705 8056131799 356
816 iso_pu_bacteria 8056137416 8056142964 356
817 iso_pu_bacteria 8056143049 8056143154 356
818 iso_pu_bacteria 8056148874 8056151306 356
819 iso_pu_bacteria 8056155041 8056159952 356
820 iso_pu_bacteria 8056161164 8056163816 356
821 iso_pu_bacteria 8056166840 8056171097 356
822 iso_pu_bacteria 8056172158 8056177219 356
823 iso_pu_bacteria 8056177738 8056182308 356
824 iso_pu_bacteria 8056569372 8056570676 356
825 iso_pu_bacteria 8057582654 8057583006 356
826 iso_pu_bacteria 8057632132 8057632806 356
827 iso_pu_bacteria 8057798959 8057802137 356
828 3300005435 Ga0070714_100002598 Ga0070714_1000025985 358
829 3300044694 Ga0466963_0002599 Ga0466963_0002599_4168_5328 358
830 3300044842 Ga0466957_0007862 Ga0466957_0007862_4049_5209 358
831 3300045836 Ga0466958_0002591 Ga0466958_0002591_4943_6103 358
832 3300048927 Ga0496124_0006802 Ga0496124_0006802_4455_5531 358
833 3300013104 Ga0157370_10009550 Ga0157370_100095502 359
834 3300028794 Ga0307515_10017677 Ga0307515_100176778 359
835 3300031456 Ga0307513_10113714 Ga0307513_101137141 359
836 3300044684 Ga0466966_0010386 Ga0466966_0010386_3112_4260 359
837 3300046507 Ga0495606_0001158 Ga0495606_0001158_22066_23145 359
838 3300046519 Ga0495632_0057560 Ga0495632_0057560_461_1558 359
839 3300046522 Ga0495643_0002637 Ga0495643_0002637_9767_10846 359
840 3300046694 Ga0495649_0001815 Ga0495649_0001815_2255_3334 359
841 3300053092 Ga0500583_0029764 Ga0500583_0029764_1078_2175 359
842 3300053093 Ga0500651_0108059 Ga0500651_0108059_588_1685 359
843 3300053096 Ga0500641_0048344 Ga0500641_0048344_228_1325 359
844 3300053156 Ga0500622_0013825 Ga0500622_0013825_2745_3842 359
845 2124908027 MRS2a_Contig_41 MRS2a_00299870 360
846 3300001915 JGI24741J21665_1002517 JGI24741J21665_10025176 360
847 3300002737 JGI25162J39368_1000082 JGI25162J39368_100008234 360
848 3300002737 JGI25162J39368_1000282 JGI25162J39368_100028219 360
849 3300002771 JGI25163J39215_1002227 JGI25163J39215_10022273 360
850 3300002771 JGI25163J39215_1002252 JGI25163J39215_10022522 360
851 3300002772 JGI25164J39214_1000058 JGI25164J39214_100005834 360
852 3300002772 JGI25164J39214_1000212 JGI25164J39214_100021219 360
853 3300003214 JGI25165J46597_1000154 JGI25165J46597_100015434 360
854 3300003214 JGI25165J46597_1000383 JGI25165J46597_100038326 360
855 3300003323 rootH1_10196566 rootH1_101965663 360
856 3300003751 Ga0055538_1000012 Ga0055538_1000012200 360
857 3300003752 Ga0055539_1000017 Ga0055539_1000017200 360
858 3300003756 Ga0055533_1000021 Ga0055533_1000021200 360
859 3300003758 Ga0055532_1000020 Ga0055532_100002042 360
860 3300003759 Ga0055525_1000078 Ga0055525_100007872 360
861 3300003781 Ga0055536_1004543 Ga0055536_10045431 360
862 3300003781 Ga0055536_1009458 Ga0055536_10094582 360
863 3300003791 Ga0055530_10005470 Ga0055530_100054702 360
864 3300003791 Ga0055530_10008701 Ga0055530_100087012 360
865 3300003792 Ga0055540_1004724 Ga0055540_10047242 360
866 3300003792 Ga0055540_1007682 Ga0055540_10076825 360
867 3300003792 Ga0055540_1007709 Ga0055540_10077092 360
868 3300003794 Ga0055531_10018175 Ga0055531_100181752 360
869 3300003841 Ga0055541_1000012 Ga0055541_1000012200 360
870 3300003856 Ga0058692_1002657 Ga0058692_10026577 360
871 3300005288 Ga0065714_10000267 Ga0065714_100002672 360
872 3300005288 Ga0065714_10002271 Ga0065714_1000227132 360
873 3300005288 Ga0065714_10079463 Ga0065714_100794633 360
874 3300005288 Ga0065714_10092917 Ga0065714_100929171 360
875 3300005288 Ga0065714_10094068 Ga0065714_100940683 360
876 3300005288 Ga0065714_10098654 Ga0065714_100986543 360
877 3300005288 Ga0065714_10115267 Ga0065714_101152672 360
878 3300005289 Ga0065704_10015230 Ga0065704_100152302 360
879 3300005289 Ga0065704_10075102 Ga0065704_100751022 360
880 3300005289 Ga0065704_10109318 Ga0065704_101093182 360
881 3300005290 Ga0065712_10067981 Ga0065712_1006798115 360
882 3300005331 Ga0070670_100032384 Ga0070670_1000323846 360
883 3300005331 Ga0070670_100090345 Ga0070670_1000903453 360
884 3300005344 Ga0070661_100004654 Ga0070661_1000046546 360
885 3300005353 Ga0070669_100000186 Ga0070669_10000018626 360
886 3300005353 Ga0070669_100005487 Ga0070669_1000054878 360
887 3300005366 Ga0070659_100176840 Ga0070659_1001768402 360
888 3300005539 Ga0068853_100000102 Ga0068853_10000010227 360
889 3300005548 Ga0070665_100018309 Ga0070665_1000183092 360
890 3300005548 Ga0070665_100268266 Ga0070665_1002682661 360
891 3300005564 Ga0070664_100000292 Ga0070664_10000029224 360
892 3300005564 Ga0070664_100069489 Ga0070664_1000694894 360
893 3300005834 Ga0068851_10000039 Ga0068851_1000003910 360
894 3300006058 Ga0075432_10005388 Ga0075432_100053881 360
895 3300006058 Ga0075432_10007561 Ga0075432_100075611 360
896 3300006058 Ga0075432_10011898 Ga0075432_100118981 360
897 3300006058 Ga0075432_10066334 Ga0075432_100663341 360
898 3300006944 Ga0099823_1033941 Ga0099823_10339415 360
899 3300006946 Ga0079104_1000783 Ga0079104_10007836 360
900 3300006946 Ga0079104_1001850 Ga0079104_10018509 360
901 3300006946 Ga0079104_1007967 Ga0079104_10079672 360
902 3300006946 Ga0079104_1025604 Ga0079104_10256042 360
903 3300006948 Ga0099826_10018325 Ga0099826_100183253 360
904 3300009011 Ga0105251_10000089 Ga0105251_100000896 360
905 3300009011 Ga0105251_10000309 Ga0105251_100003092 360
906 3300009011 Ga0105251_10001733 Ga0105251_1000173316 360
907 3300009011 Ga0105251_10002983 Ga0105251_100029839 360
908 3300009011 Ga0105251_10008371 Ga0105251_100083712 360
909 3300009011 Ga0105251_10008769 Ga0105251_100087697 360
910 3300009011 Ga0105251_10008839 Ga0105251_100088396 360
911 3300009011 Ga0105251_10011986 Ga0105251_100119864 360
912 3300009011 Ga0105251_10016631 Ga0105251_100166315 360
913 3300009011 Ga0105251_10031611 Ga0105251_100316113 360
914 3300009036 Ga0105244_10000073 Ga0105244_1000007336 360
915 3300009036 Ga0105244_10008948 Ga0105244_100089487 360
916 3300009036 Ga0105244_10019839 Ga0105244_100198395 360
917 3300009036 Ga0105244_10026498 Ga0105244_100264983 360
