F494279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1482 | 801 | 1133 | 365 |
Family's Representative Sequence
| Representative Sequence | 3300003382|JGI26139J50223_100054|JGI26139J50223_1000543 |
| Length | 399 |
| Sequence | MKQPFSFYKYGFSPNGITLGVIGGGQLGKMLGIEAKRMSMKLAYLDPDMNCPASTLADQMIVSDFKDEKSILELAEKVDVLTYEIELANSSVLKDLESRGHLIHPASGVLKTIQNKLRQKKFLKAKGIPVPAFEEVTSVEQIKKICKEFGYPSVLKACEDSYDGRGNFLIRSTSDVERGIKYFEGRRCMIEKYIHFTKEISVMVARNTHGQIVSFPVVQNIHTNGILDTTIVPSGENRRVESNAMSIAEKVVKSLRGVGIFGIEMFLKDNKIMINEIAPRPHNSGHYSIEACSVSQFEQHIRAILGLPLVEPRLLSPVVMMXILGXPDYSGEYSFRGIEKALSVPGLKLHFYGKRITKPQRKLGHFTVTAERIEEALSRARRVRKMLTIGKRNGDKQKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 5 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 6 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 7 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 8 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 9 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 10 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 11 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 12 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 13 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 14 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 15 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 16 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 17 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 18 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 19 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 20 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 21 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 22 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 23 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 24 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 25 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 26 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 27 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 28 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 29 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 30 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 31 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 32 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 33 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 34 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 35 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 36 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 37 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 38 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 39 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 40 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 41 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 42 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 43 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 44 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 45 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 46 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 47 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 48 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 49 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 50 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 51 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 52 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 53 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 54 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 55 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 56 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 57 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 58 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 59 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 60 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 61 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 62 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 63 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 64 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 65 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 66 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 67 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 68 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 69 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 70 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 71 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 72 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 73 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 74 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 75 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 76 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 77 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 78 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 79 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 80 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 81 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 82 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 83 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 84 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 85 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 86 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 87 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 88 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 89 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 90 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 91 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 92 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 93 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 94 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 95 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 96 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 97 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 98 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 99 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 100 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 101 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 102 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 103 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 104 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 105 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 106 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 107 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 108 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 109 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 110 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 111 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 112 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 113 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 114 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 115 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 116 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 117 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 118 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 119 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 120 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 121 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 122 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 123 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 124 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 125 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 126 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 127 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 128 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 129 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 130 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 131 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 132 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 133 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 134 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 135 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 136 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 137 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 138 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 139 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 140 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 141 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 142 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 143 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 144 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 145 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 146 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 147 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 148 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 149 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 150 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 151 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 152 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 153 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 154 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 155 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 156 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 157 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 158 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 159 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 160 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 161 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 162 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 163 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 164 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 165 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 166 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 167 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 168 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 169 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 170 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 171 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 172 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 173 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 174 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 175 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 176 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 177 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 178 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 179 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 180 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 181 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 182 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 183 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 184 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 185 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 186 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 187 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 188 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 189 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 190 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 191 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 192 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 193 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 194 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 195 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 196 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 197 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 198 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 199 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 200 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 201 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 202 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 203 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 204 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 205 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 206 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 207 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 208 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 209 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 210 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 211 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 212 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 213 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 214 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 215 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 216 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 217 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 218 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 219 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 220 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 221 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 222 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 223 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 224 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 225 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 226 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 227 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 228 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 229 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 230 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 231 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 232 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 233 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 234 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 235 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 236 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 237 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 238 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 239 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 240 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 241 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 242 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 243 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 244 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 245 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 246 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 247 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 248 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 249 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 250 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 251 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 252 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 253 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 254 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 255 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 256 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 257 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 258 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 259 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 260 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 261 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 262 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 263 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 264 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 265 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 266 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 267 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 268 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 