918 3300009036 Ga0105244_10040778 Ga0105244_100407781 360
919 3300009036 Ga0105244_10053285 Ga0105244_100532852 360
920 3300009036 Ga0105244_10056111 Ga0105244_100561112 360
921 3300009036 Ga0105244_10069855 Ga0105244_100698552 360
922 3300009036 Ga0105244_10081426 Ga0105244_100814262 360
923 3300009036 Ga0105244_10134339 Ga0105244_101343392 360
924 3300009092 Ga0105250_10001135 Ga0105250_1000113511 360
925 3300009092 Ga0105250_10004905 Ga0105250_100049057 360
926 3300009092 Ga0105250_10012182 Ga0105250_100121825 360
927 3300009092 Ga0105250_10023887 Ga0105250_100238873 360
928 3300009092 Ga0105250_10054760 Ga0105250_100547602 360
929 3300009148 Ga0105243_10005333 Ga0105243_100053338 360
930 3300009148 Ga0105243_10005730 Ga0105243_100057305 360
931 3300009148 Ga0105243_10006305 Ga0105243_100063055 360
932 3300009148 Ga0105243_10013497 Ga0105243_100134977 360
933 3300009148 Ga0105243_10013630 Ga0105243_100136301 360
934 3300009176 Ga0105242_10001069 Ga0105242_100010693 360
935 3300009177 Ga0105248_10006628 Ga0105248_100066283 360
936 3300009545 Ga0105237_10001100 Ga0105237_1000110024 360
937 3300009553 Ga0105249_10007620 Ga0105249_100076203 360
938 3300011119 Ga0105246_10002522 Ga0105246_100025229 360
939 3300011119 Ga0105246_10006273 Ga0105246_100062732 360
940 3300011119 Ga0105246_10012251 Ga0105246_100122513 360
941 3300011119 Ga0105246_10028338 Ga0105246_100283385 360
942 3300011119 Ga0105246_10061654 Ga0105246_100616543 360
943 3300013100 Ga0157373_10014293 Ga0157373_100142937 360
944 3300013100 Ga0157373_10014510 Ga0157373_100145106 360
945 3300013100 Ga0157373_10015065 Ga0157373_100150657 360
946 3300013100 Ga0157373_10015661 Ga0157373_100156616 360
947 3300013100 Ga0157373_10066263 Ga0157373_100662632 360
948 3300013100 Ga0157373_10226937 Ga0157373_102269371 360
949 3300013102 Ga0157371_10000109 Ga0157371_1000010971 360
950 3300013102 Ga0157371_10009858 Ga0157371_100098583 360
951 3300013102 Ga0157371_10036088 Ga0157371_100360881 360
952 3300013102 Ga0157371_10132087 Ga0157371_101320872 360
953 3300013104 Ga0157370_10027707 Ga0157370_100277072 360
954 3300013104 Ga0157370_10037357 Ga0157370_100373576 360
955 3300013104 Ga0157370_10039769 Ga0157370_100397694 360
956 3300013104 Ga0157370_10215823 Ga0157370_102158231 360
957 3300013105 Ga0157369_10001968 Ga0157369_1000196819 360
958 3300013105 Ga0157369_10028227 Ga0157369_100282272 360
959 3300013105 Ga0157369_10031841 Ga0157369_100318412 360
960 3300013306 Ga0163162_10015186 Ga0163162_100151866 360
961 3300013307 Ga0157372_10003284 Ga0157372_100032846 360
962 3300013307 Ga0157372_10028128 Ga0157372_100281287 360
963 3300014497 Ga0182008_10007384 Ga0182008_100073842 360
964 3300014497 Ga0182008_10007985 Ga0182008_100079857 360
965 3300014497 Ga0182008_10009595 Ga0182008_100095951 360
966 3300014497 Ga0182008_10009942 Ga0182008_100099426 360
967 3300014497 Ga0182008_10141110 Ga0182008_101411101 360
968 3300015261 Ga0182006_1004027 Ga0182006_10040276 360
969 3300015261 Ga0182006_1004263 Ga0182006_10042639 360
970 3300015261 Ga0182006_1005362 Ga0182006_10053622 360
971 3300015261 Ga0182006_1006516 Ga0182006_10065161 360
972 3300015261 Ga0182006_1026738 Ga0182006_10267384 360
973 3300015261 Ga0182006_1044443 Ga0182006_10444431 360
974 3300015262 Ga0182007_10005678 Ga0182007_100056781 360
975 3300015265 Ga0182005_1002764 Ga0182005_10027646 360
976 3300015265 Ga0182005_1003401 Ga0182005_10034016 360
977 3300017792 Ga0163161_10032067 Ga0163161_100320675 360
978 3300017792 Ga0163161_10056408 Ga0163161_100564081 360
979 3300017792 Ga0163161_10247925 Ga0163161_102479251 360
980 3300025206 Ga0209435_100579 Ga0209435_1005797 360
981 3300025207 Ga0209760_100160 Ga0209760_10016037 360
982 3300025207 Ga0209760_100475 Ga0209760_1004754 360
983 3300025224 Ga0209784_100007 Ga0209784_100007200 360
984 3300025225 Ga0209566_100009 Ga0209566_100009200 360
985 3300025226 Ga0209674_100021 Ga0209674_100021200 360
986 3300025229 Ga0209147_100009 Ga0209147_100009200 360
987 3300025230 Ga0209563_100018 Ga0209563_100018200 360
988 3300025230 Ga0209563_100368 Ga0209563_1003683 360
989 3300025231 Ga0207427_100005 Ga0207427_100005522 360
990 3300025231 Ga0207427_100006 Ga0207427_100006220 360
991 3300025233 Ga0209437_100013 Ga0209437_100013220 360
992 3300025233 Ga0209437_100018 Ga0209437_100018432 360
993 3300025233 Ga0209437_105686 Ga0209437_1056862 360
994 3300025242 Ga0209258_100321 Ga0209258_10032129 360
995 3300025246 Ga0209646_1000787 Ga0209646_10007879 360
996 3300025253 Ga0209677_100012 Ga0209677_100012200 360
997 3300025261 Ga0209233_1000021 Ga0209233_1000021522 360
998 3300025261 Ga0209233_1000022 Ga0209233_1000022220 360
999 3300025292 Ga0209676_1000015 Ga0209676_1000015210 360
1000 3300025292 Ga0209676_1000030 Ga0209676_1000030464 360
1001 3300025292 Ga0209676_1000278 Ga0209676_100027869 360
1002 3300025292 Ga0209676_1020849 Ga0209676_10208492 360
1003 3300025298 Ga0209050_1000030 Ga0209050_1000030228 360
1004 3300025298 Ga0209050_1000061 Ga0209050_100006146 360
1005 3300025298 Ga0209050_1000241 Ga0209050_10002419 360
1006 3300025298 Ga0209050_1007643 Ga0209050_10076436 360
1007 3300025303 Ga0209051_1000012 Ga0209051_1000012469 360
1008 3300025303 Ga0209051_1000519 Ga0209051_100051945 360
1009 3300025303 Ga0209051_1000572 Ga0209051_100057246 360
1010 3300025304 Ga0209257_1000143 Ga0209257_1000143128 360
1011 3300025304 Ga0209257_1008653 Ga0209257_10086532 360
1012 3300025321 Ga0207656_10000009 Ga0207656_10000009201 360
1013 3300025711 Ga0207696_1000055 Ga0207696_100005557 360
1014 3300025711 Ga0207696_1000078 Ga0207696_100007872 360
1015 3300025711 Ga0207696_1000080 Ga0207696_1000080106 360
1016 3300025711 Ga0207696_1000204 Ga0207696_10002045 360
1017 3300025711 Ga0207696_1009751 Ga0207696_10097513 360
1018 3300025711 Ga0207696_1019315 Ga0207696_10193153 360
1019 3300025711 Ga0207696_1030235 Ga0207696_10302353 360
1020 3300025728 Ga0207655_1000033 Ga0207655_1000033269 360