269 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 270 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 271 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 272 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 273 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 274 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 275 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 276 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 277 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 278 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 279 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 280 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 281 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 282 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 283 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 284 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 285 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 286 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 287 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 288 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 289 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 290 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 291 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 292 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 293 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 294 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 295 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 296 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 297 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 298 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 299 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 300 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 301 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 302 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 303 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 304 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 305 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 306 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 307 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 308 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 309 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 310 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 311 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 312 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 313 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 314 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 317 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 318 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 319 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 320 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 321 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 322 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 323 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 324 | 3300003382 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM | Metagenome | Rhizosphere |
| 325 | 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Metagenome | Rhizosphere |
| 326 | 3300003391 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM | Metagenome | Rhizosphere |
| 327 | 3300003392 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM | Metagenome | Rhizosphere |
| 328 | 3300003396 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM | Metagenome | Rhizosphere |
| 329 | 3300003400 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM | Metagenome | Rhizosphere |
| 330 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 331 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 332 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 333 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 334 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 335 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 336 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 337 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 338 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 339 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 340 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 341 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 342 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 343 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 344 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 345 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 346 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 347 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 348 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 350 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 351 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 352 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 353 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 354 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 355 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 357 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 358 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 360 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 361 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 362 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 364 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 365 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 366 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 367 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 368 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 369 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 370 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 371 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 372 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 373 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 374 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 375 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 376 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 377 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 378 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 379 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 380 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 381 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 382 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 383 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 384 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 385 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 386 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 387 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 388 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 389 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 390 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 391 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 392 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 393 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 394 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 395 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 396 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 397 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 398 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 399 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 400 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 402 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 403 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 404 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 405 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 406 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 407 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 408 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 409 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 411 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 412 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 413 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 414 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 415 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 416 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 417 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 418 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 420 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 422 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 423 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 424 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 425 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 426 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 427 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 428 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 429 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 430 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 431 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 432 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 433 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 434 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 435 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 436 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 437 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 438 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 439 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 440 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 441 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 442 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 443 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 444 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 445 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 446 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 447 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 448 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 449 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 450 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 451 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 452 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 453 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 454 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 455 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 456 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 457 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 458 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 459 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 460 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 461 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 465 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 466 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 467 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 468 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 469 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 470 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 471 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 472 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 473 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 474 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 475 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 476 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 477 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 478 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 479 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 526 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 527 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 531 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 533 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 540 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 545 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 548 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 549 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 550 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 551 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 552 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 553 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 554 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 555 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 556 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 557 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 558 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 559 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 560 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 561 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 562 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 563 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 564 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 565 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 566 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 567 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 568 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 569 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 570 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 571 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 572 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 573 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 574 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 575 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 576 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 577 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 578 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 579 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 580 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 581 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 582 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 583 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 584 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 585 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 586 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 587 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 588 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 589 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 590 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 591 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 592 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 593 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 594 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 595 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 596 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 597 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 598 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 599 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 600 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 601 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 602 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 603 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 604 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 605 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 606 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 607 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 608 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 609 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 610 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 611 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 612 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 613 