1021 3300025728 Ga0207655_1000116 Ga0207655_100011674 360
1022 3300025728 Ga0207655_1000541 Ga0207655_10005414 360
1023 3300025728 Ga0207655_1002134 Ga0207655_10021346 360
1024 3300025728 Ga0207655_1003636 Ga0207655_10036361 360
1025 3300025728 Ga0207655_1003780 Ga0207655_100378011 360
1026 3300025728 Ga0207655_1003858 Ga0207655_10038589 360
1027 3300025728 Ga0207655_1004732 Ga0207655_10047322 360
1028 3300025728 Ga0207655_1006294 Ga0207655_100629410 360
1029 3300025728 Ga0207655_1014070 Ga0207655_10140704 360
1030 3300025728 Ga0207655_1016130 Ga0207655_10161302 360
1031 3300025728 Ga0207655_1029363 Ga0207655_10293633 360
1032 3300025728 Ga0207655_1030510 Ga0207655_10305104 360
1033 3300025728 Ga0207655_1031354 Ga0207655_10313541 360
1034 3300025728 Ga0207655_1031805 Ga0207655_10318052 360
1035 3300025728 Ga0207655_1075271 Ga0207655_10752711 360
1036 3300025735 Ga0207713_1000010 Ga0207713_1000010433 360
1037 3300025735 Ga0207713_1000707 Ga0207713_100070717 360
1038 3300025735 Ga0207713_1000912 Ga0207713_10009125 360
1039 3300025735 Ga0207713_1001898 Ga0207713_100189815 360
1040 3300025735 Ga0207713_1002747 Ga0207713_10027472 360
1041 3300025735 Ga0207713_1004151 Ga0207713_10041516 360
1042 3300025735 Ga0207713_1004464 Ga0207713_10044647 360
1043 3300025735 Ga0207713_1004468 Ga0207713_10044685 360
1044 3300025735 Ga0207713_1005294 Ga0207713_10052948 360
1045 3300025735 Ga0207713_1005979 Ga0207713_10059794 360
1046 3300025735 Ga0207713_1025432 Ga0207713_10254323 360
1047 3300025914 Ga0207671_10000027 Ga0207671_10000027121 360
1048 3300025920 Ga0207649_10000007 Ga0207649_1000000753 360
1049 3300025923 Ga0207681_10000059 Ga0207681_1000005924 360
1050 3300025923 Ga0207681_10031926 Ga0207681_100319264 360
1051 3300025925 Ga0207650_10000044 Ga0207650_1000004484 360
1052 3300025925 Ga0207650_10000089 Ga0207650_1000008986 360
1053 3300025933 Ga0207706_10002297 Ga0207706_100022973 360
1054 3300025934 Ga0207686_10003528 Ga0207686_100035288 360
1055 3300025934 Ga0207686_10060840 Ga0207686_100608403 360
1056 3300025935 Ga0207709_10000061 Ga0207709_1000006174 360
1057 3300025935 Ga0207709_10000063 Ga0207709_1000006395 360
1058 3300025935 Ga0207709_10000545 Ga0207709_1000054516 360
1059 3300025935 Ga0207709_10006915 Ga0207709_100069157 360
1060 3300025935 Ga0207709_10011028 Ga0207709_100110285 360
1061 3300025945 Ga0207679_10000013 Ga0207679_10000013251 360
1062 3300025945 Ga0207679_10019106 Ga0207679_100191066 360
1063 3300025961 Ga0207712_10010833 Ga0207712_100108333 360
1064 3300026041 Ga0207639_10000091 Ga0207639_1000009127 360
1065 3300026067 Ga0207678_10048930 Ga0207678_100489303 360
1066 3300027111 Ga0209281_1000016 Ga0209281_1000016469 360
1067 3300027111 Ga0209281_1000019 Ga0209281_100001936 360
1068 3300027111 Ga0209281_1006992 Ga0209281_10069923 360
1069 3300027296 Ga0209389_1000036 Ga0209389_100003653 360
1070 3300027312 Ga0209371_1000066 Ga0209371_100006613 360
1071 3300027312 Ga0209371_1000632 Ga0209371_10006324 360
1072 3300027360 Ga0209969_1002764 Ga0209969_10027642 360
1073 3300027378 Ga0209981_1006009 Ga0209981_10060092 360
1074 3300027395 Ga0209996_1001591 Ga0209996_10015913 360
1075 3300027665 Ga0209983_1001713 Ga0209983_10017134 360
1076 3300027682 Ga0209971_1009875 Ga0209971_10098752 360
1077 3300027876 Ga0209974_10007695 Ga0209974_100076952 360
1078 3300027907 Ga0207428_10008051 Ga0207428_100080514 360
1079 3300027907 Ga0207428_10010019 Ga0207428_100100194 360
1080 3300027907 Ga0207428_10034796 Ga0207428_100347963 360
1081 3300027907 Ga0207428_10136120 Ga0207428_101361201 360
1082 3300028786 Ga0307517_10097154 Ga0307517_100971542 360
1083 3300030500 Ga0268256_1000063 Ga0268256_100006313 360
1084 3300030500 Ga0268256_1000247 Ga0268256_10002474 360
1085 3300030521 Ga0307511_10125920 Ga0307511_101259202 360
1086 3300030734 Ga0316179_1002654 Ga0316179_10026547 360
1087 3300030735 Ga0316178_1047147 Ga0316178_104714792 360
1088 3300030742 Ga0316183_1059891 Ga0316183_10598913 360
1089 3300030744 Ga0316181_1001658 Ga0316181_10016582 360
1090 3300031548 Ga0307408_100000002 Ga0307408_100000002669 360
1091 3300031548 Ga0307408_100030241 Ga0307408_1000302414 360
1092 3300031731 Ga0307405_10014813 Ga0307405_100148135 360
1093 3300031731 Ga0307405_10139706 Ga0307405_101397062 360
1094 3300031731 Ga0307405_10167710 Ga0307405_101677102 360
1095 3300031824 Ga0307413_10069955 Ga0307413_100699552 360
1096 3300032002 Ga0307416_100081686 Ga0307416_1000816862 360
1097 3300032004 Ga0307414_10015714 Ga0307414_100157143 360
1098 3300033180 Ga0307510_10024600 Ga0307510_100246008 360
1099 3300033180 Ga0307510_10126867 Ga0307510_101268673 360
1100 3300038705 Ga0237819_00416 Ga0237819_00416_9037_10119 360
1101 3300041404 Ga0439436_0000094 Ga0439436_0000094_2093_3178 360
1102 3300041405 Ga0439438_002010 Ga0439438_002010_3277_4359 360
1103 3300041405 Ga0439438_003391 Ga0439438_003391_4211_5296 360
1104 3300041405 Ga0439438_003796 Ga0439438_003796_4296_5378 360
1105 3300041405 Ga0439438_024700 Ga0439438_024700_363_1445 360
1106 3300041405 Ga0439438_026050 Ga0439438_026050_444_1526 360
1107 3300041407 Ga0439447_007063 Ga0439447_007063_1584_2669 360
1108 3300041407 Ga0439447_011576 Ga0439447_011576_443_1525 360
1109 3300041407 Ga0439447_023361 Ga0439447_023361_139_1221 360
1110 3300041411 Ga0439466_0002316 Ga0439466_0002316_4215_5297 360
1111 3300041411 Ga0439466_0003713 Ga0439466_0003713_1650_2732 360
1112 3300041411 Ga0439466_0006210 Ga0439466_0006210_359_1441 360
1113 3300041411 Ga0439466_0008448 Ga0439466_0008448_2399_3481 360
1114 3300041411 Ga0439466_0015260 Ga0439466_0015260_244_1326 360
1115 3300041411 Ga0439466_0020320 Ga0439466_0020320_665_1747 360
1116 3300041411 Ga0439466_0038106 Ga0439466_0038106_101_1183 360
1117 3300042000 Ga0439437_000861 Ga0439437_000861_177_1259 360
1118 3300042006 Ga0439432_000757 Ga0439432_000757_10850_11935 360
1119 3300042006 Ga0439432_001455 Ga0439432_001455_4832_5914 360
1120 3300042006 Ga0439432_003124 Ga0439432_003124_446_1531 360