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 614 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 615 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 616 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 617 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 685 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 686 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 687 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 688 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 689 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 690 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 691 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 692 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 693 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 694 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 695 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 696 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 697 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 698 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 699 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 700 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 701 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 702 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 703 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 704 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 707 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 708 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 709 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 710 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 711 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 712 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 713 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 714 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 715 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 716 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 717 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 718 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 719 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 720 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 721 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 722 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 723 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 724 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 725 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 726 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 727 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 728 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 729 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 730 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 731 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 732 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 733 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 734 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 735 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 736 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 737 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 738 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 739 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 740 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 741 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 742 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 743 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 744 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 745 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 746 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 747 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 748 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 749 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 750 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 751 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 752 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 753 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 754 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 755 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 756 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 757 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 758 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 759 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 760 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 761 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 762 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 763 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 764 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 765 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 766 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 767 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 768 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 769 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 770 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 771 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 772 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 773 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 774 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 775 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 776 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 777 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 778 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 779 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 780 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 781 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 782 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 783 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 784 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 785 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 786 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 787 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 788 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 789 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 790 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 791 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 792 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 793 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 794 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 795 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 796 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 797 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 798 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 799 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 800 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 801 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.18 |
| Metatranscriptomes | 0.27 |
| Isolates | 23.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 5.67 |
| Nodule | 3.31 |
| Rhizoplane | 5.87 |
| Rhizosphere | 71.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_41 | 2124908027 | Bacteria | 51011 |
| 2 | SwRhRL2b_contig_1813663 | 2162886007 | Archaea | 4811 |
| 3 | 2214767444 | 2209111006 | Archaea | 2735 |
| 4 | ARSoilYngRDRAFT_c00058 | 3300000042 | Archaea | 18443 |
| 5 | ARcpr5yngRDRAFT_c000667 | 3300000043 | Unclassified | 4288 |
| 6 | ARCol0oldRDRAFT_c01097 | 3300000045 | Unclassified | 2003 |
| 7 | ARCol0yngRDRAFT_1000156 | 3300000652 | Archaea | 12026 |
| 8 | JGI24741J21665_1002517 | 3300001915 | Bacteria | 4736 |
| 9 | JGI25162J39368_1000082 | 3300002737 | Bacteria | 112599 |
| 10 | JGI25162J39368_1000282 | 3300002737 | Bacteria | 47984 |
| 11 | JGI25163J39215_1002227 | 3300002771 | Bacteria | 2175 |
| 12 | JGI25163J39215_1002252 | 3300002771 | Bacteria | 2132 |
| 13 | JGI25164J39214_1000058 | 3300002772 | Bacteria | 112599 |
| 14 | JGI25164J39214_1000212 | 3300002772 | Bacteria | 47984 |
| 15 | JGI25151J46595_10032883 | 3300003187 | Bacteria | 2004 |
| 16 | JGI25165J46597_1000154 | 3300003214 | Bacteria | 112599 |
| 17 | JGI25165J46597_1000383 | 3300003214 | Bacteria | 47984 |
| 18 | rootH1_10196566 | 3300003323 | Bacteria | 2082 |
| 19 | JGI26139J50223_100054 | 3300003382 | Archaea | 5831 |
| 20 | JGI26140J50224_100023 | 3300003383 | Archaea | 10005 |
| 21 | JGI26135J50243_100037 | 3300003391 | Archaea | 3689 |
| 22 | JGI26134J50242_100070 | 3300003392 | Archaea | 5465 |
| 23 | JGI26137J50245_100034 | 3300003396 | Archaea | 7117 |
| 24 | JGI26131J50246_100183 | 3300003400 | Archaea | 3089 |
| 25 | JGI26141J51220_1000083 | 3300003503 | Archaea | 4317 |
| 26 | Ga0006562J51391_1005474 | 3300003578 | Bacteria | 7544 |
| 27 | Ga0006562J51391_1082126 | 3300003578 | Bacteria | 5446 |
| 28 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 29 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 30 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 31 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 32 | Ga0055525_1000078 | 3300003759 | Bacteria | 165788 |
| 33 | Ga0055536_1004543 | 3300003781 | Bacteria | 7053 |
| 34 | Ga0055536_1009458 | 3300003781 | Bacteria | 4031 |
| 35 | Ga0055530_10005470 | 3300003791 | Bacteria | 6021 |
| 36 | Ga0055530_10008701 | 3300003791 | Bacteria | 4019 |
| 37 | Ga0055540_1004724 | 3300003792 | Bacteria | 6021 |
| 38 | Ga0055540_1007682 | 3300003792 | Bacteria | 4019 |
| 39 | Ga0055540_1007709 | 3300003792 | Bacteria | 4009 |
| 40 | Ga0055531_10018175 | 3300003794 | Bacteria | 2918 |
| 41 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 42 | Ga0058692_1002657 | 3300003856 | Bacteria | 5886 |
| 43 | Ga0058692_1010554 | 3300003856 | Bacteria | 2278 |
| 44 | Ga0065714_10000267 | 3300005288 | Bacteria | 6421 |
| 45 | Ga0065714_10002271 | 3300005288 | Bacteria | 29440 |
| 46 | Ga0065714_10079463 | 3300005288 | Bacteria | 2514 |
| 47 | Ga0065714_10092917 | 3300005288 | Bacteria | 1862 |
| 48 | Ga0065714_10094068 | 3300005288 | Bacteria | 1828 |
| 49 | Ga0065714_10098654 | 3300005288 | Bacteria | 1705 |
| 50 | Ga0065714_10115267 | 3300005288 | Bacteria | 1411 |
| 51 | Ga0065704_10000453 | 3300005289 | Archaea | 26914 |
| 52 | Ga0065704_10015230 | 3300005289 | Bacteria | 1992 |
| 53 | Ga0065704_10075102 | 3300005289 | Bacteria | 5789 |
| 54 | Ga0065704_10109318 | 3300005289 | Bacteria | 1991 |
| 55 | Ga0065704_10137692 | 3300005289 | Archaea | 1537 |
| 56 | Ga0065712_10067981 | 3300005290 | Bacteria | 18214 |
| 57 | Ga0065715_10000311 | 3300005293 | Archaea | 15053 |
| 58 | Ga0065707_10000468 | 3300005295 | Archaea | 35383 |
| 59 | Ga0065707_10006314 | 3300005295 | Archaea | 3629 |
| 60 | Ga0070658_10001239 | 3300005327 | Bacteria | 21882 |
| 61 | Ga0070658_10011905 | 3300005327 | Bacteria | 6985 |
| 62 | Ga0070676_10010547 | 3300005328 | Archaea | 5012 |
| 63 | Ga0070670_100023631 | 3300005331 | Archaea | 5290 |
| 64 | Ga0070670_100032384 | 3300005331 | Bacteria | 4502 |
| 65 | Ga0070670_100090345 | 3300005331 | Bacteria | 2632 |
| 66 | Ga0070670_100102136 | 3300005331 | Unclassified | 2469 |
| 67 | Ga0070677_10000357 | 3300005333 | Bacteria | 15999 |
| 68 | Ga0068869_100108529 | 3300005334 | Archaea | 2109 |
| 69 | Ga0070680_100002694 | 3300005336 | Bacteria | 13171 |
| 70 | Ga0070680_100021537 | 3300005336 | Bacteria | 5124 |
| 71 | Ga0070680_100043723 | 3300005336 | Archaea | 3638 |
| 72 | Ga0070680_100159948 | 3300005336 | Archaea | 1892 |
| 73 | Ga0068868_100000090 | 3300005338 | Bacteria | 55967 |
| 74 | Ga0068868_100024633 | 3300005338 | Archaea | 4569 |
| 75 | Ga0070660_100000304 | 3300005339 | Bacteria | 32718 |
| 76 | Ga0070660_100002009 | 3300005339 | Bacteria | 14025 |
| 77 | Ga0070687_100001943 | 3300005343 | Archaea | 7543 |
| 78 | Ga0070661_100004654 | 3300005344 | Bacteria | 9450 |
| 79 | Ga0070669_100000186 | 3300005353 | Bacteria | 54020 |
| 80 | Ga0070669_100005298 | 3300005353 | Archaea | 9312 |
| 81 | Ga0070669_100005487 | 3300005353 | Bacteria | 9155 |
| 82 | Ga0070675_100002894 | 3300005354 | Archaea | 12934 |
| 83 | Ga0070675_100034536 | 3300005354 | Bacteria | 4105 |
| 84 | Ga0070671_100125049 | 3300005355 | Bacteria | 2165 |
| 85 | Ga0070673_100003226 | 3300005364 | Archaea | 10116 |
| 86 | Ga0070659_100000017 | 3300005366 | Bacteria | 163966 |
| 87 | Ga0070659_100176840 | 3300005366 | Bacteria | 1750 |
| 88 | Ga0070667_100018360 | 3300005367 | Archaea | 5800 |
| 89 | Ga0070714_100002598 | 3300005435 | Bacteria | 13311 |
| 90 | Ga0070714_100106996 | 3300005435 | Bacteria | 2471 |
| 91 | Ga0070701_10040588 | 3300005438 | Archaea | 2367 |
| 92 | Ga0070705_100002795 | 3300005440 | Archaea | 8697 |
| 93 | Ga0070700_100007831 | 3300005441 | Archaea | 5794 |
| 94 | Ga0070694_100018613 | 3300005444 | Archaea | 4410 |
| 95 | Ga0070694_100056352 | 3300005444 | Archaea | 2669 |
| 96 | Ga0070694_100218124 | 3300005444 | Archaea | 1430 |
| 97 | Ga0070663_100103032 | 3300005455 | Bacteria | 2132 |
| 98 | Ga0070662_100039239 | 3300005457 | Archaea | 3368 |
| 99 | Ga0068867_100003802 | 3300005459 | Archaea | 10616 |
| 100 | Ga0068867_100012617 | 3300005459 | Archaea | 5976 |
| 101 | Ga0068867_100012758 | 3300005459 | Archaea | 5945 |
| 102 | Ga0070679_100017671 | 3300005530 | Bacteria | 6904 |
| 103 | Ga0070679_100119369 | 3300005530 | Archaea | 2622 |
| 104 | Ga0068853_100000102 | 3300005539 | Bacteria | 57320 |
| 105 | Ga0070672_100009136 | 3300005543 | Archaea | 6820 |
| 106 | Ga0070672_100020750 | 3300005543 | Archaea | 4796 |
| 107 | Ga0070695_100004446 | 3300005545 | Archaea | 8235 |
| 108 | Ga0070695_100009911 | 3300005545 | Archaea | 5677 |
| 109 | Ga0070696_100008204 | 3300005546 | Archaea | 6989 |
| 110 | Ga0070693_100001832 | 3300005547 | Archaea | 9703 |
| 111 | Ga0070693_100047719 | 3300005547 | Archaea | 2437 |
| 112 | Ga0070693_100128084 | 3300005547 | Archaea | 1583 |
| 113 | Ga0070665_100009114 | 3300005548 | Bacteria | 10052 |
| 114 | Ga0070665_100018309 | 3300005548 | Bacteria | 7021 |
| 115 | Ga0070665_100268266 | 3300005548 | Bacteria | 1708 |
| 116 | Ga0070704_100029590 | 3300005549 | Archaea | 3659 |
| 117 | Ga0068855_100145236 | 3300005563 | Bacteria | 2701 |
| 118 | Ga0068855_100193266 | 3300005563 | Bacteria | 2294 |
| 119 | Ga0070664_100000292 | 3300005564 | Bacteria | 36276 |
| 120 | Ga0070664_100069489 | 3300005564 | Bacteria | 3014 |
| 121 | Ga0068857_100000202 | 3300005577 | Bacteria | 38628 |
| 122 | Ga0068857_100087774 | 3300005577 | Archaea | 2782 |
| 123 | Ga0070702_100005406 | 3300005615 | Archaea | 5943 |
| 124 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 125 | Ga0068859_100031931 | 3300005617 | Bacteria | 5290 |
| 126 | Ga0068864_100050941 | 3300005618 | Archaea | 3565 |
| 127 | Ga0068851_10000039 | 3300005834 | Bacteria | 93193 |
| 128 | Ga0068870_10006861 | 3300005840 | Archaea | 5051 |
| 129 | Ga0068860_100015622 | 3300005843 | Archaea | 7413 |
| 130 | Ga0068862_100009539 | 3300005844 | Archaea | 8028 |
| 131 | Ga0081455_10001563 | 3300005937 | Archaea | 28124 |
| 132 | Ga0081455_10091056 | 3300005937 | Archaea | 2471 |
| 133 | Ga0081539_10009797 | 3300005985 | Bacteria | 7921 |
| 134 | Ga0075365_10032862 | 3300006038 | Bacteria | 3339 |
| 135 | Ga0075368_10008012 | 3300006042 | Bacteria | 3747 |
| 136 | Ga0075363_100000028 | 3300006048 | Bacteria | 28528 |
| 137 | Ga0075432_10005388 | 3300006058 | Bacteria | 4361 |
| 138 | Ga0075432_10007561 | 3300006058 | Bacteria | 3702 |
| 139 | Ga0075432_10011898 | 3300006058 | Bacteria | 2957 |
| 140 | Ga0075432_10066334 | 3300006058 | Bacteria | 1291 |
| 141 | Ga0075362_10000123 | 3300006177 | Bacteria | 21730 |
| 142 | Ga0075427_10001751 | 3300006194 | Unclassified | 2827 |
| 143 | Ga0075366_10002286 | 3300006195 | Bacteria | 9788 |
| 144 | Ga0097621_100039789 | 3300006237 | Archaea | 3778 |
| 145 | Ga0075428_100031193 | 3300006844 | Archaea | 5894 |
| 146 | Ga0075428_100061051 | 3300006844 | Unclassified | 4127 |