1121 3300042006 Ga0439432_038536 Ga0439432_038536_17_1099 360
1122 3300042009 Ga0439451_010195 Ga0439451_010195_429_1511 360
1123 3300042010 Ga0439452_002183 Ga0439452_002183_4365_5447 360
1124 3300042010 Ga0439452_002265 Ga0439452_002265_1291_2376 360
1125 3300042010 Ga0439452_002419 Ga0439452_002419_562_1644 360
1126 3300042010 Ga0439452_003104 Ga0439452_003104_4424_5506 360
1127 3300042010 Ga0439452_007546 Ga0439452_007546_1924_3006 360
1128 3300042013 Ga0439456_000080 Ga0439456_000080_27898_28980 360
1129 3300042013 Ga0439456_006404 Ga0439456_006404_373_1455 360
1130 3300042013 Ga0439456_017964 Ga0439456_017964_250_1332 360
1131 3300042016 Ga0439463_000261 Ga0439463_000261_12847_13929 360
1132 3300042016 Ga0439463_000477 Ga0439463_000477_2415_3497 360
1133 3300042016 Ga0439463_002267 Ga0439463_002267_3426_4508 360
1134 3300042115 Ga0450911_000011 Ga0450911_000011_11393_12475 360
1135 3300042115 Ga0450911_001296 Ga0450911_001296_4427_5509 360
1136 3300042122 Ga0450920_000286 Ga0450920_000286_3805_4887 360
1137 3300042124 Ga0450922_000446 Ga0450922_000446_438_1520 360
1138 3300042137 Ga0450902_003051 Ga0450902_003051_1011_2093 360
1139 3300042137 Ga0450902_004332 Ga0450902_004332_607_1689 360
1140 3300042138 Ga0450903_001699 Ga0450903_001699_35_1117 360
1141 3300042139 Ga0450904_000115 Ga0450904_000115_12319_13401 360
1142 3300042145 Ga0450906_000355 Ga0450906_000355_3702_4784 360
1143 3300042146 Ga0450907_000520 Ga0450907_000520_2006_3088 360
1144 3300042146 Ga0450907_000867 Ga0450907_000867_4092_5174 360
1145 3300042147 Ga0450910_000137 Ga0450910_000137_3888_4970 360
1146 3300042156 Ga0439446_0001927 Ga0439446_0001927_2802_3887 360
1147 3300042156 Ga0439446_0003287 Ga0439446_0003287_238_1323 360
1148 3300042156 Ga0439446_0003992 Ga0439446_0003992_426_1508 360
1149 3300042184 Ga0450908_000962 Ga0450908_000962_4335_5417 360
1150 3300042435 Ga0439434_0001117 Ga0439434_0001117_6235_7317 360
1151 3300042435 Ga0439434_0001196 Ga0439434_0001196_4744_5829 360
1152 3300042438 Ga0439459_0006118 Ga0439459_0006118_326_1408 360
1153 3300042439 Ga0439464_0006763 Ga0439464_0006763_521_1606 360
1154 3300042461 Ga0439460_0004700 Ga0439460_0004700_1934_3016 360
1155 3300042461 Ga0439460_0027644 Ga0439460_0027644_442_1524 360
1156 3300042876 Ga0451577_0038790 Ga0451577_0038790_1435_2517 360
1157 3300046452 Ga0495617_002371 Ga0495617_002371_2003_3085 360
1158 3300046452 Ga0495617_006750 Ga0495617_006750_763_1845 360
1159 3300046452 Ga0495617_007712 Ga0495617_007712_42_1124 360
1160 3300046452 Ga0495617_040143 Ga0495617_040143_418_1500 360
1161 3300046453 Ga0495627_000115 Ga0495627_000115_53715_54797 360
1162 3300046453 Ga0495627_002716 Ga0495627_002716_2583_3665 360
1163 3300046453 Ga0495627_014628 Ga0495627_014628_1485_2567 360
1164 3300046453 Ga0495627_024550 Ga0495627_024550_375_1457 360
1165 3300046455 Ga0495603_0104203 Ga0495603_0104203_228_1310 360
1166 3300046457 Ga0495590_0001555 Ga0495590_0001555_6016_7098 360
1167 3300046457 Ga0495590_0013497 Ga0495590_0013497_273_1355 360
1168 3300046457 Ga0495590_0015791 Ga0495590_0015791_210_1292 360
1169 3300046458 Ga0495591_000061 Ga0495591_000061_58990_60072 360
1170 3300046458 Ga0495591_000769 Ga0495591_000769_19280_20362 360
1171 3300046458 Ga0495591_004633 Ga0495591_004633_1857_2939 360
1172 3300046458 Ga0495591_005294 Ga0495591_005294_441_1523 360
1173 3300046458 Ga0495591_007208 Ga0495591_007208_1229_2311 360
1174 3300046458 Ga0495591_008860 Ga0495591_008860_1740_2822 360
1175 3300046458 Ga0495591_009117 Ga0495591_009117_2552_3634 360
1176 3300046458 Ga0495591_013638 Ga0495591_013638_121_1203 360
1177 3300046458 Ga0495591_020715 Ga0495591_020715_596_1678 360
1178 3300046460 Ga0495638_0015492 Ga0495638_0015492_3285_4367 360
1179 3300046460 Ga0495638_0023151 Ga0495638_0023151_2960_4042 360
1180 3300046460 Ga0495638_0024593 Ga0495638_0024593_825_1907 360
1181 3300046460 Ga0495638_0038782 Ga0495638_0038782_562_1644 360
1182 3300046463 Ga0495653_0028233 Ga0495653_0028233_173_1255 360
1183 3300046463 Ga0495653_0032916 Ga0495653_0032916_2745_3827 360
1184 3300046463 Ga0495653_0049907 Ga0495653_0049907_430_1512 360
1185 3300046463 Ga0495653_0091619 Ga0495653_0091619_410_1492 360
1186 3300046471 Ga0495650_0001411 Ga0495650_0001411_15801_16883 360
1187 3300046471 Ga0495650_0003915 Ga0495650_0003915_6732_7814 360
1188 3300046471 Ga0495650_0006927 Ga0495650_0006927_3954_5036 360
1189 3300046471 Ga0495650_0030700 Ga0495650_0030700_375_1457 360
1190 3300046471 Ga0495650_0040440 Ga0495650_0040440_367_1449 360
1191 3300046474 Ga0495605_0000079 Ga0495605_0000079_44442_45524 360
1192 3300046474 Ga0495605_0000441 Ga0495605_0000441_514_1596 360
1193 3300046474 Ga0495605_0002193 Ga0495605_0002193_10528_11610 360
1194 3300046474 Ga0495605_0002696 Ga0495605_0002696_6092_7174 360
1195 3300046474 Ga0495605_0010405 Ga0495605_0010405_561_1643 360
1196 3300046474 Ga0495605_0024924 Ga0495605_0024924_1561_2643 360
1197 3300046474 Ga0495605_0026038 Ga0495605_0026038_1520_2602 360
1198 3300046474 Ga0495605_0039963 Ga0495605_0039963_1202_2284 360
1199 3300046474 Ga0495605_0040798 Ga0495605_0040798_494_1576 360
1200 3300046474 Ga0495605_0097812 Ga0495605_0097812_209_1291 360
1201 3300046475 Ga0495639_0004422 Ga0495639_0004422_440_1522 360
1202 3300046491 Ga0495584_0006922 Ga0495584_0006922_4408_5490 360
1203 3300046491 Ga0495584_0006997 Ga0495584_0006997_4383_5465 360
1204 3300046491 Ga0495584_0007121 Ga0495584_0007121_4416_5498 360
1205 3300046491 Ga0495584_0007934 Ga0495584_0007934_93_1175 360
1206 3300046491 Ga0495584_0008025 Ga0495584_0008025_4313_5395 360
1207 3300046491 Ga0495584_0016043 Ga0495584_0016043_195_1277 360
1208 3300046492 Ga0495585_0009311 Ga0495585_0009311_442_1524 360
1209 3300046499 Ga0495594_0018026 Ga0495594_0018026_148_1230 360
1210 3300046500 Ga0495596_0000257 Ga0495596_0000257_31599_32681 360
1211 3300046500 Ga0495596_0007840 Ga0495596_0007840_2466_3548 360