| 147 | Ga0075430_100019455 | 3300006846 | Bacteria | 5774 |
| 148 | Ga0075431_100052886 | 3300006847 | Bacteria | 4187 |
| 149 | Ga0075433_10001199 | 3300006852 | Archaea | 18871 |
| 150 | Ga0075433_10304420 | 3300006852 | Archaea | 1411 |
| 151 | Ga0075434_100013393 | 3300006871 | Archaea | 7802 |
| 152 | Ga0075434_100042060 | 3300006871 | Bacteria | 4529 |
| 153 | Ga0075429_100021754 | 3300006880 | Archaea | 5561 |
| 154 | Ga0075429_100037148 | 3300006880 | Archaea | 4239 |
| 155 | Ga0068865_100011657 | 3300006881 | Archaea | 5507 |
| 156 | Ga0068865_100194332 | 3300006881 | Archaea | 1571 |
| 157 | Ga0075436_100001494 | 3300006914 | Archaea | 15938 |
| 158 | Ga0097620_100031931 | 3300006931 | Bacteria | 5290 |
| 159 | Ga0099823_1033941 | 3300006944 | Bacteria | 4068 |
| 160 | Ga0079104_1000783 | 3300006946 | Bacteria | 26990 |
| 161 | Ga0079104_1001850 | 3300006946 | Bacteria | 12887 |
| 162 | Ga0079104_1007967 | 3300006946 | Bacteria | 3769 |
| 163 | Ga0079104_1025604 | 3300006946 | Bacteria | 1538 |
| 164 | Ga0099826_10018325 | 3300006948 | Bacteria | 5285 |
| 165 | Ga0099826_10022778 | 3300006948 | Bacteria | 4677 |
| 166 | Ga0075435_100001664 | 3300007076 | Archaea | 14421 |
| 167 | Ga0075435_100027360 | 3300007076 | Bacteria | 4459 |
| 168 | Ga0105251_10000089 | 3300009011 | Bacteria | 88101 |
| 169 | Ga0105251_10000309 | 3300009011 | Bacteria | 48873 |
| 170 | Ga0105251_10001733 | 3300009011 | Bacteria | 18202 |
| 171 | Ga0105251_10002983 | 3300009011 | Bacteria | 12666 |
| 172 | Ga0105251_10008371 | 3300009011 | Bacteria | 6235 |
| 173 | Ga0105251_10008769 | 3300009011 | Bacteria | 6063 |
| 174 | Ga0105251_10008839 | 3300009011 | Bacteria | 6032 |
| 175 | Ga0105251_10011986 | 3300009011 | Bacteria | 4922 |
| 176 | Ga0105251_10016631 | 3300009011 | Bacteria | 3967 |
| 177 | Ga0105251_10031611 | 3300009011 | Bacteria | 2647 |
| 178 | Ga0105251_10060729 | 3300009011 | Bacteria | 1779 |
| 179 | Ga0105244_10000073 | 3300009036 | Bacteria | 115279 |
| 180 | Ga0105244_10008948 | 3300009036 | Bacteria | 6199 |
| 181 | Ga0105244_10019839 | 3300009036 | Bacteria | 3742 |
| 182 | Ga0105244_10026498 | 3300009036 | Bacteria | 3136 |
| 183 | Ga0105244_10040778 | 3300009036 | Bacteria | 2408 |
| 184 | Ga0105244_10053285 | 3300009036 | Bacteria | 2056 |
| 185 | Ga0105244_10056111 | 3300009036 | Bacteria | 1994 |
| 186 | Ga0105244_10069855 | 3300009036 | Bacteria | 1753 |
| 187 | Ga0105244_10074858 | 3300009036 | Bacteria | 1683 |
| 188 | Ga0105244_10081426 | 3300009036 | Bacteria | 1602 |
| 189 | Ga0105244_10134339 | 3300009036 | Bacteria | 1193 |
| 190 | Ga0105250_10001135 | 3300009092 | Bacteria | 15004 |
| 191 | Ga0105250_10004905 | 3300009092 | Bacteria | 6080 |
| 192 | Ga0105250_10006294 | 3300009092 | Bacteria | 5202 |
| 193 | Ga0105250_10012182 | 3300009092 | Bacteria | 3556 |
| 194 | Ga0105250_10023887 | 3300009092 | Bacteria | 2465 |
| 195 | Ga0105250_10054760 | 3300009092 | Bacteria | 1600 |
| 196 | Ga0105240_10011111 | 3300009093 | Bacteria | 12585 |
| 197 | Ga0105240_10235193 | 3300009093 | Bacteria | 2127 |
| 198 | Ga0105240_10404324 | 3300009093 | Archaea | 1537 |
| 199 | Ga0111539_10017218 | 3300009094 | Archaea | 8944 |
| 200 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 201 | Ga0105245_10014262 | 3300009098 | Bacteria | 6924 |
| 202 | Ga0114129_10067799 | 3300009147 | Archaea | 4975 |
| 203 | Ga0105243_10005333 | 3300009148 | Bacteria | 10041 |
| 204 | Ga0105243_10005730 | 3300009148 | Bacteria | 9649 |
| 205 | Ga0105243_10006305 | 3300009148 | Bacteria | 9166 |
| 206 | Ga0105243_10013497 | 3300009148 | Bacteria | 6179 |
| 207 | Ga0105243_10013630 | 3300009148 | Bacteria | 6149 |
| 208 | Ga0105243_10118135 | 3300009148 | Bacteria | 2231 |
| 209 | Ga0105241_10013723 | 3300009174 | Bacteria | 5935 |
| 210 | Ga0105242_10001069 | 3300009176 | Bacteria | 21506 |
| 211 | Ga0105242_10076312 | 3300009176 | Bacteria | 2793 |
| 212 | Ga0105248_10006628 | 3300009177 | Bacteria | 12693 |
| 213 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 214 | Ga0105237_10000737 | 3300009545 | Bacteria | 45119 |
| 215 | Ga0105237_10001100 | 3300009545 | Bacteria | 36161 |
| 216 | Ga0105237_10036109 | 3300009545 | Bacteria | 5000 |
| 217 | Ga0105237_10064979 | 3300009545 | Archaea | 3645 |
| 218 | Ga0105238_10012550 | 3300009551 | Bacteria | 8551 |
| 219 | Ga0105238_10069303 | 3300009551 | Bacteria | 3527 |
| 220 | Ga0105238_10213913 | 3300009551 | Bacteria | 1904 |
| 221 | Ga0105249_10007620 | 3300009553 | Bacteria | 9443 |
| 222 | Ga0105239_10001737 | 3300010375 | Bacteria | 28726 |
| 223 | Ga0105239_10038118 | 3300010375 | Archaea | 5266 |
| 224 | Ga0105246_10002522 | 3300011119 | Bacteria | 11069 |
| 225 | Ga0105246_10006273 | 3300011119 | Bacteria | 7256 |
| 226 | Ga0105246_10007597 | 3300011119 | Archaea | 6648 |
| 227 | Ga0105246_10012251 | 3300011119 | Bacteria | 5345 |
| 228 | Ga0105246_10028338 | 3300011119 | Bacteria | 3678 |
| 229 | Ga0105246_10054082 | 3300011119 | Bacteria | 2765 |
| 230 | Ga0105246_10061654 | 3300011119 | Bacteria | 2611 |
| 231 | Ga0157340_1000098 | 3300012473 | Archaea | 2784 |
| 232 | Ga0157317_1000264 | 3300012475 | Archaea | 1979 |
| 233 | Ga0157320_1000028 | 3300012481 | Archaea | 3405 |
| 234 | Ga0157325_1000443 | 3300012485 | Unclassified | 1717 |
| 235 | Ga0157335_1000211 | 3300012492 | Archaea | 2441 |
| 236 | Ga0157323_1000034 | 3300012495 | Archaea | 6189 |
| 237 | Ga0157345_1000325 | 3300012498 | Archaea | 5770 |
| 238 | Ga0157339_1000142 | 3300012505 | Archaea | 3328 |
| 239 | Ga0157342_1001355 | 3300012507 | Archaea | 1791 |
| 240 | Ga0157315_1000364 | 3300012508 | Archaea | 2038 |
| 241 | Ga0157326_1000169 | 3300012513 | Archaea | 7147 |
| 242 | Ga0157338_1000083 | 3300012515 | Archaea | 4088 |
| 243 | Ga0157373_10010689 | 3300013100 | Bacteria | 6751 |
| 244 | Ga0157373_10014293 | 3300013100 | Bacteria | 5822 |
| 245 | Ga0157373_10014510 | 3300013100 | Bacteria | 5775 |
| 246 | Ga0157373_10015065 | 3300013100 | Bacteria | 5655 |
| 247 | Ga0157373_10015661 | 3300013100 | Bacteria | 5539 |
| 248 | Ga0157373_10066263 | 3300013100 | Bacteria | 2555 |
| 249 | Ga0157373_10226937 | 3300013100 | Bacteria | 1318 |
| 250 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 251 | Ga0157371_10000109 | 3300013102 | Bacteria | 124990 |
| 252 | Ga0157371_10007309 | 3300013102 | Bacteria | 8969 |
| 253 | Ga0157371_10009858 | 3300013102 | Bacteria | 7486 |
| 254 | Ga0157371_10010875 | 3300013102 | Archaea | 7059 |
| 255 | Ga0157371_10036088 | 3300013102 | Bacteria | 3540 |
| 256 | Ga0157371_10075062 | 3300013102 | Bacteria | 2394 |
| 257 | Ga0157371_10132087 | 3300013102 | Bacteria | 1777 |
| 258 | Ga0157370_10000246 | 3300013104 | Bacteria | 69424 |
| 259 | Ga0157370_10009550 | 3300013104 | Bacteria | 10342 |
| 260 | Ga0157370_10027707 | 3300013104 | Bacteria | 5586 |
| 261 | Ga0157370_10037357 | 3300013104 | Bacteria | 4708 |
| 262 | Ga0157370_10039769 | 3300013104 | Bacteria | 4543 |
| 263 | Ga0157370_10063353 | 3300013104 | Bacteria | 3503 |
| 264 | Ga0157370_10215823 | 3300013104 | Bacteria | 1777 |
| 265 | Ga0157369_10001968 | 3300013105 | Bacteria | 24775 |
| 266 | Ga0157369_10028227 | 3300013105 | Bacteria | 6212 |
| 267 | Ga0157369_10031841 | 3300013105 | Bacteria | 5803 |
| 268 | Ga0157374_10008870 | 3300013296 | Archaea | 8612 |
| 269 | Ga0157378_10002128 | 3300013297 | Archaea | 17615 |
| 270 | Ga0163162_10015186 | 3300013306 | Bacteria | 7522 |
| 271 | Ga0157372_10003284 | 3300013307 | Bacteria | 17473 |
| 272 | Ga0157372_10004085 | 3300013307 | Bacteria | 15649 |
| 273 | Ga0157372_10018767 | 3300013307 | Bacteria | 7441 |
| 274 | Ga0157372_10028128 | 3300013307 | Bacteria | 6133 |
| 275 | Ga0157372_10406229 | 3300013307 | Archaea | 1587 |
| 276 | Ga0157372_10491938 | 3300013307 | Bacteria | 1430 |
| 277 | Ga0163163_10147343 | 3300014325 | Bacteria | 2398 |
| 278 | Ga0157380_10019720 | 3300014326 | Archaea | 5029 |
| 279 | Ga0157380_10136915 | 3300014326 | Archaea | 2097 |
| 280 | Ga0182008_10007384 | 3300014497 | Bacteria | 6071 |
| 281 | Ga0182008_10007985 | 3300014497 | Bacteria | 5801 |
| 282 | Ga0182008_10009595 | 3300014497 | Bacteria | 5212 |
| 283 | Ga0182008_10009942 | 3300014497 | Bacteria | 5114 |
| 284 | Ga0182008_10141110 | 3300014497 | Bacteria | 1205 |
| 285 | Ga0182006_1004027 | 3300015261 | Bacteria | 7334 |
| 286 | Ga0182006_1004263 | 3300015261 | Bacteria | 7077 |
| 287 | Ga0182006_1005362 | 3300015261 | Bacteria | 6133 |
| 288 | Ga0182006_1006516 | 3300015261 | Bacteria | 5417 |
| 289 | Ga0182006_1026738 | 3300015261 | Bacteria | 2360 |
| 290 | Ga0182006_1044443 | 3300015261 | Bacteria | 1732 |
| 291 | Ga0182007_10005678 | 3300015262 | Bacteria | 5445 |
| 292 | Ga0182005_1002764 | 3300015265 | Bacteria | 6119 |
| 293 | Ga0182005_1003401 | 3300015265 | Bacteria | 5412 |
| 294 | Ga0163161_10032067 | 3300017792 | Bacteria | 3748 |
| 295 | Ga0163161_10056408 | 3300017792 | Bacteria | 2853 |
| 296 | Ga0163161_10090452 | 3300017792 | Archaea | 2265 |
| 297 | Ga0163161_10247925 | 3300017792 | Bacteria | 1387 |
| 298 | Ga0206354_10094784 | 3300020081 | Bacteria | 2262 |
| 299 | Ga0206353_10636536 | 3300020082 | Bacteria | 6502 |
| 300 | Ga0213876_10003358 | 3300021384 | Bacteria | 9163 |
| 301 | Ga0213876_10008931 | 3300021384 | Bacteria | 5405 |
| 302 | Ga0213876_10079825 | 3300021384 | Bacteria | 1729 |
| 303 | Ga0209435_100579 | 3300025206 | Bacteria | 6870 |
| 304 | Ga0209760_100160 | 3300025207 | Bacteria | 40397 |
| 305 | Ga0209760_100475 | 3300025207 | Bacteria | 8673 |
| 306 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 307 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 308 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 309 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 310 | Ga0209147_101522 | 3300025229 | Bacteria | 8107 |
| 311 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 312 | Ga0209563_100368 | 3300025230 | Bacteria | 16599 |
| 313 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 314 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 315 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 316 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 317 | Ga0209437_105686 | 3300025233 | Bacteria | 2114 |
| 318 | Ga0209258_100321 | 3300025242 | Bacteria | 72995 |
| 319 | Ga0209646_1000787 | 3300025246 | Bacteria | 10866 |
| 320 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 321 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 322 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 323 | Ga0209130_1005357 | 3300025284 | Bacteria | 4482 |
| 324 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 325 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 326 | Ga0209676_1000278 | 3300025292 | Bacteria | 106516 |
| 327 | Ga0209676_1020849 | 3300025292 | Bacteria | 2213 |
| 328 | Ga0209025_1000043 | 3300025294 | Bacteria | 350458 |
| 329 | Ga0209025_1000255 | 3300025294 | Bacteria | 125764 |
| 330 | Ga0209025_1001401 | 3300025294 | Bacteria | 32001 |
| 331 | Ga0209025_1004446 | 3300025294 | Bacteria | 12175 |
| 332 | Ga0209025_1016363 | 3300025294 | Bacteria | 4385 |
| 333 | Ga0209025_1016783 | 3300025294 | Bacteria | 4285 |
| 334 | Ga0209025_1032565 | 3300025294 | Bacteria | 2432 |
| 335 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 336 | Ga0209050_1000061 | 3300025298 | Bacteria | 321435 |
| 337 | Ga0209050_1000241 | 3300025298 | Bacteria | 118446 |
| 338 | Ga0209050_1007643 | 3300025298 | Bacteria | 5991 |
| 339 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 340 | Ga0209051_1000519 | 3300025303 | Bacteria | 48314 |
| 341 | Ga0209051_1000572 | 3300025303 | Bacteria | 44529 |
| 342 | Ga0209257_1000143 | 3300025304 | Bacteria | 199975 |
| 343 | Ga0209257_1008653 | 3300025304 | Bacteria | 5705 |
| 344 | Ga0207697_10006971 | 3300025315 | Archaea | 5067 |
| 345 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 346 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 347 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 348 | Ga0207696_1000080 | 3300025711 | Bacteria | 199217 |
| 349 | Ga0207696_1000204 | 3300025711 | Bacteria | 90602 |
| 350 | Ga0207696_1000694 | 3300025711 | Bacteria | 23220 |
| 351 | Ga0207696_1009751 | 3300025711 | Bacteria | 3564 |
| 352 | Ga0207696_1019315 | 3300025711 | Bacteria | 2222 |
| 353 | Ga0207696_1027305 | 3300025711 | Bacteria | 1760 |
| 354 | Ga0207696_1030235 | 3300025711 | Bacteria | 1648 |
| 355 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 356 | Ga0207655_1000116 | 3300025728 | Bacteria | 161950 |
| 357 | Ga0207655_1000541 | 3300025728 | Bacteria | 47787 |
| 358 | Ga0207655_1002134 | 3300025728 | Bacteria | 16488 |
| 359 | Ga0207655_1003636 | 3300025728 | Bacteria | 11389 |
| 360 | Ga0207655_1003780 | 3300025728 | Bacteria | 11076 |
| 361 | Ga0207655_1003858 | 3300025728 | Bacteria | 10912 |
| 362 | Ga0207655_1004732 | 3300025728 | Bacteria | 9511 |
| 363 | Ga0207655_1006294 | 3300025728 | Bacteria | 7894 |
| 364 | Ga0207655_1014070 | 3300025728 | Bacteria | 4546 |
| 365 | Ga0207655_1016130 | 3300025728 | Bacteria | 4107 |
| 366 | Ga0207655_1020062 | 3300025728 | Bacteria | 3459 |
| 367 | Ga0207655_1029363 | 3300025728 | Bacteria | 2576 |
| 368 | Ga0207655_1030510 | 3300025728 | Bacteria | 2505 |
| 369 | Ga0207655_1031354 | 3300025728 | Bacteria | 2451 |
| 370 | Ga0207655_1031805 | 3300025728 | Bacteria | 2424 |
| 371 | Ga0207655_1075271 | 3300025728 | Bacteria | 1239 |
| 372 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 373 | Ga0207713_1000707 | 3300025735 | Bacteria | 31256 |
| 374 | Ga0207713_1000912 | 3300025735 | Bacteria | 26556 |
| 375 | Ga0207713_1001898 | 3300025735 | Bacteria | 15844 |
| 376 | Ga0207713_1002747 | 3300025735 | Bacteria | 12500 |
| 377 | Ga0207713_1004151 | 3300025735 | Bacteria | 9518 |
| 378 | Ga0207713_1004464 | 3300025735 | Bacteria | 9062 |
| 379 | Ga0207713_1004468 | 3300025735 | Bacteria | 9059 |
| 380 | Ga0207713_1005294 | 3300025735 | Bacteria | 8115 |
| 381 | Ga0207713_1005979 | 3300025735 | Bacteria | 7507 |
| 382 | Ga0207713_1025432 | 3300025735 | Bacteria | 2734 |
| 383 | Ga0207682_10000578 | 3300025893 | Bacteria | 16958 |
| 384 | Ga0207688_10000774 | 3300025901 | Archaea | 15921 |
| 385 | Ga0207688_10018685 | 3300025901 | Archaea | 3770 |
| 386 | Ga0207647_10000815 | 3300025904 | Archaea | 24206 |
| 387 | Ga0207647_10009414 | 3300025904 | Archaea | 6942 |
| 388 | Ga0207645_10000612 | 3300025907 | Archaea | 29556 |
| 389 | Ga0207645_10132985 | 3300025907 | Unclassified | 1619 |
| 390 | Ga0207643_10000173 | 3300025908 | Archaea | 44225 |
| 391 | Ga0207643_10000239 | 3300025908 | Archaea | 38264 |
| 392 | Ga0207643_10174993 | 3300025908 | Archaea | 1297 |
| 393 | Ga0207705_10012562 | 3300025909 | Bacteria | 6113 |
| 394 | Ga0207705_10020971 | 3300025909 | Bacteria | 4661 |
| 395 | Ga0207654_10008653 | 3300025911 | Bacteria | 5157 |
| 396 | Ga0207707_10296908 | 3300025912 | Archaea | 1398 |
| 397 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 398 | Ga0207671_10000027 | 3300025914 | Bacteria | 264907 |
| 399 | Ga0207660_10001420 | 3300025917 | Bacteria | 16075 |
| 400 | Ga0207662_10016717 | 3300025918 | Archaea | 4143 |
| 401 | Ga0207657_10001623 | 3300025919 | Bacteria | 24212 |
| 402 | Ga0207657_10021483 | 3300025919 | Bacteria | 6071 |
| 403 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 404 | Ga0207652_10003166 | 3300025921 | Bacteria | 13705 |
| 405 | Ga0207681_10000059 | 3300025923 | Bacteria | 104079 |
| 406 | Ga0207681_10004468 | 3300025923 | Archaea | 8607 |
| 407 | Ga0207681_10031926 | 3300025923 | Bacteria | 3443 |
| 408 | Ga0207694_10043789 | 3300025924 | Bacteria | 3455 |
| 409 | Ga0207650_10000044 | 3300025925 | Bacteria | 183146 |
| 410 | Ga0207650_10000089 | 3300025925 | Bacteria | 120962 |
| 411 | Ga0207659_10017853 | 3300025926 | Bacteria | 4643 |
| 412 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 413 | Ga0207664_10082292 | 3300025929 | Bacteria | 2622 |
| 414 | Ga0207690_10000035 | 3300025932 | Bacteria | 149201 |
| 415 | Ga0207690_10032776 | 3300025932 | Archaea | 3336 |
| 416 | Ga0207690_10040392 | 3300025932 | Bacteria | 3050 |
| 417 | Ga0207706_10002297 | 3300025933 | Bacteria | 18648 |
| 418 | Ga0207706_10002726 | 3300025933 | Archaea | 17210 |
| 419 | Ga0207706_10015147 | 3300025933 | Archaea | 6978 |
| 420 | Ga0207706_10121407 | 3300025933 | Bacteria | 2298 |
| 421 | Ga0207706_10138548 | 3300025933 | Archaea | 2140 |
| 422 | Ga0207686_10003528 | 3300025934 | Bacteria | 8397 |
| 423 | Ga0207686_10060840 | 3300025934 | Bacteria | 2392 |
| 424 | Ga0207686_10154773 | 3300025934 | Archaea | 1600 |
| 425 | Ga0207709_10000061 | 3300025935 | Bacteria | 199097 |
| 426 | Ga0207709_10000063 | 3300025935 | Bacteria | 191397 |
| 427 | Ga0207709_10000545 | 3300025935 | Bacteria | 32259 |
| 428 | Ga0207709_10006915 | 3300025935 | Bacteria | 6348 |
| 429 | Ga0207709_10011028 | 3300025935 | Bacteria | 4983 |
| 430 | Ga0207704_10039841 | 3300025938 | Archaea | 2740 |
| 431 | Ga0207691_10003733 | 3300025940 | Archaea | 14777 |
| 432 | Ga0207691_10043182 | 3300025940 | Archaea | 4155 |
| 433 | Ga0207691_10044409 | 3300025940 | Archaea | 4092 |
| 434 | Ga0207689_10002546 | 3300025942 | Archaea | 16921 |
| 435 | Ga0207689_10010938 | 3300025942 | Bacteria | 7801 |
| 436 | Ga0207689_10218388 | 3300025942 | Unclassified | 1575 |
| 437 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 438 | Ga0207679_10019106 | 3300025945 | Bacteria | 4599 |
| 439 | Ga0207679_10119247 | 3300025945 | Archaea | 2097 |
| 440 | Ga0207712_10010121 | 3300025961 | Archaea | 5980 |
| 441 | Ga0207712_10010833 | 3300025961 | Bacteria | 5801 |
| 442 | Ga0207668_10181931 | 3300025972 | Bacteria | 1659 |
| 443 | Ga0207640_10006138 | 3300025981 | Bacteria | 6574 |
| 444 | Ga0207640_10019529 | 3300025981 | Bacteria | 4006 |
| 445 | Ga0207658_10031857 | 3300025986 | Archaea | 3748 |
| 446 | Ga0207677_10000224 | 3300026023 | Bacteria | 44846 |
| 447 | Ga0207639_10000091 | 3300026041 | Bacteria | 76122 |
| 448 | Ga0207639_10130395 | 3300026041 | Bacteria | 2080 |
| 449 | Ga0207678_10048930 | 3300026067 | Bacteria | 3653 |
| 450 | Ga0207678_10057508 | 3300026067 | Bacteria | 3347 |
| 451 | Ga0207708_10000131 | 3300026075 | Archaea | 58894 |
| 452 | Ga0207708_10010892 | 3300026075 | Archaea | 6764 |
| 453 | Ga0207708_10012565 | 3300026075 | Archaea | 6313 |
| 454 | Ga0207708_10080588 | 3300026075 | Bacteria | 2501 |
| 455 | Ga0207648_10001723 | 3300026089 | Archaea | 23938 |
| 456 | Ga0207648_10016819 | 3300026089 | Archaea | 6669 |
| 457 | Ga0207648_10018497 | 3300026089 | Archaea | 6306 |
| 458 | Ga0207676_10054383 | 3300026095 | Archaea | 3138 |
| 459 | Ga0207674_10000866 | 3300026116 | Bacteria | 39599 |
| 460 | Ga0207674_10033629 | 3300026116 | Bacteria | 5366 |
| 461 | Ga0207674_10055650 | 3300026116 | Archaea | 4021 |
| 462 | Ga0207683_10416755 | 3300026121 | Bacteria | 1237 |
| 463 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 464 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 465 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 466 | Ga0209281_1006992 | 3300027111 | Bacteria | 2866 |
| 467 | Ga0209389_1000036 | 3300027296 | Bacteria | 126146 |
| 468 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 469 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 470 | Ga0209371_1000632 | 3300027312 | Bacteria | 31121 |
| 471 | Ga0209371_1000729 | 3300027312 | Bacteria | 27629 |
| 472 | Ga0209969_1002764 | 3300027360 | Bacteria | 2431 |
| 473 | Ga0209967_1000089 | 3300027364 | Archaea | 11945 |
| 474 | Ga0209981_1000714 | 3300027378 | Archaea | 4212 |
| 475 | Ga0209981_1006009 | 3300027378 | Bacteria | 1621 |
| 476 | Ga0209996_1000471 | 3300027395 | Archaea | 4839 |
| 477 | Ga0209996_1001591 | 3300027395 | Bacteria | 2764 |
| 478 | Ga0210000_1000394 | 3300027462 | Archaea | 6105 |
| 479 | Ga0209995_1000026 | 3300027471 | Archaea | 22671 |
| 480 | Ga0209999_1000072 | 3300027543 | Archaea | 11637 |
| 481 | Ga0209999_1006028 | 3300027543 | Archaea | 2178 |
| 482 | Ga0209982_1000121 | 3300027552 | Archaea | 8453 |
| 483 | Ga0209970_1000189 | 3300027614 | Archaea | 9784 |
| 484 | Ga0209970_1010631 | 3300027614 | Unclassified | 1507 |
| 485 | Ga0210002_1000451 | 3300027617 | Archaea | 5553 |
| 486 | Ga0210002_1002809 | 3300027617 | Unclassified | 2534 |
| 487 | Ga0209983_1001713 | 3300027665 | Bacteria | 4849 |
| 488 | Ga0209282_1005146 | 3300027666 | Bacteria | 7997 |
| 489 | Ga0209971_1001594 | 3300027682 | Archaea | 5620 |
| 490 | Ga0209971_1009875 | 3300027682 | Bacteria | 2258 |
| 491 | Ga0209966_1000473 | 3300027695 | Archaea | 10944 |
| 492 | Ga0209998_10001230 | 3300027717 | Archaea | 6303 |
| 493 | Ga0209974_10000647 | 3300027876 | Archaea | 11770 |
| 494 | Ga0209974_10005170 | 3300027876 | Archaea | 4606 |
| 495 | Ga0209974_10007695 | 3300027876 | Bacteria | 3706 |
| 496 | Ga0207428_10000363 | 3300027907 | Archaea | 58405 |
| 497 | Ga0207428_10000499 | 3300027907 | Archaea | 46861 |
| 498 | Ga0207428_10004175 | 3300027907 | Archaea | 13841 |
| 499 | Ga0207428_10008051 | 3300027907 | Bacteria | 9566 |
| 500 | Ga0207428_10010019 | 3300027907 | Bacteria | 8481 |
| 501 | Ga0207428_10034796 | 3300027907 | Bacteria | 4124 |
| 502 | Ga0207428_10136120 | 3300027907 | Bacteria | 1878 |
| 503 | Ga0268266_10004829 | 3300028379 | Bacteria | 12797 |
| 504 | Ga0268265_10028394 | 3300028380 | Archaea | 4004 |
| 505 | Ga0307517_10097154 | 3300028786 | Bacteria | 2354 |
| 506 | Ga0307515_10017677 | 3300028794 | Bacteria | 12968 |
| 507 | Ga0265338_10000189 | 3300028800 | Bacteria | 115979 |
| 508 | Ga0265338_10013602 | 3300028800 | Bacteria | 9168 |
| 509 | Ga0265338_10053664 | 3300028800 | Bacteria | 3603 |
| 510 | Ga0265338_10080128 | 3300028800 | Bacteria | 2745 |
| 511 | Ga0265338_10083893 | 3300028800 | Bacteria | 2663 |
| 512 | Ga0237817_10467 | 3300030083 | Bacteria | 5832 |
| 513 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 514 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 515 | Ga0268256_1000247 | 3300030500 | Bacteria | 57439 |
| 516 | Ga0307511_10125920 | 3300030521 | Bacteria | 1563 |
| 517 | Ga0316179_1002654 | 3300030734 | Bacteria | 6862 |
| 518 | Ga0316178_1047147 | 3300030735 | Bacteria | 102800 |
| 519 | Ga0316183_1059891 | 3300030742 | Bacteria | 1982 |
| 520 | Ga0316181_1001658 | 3300030744 | Bacteria | 5430 |
| 521 | Ga0316181_1260236 | 3300030744 | Bacteria | 3871 |
| 522 | Ga0307513_10113714 | 3300031456 | Bacteria | 2694 |
| 523 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 524 | Ga0307408_100013164 | 3300031548 | Bacteria | 5490 |
| 525 | Ga0307408_100030241 | 3300031548 | Bacteria | 3759 |
| 526 | Ga0307405_10014813 | 3300031731 | Bacteria | 4204 |
| 527 | Ga0307405_10021164 | 3300031731 | Bacteria | 3651 |
| 528 | Ga0307405_10139706 | 3300031731 | Bacteria | 1687 |
| 529 | Ga0307405_10167710 | 3300031731 | Bacteria | 1562 |
| 530 | Ga0307413_10001990 | 3300031824 | Bacteria | 8115 |
| 531 | Ga0307413_10069955 | 3300031824 | Bacteria | 2204 |
| 532 | Ga0307410_10002976 | 3300031852 | Bacteria | 8360 |
| 533 | Ga0307409_100326381 | 3300031995 | Bacteria | 1438 |
| 534 | Ga0307416_100014760 | 3300032002 | Bacteria | 5368 |
| 535 | Ga0307416_100032296 | 3300032002 | Bacteria | 3953 |
| 536 | Ga0307416_100081686 | 3300032002 | Bacteria | 2734 |
| 537 | Ga0307414_10015714 | 3300032004 | Bacteria | 4577 |
| 538 | Ga0307414_10144956 | 3300032004 | Bacteria | 1864 |
| 539 | Ga0307415_100008349 | 3300032126 | Bacteria | 5730 |
| 540 | Ga0307415_100062049 | 3300032126 | Bacteria | 2590 |
| 541 | Ga0307510_10024600 | 3300033180 | Bacteria | 6955 |
| 542 | Ga0307510_10126867 | 3300033180 | Bacteria | 2238 |
| 543 | Ga0373939_0009240 | 3300035114 | Archaea | 2441 |
| 544 | Ga0373962_0004103 | 3300035242 | Archaea | 3513 |
| 545 | Ga0395899_0000052 | 3300037312 | Bacteria | 221643 |
| 546 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 547 | Ga0395900_0052744 | 3300037418 | Bacteria | 4186 |
| 548 | Ga0395900_0110410 | 3300037418 | Bacteria | 2825 |
| 549 | Ga0395900_0471790 | 3300037418 | Bacteria | 1208 |
| 550 | Ga0395898_0050393 | 3300037466 | Bacteria | 4074 |
| 551 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 552 | Ga0395901_0004300 | 3300038443 | Bacteria | 14365 |
| 553 | Ga0237819_00416 | 3300038705 | Bacteria | 14684 |
| 554 | Ga0237819_01945 | 3300038705 | Bacteria | 4682 |
| 555 | Ga0237819_02348 | 3300038705 | Bacteria | 3867 |
| 556 | Ga0436365_0478409 | 3300039437 | Bacteria | 9475 |
| 557 | Ga0436365_0516586 | 3300039437 | Bacteria | 13777 |
| 558 | Ga0436365_1729816 | 3300039437 | Bacteria | 4249 |
| 559 | Ga0436360_0114333 | 3300039438 | Bacteria | 1304 |
| 560 | Ga0439436_0000094 | 3300041404 | Bacteria | 20995 |
| 561 | Ga0439438_002010 | 3300041405 | Bacteria | 8866 |
| 562 | Ga0439438_003391 | 3300041405 | Bacteria | 6452 |
| 563 | Ga0439438_003796 | 3300041405 | Bacteria | 5971 |
| 564 | Ga0439438_004810 | 3300041405 | Bacteria | 5091 |
| 565 | Ga0439438_024700 | 3300041405 | Bacteria | 1644 |
| 566 | Ga0439438_026050 | 3300041405 | Bacteria | 1587 |
| 567 | Ga0439447_007063 | 3300041407 | Bacteria | 3595 |
| 568 | Ga0439447_010462 | 3300041407 | Bacteria | 2751 |
| 569 | Ga0439447_011576 | 3300041407 | Bacteria | 2567 |
| 570 | Ga0439447_023361 | 3300041407 | Bacteria | 1611 |
| 571 | Ga0439466_0002316 | 3300041411 | Bacteria | 7474 |
| 572 | Ga0439466_0003713 | 3300041411 | Bacteria | 5893 |
| 573 | Ga0439466_0006210 | 3300041411 | Bacteria | 4548 |
| 574 | Ga0439466_0008448 | 3300041411 | Bacteria | 3882 |
| 575 | Ga0439466_0015260 | 3300041411 | Bacteria | 2791 |
| 576 | Ga0439466_0020320 | 3300041411 | Bacteria | 2366 |
| 577 | Ga0439466_0038106 | 3300041411 | Bacteria | 1615 |
| 578 | Ga0439437_000861 | 3300042000 | Bacteria | 3153 |
| 579 | Ga0439441_006439 | 3300042001 | Unclassified | 1864 |
| 580 | Ga0439432_000735 | 3300042006 | Bacteria | 12268 |
| 581 | Ga0439432_000757 | 3300042006 | Bacteria | 12078 |
| 582 | Ga0439432_001455 | 3300042006 | Bacteria | 8885 |
| 583 | Ga0439432_003124 | 3300042006 | Bacteria | 6169 |
| 584 | Ga0439432_011915 | 3300042006 | Bacteria | 2988 |
| 585 | Ga0439432_038536 | 3300042006 | Bacteria | 1522 |
| 586 | Ga0439450_015473 | 3300042008 | Bacteria | 1562 |
| 587 | Ga0439451_010195 | 3300042009 | Bacteria | 1895 |
| 588 | Ga0439452_002183 | 3300042010 | Bacteria | 7391 |
| 589 | Ga0439452_002265 | 3300042010 | Bacteria | 7191 |
| 590 | Ga0439452_002419 | 3300042010 | Bacteria | 6905 |
| 591 | Ga0439452_003104 | 3300042010 | Bacteria | 5888 |
| 592 | Ga0439452_007546 | 3300042010 | Bacteria | 3329 |
| 593 | Ga0439452_017343 | 3300042010 | Bacteria | 1937 |
| 594 | Ga0439454_000032 | 3300042011 | Archaea | 8781 |
| 595 | Ga0439456_000080 | 3300042013 | Bacteria | 33226 |
| 596 | Ga0439456_006404 | 3300042013 | Bacteria | 2403 |
| 597 | Ga0439456_006694 | 3300042013 | Bacteria | 2357 |
| 598 | Ga0439456_008594 | 3300042013 | Archaea | 2109 |
| 599 | Ga0439456_017964 | 3300042013 | Bacteria | 1483 |
| 600 | Ga0439463_000261 | 3300042016 | Bacteria | 14483 |
| 601 | Ga0439463_000477 | 3300042016 | Bacteria | 11171 |
| 602 | Ga0439463_000765 | 3300042016 | Archaea | 8906 |
| 603 | Ga0439463_002267 | 3300042016 | Bacteria | 4929 |
| 604 | Ga0450911_000011 | 3300042115 | Bacteria | 130739 |
| 605 | Ga0450911_001296 | 3300042115 | Bacteria | 5940 |
| 606 | Ga0450920_000286 | 3300042122 | Bacteria | 7648 |
| 607 | Ga0450922_000446 | 3300042124 | Bacteria | 4426 |
| 608 | Ga0450902_003051 | 3300042137 | Bacteria | 2419 |
| 609 | Ga0450902_004332 | 3300042137 | Bacteria | 2106 |
| 610 | Ga0450903_001699 | 3300042138 | Bacteria | 4059 |
| 611 | Ga0450903_002152 | 3300042138 | Bacteria | 3526 |
| 612 | Ga0450904_000115 | 3300042139 | Bacteria | 17804 |
| 613 | Ga0450906_000355 | 3300042145 | Bacteria | 9282 |
| 614 | Ga0450906_000517 | 3300042145 | Bacteria | 8109 |
| 615 | Ga0450907_000520 | 3300042146 | Bacteria | 10559 |
| 616 | Ga0450907_000867 | 3300042146 | Bacteria | 7244 |
| 617 | Ga0450907_003664 | 3300042146 | Bacteria | 2712 |
| 618 | Ga0450910_000137 | 3300042147 | Bacteria | 7861 |
| 619 | Ga0439446_0001927 | 3300042156 | Bacteria | 4888 |
| 620 | Ga0439446_0003287 | 3300042156 | Bacteria | 3990 |
| 621 | Ga0439446_0003992 | 3300042156 | Bacteria | 3712 |
| 622 | Ga0439446_0021049 | 3300042156 | Unclassified | 1841 |
| 623 | Ga0450908_000962 | 3300042184 | Bacteria | 5546 |
| 624 | Ga0450909_007054 | 3300042185 | Bacteria | 1623 |
| 625 | Ga0439434_0001117 | 3300042435 | Bacteria | 7759 |
| 626 | Ga0439434_0001196 | 3300042435 | Bacteria | 7472 |
| 627 | Ga0439444_0000025 | 3300042437 | Archaea | 11315 |
| 628 | Ga0439459_0006118 | 3300042438 | Bacteria | 1998 |
| 629 | Ga0439464_0000769 | 3300042439 | Archaea | 6981 |
| 630 | Ga0439464_0006763 | 3300042439 | Bacteria | 2989 |
| 631 | Ga0439460_0000568 | 3300042461 | Bacteria | 8092 |
| 632 | Ga0439460_0002486 | 3300042461 | Archaea | 4448 |
| 633 | Ga0439460_0004700 | 3300042461 | Bacteria | 3331 |
| 634 | Ga0439460_0027644 | 3300042461 | Bacteria | 1594 |
| 635 | Ga0450918_001120 | 3300042531 | Bacteria | 5501 |
| 636 | Ga0450901_002321 | 3300042533 | Bacteria | 2066 |
| 637 | Ga0451577_0038790 | 3300042876 | Bacteria | 4283 |
| 638 | Ga0451577_0045908 | 3300042876 | Archaea | 3910 |
| 639 | Ga0439440_0002803 | 3300042993 | Archaea | 3315 |
| 640 | Ga0439440_0008586 | 3300042993 | Bacteria | 2100 |
| 641 | Ga0439440_0027586 | 3300042993 | Archaea | 1321 |
| 642 | Ga0466969_0031750 | 3300044656 | Bacteria | 2687 |
| 643 | Ga0466966_0010386 | 3300044684 | Bacteria | 6182 |
| 644 | Ga0466963_0002599 | 3300044694 | Bacteria | 10128 |
| 645 | Ga0466957_0007862 | 3300044842 | Bacteria | 6046 |
| 646 | Ga0451576_0015887 | 3300045051 | Archaea | 8322 |
| 647 | Ga0466958_0002591 | 3300045836 | Bacteria | 9127 |
| 648 | Ga0466967_0020054 | 3300045976 | Bacteria | 5392 |
| 649 | Ga0495617_002371 | 3300046452 | Bacteria | 7525 |
| 650 | Ga0495617_006750 | 3300046452 | Bacteria | 4014 |
| 651 | Ga0495617_007712 | 3300046452 | Bacteria | 3722 |
| 652 | Ga0495617_040143 | 3300046452 | Bacteria | 1565 |
| 653 | Ga0495627_000115 | 3300046453 | Bacteria | 99960 |
| 654 | Ga0495627_002716 | 3300046453 | Bacteria | 8271 |
| 655 | Ga0495627_014628 | 3300046453 | Bacteria | 2732 |
| 656 | Ga0495627_024550 | 3300046453 | Bacteria | 1963 |
| 657 | Ga0495627_036336 | 3300046453 | Bacteria | 1531 |
| 658 | Ga0495603_0104203 | 3300046455 | Bacteria | 1655 |
| 659 | Ga0495590_0001555 | 3300046457 | Bacteria | 9846 |
| 660 | Ga0495590_0013497 | 3300046457 | Bacteria | 3000 |
| 661 | Ga0495590_0015791 | 3300046457 | Bacteria | 2734 |
| 662 | Ga0495591_000061 | 3300046458 | Bacteria | 126594 |
| 663 | Ga0495591_000769 | 3300046458 | Bacteria | 23170 |
| 664 | Ga0495591_004633 | 3300046458 | Bacteria | 6623 |
| 665 | Ga0495591_005294 | 3300046458 | Bacteria | 6008 |
| 666 | Ga0495591_006081 | 3300046458 | Bacteria | 5424 |
| 667 | Ga0495591_007208 | 3300046458 | Bacteria | 4761 |
| 668 | Ga0495591_008860 | 3300046458 | Bacteria | 4064 |
| 669 | Ga0495591_009117 | 3300046458 | Bacteria | 3973 |
| 670 | Ga0495591_013638 | 3300046458 | Bacteria | 2959 |
| 671 | Ga0495591_020715 | 3300046458 | Bacteria | 2164 |
| 672 | Ga0495591_050135 | 3300046458 | Bacteria | 1144 |
| 673 | Ga0495638_0015492 | 3300046460 | Bacteria | 5117 |
| 674 | Ga0495638_0023151 | 3300046460 | Bacteria | 4067 |
| 675 | Ga0495638_0024593 | 3300046460 | Bacteria | 3925 |
| 676 | Ga0495638_0038782 | 3300046460 | Bacteria | 3025 |
| 677 | Ga0495653_0028233 | 3300046463 | Bacteria | 4487 |
| 678 | Ga0495653_0032916 | 3300046463 | Bacteria | 4111 |
| 679 | Ga0495653_0049907 | 3300046463 | Bacteria | 3220 |
| 680 | Ga0495653_0091619 | 3300046463 | Bacteria | 2222 |
| 681 | Ga0495650_0001411 | 3300046471 | Bacteria | 23439 |