1212 3300046501 Ga0495607_0000147 Ga0495607_0000147_17740_18822 360
1213 3300046501 Ga0495607_0001158 Ga0495607_0001158_12125_13207 360
1214 3300046501 Ga0495607_0003466 Ga0495607_0003466_511_1593 360
1215 3300046501 Ga0495607_0007687 Ga0495607_0007687_4380_5462 360
1216 3300046501 Ga0495607_0007858 Ga0495607_0007858_3376_4458 360
1217 3300046501 Ga0495607_0073243 Ga0495607_0073243_743_1825 360
1218 3300046501 Ga0495607_0109322 Ga0495607_0109322_245_1327 360
1219 3300046506 Ga0495583_0000763 Ga0495583_0000763_27663_28745 360
1220 3300046506 Ga0495583_0002078 Ga0495583_0002078_14204_15286 360
1221 3300046506 Ga0495583_0002814 Ga0495583_0002814_2744_3826 360
1222 3300046506 Ga0495583_0002975 Ga0495583_0002975_2055_3137 360
1223 3300046506 Ga0495583_0007538 Ga0495583_0007538_1125_2207 360
1224 3300046506 Ga0495583_0009278 Ga0495583_0009278_4776_5861 360
1225 3300046506 Ga0495583_0032210 Ga0495583_0032210_440_1522 360
1226 3300046507 Ga0495606_0000139 Ga0495606_0000139_33188_34270 360
1227 3300046507 Ga0495606_0005994 Ga0495606_0005994_297_1379 360
1228 3300046507 Ga0495606_0009824 Ga0495606_0009824_4157_5239 360
1229 3300046507 Ga0495606_0018173 Ga0495606_0018173_3644_4726 360
1230 3300046507 Ga0495606_0021237 Ga0495606_0021237_206_1288 360
1231 3300046507 Ga0495606_0050347 Ga0495606_0050347_78_1160 360
1232 3300046512 Ga0495610_0011258 Ga0495610_0011258_42_1124 360
1233 3300046512 Ga0495610_0019562 Ga0495610_0019562_2269_3351 360
1234 3300046512 Ga0495610_0020042 Ga0495610_0020042_2079_3161 360
1235 3300046512 Ga0495610_0023220 Ga0495610_0023220_2253_3335 360
1236 3300046512 Ga0495610_0057660 Ga0495610_0057660_283_1365 360
1237 3300046513 Ga0495616_0005952 Ga0495616_0005952_432_1514 360
1238 3300046513 Ga0495616_0019034 Ga0495616_0019034_72_1154 360
1239 3300046513 Ga0495616_0032604 Ga0495616_0032604_42_1124 360
1240 3300046513 Ga0495616_0043199 Ga0495616_0043199_526_1608 360
1241 3300046513 Ga0495616_0052465 Ga0495616_0052465_772_1854 360
1242 3300046513 Ga0495616_0073767 Ga0495616_0073767_102_1184 360
1243 3300046515 Ga0495620_0000044 Ga0495620_0000044_35709_36791 360
1244 3300046515 Ga0495620_0000270 Ga0495620_0000270_14445_15527 360
1245 3300046515 Ga0495620_0000538 Ga0495620_0000538_14087_15169 360
1246 3300046515 Ga0495620_0000724 Ga0495620_0000724_17559_18641 360
1247 3300046515 Ga0495620_0006866 Ga0495620_0006866_2642_3724 360
1248 3300046515 Ga0495620_0015829 Ga0495620_0015829_2206_3288 360
1249 3300046517 Ga0495630_0023231 Ga0495630_0023231_3079_4161 360
1250 3300046517 Ga0495630_0066550 Ga0495630_0066550_1368_2450 360
1251 3300046518 Ga0495631_0006682 Ga0495631_0006682_444_1526 360
1252 3300046518 Ga0495631_0010667 Ga0495631_0010667_3176_4258 360
1253 3300046519 Ga0495632_0001693 Ga0495632_0001693_2694_3776 360
1254 3300046519 Ga0495632_0006009 Ga0495632_0006009_4143_5225 360
1255 3300046519 Ga0495632_0006158 Ga0495632_0006158_4863_5945 360
1256 3300046519 Ga0495632_0006308 Ga0495632_0006308_4442_5524 360
1257 3300046519 Ga0495632_0009750 Ga0495632_0009750_42_1124 360
1258 3300046519 Ga0495632_0010862 Ga0495632_0010862_2421_3503 360
1259 3300046519 Ga0495632_0013427 Ga0495632_0013427_2933_4015 360
1260 3300046519 Ga0495632_0046623 Ga0495632_0046623_72_1154 360
1261 3300046520 Ga0495637_0000066 Ga0495637_0000066_76633_77715 360
1262 3300046520 Ga0495637_0000239 Ga0495637_0000239_31127_32209 360
1263 3300046520 Ga0495637_0007048 Ga0495637_0007048_446_1528 360
1264 3300046520 Ga0495637_0014325 Ga0495637_0014325_2558_3640 360
1265 3300046520 Ga0495637_0019951 Ga0495637_0019951_104_1186 360
1266 3300046520 Ga0495637_0044385 Ga0495637_0044385_375_1457 360
1267 3300046520 Ga0495637_0046621 Ga0495637_0046621_478_1560 360
1268 3300046520 Ga0495637_0055494 Ga0495637_0055494_501_1583 360
1269 3300046522 Ga0495643_0000763 Ga0495643_0000763_32312_33394 360
1270 3300046522 Ga0495643_0001974 Ga0495643_0001974_12298_13380 360
1271 3300046522 Ga0495643_0008586 Ga0495643_0008586_486_1568 360
1272 3300046522 Ga0495643_0032256 Ga0495643_0032256_44_1126 360
1273 3300046522 Ga0495643_0040785 Ga0495643_0040785_474_1556 360
1274 3300046522 Ga0495643_0145759 Ga0495643_0145759_63_1145 360
1275 3300046523 Ga0495644_0000476 Ga0495644_0000476_8108_9190 360
1276 3300046524 Ga0495648_0002285 Ga0495648_0002285_2747_3829 360
1277 3300046524 Ga0495648_0007380 Ga0495648_0007380_2826_3911 360
1278 3300046524 Ga0495648_0008468 Ga0495648_0008468_2701_3783 360
1279 3300046524 Ga0495648_0013321 Ga0495648_0013321_596_1678 360
1280 3300046524 Ga0495648_0020185 Ga0495648_0020185_1672_2754 360
1281 3300046524 Ga0495648_0025964 Ga0495648_0025964_2050_3132 360
1282 3300046524 Ga0495648_0088112 Ga0495648_0088112_235_1317 360
1283 3300046524 Ga0495648_0139033 Ga0495648_0139033_28_1110 360
1284 3300046526 Ga0495666_0054702 Ga0495666_0054702_749_1831 360
1285 3300046526 Ga0495666_0098701 Ga0495666_0098701_277_1359 360
1286 3300046528 Ga0495642_0003701 Ga0495642_0003701_433_1515 360
1287 3300046528 Ga0495642_0003845 Ga0495642_0003845_388_1470 360
1288 3300046530 Ga0495654_0001913 Ga0495654_0001913_6507_7589 360
1289 3300046530 Ga0495654_0007275 Ga0495654_0007275_5083_6168 360
1290 3300046530 Ga0495654_0008103 Ga0495654_0008103_4333_5415 360
1291 3300046530 Ga0495654_0014487 Ga0495654_0014487_1844_2926 360
1292 3300046530 Ga0495654_0019319 Ga0495654_0019319_443_1525 360
1293 3300046530 Ga0495654_0021353 Ga0495654_0021353_2248_3330 360
1294 3300046530 Ga0495654_0062522 Ga0495654_0062522_72_1154 360
1295 3300046530 Ga0495654_0071585 Ga0495654_0071585_462_1544 360
1296 3300046530 Ga0495654_0077161 Ga0495654_0077161_63_1145 360
1297 3300046536 Ga0495587_0079919 Ga0495587_0079919_742_1824 360
1298 3300046538 Ga0495609_0000098 Ga0495609_0000098_54767_55849 360
1299 3300046538 Ga0495609_0000323 Ga0495609_0000323_7260_8342 360
1300 3300046538 Ga0495609_0000398 Ga0495609_0000398_2735_3817 360
1301 3300046542 Ga0495597_0000137 Ga0495597_0000137_45070_46152 360
1302 3300046542 Ga0495597_0019474 Ga0495597_0019474_229_1311 360