| 682 | Ga0495650_0003915 | 3300046471 | Bacteria | 10508 |
| 683 | Ga0495650_0006927 | 3300046471 | Bacteria | 6940 |
| 684 | Ga0495650_0030700 | 3300046471 | Bacteria | 2429 |
| 685 | Ga0495650_0040440 | 3300046471 | Bacteria | 2001 |
| 686 | Ga0495605_0000079 | 3300046474 | Bacteria | 126756 |
| 687 | Ga0495605_0000441 | 3300046474 | Bacteria | 37414 |
| 688 | Ga0495605_0002193 | 3300046474 | Bacteria | 12204 |
| 689 | Ga0495605_0002696 | 3300046474 | Bacteria | 10871 |
| 690 | Ga0495605_0010405 | 3300046474 | Bacteria | 5204 |
| 691 | Ga0495605_0019206 | 3300046474 | Bacteria | 3656 |
| 692 | Ga0495605_0024924 | 3300046474 | Bacteria | 3122 |
| 693 | Ga0495605_0026038 | 3300046474 | Bacteria | 3042 |
| 694 | Ga0495605_0039963 | 3300046474 | Bacteria | 2346 |
| 695 | Ga0495605_0040798 | 3300046474 | Bacteria | 2315 |
| 696 | Ga0495605_0073007 | 3300046474 | Bacteria | 1617 |
| 697 | Ga0495605_0097812 | 3300046474 | Bacteria | 1352 |
| 698 | Ga0495639_0004422 | 3300046475 | Bacteria | 6026 |
| 699 | Ga0495584_0006922 | 3300046491 | Bacteria | 5925 |
| 700 | Ga0495584_0006997 | 3300046491 | Bacteria | 5892 |
| 701 | Ga0495584_0007121 | 3300046491 | Bacteria | 5843 |
| 702 | Ga0495584_0007934 | 3300046491 | Bacteria | 5521 |
| 703 | Ga0495584_0008019 | 3300046491 | Bacteria | 5489 |
| 704 | Ga0495584_0008025 | 3300046491 | Bacteria | 5487 |
| 705 | Ga0495584_0016043 | 3300046491 | Bacteria | 3822 |
| 706 | Ga0495585_0009311 | 3300046492 | Bacteria | 5899 |
| 707 | Ga0495585_0133382 | 3300046492 | Bacteria | 1305 |
| 708 | Ga0495594_0018026 | 3300046499 | Bacteria | 3738 |
| 709 | Ga0495594_0100082 | 3300046499 | Bacteria | 1630 |
| 710 | Ga0495596_0000257 | 3300046500 | Bacteria | 35407 |
| 711 | Ga0495596_0007840 | 3300046500 | Bacteria | 4785 |
| 712 | Ga0495607_0000113 | 3300046501 | Bacteria | 84993 |
| 713 | Ga0495607_0000147 | 3300046501 | Bacteria | 74197 |
| 714 | Ga0495607_0001158 | 3300046501 | Bacteria | 23891 |
| 715 | Ga0495607_0003466 | 3300046501 | Bacteria | 12081 |
| 716 | Ga0495607_0007687 | 3300046501 | Bacteria | 7428 |
| 717 | Ga0495607_0007858 | 3300046501 | Bacteria | 7342 |
| 718 | Ga0495607_0073243 | 3300046501 | Bacteria | 1904 |
| 719 | Ga0495607_0109322 | 3300046501 | Bacteria | 1468 |
| 720 | Ga0495583_0000763 | 3300046506 | Bacteria | 40467 |
| 721 | Ga0495583_0002078 | 3300046506 | Bacteria | 18068 |
| 722 | Ga0495583_0002814 | 3300046506 | Bacteria | 14231 |
| 723 | Ga0495583_0002975 | 3300046506 | Bacteria | 13598 |
| 724 | Ga0495583_0007538 | 3300046506 | Bacteria | 6811 |
| 725 | Ga0495583_0009278 | 3300046506 | Bacteria | 5894 |
| 726 | Ga0495583_0032210 | 3300046506 | Bacteria | 2532 |
| 727 | Ga0495606_0000139 | 3300046507 | Bacteria | 124493 |
| 728 | Ga0495606_0001158 | 3300046507 | Bacteria | 37308 |
| 729 | Ga0495606_0005994 | 3300046507 | Bacteria | 11392 |
| 730 | Ga0495606_0009824 | 3300046507 | Bacteria | 8036 |
| 731 | Ga0495606_0018173 | 3300046507 | Bacteria | 5283 |
| 732 | Ga0495606_0021237 | 3300046507 | Bacteria | 4759 |
| 733 | Ga0495606_0050347 | 3300046507 | Bacteria | 2725 |
| 734 | Ga0495610_0011258 | 3300046512 | Bacteria | 5482 |
| 735 | Ga0495610_0019562 | 3300046512 | Bacteria | 3784 |
| 736 | Ga0495610_0020042 | 3300046512 | Bacteria | 3723 |
| 737 | Ga0495610_0023220 | 3300046512 | Bacteria | 3376 |
| 738 | Ga0495610_0057660 | 3300046512 | Bacteria | 1861 |
| 739 | Ga0495610_0067114 | 3300046512 | Bacteria | 1687 |
| 740 | Ga0495616_0005952 | 3300046513 | Bacteria | 7439 |
| 741 | Ga0495616_0019034 | 3300046513 | Bacteria | 3753 |
| 742 | Ga0495616_0032604 | 3300046513 | Bacteria | 2719 |
| 743 | Ga0495616_0043199 | 3300046513 | Bacteria | 2290 |
| 744 | Ga0495616_0052465 | 3300046513 | Bacteria | 2030 |
| 745 | Ga0495616_0073767 | 3300046513 | Bacteria | 1645 |
| 746 | Ga0495620_0000044 | 3300046515 | Bacteria | 110431 |
| 747 | Ga0495620_0000270 | 3300046515 | Bacteria | 38032 |
| 748 | Ga0495620_0000538 | 3300046515 | Bacteria | 24158 |
| 749 | Ga0495620_0000724 | 3300046515 | Bacteria | 20326 |
| 750 | Ga0495620_0006866 | 3300046515 | Bacteria | 6221 |
| 751 | Ga0495620_0015829 | 3300046515 | Bacteria | 3798 |
| 752 | Ga0495620_0017505 | 3300046515 | Bacteria | 3570 |
| 753 | Ga0495630_0023231 | 3300046517 | Bacteria | 4583 |
| 754 | Ga0495630_0066550 | 3300046517 | Bacteria | 2708 |
| 755 | Ga0495631_0006682 | 3300046518 | Bacteria | 5928 |
| 756 | Ga0495631_0010667 | 3300046518 | Bacteria | 4541 |
| 757 | Ga0495632_0001693 | 3300046519 | Bacteria | 18034 |
| 758 | Ga0495632_0006009 | 3300046519 | Bacteria | 7897 |
| 759 | Ga0495632_0006158 | 3300046519 | Bacteria | 7769 |
| 760 | Ga0495632_0006308 | 3300046519 | Bacteria | 7652 |
| 761 | Ga0495632_0009750 | 3300046519 | Bacteria | 5757 |
| 762 | Ga0495632_0010862 | 3300046519 | Bacteria | 5356 |
| 763 | Ga0495632_0013427 | 3300046519 | Bacteria | 4674 |
| 764 | Ga0495632_0046623 | 3300046519 | Bacteria | 2152 |
| 765 | Ga0495632_0057560 | 3300046519 | Bacteria | 1897 |
| 766 | Ga0495637_0000066 | 3300046520 | Bacteria | 89139 |
| 767 | Ga0495637_0000239 | 3300046520 | Bacteria | 42753 |
| 768 | Ga0495637_0007048 | 3300046520 | Bacteria | 5598 |
| 769 | Ga0495637_0014187 | 3300046520 | Bacteria | 3762 |
| 770 | Ga0495637_0014325 | 3300046520 | Bacteria | 3740 |
| 771 | Ga0495637_0019951 | 3300046520 | Bacteria | 3090 |
| 772 | Ga0495637_0026021 | 3300046520 | Bacteria | 2632 |
| 773 | Ga0495637_0044385 | 3300046520 | Bacteria | 1892 |
| 774 | Ga0495637_0046621 | 3300046520 | Bacteria | 1832 |
| 775 | Ga0495637_0055494 | 3300046520 | Bacteria | 1642 |
| 776 | Ga0495643_0000763 | 3300046522 | Bacteria | 36080 |
| 777 | Ga0495643_0001974 | 3300046522 | Bacteria | 17209 |
| 778 | Ga0495643_0002637 | 3300046522 | Bacteria | 13917 |
| 779 | Ga0495643_0008586 | 3300046522 | Bacteria | 6452 |
| 780 | Ga0495643_0032256 | 3300046522 | Bacteria | 2908 |
| 781 | Ga0495643_0040785 | 3300046522 | Bacteria | 2533 |
| 782 | Ga0495643_0145759 | 3300046522 | Bacteria | 1176 |
| 783 | Ga0495644_0000476 | 3300046523 | Bacteria | 17339 |
| 784 | Ga0495644_0008526 | 3300046523 | Bacteria | 3948 |
| 785 | Ga0495648_0002285 | 3300046524 | Bacteria | 17885 |
| 786 | Ga0495648_0007380 | 3300046524 | Bacteria | 8803 |
| 787 | Ga0495648_0008468 | 3300046524 | Bacteria | 8091 |
| 788 | Ga0495648_0013321 | 3300046524 | Bacteria | 6085 |
| 789 | Ga0495648_0020185 | 3300046524 | Bacteria | 4658 |
| 790 | Ga0495648_0025964 | 3300046524 | Bacteria | 3954 |
| 791 | Ga0495648_0088112 | 3300046524 | Bacteria | 1745 |
| 792 | Ga0495648_0139033 | 3300046524 | Bacteria | 1280 |
| 793 | Ga0495666_0054702 | 3300046526 | Bacteria | 1913 |
| 794 | Ga0495666_0098701 | 3300046526 | Bacteria | 1376 |
| 795 | Ga0495642_0003701 | 3300046528 | Bacteria | 5997 |
| 796 | Ga0495642_0003845 | 3300046528 | Bacteria | 5883 |
| 797 | Ga0495654_0001913 | 3300046530 | Bacteria | 13821 |
| 798 | Ga0495654_0007275 | 3300046530 | Bacteria | 6200 |
| 799 | Ga0495654_0008103 | 3300046530 | Bacteria | 5826 |
| 800 | Ga0495654_0009176 | 3300046530 | Bacteria | 5423 |
| 801 | Ga0495654_0014487 | 3300046530 | Bacteria | 4196 |
| 802 | Ga0495654_0019319 | 3300046530 | Bacteria | 3564 |
| 803 | Ga0495654_0021353 | 3300046530 | Bacteria | 3368 |
| 804 | Ga0495654_0062522 | 3300046530 | Bacteria | 1784 |
| 805 | Ga0495654_0071585 | 3300046530 | Bacteria | 1642 |
| 806 | Ga0495654_0077161 | 3300046530 | Bacteria | 1568 |
| 807 | Ga0495587_0079919 | 3300046536 | Bacteria | 1895 |
| 808 | Ga0495609_0000098 | 3300046538 | Bacteria | 103106 |
| 809 | Ga0495609_0000323 | 3300046538 | Bacteria | 42572 |
| 810 | Ga0495609_0000398 | 3300046538 | Bacteria | 36528 |
| 811 | Ga0495597_0000137 | 3300046542 | Bacteria | 65550 |
| 812 | Ga0495597_0019474 | 3300046542 | Bacteria | 3175 |
| 813 | Ga0495597_0022178 | 3300046542 | Bacteria | 2947 |
| 814 | Ga0495597_0022986 | 3300046542 | Bacteria | 2886 |
| 815 | Ga0495622_0005353 | 3300046557 | Bacteria | 5958 |
| 816 | Ga0495622_0006837 | 3300046557 | Bacteria | 5294 |
| 817 | Ga0495622_0019242 | 3300046557 | Bacteria | 3179 |
| 818 | Ga0495633_0000440 | 3300046558 | Bacteria | 42906 |
| 819 | Ga0495633_0004409 | 3300046558 | Bacteria | 8961 |
| 820 | Ga0495633_0020892 | 3300046558 | Bacteria | 3284 |
| 821 | Ga0495668_0033998 | 3300046616 | Bacteria | 2862 |
| 822 | Ga0495668_0040891 | 3300046616 | Bacteria | 2584 |
| 823 | Ga0495668_0041083 | 3300046616 | Bacteria | 2578 |
| 824 | Ga0495668_0058460 | 3300046616 | Bacteria | 2127 |
| 825 | Ga0495634_0037677 | 3300046642 | Bacteria | 3303 |
| 826 | Ga0495611_0001266 | 3300046648 | Bacteria | 13018 |
| 827 | Ga0495611_0004728 | 3300046648 | Bacteria | 5848 |
| 828 | Ga0495611_0010879 | 3300046648 | Bacteria | 3854 |
| 829 | Ga0495611_0016386 | 3300046648 | Bacteria | 3168 |
| 830 | Ga0495611_0031597 | 3300046648 | Bacteria | 2331 |
| 831 | Ga0495625_0000113 | 3300046660 | Bacteria | 124185 |
| 832 | Ga0495625_0013708 | 3300046660 | Bacteria | 6498 |
| 833 | Ga0495625_0027708 | 3300046660 | Bacteria | 4258 |
| 834 | Ga0495625_0039549 | 3300046660 | Bacteria | 3442 |
| 835 | Ga0495625_0075893 | 3300046660 | Bacteria | 2351 |
| 836 | Ga0495635_0014354 | 3300046663 | Bacteria | 5541 |
| 837 | Ga0495659_0001791 | 3300046664 | Bacteria | 7127 |
| 838 | Ga0495661_0000050 | 3300046665 | Bacteria | 143435 |
| 839 | Ga0495661_0000112 | 3300046665 | Bacteria | 96840 |
| 840 | Ga0495661_0000237 | 3300046665 | Bacteria | 63564 |
| 841 | Ga0495661_0000633 | 3300046665 | Bacteria | 35712 |
| 842 | Ga0495661_0006107 | 3300046665 | Bacteria | 8486 |
| 843 | Ga0495661_0016928 | 3300046665 | Bacteria | 4817 |
| 844 | Ga0495661_0102617 | 3300046665 | Bacteria | 1607 |
| 845 | Ga0495661_0171753 | 3300046665 | Bacteria | 1155 |
| 846 | Ga0495588_0025085 | 3300046674 | Bacteria | 2967 |
| 847 | Ga0495588_0079410 | 3300046674 | Bacteria | 1712 |
| 848 | Ga0495623_0010236 | 3300046679 | Bacteria | 6066 |
| 849 | Ga0495669_0002201 | 3300046684 | Bacteria | 8004 |
| 850 | Ga0495613_0103782 | 3300046689 | Bacteria | 2052 |
| 851 | Ga0495624_0013052 | 3300046690 | Bacteria | 5664 |
| 852 | Ga0495670_0003539 | 3300046691 | Bacteria | 7669 |
| 853 | Ga0495670_0007472 | 3300046691 | Bacteria | 5368 |
| 854 | Ga0495670_0023021 | 3300046691 | Bacteria | 3075 |
| 855 | Ga0495670_0024154 | 3300046691 | Bacteria | 3003 |
| 856 | Ga0495671_0001137 | 3300046692 | Bacteria | 18324 |
| 857 | Ga0495671_0007515 | 3300046692 | Bacteria | 6205 |
| 858 | Ga0495671_0008147 | 3300046692 | Bacteria | 5912 |
| 859 | Ga0495671_0028508 | 3300046692 | Bacteria | 2874 |
| 860 | Ga0495671_0029779 | 3300046692 | Bacteria | 2800 |
| 861 | Ga0495671_0045586 | 3300046692 | Bacteria | 2194 |
| 862 | Ga0495671_0071760 | 3300046692 | Bacteria | 1700 |
| 863 | Ga0495671_0087557 | 3300046692 | Bacteria | 1525 |
| 864 | Ga0495671_0099779 | 3300046692 | Bacteria | 1419 |
| 865 | Ga0495649_0001815 | 3300046694 | Bacteria | 15676 |
| 866 | Ga0495649_0002055 | 3300046694 | Bacteria | 14487 |
| 867 | Ga0495649_0009532 | 3300046694 | Bacteria | 5761 |
| 868 | Ga0495649_0010872 | 3300046694 | Bacteria | 5359 |
| 869 | Ga0495649_0011731 | 3300046694 | Bacteria | 5128 |
| 870 | Ga0495649_0021128 | 3300046694 | Bacteria | 3649 |
| 871 | Ga0495649_0022205 | 3300046694 | Bacteria | 3550 |
| 872 | Ga0495649_0031256 | 3300046694 | Bacteria | 2936 |
| 873 | Ga0495649_0040018 | 3300046694 | Bacteria | 2568 |
| 874 | Ga0495649_0096761 | 3300046694 | Bacteria | 1570 |
| 875 | Ga0495589_0004591 | 3300046794 | Bacteria | 7344 |
| 876 | Ga0495589_0038319 | 3300046794 | Bacteria | 2400 |
| 877 | Ga0495600_0018130 | 3300046809 | Bacteria | 4482 |
| 878 | Ga0495660_0000190 | 3300046810 | Bacteria | 64685 |
| 879 | Ga0495660_0021050 | 3300046810 | Bacteria | 3736 |
| 880 | Ga0495660_0049616 | 3300046810 | Bacteria | 2289 |
| 881 | Ga0495660_0088728 | 3300046810 | Bacteria | 1610 |
| 882 | Ga0495660_0096705 | 3300046810 | Bacteria | 1525 |
| 883 | Ga0495604_0023499 | 3300047317 | Bacteria | 4918 |
| 884 | Ga0495672_0008328 | 3300047320 | Bacteria | 7674 |
| 885 | Ga0495672_0009503 | 3300047320 | Bacteria | 7039 |
| 886 | Ga0495672_0010702 | 3300047320 | Bacteria | 6513 |
| 887 | Ga0495672_0011678 | 3300047320 | Bacteria | 6181 |
| 888 | Ga0495672_0011796 | 3300047320 | Bacteria | 6139 |
| 889 | Ga0495672_0013936 | 3300047320 | Bacteria | 5526 |
| 890 | Ga0495672_0019532 | 3300047320 | Bacteria | 4467 |
| 891 | Ga0495672_0024934 | 3300047320 | Bacteria | 3840 |
| 892 | Ga0495672_0033191 | 3300047320 | Bacteria | 3200 |
| 893 | Ga0495672_0094640 | 3300047320 | Bacteria | 1633 |
| 894 | Ga0495676_0000032 | 3300047321 | Bacteria | 131215 |
| 895 | Ga0495676_0013185 | 3300047321 | Bacteria | 7434 |
| 896 | Ga0495680_0022986 | 3300047322 | Bacteria | 5189 |
| 897 | Ga0495680_0084248 | 3300047322 | Bacteria | 2395 |
| 898 | Ga0495683_0000055 | 3300047323 | Bacteria | 119199 |
| 899 | Ga0495683_0000236 | 3300047323 | Bacteria | 50369 |
| 900 | Ga0495683_0004276 | 3300047323 | Bacteria | 8140 |
| 901 | Ga0495683_0007387 | 3300047323 | Bacteria | 5952 |
| 902 | Ga0495683_0008977 | 3300047323 | Bacteria | 5334 |
| 903 | Ga0495683_0011955 | 3300047323 | Bacteria | 4560 |
| 904 | Ga0495687_009435 | 3300047443 | Bacteria | 5452 |
| 905 | Ga0495687_013719 | 3300047443 | Bacteria | 4209 |
| 906 | Ga0495687_021505 | 3300047443 | Bacteria | 3118 |
| 907 | Ga0495687_090065 | 3300047443 | Bacteria | 1176 |
| 908 | Ga0495675_0007905 | 3300047444 | Bacteria | 6570 |
| 909 | Ga0495679_030775 | 3300047446 | Bacteria | 1738 |
| 910 | Ga0495679_043940 | 3300047446 | Bacteria | 1370 |
| 911 | Ga0495673_0001256 | 3300047469 | Bacteria | 20933 |
| 912 | Ga0495673_0002288 | 3300047469 | Bacteria | 13723 |
| 913 | Ga0495673_0005066 | 3300047469 | Bacteria | 8066 |
| 914 | Ga0495673_0014221 | 3300047469 | Bacteria | 4144 |
| 915 | Ga0495673_0022036 | 3300047469 | Bacteria | 3130 |
| 916 | Ga0495673_0024272 | 3300047469 | Bacteria | 2933 |
| 917 | Ga0495673_0026466 | 3300047469 | Bacteria | 2772 |
| 918 | Ga0495673_0030031 | 3300047469 | Bacteria | 2558 |
| 919 | Ga0495673_0039165 | 3300047469 | Bacteria | 2151 |
| 920 | Ga0495673_0061992 | 3300047469 | Bacteria | 1599 |
| 921 | Ga0495673_0073270 | 3300047469 | Bacteria | 1435 |
| 922 | Ga0495673_0081441 | 3300047469 | Bacteria | 1340 |
| 923 | Ga0495673_0086996 | 3300047469 | Bacteria | 1283 |
| 924 | Ga0495673_0105190 | 3300047469 | Bacteria | 1135 |
| 925 | Ga0495681_0009856 | 3300047470 | Bacteria | 5842 |
| 926 | Ga0495681_0013570 | 3300047470 | Bacteria | 4718 |
| 927 | Ga0495681_0020409 | 3300047470 | Bacteria | 3596 |
| 928 | Ga0495681_0029047 | 3300047470 | Bacteria | 2835 |
| 929 | Ga0495681_0109114 | 3300047470 | Bacteria | 1200 |
| 930 | Ga0495684_0038420 | 3300047471 | Bacteria | 3670 |
| 931 | Ga0495686_0000834 | 3300047472 | Bacteria | 39641 |
| 932 | Ga0495686_0012681 | 3300047472 | Bacteria | 5890 |
| 933 | Ga0495686_0024290 | 3300047472 | Bacteria | 3985 |
| 934 | Ga0495686_0047370 | 3300047472 | Bacteria | 2714 |
| 935 | Ga0495593_0013908 | 3300047673 | Bacteria | 4584 |
| 936 | Ga0495593_0052038 | 3300047673 | Bacteria | 2165 |
| 937 | Ga0495593_0085127 | 3300047673 | Bacteria | 1632 |
| 938 | Ga0495626_0000024 | 3300048091 | Bacteria | 214179 |
| 939 | Ga0495626_0004732 | 3300048091 | Bacteria | 8236 |
| 940 | Ga0495626_0005414 | 3300048091 | Bacteria | 7482 |
| 941 | Ga0495626_0007792 | 3300048091 | Bacteria | 5931 |
| 942 | Ga0495626_0016287 | 3300048091 | Bacteria | 3779 |
| 943 | Ga0495626_0022666 | 3300048091 | Bacteria | 3099 |
| 944 | Ga0495626_0027792 | 3300048091 | Bacteria | 2748 |
| 945 | Ga0496100_0101817 | 3300048903 | Archaea | 1981 |
| 946 | Ga0496102_0005400 | 3300048905 | Archaea | 10852 |
| 947 | Ga0496102_0020156 | 3300048905 | Bacteria | 5887 |
| 948 | Ga0496104_0046163 | 3300048907 | Bacteria | 4101 |
| 949 | Ga0496107_0035808 | 3300048910 | Archaea | 3559 |