1303 3300046542 Ga0495597_0022178 Ga0495597_0022178_384_1466 360
1304 3300046542 Ga0495597_0022986 Ga0495597_0022986_211_1293 360
1305 3300046557 Ga0495622_0005353 Ga0495622_0005353_2860_3942 360
1306 3300046557 Ga0495622_0006837 Ga0495622_0006837_103_1185 360
1307 3300046557 Ga0495622_0019242 Ga0495622_0019242_140_1222 360
1308 3300046558 Ga0495633_0000440 Ga0495633_0000440_6104_7186 360
1309 3300046558 Ga0495633_0004409 Ga0495633_0004409_1951_3033 360
1310 3300046616 Ga0495668_0033998 Ga0495668_0033998_1709_2791 360
1311 3300046616 Ga0495668_0040891 Ga0495668_0040891_1201_2283 360
1312 3300046616 Ga0495668_0041083 Ga0495668_0041083_532_1614 360
1313 3300046616 Ga0495668_0058460 Ga0495668_0058460_72_1154 360
1314 3300046642 Ga0495634_0037677 Ga0495634_0037677_387_1469 360
1315 3300046648 Ga0495611_0001266 Ga0495611_0001266_11425_12507 360
1316 3300046648 Ga0495611_0004728 Ga0495611_0004728_4751_5833 360
1317 3300046648 Ga0495611_0010879 Ga0495611_0010879_2451_3533 360
1318 3300046648 Ga0495611_0016386 Ga0495611_0016386_1583_2665 360
1319 3300046648 Ga0495611_0031597 Ga0495611_0031597_922_2004 360
1320 3300046660 Ga0495625_0000113 Ga0495625_0000113_47317_48399 360
1321 3300046660 Ga0495625_0013708 Ga0495625_0013708_2820_3902 360
1322 3300046660 Ga0495625_0027708 Ga0495625_0027708_1179_2261 360
1323 3300046660 Ga0495625_0039549 Ga0495625_0039549_1931_3013 360
1324 3300046663 Ga0495635_0014354 Ga0495635_0014354_72_1154 360
1325 3300046664 Ga0495659_0001791 Ga0495659_0001791_4249_5331 360
1326 3300046665 Ga0495661_0000112 Ga0495661_0000112_76624_77706 360
1327 3300046665 Ga0495661_0000237 Ga0495661_0000237_47150_48232 360
1328 3300046665 Ga0495661_0000633 Ga0495661_0000633_12171_13253 360
1329 3300046665 Ga0495661_0006107 Ga0495661_0006107_7000_8085 360
1330 3300046665 Ga0495661_0016928 Ga0495661_0016928_3315_4397 360
1331 3300046665 Ga0495661_0102617 Ga0495661_0102617_404_1486 360
1332 3300046665 Ga0495661_0171753 Ga0495661_0171753_32_1114 360
1333 3300046674 Ga0495588_0079410 Ga0495588_0079410_609_1691 360
1334 3300046679 Ga0495623_0010236 Ga0495623_0010236_375_1457 360
1335 3300046684 Ga0495669_0002201 Ga0495669_0002201_4910_5992 360
1336 3300046689 Ga0495613_0103782 Ga0495613_0103782_548_1630 360
1337 3300046691 Ga0495670_0003539 Ga0495670_0003539_1779_2861 360
1338 3300046691 Ga0495670_0023021 Ga0495670_0023021_1421_2503 360
1339 3300046691 Ga0495670_0024154 Ga0495670_0024154_1711_2793 360
1340 3300046692 Ga0495671_0007515 Ga0495671_0007515_3092_4174 360
1341 3300046692 Ga0495671_0008147 Ga0495671_0008147_4416_5498 360
1342 3300046692 Ga0495671_0028508 Ga0495671_0028508_1197_2279 360
1343 3300046692 Ga0495671_0029779 Ga0495671_0029779_442_1524 360
1344 3300046692 Ga0495671_0045586 Ga0495671_0045586_382_1464 360
1345 3300046692 Ga0495671_0071760 Ga0495671_0071760_325_1407 360
1346 3300046692 Ga0495671_0087557 Ga0495671_0087557_385_1467 360
1347 3300046692 Ga0495671_0099779 Ga0495671_0099779_296_1378 360
1348 3300046694 Ga0495649_0002055 Ga0495649_0002055_9508_10590 360
1349 3300046694 Ga0495649_0009532 Ga0495649_0009532_4238_5320 360
1350 3300046694 Ga0495649_0010872 Ga0495649_0010872_2433_3515 360
1351 3300046694 Ga0495649_0011731 Ga0495649_0011731_2692_3774 360
1352 3300046694 Ga0495649_0021128 Ga0495649_0021128_2101_3183 360
1353 3300046694 Ga0495649_0022205 Ga0495649_0022205_1833_2915 360
1354 3300046694 Ga0495649_0031256 Ga0495649_0031256_1293_2375 360
1355 3300046694 Ga0495649_0040018 Ga0495649_0040018_199_1281 360
1356 3300046794 Ga0495589_0004591 Ga0495589_0004591_1920_3002 360
1357 3300046794 Ga0495589_0038319 Ga0495589_0038319_1045_2127 360
1358 3300046809 Ga0495600_0018130 Ga0495600_0018130_3138_4220 360
1359 3300046810 Ga0495660_0000190 Ga0495660_0000190_63194_64276 360
1360 3300046810 Ga0495660_0049616 Ga0495660_0049616_1193_2275 360
1361 3300046810 Ga0495660_0088728 Ga0495660_0088728_140_1222 360
1362 3300046810 Ga0495660_0096705 Ga0495660_0096705_42_1124 360
1363 3300047317 Ga0495604_0023499 Ga0495604_0023499_366_1448 360
1364 3300047320 Ga0495672_0008328 Ga0495672_0008328_4065_5147 360
1365 3300047320 Ga0495672_0010702 Ga0495672_0010702_3516_4598 360
1366 3300047320 Ga0495672_0011678 Ga0495672_0011678_2278_3360 360
1367 3300047320 Ga0495672_0011796 Ga0495672_0011796_4516_5598 360
1368 3300047320 Ga0495672_0013936 Ga0495672_0013936_2546_3628 360
1369 3300047320 Ga0495672_0019532 Ga0495672_0019532_120_1202 360
1370 3300047320 Ga0495672_0033191 Ga0495672_0033191_1699_2781 360
1371 3300047321 Ga0495676_0000032 Ga0495676_0000032_78299_79381 360
1372 3300047321 Ga0495676_0013185 Ga0495676_0013185_5260_6342 360
1373 3300047322 Ga0495680_0022986 Ga0495680_0022986_562_1644 360
1374 3300047322 Ga0495680_0084248 Ga0495680_0084248_1296_2378 360
1375 3300047323 Ga0495683_0000055 Ga0495683_0000055_27852_28934 360
1376 3300047323 Ga0495683_0000236 Ga0495683_0000236_6244_7326 360
1377 3300047323 Ga0495683_0004276 Ga0495683_0004276_4373_5455 360
1378 3300047323 Ga0495683_0007387 Ga0495683_0007387_4429_5511 360
1379 3300047323 Ga0495683_0008977 Ga0495683_0008977_36_1118 360
1380 3300047323 Ga0495683_0011955 Ga0495683_0011955_1636_2718 360
1381 3300047443 Ga0495687_009435 Ga0495687_009435_12_1094 360
1382 3300047443 Ga0495687_013719 Ga0495687_013719_2689_3771 360
1383 3300047443 Ga0495687_090065 Ga0495687_090065_83_1165 360
1384 3300047444 Ga0495675_0007905 Ga0495675_0007905_1124_2206 360
1385 3300047446 Ga0495679_043940 Ga0495679_043940_134_1216 360
1386 3300047469 Ga0495673_0001256 Ga0495673_0001256_16368_17450 360
1387 3300047469 Ga0495673_0002288 Ga0495673_0002288_10499_11581 360
1388 3300047469 Ga0495673_0005066 Ga0495673_0005066_5033_6115 360
1389 3300047469 Ga0495673_0014221 Ga0495673_0014221_2145_3227 360
1390 3300047469 Ga0495673_0024272 Ga0495673_0024272_437_1519 360
1391 3300047469 Ga0495673_0030031 Ga0495673_0030031_441_1523 360
1392 3300047469 Ga0495673_0039165 Ga0495673_0039165_487_1569 360
1393 3300047469 Ga0495673_0061992 Ga0495673_0061992_132_1214 360
1394 3300047469 Ga0495673_0073270 Ga0495673_0073270_300_1382 360
1395 3300047469 Ga0495673_0081441 Ga0495673_0081441_223_1305 360
1396 3300047469 Ga0495673_0086996 Ga0495673_0086996_54_1136 360
1397 3300047470 Ga0495681_0009856 Ga0495681_0009856_4410_5492 360
1398 3300047470 Ga0495681_0013570 Ga0495681_0013570_1676_2758 360
1399 3300047470 Ga0495681_0020409 Ga0495681_0020409_36_1118 360
1400 3300047470 Ga0495681_0029047 Ga0495681_0029047_1225_2307 360
1401 3300047470 Ga0495681_0109114 Ga0495681_0109114_93_1175 360
1402 3300047471 Ga0495684_0038420 Ga0495684_0038420_2157_3239 360
1403 3300047472 Ga0495686_0012681 Ga0495686_0012681_472_1554 360
1404 3300047472 Ga0495686_0047370 Ga0495686_0047370_431_1513 360
1405 3300047673 Ga0495593_0013908 Ga0495593_0013908_3136_4218 360
1406 3300047673 Ga0495593_0052038 Ga0495593_0052038_390_1472 360
1407 3300048091 Ga0495626_0000024 Ga0495626_0000024_76420_77502 360
1408 3300048091 Ga0495626_0004732 Ga0495626_0004732_2838_3920 360
1409 3300048091 Ga0495626_0005414 Ga0495626_0005414_1885_2967 360
1410 3300048091 Ga0495626_0007792 Ga0495626_0007792_4380_5462 360
1411 3300048091 Ga0495626_0016287 Ga0495626_0016287_2251_3333 360
1412 3300048091 Ga0495626_0027792 Ga0495626_0027792_1036_2118 360
1413 3300048905 Ga0496102_0020156 Ga0496102_0020156_393_1475 360
1414 3300048913 Ga0496110_0048183 Ga0496110_0048183_130_1212 360
1415 3300048913 Ga0496110_0164361 Ga0496110_0164361_388_1470 360
1416 3300048914 Ga0496111_0170923 Ga0496111_0170923_423_1505 360
1417 3300048917 Ga0496114_0143955 Ga0496114_0143955_221_1303 360
1418 3300048919 Ga0496116_0001725 Ga0496116_0001725_7799_8881 360
1419 3300048919 Ga0496116_0011675 Ga0496116_0011675_4238_5320 360
1420 3300048919 Ga0496116_0025706 Ga0496116_0025706_2894_3976 360
1421 3300048920 Ga0496117_0006500 Ga0496117_0006500_7761_8843 360
1422 3300048920 Ga0496117_0007309 Ga0496117_0007309_382_1464 360
1423 3300048920 Ga0496117_0008713 Ga0496117_0008713_529_1611 360
1424 3300048920 Ga0496117_0009017 Ga0496117_0009017_81_1163 360
1425 3300048920 Ga0496117_0017029 Ga0496117_0017029_442_1527 360
1426 3300048920 Ga0496117_0018515 Ga0496117_0018515_4278_5360 360
1427 3300048920 Ga0496117_0030449 Ga0496117_0030449_2620_3705 360
1428 3300048920 Ga0496117_0125530 Ga0496117_0125530_119_1201 360
1429 3300048921 Ga0496118_0028798 Ga0496118_0028798_979_2061 360
1430 3300048921 Ga0496118_0031832 Ga0496118_0031832_377_1459 360
1431 3300048921 Ga0496118_0033154 Ga0496118_0033154_2733_3815 360
1432 3300048921 Ga0496118_0042110 Ga0496118_0042110_440_1525 360
1433 3300048921 Ga0496118_0075233 Ga0496118_0075233_312_1394 360
1434 3300048922 Ga0496119_0000506 Ga0496119_0000506_40518_41600 360
1435 3300048922 Ga0496119_0071609 Ga0496119_0071609_386_1468 360
1436 3300048923 Ga0496120_0001362 Ga0496120_0001362_2667_3749 360
1437 3300048924 Ga0496121_0005168 Ga0496121_0005168_65_1147 360
1438 3300048924 Ga0496121_0006488 Ga0496121_0006488_2729_3811 360
1439 3300048924 Ga0496121_0014652 Ga0496121_0014652_2719_3801 360
1440 3300048924 Ga0496121_0022108 Ga0496121_0022108_4097_5179 360
1441 3300048924 Ga0496121_0096953 Ga0496121_0096953_344_1429 360
1442 3300048925 Ga0496122_0001565 Ga0496122_0001565_32257_33339 360
1443 3300048925 Ga0496122_0007408 Ga0496122_0007408_5475_6557 360
1444 3300048925 Ga0496122_0021592 Ga0496122_0021592_437_1519 360
1445 3300048925 Ga0496122_0088032 Ga0496122_0088032_439_1521 360
1446 3300048926 Ga0496123_0001258 Ga0496123_0001258_32521_33603 360
1447 3300048926 Ga0496123_0005881 Ga0496123_0005881_1771_2853 360
1448 3300048926 Ga0496123_0024029 Ga0496123_0024029_3345_4427 360
1449 3300048926 Ga0496123_0031632 Ga0496123_0031632_1550_2632 360
1450 3300048927 Ga0496124_0000279 Ga0496124_0000279_74051_75133 360
1451 3300048927 Ga0496124_0003507 Ga0496124_0003507_5627_6709 360
1452 3300048927 Ga0496124_0007177 Ga0496124_0007177_485_1567 360
1453 3300048927 Ga0496124_0013149 Ga0496124_0013149_4507_5589 360
1454 3300048927 Ga0496124_0035067 Ga0496124_0035067_165_1247 360
1455 3300048927 Ga0496124_0041751 Ga0496124_0041751_254_1336 360
1456 3300048927 Ga0496124_0105578 Ga0496124_0105578_472_1554 360
1457 3300048927 Ga0496124_0121323 Ga0496124_0121323_27_1109 360
1458 3300048928 Ga0496125_0014065 Ga0496125_0014065_6211_7293 360
1459 3300048928 Ga0496125_0015865 Ga0496125_0015865_5738_6823 360
1460 3300048928 Ga0496125_0040690 Ga0496125_0040690_444_1526 360
1461 3300048928 Ga0496125_0087462 Ga0496125_0087462_268_1350 360
1462 3300048929 Ga0496126_0043641 Ga0496126_0043641_105_1187 360
1463 3300048929 Ga0496126_0056657 Ga0496126_0056657_429_1514 360
1464 3300048929 Ga0496126_0160922 Ga0496126_0160922_256_1338 360
1465 3300049459 Ga0495678_000054 Ga0495678_000054_35741_36823 360
1466 3300049459 Ga0495678_000078 Ga0495678_000078_80000_81082 360
1467 3300049459 Ga0495678_005003 Ga0495678_005003_4383_5465 360
1468 3300049459 Ga0495678_006344 Ga0495678_006344_2666_3748 360
1469 3300049459 Ga0495678_007286 Ga0495678_007286_369_1451 360
1470 3300049459 Ga0495678_011543 Ga0495678_011543_2076_3158 360
1471 3300049459 Ga0495678_061005 Ga0495678_061005_193_1275 360
1472 3300049460 Ga0495682_0001399 Ga0495682_0001399_2737_3819 360
1473 3300049460 Ga0495682_0001713 Ga0495682_0001713_9021_10103 360
1474 3300049460 Ga0495682_0030254 Ga0495682_0030254_483_1565 360
1475 3300049460 Ga0495682_0069278 Ga0495682_0069278_111_1193 360
1476 3300049569 Ga0501032_0011796 Ga0501032_0011796_3153_4238 360
1477 3300049571 Ga0501034_0000136 Ga0501034_0000136_92879_93961 360
1478 3300049581 Ga0501047_0215307 Ga0501047_0215307_576_1661 360
1479 3300049853 Ga0501226_000060 Ga0501226_000060_10617_11699 360
1480 3300053098 Ga0500650_0000224 Ga0500650_0000224_4352_5440 360
1481 3300053138 Ga0500564_007906 Ga0500564_007906_2105_3190 360
1482 3300055283 Ga0500661_012745 Ga0500661_012745_349_1431 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02222