| 950 | Ga0496109_0396407 | 3300048912 | Bacteria | 1304 |
| 951 | Ga0496110_0000254 | 3300048913 | Bacteria | 34664 |
| 952 | Ga0496110_0048183 | 3300048913 | Bacteria | 3735 |
| 953 | Ga0496110_0120635 | 3300048913 | Bacteria | 2362 |
| 954 | Ga0496110_0164361 | 3300048913 | Bacteria | 2012 |
| 955 | Ga0496111_0170923 | 3300048914 | Bacteria | 1615 |
| 956 | Ga0496113_0028490 | 3300048916 | Bacteria | 4018 |
| 957 | Ga0496114_0143955 | 3300048917 | Bacteria | 2065 |
| 958 | Ga0496116_0001725 | 3300048919 | Bacteria | 23879 |
| 959 | Ga0496116_0011675 | 3300048919 | Bacteria | 7240 |
| 960 | Ga0496116_0019776 | 3300048919 | Bacteria | 5144 |
| 961 | Ga0496116_0025706 | 3300048919 | Bacteria | 4323 |
| 962 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 963 | Ga0496117_0006500 | 3300048920 | Bacteria | 11789 |
| 964 | Ga0496117_0007309 | 3300048920 | Bacteria | 10841 |
| 965 | Ga0496117_0008713 | 3300048920 | Bacteria | 9585 |
| 966 | Ga0496117_0009017 | 3300048920 | Bacteria | 9382 |
| 967 | Ga0496117_0017029 | 3300048920 | Bacteria | 6088 |
| 968 | Ga0496117_0018515 | 3300048920 | Bacteria | 5762 |
| 969 | Ga0496117_0030449 | 3300048920 | Bacteria | 4141 |
| 970 | Ga0496117_0098658 | 3300048920 | Bacteria | 1856 |
| 971 | Ga0496117_0125530 | 3300048920 | Bacteria | 1567 |
| 972 | Ga0496118_0000709 | 3300048921 | Bacteria | 53670 |
| 973 | Ga0496118_0028798 | 3300048921 | Bacteria | 4670 |
| 974 | Ga0496118_0031832 | 3300048921 | Bacteria | 4362 |
| 975 | Ga0496118_0033154 | 3300048921 | Bacteria | 4243 |
| 976 | Ga0496118_0042110 | 3300048921 | Bacteria | 3607 |
| 977 | Ga0496118_0065533 | 3300048921 | Bacteria | 2658 |
| 978 | Ga0496118_0075233 | 3300048921 | Bacteria | 2409 |
| 979 | Ga0496119_0000506 | 3300048922 | Bacteria | 53174 |
| 980 | Ga0496119_0071609 | 3300048922 | Bacteria | 2028 |
| 981 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 982 | Ga0496120_0001362 | 3300048923 | Bacteria | 29974 |
| 983 | Ga0496120_0040962 | 3300048923 | Bacteria | 2718 |
| 984 | Ga0496121_0005168 | 3300048924 | Bacteria | 16939 |
| 985 | Ga0496121_0006488 | 3300048924 | Bacteria | 14486 |
| 986 | Ga0496121_0007935 | 3300048924 | Bacteria | 12686 |
| 987 | Ga0496121_0014652 | 3300048924 | Bacteria | 8290 |
| 988 | Ga0496121_0022108 | 3300048924 | Bacteria | 6188 |
| 989 | Ga0496121_0096953 | 3300048924 | Bacteria | 2286 |
| 990 | Ga0496121_0153909 | 3300048924 | Bacteria | 1689 |
| 991 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 992 | Ga0496122_0001565 | 3300048925 | Bacteria | 36130 |
| 993 | Ga0496122_0007408 | 3300048925 | Bacteria | 12214 |
| 994 | Ga0496122_0021592 | 3300048925 | Bacteria | 5756 |
| 995 | Ga0496122_0088032 | 3300048925 | Bacteria | 2131 |
| 996 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 997 | Ga0496123_0001258 | 3300048926 | Bacteria | 36442 |
| 998 | Ga0496123_0005881 | 3300048926 | Bacteria | 12133 |
| 999 | Ga0496123_0024029 | 3300048926 | Bacteria | 4646 |
| 1000 | Ga0496123_0031632 | 3300048926 | Bacteria | 3846 |
| 1001 | Ga0496124_0000279 | 3300048927 | Bacteria | 97488 |
| 1002 | Ga0496124_0003507 | 3300048927 | Bacteria | 19104 |
| 1003 | Ga0496124_0006802 | 3300048927 | Bacteria | 12347 |
| 1004 | Ga0496124_0007177 | 3300048927 | Bacteria | 11908 |
| 1005 | Ga0496124_0012008 | 3300048927 | Bacteria | 8609 |
| 1006 | Ga0496124_0013149 | 3300048927 | Bacteria | 8103 |
| 1007 | Ga0496124_0035067 | 3300048927 | Bacteria | 4393 |
| 1008 | Ga0496124_0041751 | 3300048927 | Bacteria | 3955 |
| 1009 | Ga0496124_0105578 | 3300048927 | Bacteria | 2275 |
| 1010 | Ga0496124_0121323 | 3300048927 | Bacteria | 2088 |
| 1011 | Ga0496124_0173428 | 3300048927 | Bacteria | 1667 |
| 1012 | Ga0496125_0014065 | 3300048928 | Bacteria | 7821 |
| 1013 | Ga0496125_0015865 | 3300048928 | Bacteria | 7258 |
| 1014 | Ga0496125_0015902 | 3300048928 | Bacteria | 7249 |
| 1015 | Ga0496125_0040690 | 3300048928 | Bacteria | 3983 |
| 1016 | Ga0496125_0087462 | 3300048928 | Bacteria | 2353 |
| 1017 | Ga0496126_0043641 | 3300048929 | Bacteria | 4134 |
| 1018 | Ga0496126_0056657 | 3300048929 | Bacteria | 3541 |
| 1019 | Ga0496126_0160922 | 3300048929 | Bacteria | 1918 |
| 1020 | Ga0495678_000054 | 3300049459 | Bacteria | 153487 |
| 1021 | Ga0495678_000078 | 3300049459 | Bacteria | 123666 |
| 1022 | Ga0495678_005003 | 3300049459 | Bacteria | 7467 |
| 1023 | Ga0495678_006344 | 3300049459 | Bacteria | 6305 |
| 1024 | Ga0495678_007286 | 3300049459 | Bacteria | 5754 |
| 1025 | Ga0495678_011543 | 3300049459 | Bacteria | 4224 |
| 1026 | Ga0495678_061005 | 3300049459 | Bacteria | 1416 |
| 1027 | Ga0495682_0001399 | 3300049460 | Bacteria | 13150 |
| 1028 | Ga0495682_0001713 | 3300049460 | Bacteria | 11116 |
| 1029 | Ga0495682_0030254 | 3300049460 | Bacteria | 2003 |
| 1030 | Ga0495682_0069278 | 3300049460 | Bacteria | 1269 |
| 1031 | Ga0501031_0017408 | 3300049568 | Unclassified | 4670 |
| 1032 | Ga0501032_0011796 | 3300049569 | Bacteria | 6264 |
| 1033 | Ga0501033_0000913 | 3300049570 | Bacteria | 26962 |
| 1034 | Ga0501033_0051844 | 3300049570 | Bacteria | 3042 |
| 1035 | Ga0501034_0000136 | 3300049571 | Bacteria | 136835 |
| 1036 | Ga0501034_0026829 | 3300049571 | Bacteria | 5860 |
| 1037 | Ga0501036_0001043 | 3300049572 | Archaea | 20923 |
| 1038 | Ga0501036_0009992 | 3300049572 | Bacteria | 7817 |
| 1039 | Ga0501036_0190882 | 3300049572 | Bacteria | 1724 |
| 1040 | Ga0501037_0049888 | 3300049573 | Bacteria | 3064 |
| 1041 | Ga0501038_0071186 | 3300049574 | Bacteria | 2950 |
| 1042 | Ga0501039_0003061 | 3300049575 | Archaea | 12507 |
| 1043 | Ga0501039_0073825 | 3300049575 | Unclassified | 2650 |
| 1044 | Ga0501039_0097948 | 3300049575 | Bacteria | 2287 |
| 1045 | Ga0501040_0013555 | 3300049576 | Archaea | 5360 |
| 1046 | Ga0501040_0057152 | 3300049576 | Archaea | 2678 |
| 1047 | Ga0501041_0000144 | 3300049577 | Archaea | 31221 |
| 1048 | Ga0501041_0024012 | 3300049577 | Unclassified | 3658 |
| 1049 | Ga0501041_0056225 | 3300049577 | Bacteria | 2403 |
| 1050 | Ga0501041_0114148 | 3300049577 | Unclassified | 1677 |
| 1051 | Ga0501041_0135961 | 3300049577 | Archaea | 1532 |
| 1052 | Ga0501042_0017772 | 3300049578 | Archaea | 4910 |
| 1053 | Ga0501042_0152935 | 3300049578 | Unclassified | 1664 |
| 1054 | Ga0501043_0211676 | 3300049579 | Bacteria | 1502 |
| 1055 | Ga0501046_0034659 | 3300049580 | Bacteria | 4072 |
| 1056 | Ga0501047_0215307 | 3300049581 | Bacteria | 1778 |
| 1057 | Ga0501048_0007809 | 3300049582 | Archaea | 8106 |
| 1058 | Ga0501048_0116063 | 3300049582 | Archaea | 1891 |
| 1059 | Ga0501067_0132694 | 3300049583 | Bacteria | 1386 |
| 1060 | Ga0501069_0130391 | 3300049585 | Archaea | 1439 |
| 1061 | Ga0501071_0000772 | 3300049587 | Archaea | 16990 |
| 1062 | Ga0501071_0005028 | 3300049587 | Bacteria | 8454 |
| 1063 | Ga0501072_0001871 | 3300049588 | Archaea | 15678 |
| 1064 | Ga0501072_0117024 | 3300049588 | Bacteria | 2123 |
| 1065 | Ga0501075_0000617 | 3300049591 | Archaea | 21811 |
| 1066 | Ga0501075_0076397 | 3300049591 | Archaea | 2533 |
| 1067 | Ga0501076_0000085 | 3300049592 | Archaea | 49144 |
| 1068 | Ga0501076_0008106 | 3300049592 | Archaea | 7680 |
| 1069 | Ga0501076_0062357 | 3300049592 | Archaea | 2969 |
| 1070 | Ga0501076_0065277 | 3300049592 | Unclassified | 2902 |
| 1071 | Ga0501077_0004394 | 3300049593 | Archaea | 8549 |
| 1072 | Ga0501077_0049460 | 3300049593 | Unclassified | 2672 |
| 1073 | Ga0501079_0031309 | 3300049741 | Archaea | 4088 |
| 1074 | Ga0501079_0046665 | 3300049741 | Unclassified | 3343 |
| 1075 | Ga0501079_0134653 | 3300049741 | Archaea | 1924 |
| 1076 | Ga0501080_0006827 | 3300049742 | Archaea | 10295 |
| 1077 | Ga0501080_0022050 | 3300049742 | Bacteria | 5900 |
| 1078 | Ga0501081_0000813 | 3300049743 | Archaea | 18427 |
| 1079 | Ga0501081_0058623 | 3300049743 | Unclassified | 2664 |
| 1080 | Ga0501081_0065196 | 3300049743 | Bacteria | 2531 |
| 1081 | Ga0501083_0020728 | 3300049744 | Bacteria | 4571 |
| 1082 | Ga0501044_0030111 | 3300049823 | Bacteria | 5721 |
| 1083 | Ga0501044_0075054 | 3300049823 | Bacteria | 3433 |
| 1084 | Ga0501045_0005143 | 3300049824 | Archaea | 9054 |
| 1085 | Ga0501045_0015034 | 3300049824 | Bacteria | 5493 |
| 1086 | Ga0501226_000060 | 3300049853 | Bacteria | 36795 |
| 1087 | nmdc:mga03683_124_c1 | 3300050489 | Bacteria | 25785 |
| 1088 | nmdc:mga03n38_164_c1 | 3300050490 | Bacteria | 14773 |
| 1089 | nmdc:mga00v17_19984_c1 | 3300050491 | Unclassified | 3831 |
| 1090 | nmdc:mga00v17_55_c1 | 3300050491 | Bacteria | 72029 |
| 1091 | nmdc:mga0k408_36195_c1 | 3300050493 | Bacteria | 2833 |
| 1092 | nmdc:mga05p37_87590_c1 | 3300050507 | Archaea | 3838 |
| 1093 | nmdc:mga05p37_9333_c1 | 3300050507 | Archaea | 11607 |
| 1094 | nmdc:mga09592_26389_c1 | 3300050508 | Bacteria | 4812 |
| 1095 | nmdc:mga09592_4347_c1 | 3300050508 | Archaea | 11459 |
| 1096 | nmdc:mga09592_77020_c1 | 3300050508 | Bacteria | 2837 |
| 1097 | nmdc:mga09592_91436_c1 | 3300050508 | Archaea | 2601 |
| 1098 | nmdc:mga0qj67_118804_c1 | 3300050509 | Bacteria | 2138 |
| 1099 | nmdc:mga0qj67_162225_c1 | 3300050509 | Archaea | 1814 |
| 1100 | nmdc:mga06r32_8751_c1 | 3300050510 | Archaea | 9119 |
| 1101 | nmdc:mga06r32_97194_c1 | 3300050510 | Archaea | 2885 |
| 1102 | nmdc:mga08y16_119701_c1 | 3300050511 | Archaea | 2741 |
| 1103 | nmdc:mga08y16_2858_c1 | 3300050511 | Archaea | 17759 |
| 1104 | nmdc:mga08y16_4552_c1 | 3300050511 | Archaea | 14454 |
| 1105 | nmdc:mga08y16_85361_c1 | 3300050511 | Bacteria | 3290 |
| 1106 | nmdc:mga0n895_155450_c1 | 3300050512 | Archaea | 1416 |
| 1107 | nmdc:mga0n895_193307_c1 | 3300050512 | Bacteria | 2066 |
| 1108 | nmdc:mga0n895_287948_c1 | 3300050512 | Archaea | 1666 |
| 1109 | nmdc:mga0n895_75_c1 | 3300050512 | Archaea | 57220 |
| 1110 | nmdc:mga0rr50_7249_c1 | 3300050513 | Archaea | 6821 |
| 1111 | nmdc:mga08x19_848_c1 | 3300050514 | Archaea | 19414 |
| 1112 | nmdc:mga0a205_352601_c1 | 3300050515 | Archaea | 1339 |
| 1113 | nmdc:mga0a205_8161_c1 | 3300050515 | Archaea | 9513 |
| 1114 | nmdc:mga0sz30_827_c1 | 3300050516 | Bacteria | 11186 |
| 1115 | Ga0500583_0029764 | 3300053092 | Bacteria | 2384 |
| 1116 | Ga0500651_0108059 | 3300053093 | Bacteria | 1700 |
| 1117 | Ga0500641_0048344 | 3300053096 | Bacteria | 1742 |
| 1118 | Ga0500650_0000224 | 3300053098 | Bacteria | 13852 |
| 1119 | Ga0500560_001971 | 3300053107 | Bacteria | 3775 |
| 1120 | Ga0500564_007906 | 3300053138 | Bacteria | 4536 |
| 1121 | Ga0500604_0000055 | 3300053151 | Bacteria | 41071 |
| 1122 | Ga0500622_0013825 | 3300053156 | Bacteria | 4349 |
| 1123 | Ga0500624_000234 | 3300053157 | Bacteria | 20148 |
| 1124 | Ga0500634_0026692 | 3300053161 | Bacteria | 3146 |
| 1125 | Ga0501084_0006079 | 3300054114 | Bacteria | 9930 |
| 1126 | Ga0501084_0010109 | 3300054114 | Archaea | 7798 |
| 1127 | Ga0501084_0014674 | 3300054114 | Archaea | 6496 |
| 1128 | Ga0501084_0032036 | 3300054114 | Bacteria | 4397 |
| 1129 | Ga0500661_012745 | 3300055283 | Bacteria | 1517 |
| 1130 | Ga0501082_0000374 | 3300060353 | Archaea | 39553 |
| 1131 | Ga0530510_0003739 | 3300061734 | Archaea | 10476 |
| 1132 | Ga0530510_0012586 | 3300061734 | Bacteria | 5947 |
| 1133 | Ga0530510_0017902 | 3300061734 | Archaea | 5024 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0098658 | Ga0496117_0098658_342_1250 | 283 |
| 2 | 3300046474 | Ga0495605_0019206 | Ga0495605_0019206_585_1478 | 297 |
| 3 | 3300005435 | Ga0070714_100106996 | Ga0070714_1001069963 | 310 |
| 4 | 3300025929 | Ga0207664_10082292 | Ga0207664_100822923 | 310 |
| 5 | 3300050510 | nmdc:mga06r32_97194_c1 | nmdc:mga06r32_97194_c1_17_1039 | 313 |
| 6 | 3300005455 | Ga0070663_100103032 | Ga0070663_1001030322 | 319 |
| 7 | 3300005563 | Ga0068855_100145236 | Ga0068855_1001452362 | 319 |
| 8 | 3300026067 | Ga0207678_10057508 | Ga0207678_100575082 | 319 |
| 9 | 3300026116 | Ga0207674_10033629 | Ga0207674_100336295 | 319 |
| 10 | 3300042006 | Ga0439432_011915 | Ga0439432_011915_1993_2958 | 321 |
| 11 | 3300046458 | Ga0495591_050135 | Ga0495591_050135_144_1109 | 321 |
| 12 | 3300046474 | Ga0495605_0073007 | Ga0495605_0073007_623_1588 | 321 |
| 13 | 3300046491 | Ga0495584_0008019 | Ga0495584_0008019_4510_5475 | 321 |
| 14 | 3300046499 | Ga0495594_0100082 | Ga0495594_0100082_26_991 | 321 |
| 15 | 3300046520 | Ga0495637_0014187 | Ga0495637_0014187_35_1000 | 321 |
| 16 | 3300046520 | Ga0495637_0026021 | Ga0495637_0026021_1639_2604 | 321 |
| 17 | 3300046523 | Ga0495644_0008526 | Ga0495644_0008526_22_987 | 321 |
| 18 | 3300046691 | Ga0495670_0007472 | Ga0495670_0007472_4387_5352 | 321 |
| 19 | 3300047320 | Ga0495672_0009503 | Ga0495672_0009503_6046_7011 | 321 |
| 20 | 3300047320 | Ga0495672_0024934 | Ga0495672_0024934_2848_3813 | 321 |
| 21 | 3300047443 | Ga0495687_021505 | Ga0495687_021505_35_1000 | 321 |
| 22 | 3300048927 | Ga0496124_0173428 | Ga0496124_0173428_26_991 | 321 |
| 23 | 3300005354 | Ga0070675_100034536 | Ga0070675_1000345363 | 322 |
| 24 | 3300005338 | Ga0068868_100000090 | Ga0068868_1000000903 | 323 |
| 25 | 3300005339 | Ga0070660_100000304 | Ga0070660_1000003042 | 323 |
| 26 | 3300005366 | Ga0070659_100000017 | Ga0070659_10000001763 | 323 |
| 27 | 3300025919 | Ga0207657_10021483 | Ga0207657_100214833 | 323 |
| 28 | 3300025932 | Ga0207690_10000035 | Ga0207690_1000003564 | 323 |
| 29 | 3300026023 | Ga0207677_10000224 | Ga0207677_1000022423 | 323 |
| 30 | 3300026075 | Ga0207708_10080588 | Ga0207708_100805882 | 323 |
| 31 | 3300046665 | Ga0495661_0000050 | Ga0495661_0000050_79580_80662 | 323 |
| 32 | 3300021384 | Ga0213876_10003358 | Ga0213876_100033582 | 325 |
| 33 | 3300039437 | Ga0436365_0478409 | Ga0436365_0478409_2330_3397 | 325 |
| 34 | 3300025926 | Ga0207659_10017853 | Ga0207659_100178536 | 326 |
| 35 | 3300025933 | Ga0207706_10121407 | Ga0207706_101214072 | 326 |
| 36 | 3300031731 | Ga0307405_10021164 | Ga0307405_100211642 | 326 |
| 37 | 3300031824 | Ga0307413_10001990 | Ga0307413_100019907 | 326 |
| 38 | 3300031852 | Ga0307410_10002976 | Ga0307410_100029767 | 326 |
| 39 | 3300032002 | Ga0307416_100014760 | Ga0307416_1000147603 | 326 |
| 40 | 3300046660 | Ga0495625_0075893 | Ga0495625_0075893_1309_2313 | 327 |
| 41 | 3300032126 | Ga0307415_100008349 | Ga0307415_1000083492 | 329 |
| 42 | 3300049572 | Ga0501036_0009992 | Ga0501036_0009992_979_1992 | 330 |
| 43 | 3300049574 | Ga0501038_0071186 | Ga0501038_0071186_235_1248 | 330 |
| 44 | 3300049575 | Ga0501039_0097948 | Ga0501039_0097948_491_1504 | 330 |
| 45 | 3300049577 | Ga0501041_0056225 | Ga0501041_0056225_749_1762 | 330 |
| 46 | 3300049579 | Ga0501043_0211676 | Ga0501043_0211676_389_1402 | 330 |
| 47 | 3300049580 | Ga0501046_0034659 | Ga0501046_0034659_1970_2983 | 330 |
| 48 | 3300049587 | Ga0501071_0005028 | Ga0501071_0005028_6660_7673 | 330 |
| 49 | 3300049743 | Ga0501081_0065196 | Ga0501081_0065196_711_1724 | 330 |
| 50 | 3300049824 | Ga0501045_0015034 | Ga0501045_0015034_4246_5259 | 330 |
| 51 | 3300054114 | Ga0501084_0006079 | Ga0501084_0006079_1280_2293 | 330 |
| 52 | 3300061734 | Ga0530510_0012586 | Ga0530510_0012586_856_1869 | 330 |
| 53 | 3300048912 | Ga0496109_0396407 | Ga0496109_0396407_52_1131 | 331 |
| 54 | 3300049585 | Ga0501069_0130391 | Ga0501069_0130391_358_1428 | 332 |
| 55 | 3300049592 | Ga0501076_0065277 | Ga0501076_0065277_1348_2544 | 335 |
| 56 | 3300047469 | Ga0495673_0022036 | Ga0495673_0022036_1124_2188 | 336 |
| 57 | 3300047472 | Ga0495686_0000834 | Ga0495686_0000834_33849_34913 | 336 |
| 58 | 3300005548 | Ga0070665_100009114 | Ga0070665_1000091144 | 337 |
| 59 | 3300028379 | Ga0268266_10004829 | Ga0268266_100048296 | 337 |
| 60 | 3300046453 | Ga0495627_036336 | Ga0495627_036336_13_1026 | 337 |
| 61 | 3300046515 | Ga0495620_0017505 | Ga0495620_0017505_2534_3547 | 337 |
| 62 | 3300046694 | Ga0495649_0096761 | Ga0495649_0096761_13_1026 | 337 |
| 63 | 3300048916 | Ga0496113_0028490 | Ga0496113_0028490_1097_2179 | 337 |
| 64 | 3300048919 | Ga0496116_0019776 | Ga0496116_0019776_4030_5112 | 337 |
| 65 | 3300048920 | Ga0496117_0000052 | Ga0496117_0000052_70672_71754 | 337 |