ATP-grasp

ATP-grasp domain

123

292

0.99

PF22660

RS_preATP-grasp-like

Ribonucleotide synthetase preATP-grasp domain

17

114

0.98

PF17769

PurK_C

Phosphoribosylaminoimidazole carboxylase C-terminal domain

318

379

0.94

PF21244

PurT_C

PurT, C-terminal

322

387

0.92

PF02655

ATP-grasp_3

ATP-grasp domain

113

284

0.82

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

115

311

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aw8-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 0.9571 3 359
4ma5-assembly1.cif.gz_A-2 the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. 0.9548 1 358
4ma0-assembly1.cif.gz_A the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp 0.9517 1 358
4ma5-assembly1.cif.gz_A-2 the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. 0.9496 1 358
4e4t-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.9473 2 358
ID Description Score Start End Superfamily
af_Q54QE4_620_731_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9775 2 100 3.40.50.20
3v4sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9694 2 105 3.40.50.20
3aw8B03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9684 176 359 3.30.470.20
3aw8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9631 3 94 3.40.50.20
4izoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9578 2 105 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A359EMS6-F1-model_v4 deleted 0.9988 1 71
AF-A0A101DAU9-F1-model_v4 Phosphoribosylaminoimidazole carboxylase ATPase subunit 0.9985 148 358 GO:0003824
GO:0005524
GO:0005829
GO:0046872
AF-A0A355R742-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide synthase (EC 4.1.1.21) 0.9957 1 95 GO:0004638
GO:0005829
AF-A0A259SD53-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide synthase 0.9932 193 345 GO:0003824
GO:0005524
GO:0005829
GO:0046872
AF-A0A2E2J851-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.986 1 358 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.39 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map