| 66 | 3300048921 | Ga0496118_0000709 | Ga0496118_0000709_20557_21639 | 337 |
| 67 | 3300048923 | Ga0496120_0000019 | Ga0496120_0000019_70672_71754 | 337 |
| 68 | 3300048925 | Ga0496122_0000053 | Ga0496122_0000053_70672_71754 | 337 |
| 69 | 3300048926 | Ga0496123_0000038 | Ga0496123_0000038_70672_71754 | 337 |
| 70 | 3300025932 | Ga0207690_10040392 | Ga0207690_100403923 | 338 |
| 71 | 3300031548 | Ga0307408_100013164 | Ga0307408_1000131646 | 338 |
| 72 | 3300031995 | Ga0307409_100326381 | Ga0307409_1003263812 | 338 |
| 73 | 3300032004 | Ga0307414_10144956 | Ga0307414_101449561 | 338 |
| 74 | 3300032126 | Ga0307415_100062049 | Ga0307415_1000620492 | 338 |
| 75 | 3300037418 | Ga0395900_0052744 | Ga0395900_0052744_2645_3700 | 338 |
| 76 | 3300037418 | Ga0395900_0110410 | Ga0395900_0110410_221_1276 | 338 |
| 77 | 3300037418 | Ga0395900_0471790 | Ga0395900_0471790_143_1198 | 338 |
| 78 | 3300038443 | Ga0395901_0004300 | Ga0395901_0004300_11328_12383 | 338 |
| 79 | 3300044656 | Ga0466969_0031750 | Ga0466969_0031750_440_1498 | 338 |
| 80 | 3300003578 | Ga0006562J51391_1005474 | Ga0006562J51391_10054742 | 339 |
| 81 | 3300013102 | Ga0157371_10007309 | Ga0157371_100073097 | 339 |
| 82 | 3300025294 | Ga0209025_1004446 | Ga0209025_100444610 | 339 |
| 83 | 3300025909 | Ga0207705_10020971 | Ga0207705_100209713 | 339 |
| 84 | 3300009545 | Ga0105237_10036109 | Ga0105237_100361093 | 340 |
| 85 | 3300053151 | Ga0500604_0000055 | Ga0500604_0000055_29235_30296 | 340 |
| 86 | iso_pu_bacteria | 2791355253 | 2793281684 | 340 |
| 87 | iso_pu_bacteria | 2891048133 | 2891048296 | 340 |
| 88 | iso_pu_bacteria | 8005658619 | 8005658621 | 340 |
| 89 | 3300005327 | Ga0070658_10001239 | Ga0070658_1000123911 | 341 |
| 90 | 3300005336 | Ga0070680_100021537 | Ga0070680_1000215373 | 341 |
| 91 | 3300006038 | Ga0075365_10032862 | Ga0075365_100328623 | 341 |
| 92 | 3300006871 | Ga0075434_100042060 | Ga0075434_1000420605 | 341 |
| 93 | 3300009098 | Ga0105245_10014262 | Ga0105245_100142622 | 341 |
| 94 | 3300009545 | Ga0105237_10000737 | Ga0105237_1000073742 | 341 |
| 95 | 3300010375 | Ga0105239_10001737 | Ga0105239_1000173715 | 341 |
| 96 | 3300013307 | Ga0157372_10491938 | Ga0157372_104919382 | 341 |
| 97 | 3300020081 | Ga0206354_10094784 | Ga0206354_100947841 | 341 |
| 98 | 3300020082 | Ga0206353_10636536 | Ga0206353_106365362 | 341 |
| 99 | 3300021384 | Ga0213876_10079825 | Ga0213876_100798252 | 341 |
| 100 | 3300039437 | Ga0436365_1729816 | Ga0436365_1729816_938_2011 | 341 |
| 101 | 3300048924 | Ga0496121_0007935 | Ga0496121_0007935_4262_5326 | 341 |
| 102 | 3300049570 | Ga0501033_0051844 | Ga0501033_0051844_1075_2139 | 341 |
| 103 | 3300049823 | Ga0501044_0030111 | Ga0501044_0030111_4635_5699 | 341 |
| 104 | 3300050512 | nmdc:mga0n895_193307_c1 | nmdc:mga0n895_193307_c1_53_1120 | 341 |
| 105 | 3300005333 | Ga0070677_10000357 | Ga0070677_100003579 | 342 |
| 106 | 3300005355 | Ga0070671_100125049 | Ga0070671_1001250492 | 342 |
| 107 | 3300009093 | Ga0105240_10235193 | Ga0105240_102351931 | 342 |
| 108 | 3300025893 | Ga0207682_10000578 | Ga0207682_100005789 | 342 |
| 109 | 3300025981 | Ga0207640_10019529 | Ga0207640_100195293 | 342 |
| 110 | 3300026041 | Ga0207639_10130395 | Ga0207639_101303952 | 342 |
| 111 | 3300049577 | Ga0501041_0135961 | Ga0501041_0135961_394_1497 | 342 |
| 112 | 3300009093 | Ga0105240_10011111 | Ga0105240_100111118 | 343 |
| 113 | 3300009551 | Ga0105238_10012550 | Ga0105238_1001255010 | 343 |
| 114 | 3300014325 | Ga0163163_10147343 | Ga0163163_101473432 | 343 |
| 115 | 3300026121 | Ga0207683_10416755 | Ga0207683_104167552 | 343 |
| 116 | 3300037312 | Ga0395899_0000052 | Ga0395899_0000052_176919_177998 | 343 |
| 117 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_524469_525548 | 343 |
| 118 | 3300037466 | Ga0395898_0050393 | Ga0395898_0050393_1146_2225 | 343 |
| 119 | 3300038443 | Ga0395901_0000013 | Ga0395901_0000013_178237_179316 | 343 |
| 120 | 3300039438 | Ga0436360_0114333 | Ga0436360_0114333_48_1124 | 343 |
| 121 | iso_pu_bacteria | 2558860983 | 2561468127 | 343 |
| 122 | iso_pu_bacteria | 2643221598 | 2644001492 | 343 |
| 123 | 3300003578 | Ga0006562J51391_1082126 | Ga0006562J51391_10821265 | 344 |
| 124 | 3300005331 | Ga0070670_100102136 | Ga0070670_1001021363 | 344 |
| 125 | 3300005617 | Ga0068859_100031931 | Ga0068859_1000319312 | 344 |
| 126 | 3300006931 | Ga0097620_100031931 | Ga0097620_1000319314 | 344 |
| 127 | 3300009176 | Ga0105242_10076312 | Ga0105242_100763122 | 344 |
| 128 | 3300009551 | Ga0105238_10213913 | Ga0105238_102139132 | 344 |
| 129 | 3300013102 | Ga0157371_10075062 | Ga0157371_100750622 | 344 |
| 130 | 3300013104 | Ga0157370_10063353 | Ga0157370_100633535 | 344 |
| 131 | 3300025908 | Ga0207643_10000239 | Ga0207643_1000023928 | 344 |
| 132 | 3300028800 | Ga0265338_10083893 | Ga0265338_100838933 | 344 |
| 133 | 3300046501 | Ga0495607_0000113 | Ga0495607_0000113_70580_71662 | 344 |
| 134 | 3300005985 | Ga0081539_10009797 | Ga0081539_100097973 | 345 |
| 135 | 3300009011 | Ga0105251_10060729 | Ga0105251_100607292 | 345 |
| 136 | 3300009092 | Ga0105250_10006294 | Ga0105250_100062942 | 345 |
| 137 | 3300009148 | Ga0105243_10118135 | Ga0105243_101181352 | 345 |
| 138 | 3300025711 | Ga0207696_1000694 | Ga0207696_100069421 | 345 |
| 139 | 3300049570 | Ga0501033_0000913 | Ga0501033_0000913_16954_18039 | 345 |
| 140 | 3300049571 | Ga0501034_0026829 | Ga0501034_0026829_997_2082 | 345 |
| 141 | 3300049573 | Ga0501037_0049888 | Ga0501037_0049888_589_1674 | 345 |
| 142 | 3300049823 | Ga0501044_0075054 | Ga0501044_0075054_587_1672 | 345 |
| 143 | 3300003856 | Ga0058692_1010554 | Ga0058692_10105544 | 346 |
| 144 | 3300006948 | Ga0099826_10022778 | Ga0099826_100227786 | 346 |
| 145 | 3300025294 | Ga0209025_1000255 | Ga0209025_100025570 | 346 |
| 146 | 3300025972 | Ga0207668_10181931 | Ga0207668_101819313 | 346 |
| 147 | 3300025981 | Ga0207640_10006138 | Ga0207640_100061384 | 346 |
| 148 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003786 | 346 |
| 149 | 3300027312 | Ga0209371_1000729 | Ga0209371_100072911 | 346 |
| 150 | 3300027666 | Ga0209282_1005146 | Ga0209282_10051467 | 346 |
| 151 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004264 | 346 |
| 152 | 3300030744 | Ga0316181_1260236 | Ga0316181_12602363 | 346 |
| 153 | 3300048907 | Ga0496104_0046163 | Ga0496104_0046163_2221_3297 | 346 |
| 154 | 3300048921 | Ga0496118_0065533 | Ga0496118_0065533_752_1843 | 346 |
| 155 | 3300048923 | Ga0496120_0040962 | Ga0496120_0040962_1178_2254 | 346 |
| 156 | 3300048924 | Ga0496121_0153909 | Ga0496121_0153909_589_1665 | 346 |
| 157 | 3300048928 | Ga0496125_0015902 | Ga0496125_0015902_2344_3420 | 346 |
| 158 | iso_pu_bacteria | 2537561587 | 2537873697 | 346 |
| 159 | iso_pu_bacteria | 2599185210 | 2599604672 | 346 |
| 160 | iso_pu_bacteria | 2600255279 | 2601611182 | 346 |
| 161 | iso_pu_bacteria | 2600255308 | 2601747955 | 346 |
| 162 | iso_pu_bacteria | 2818991439 | 2819557196 | 346 |
| 163 | iso_pu_bacteria | 2838675328 | 2838678264 | 346 |
| 164 | iso_pu_bacteria | 2838714209 | 2838716830 | 346 |
| 165 | iso_pu_bacteria | 2838719591 | 2838722560 | 346 |
| 166 | iso_pu_bacteria | 2838724970 | 2838727579 | 346 |
| 167 | iso_pu_bacteria | 2841846520 | 2841849185 | 346 |
| 168 | iso_pu_bacteria | 2841859092 | 2841861755 | 346 |
| 169 | iso_pu_bacteria | 2842124991 | 2842128066 | 346 |
| 170 | iso_pu_bacteria | 2842130223 | 2842133157 | 346 |
| 171 | iso_pu_bacteria | 2842152218 | 2842155151 | 346 |
| 172 | iso_pu_bacteria | 2842170452 | 2842173650 | 346 |
| 173 | iso_pu_bacteria | 2842175837 | 2842178772 | 346 |
| 174 | iso_pu_bacteria | 2842187318 | 2842189937 | 346 |
| 175 | iso_pu_bacteria | 2842211629 | 2842214251 | 346 |
| 176 | iso_pu_bacteria | 2842224351 | 2842226970 | 346 |
| 177 | iso_pu_bacteria | 2842515876 | 2842517979 | 346 |
| 178 | iso_pu_bacteria | 2899792073 | 2899792844 | 346 |
| 179 | iso_pu_bacteria | 2919114240 | 2919117021 | 346 |
| 180 | iso_pu_bacteria | 2926754445 | 2926758534 | 346 |
| 181 | iso_pu_bacteria | 2933006813 | 2933009470 | 346 |
| 182 | iso_pu_bacteria | 2933011516 | 2933013608 | 346 |
| 183 | iso_pu_bacteria | 2933594066 | 2933598139 | 346 |
| 184 | iso_pu_bacteria | 2979100975 | 2979102228 | 346 |
| 185 | iso_pu_bacteria | 2984509177 | 2984509824 | 346 |
| 186 | iso_pu_bacteria | 2984518228 | 2984519479 | 346 |
| 187 | iso_pu_bacteria | 2984537506 | 2984538163 | 346 |
| 188 | iso_pu_bacteria | 2984601300 | 2984604915 | 346 |
| 189 | 3300005328 | Ga0070676_10010547 | Ga0070676_100105476 | 347 |
| 190 | 3300005334 | Ga0068869_100108529 | Ga0068869_1001085292 | 347 |
| 191 | 3300005459 | Ga0068867_100012617 | Ga0068867_1000126177 | 347 |
| 192 | 3300005840 | Ga0068870_10006861 | Ga0068870_100068612 | 347 |
| 193 | 3300025907 | Ga0207645_10132985 | Ga0207645_101329852 | 347 |
| 194 | 3300025942 | Ga0207689_10218388 | Ga0207689_102183882 | 347 |
| 195 | 3300026075 | Ga0207708_10012565 | Ga0207708_100125656 | 347 |
| 196 | 3300026089 | Ga0207648_10016819 | Ga0207648_100168195 | 347 |
| 197 | 3300027543 | Ga0209999_1006028 | Ga0209999_10060282 | 347 |
| 198 | 3300027614 | Ga0209970_1010631 | Ga0209970_10106311 | 347 |
| 199 | 3300027617 | Ga0210002_1002809 | Ga0210002_10028091 | 347 |
| 200 | 3300027717 | Ga0209998_10001230 | Ga0209998_100012306 | 347 |
| 201 | 3300027876 | Ga0209974_10000647 | Ga0209974_100006476 | 347 |
| 202 | 3300041405 | Ga0439438_004810 | Ga0439438_004810_294_1337 | 347 |
| 203 | 3300041407 | Ga0439447_010462 | Ga0439447_010462_479_1522 | 347 |
| 204 | 3300042001 | Ga0439441_006439 | Ga0439441_006439_502_1698 | 347 |
| 205 | 3300042006 | Ga0439432_000735 | Ga0439432_000735_7471_8514 | 347 |
| 206 | 3300042010 | Ga0439452_017343 | Ga0439452_017343_472_1515 | 347 |
| 207 | 3300042013 | Ga0439456_006694 | Ga0439456_006694_601_1644 | 347 |
| 208 | 3300042138 | Ga0450903_002152 | Ga0450903_002152_476_1519 | 347 |
| 209 | 3300042145 | Ga0450906_000517 | Ga0450906_000517_3846_4889 | 347 |
| 210 | 3300042146 | Ga0450907_003664 | Ga0450907_003664_1210_2253 | 347 |
| 211 | 3300042185 | Ga0450909_007054 | Ga0450909_007054_455_1498 | 347 |
| 212 | 3300042461 | Ga0439460_0000568 | Ga0439460_0000568_4594_5637 | 347 |
| 213 | 3300042531 | Ga0450918_001120 | Ga0450918_001120_258_1301 | 347 |
| 214 | 3300042533 | Ga0450901_002321 | Ga0450901_002321_1012_2055 | 347 |
| 215 | 3300046458 | Ga0495591_006081 | Ga0495591_006081_23_1066 | 347 |
| 216 | 3300046492 | Ga0495585_0133382 | Ga0495585_0133382_20_1063 | 347 |
| 217 | 3300046512 | Ga0495610_0067114 | Ga0495610_0067114_21_1064 | 347 |
| 218 | 3300046530 | Ga0495654_0009176 | Ga0495654_0009176_4368_5411 | 347 |
| 219 | 3300046690 | Ga0495624_0013052 | Ga0495624_0013052_4610_5653 | 347 |
| 220 | 3300046692 | Ga0495671_0001137 | Ga0495671_0001137_17248_18291 | 347 |
| 221 | 3300046810 | Ga0495660_0021050 | Ga0495660_0021050_21_1064 | 347 |
| 222 | 3300047320 | Ga0495672_0094640 | Ga0495672_0094640_572_1615 | 347 |
| 223 | 3300047446 | Ga0495679_030775 | Ga0495679_030775_12_1055 | 347 |
| 224 | 3300047469 | Ga0495673_0026466 | Ga0495673_0026466_15_1058 | 347 |
| 225 | 3300047469 | Ga0495673_0105190 | Ga0495673_0105190_21_1064 | 347 |
| 226 | 3300047472 | Ga0495686_0024290 | Ga0495686_0024290_36_1079 | 347 |
| 227 | 3300047673 | Ga0495593_0085127 | Ga0495593_0085127_572_1615 | 347 |
| 228 | 3300048091 | Ga0495626_0022666 | Ga0495626_0022666_21_1064 | 347 |
| 229 | 3300013307 | Ga0157372_10018767 | Ga0157372_100187678 | 348 |
| 230 | 3300006042 | Ga0075368_10008012 | Ga0075368_100080126 | 349 |
| 231 | 3300006048 | Ga0075363_100000028 | Ga0075363_10000002817 | 349 |
| 232 | 3300006177 | Ga0075362_10000123 | Ga0075362_1000012313 | 349 |
| 233 | 3300006195 | Ga0075366_10002286 | Ga0075366_100022863 | 349 |
| 234 | 3300011119 | Ga0105246_10054082 | Ga0105246_100540823 | 349 |
| 235 | 3300013100 | Ga0157373_10010689 | Ga0157373_100106898 | 349 |
| 236 | 3300013102 | Ga0157371_10000002 | Ga0157371_1000000277 | 349 |
| 237 | 3300013104 | Ga0157370_10000246 | Ga0157370_1000024629 | 349 |
| 238 | 3300028800 | Ga0265338_10053664 | Ga0265338_100536642 | 349 |
| 239 | 3300046558 | Ga0495633_0020892 | Ga0495633_0020892_1785_2867 | 349 |
| 240 | 3300046674 | Ga0495588_0025085 | Ga0495588_0025085_1863_2951 | 349 |
| 241 | 3300048927 | Ga0496124_0012008 | Ga0496124_0012008_3497_4579 | 349 |
| 242 | 3300049578 | Ga0501042_0017772 | Ga0501042_0017772_570_1766 | 349 |
| 243 | 3300049593 | Ga0501077_0049460 | Ga0501077_0049460_380_1576 | 349 |
| 244 | 3300050489 | nmdc:mga03683_124_c1 | nmdc:mga03683_124_c1_17267_18355 | 349 |
| 245 | 3300050490 | nmdc:mga03n38_164_c1 | nmdc:mga03n38_164_c1_1659_2747 | 349 |
| 246 | 3300050491 | nmdc:mga00v17_55_c1 | nmdc:mga00v17_55_c1_30050_31132 | 349 |
| 247 | 3300050493 | nmdc:mga0k408_36195_c1 | nmdc:mga0k408_36195_c1_694_1782 | 349 |
| 248 | 3300050516 | nmdc:mga0sz30_827_c1 | nmdc:mga0sz30_827_c1_2529_3617 | 349 |
| 249 | 3300053107 | Ga0500560_001971 | Ga0500560_001971_58_1140 | 349 |
| 250 | 3300053157 | Ga0500624_000234 | Ga0500624_000234_17373_18455 | 349 |
| 251 | 3300053161 | Ga0500634_0026692 | Ga0500634_0026692_1857_2939 | 349 |
| 252 | iso_pu_bacteria | 2554235003 | 2554245199 | 349 |
| 253 | iso_pu_bacteria | 2558860242 | 2559296971 | 349 |
| 254 | iso_pu_bacteria | 2643221582 | 2643916923 | 349 |
| 255 | iso_pu_bacteria | 2643221693 | 2644521213 | 349 |
| 256 | iso_pu_bacteria | 2808606387 | 2808989069 | 349 |
| 257 | iso_pu_bacteria | 2899845264 | 2899845431 | 349 |
| 258 | iso_pu_bacteria | 2926760298 | 2926763934 | 349 |
| 259 | iso_pu_bacteria | 2979089926 | 2979090968 | 349 |
| 260 | iso_pu_bacteria | 2979095461 | 2979096494 | 349 |
| 261 | iso_pu_bacteria | 650716007 | 650843392 | 349 |
| 262 | iso_pu_bacteria | 8003570095 | 8003572989 | 349 |
| 263 | 3300028800 | Ga0265338_10000189 | Ga0265338_10000189125 | 351 |
| 264 | iso_pu_bacteria | 651053060 | 651174133 | 352 |
| 265 | 3300049577 | Ga0501041_0114148 | Ga0501041_0114148_484_1632 | 353 |
| 266 | iso_pu_bacteria | 2671180330 | 2672333857 | 353 |
| 267 | iso_pu_bacteria | 3006969106 | 3006972755 | 353 |
| 268 | iso_pu_bacteria | 3006984091 | 3006988108 | 353 |
| 269 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001183 | 354 |
| 270 | 3300021384 | Ga0213876_10008931 | Ga0213876_100089314 | 354 |
| 271 | 3300025927 | Ga0207687_10000004 | Ga0207687_1000000484 | 354 |
| 272 | 3300039437 | Ga0436365_0516586 | Ga0436365_0516586_2348_3478 | 354 |
| 273 | 3300049572 | Ga0501036_0190882 | Ga0501036_0190882_266_1372 | 354 |
| 274 | 3300049583 | Ga0501067_0132694 | Ga0501067_0132694_103_1233 | 354 |
| 275 | 3300049588 | Ga0501072_0117024 | Ga0501072_0117024_910_2040 | 354 |
| 276 | 3300049742 | Ga0501080_0022050 | Ga0501080_0022050_1805_2944 | 354 |
| 277 | 3300049744 | Ga0501083_0020728 | Ga0501083_0020728_1804_2934 | 354 |
| 278 | 2162886007 | SwRhRL2b_contig_1813663 | SwRhRL2b_0072.00001290 | 355 |
| 279 | 2209111006 | 2214767444 | 2213785301 | 355 |
| 280 | 3300000042 | ARSoilYngRDRAFT_c00058 | ARSoilYngRDRAFT_000586 | 355 |
| 281 | 3300000043 | ARcpr5yngRDRAFT_c000667 | ARcpr5yngRDRAFT_0006672 | 355 |
| 282 | 3300000045 | ARCol0oldRDRAFT_c01097 | ARCol0oldRDRAFT_010972 | 355 |
| 283 | 3300000652 | ARCol0yngRDRAFT_1000156 | ARCol0yngRDRAFT_10001564 | 355 |
| 284 | 3300003382 | JGI26139J50223_100054 | JGI26139J50223_1000543 | 355 |
| 285 | 3300003383 | JGI26140J50224_100023 | JGI26140J50224_1000235 | 355 |
| 286 | 3300003391 | JGI26135J50243_100037 | JGI26135J50243_1000373 | 355 |
| 287 | 3300003392 | JGI26134J50242_100070 | JGI26134J50242_1000706 | 355 |
| 288 | 3300003396 | JGI26137J50245_100034 | JGI26137J50245_1000346 | 355 |
| 289 | 3300003400 | JGI26131J50246_100183 | JGI26131J50246_1001834 | 355 |
| 290 | 3300003503 | JGI26141J51220_1000083 | JGI26141J51220_10000834 | 355 |
| 291 | 3300005289 | Ga0065704_10000453 | Ga0065704_1000045325 | 355 |
| 292 | 3300005289 | Ga0065704_10137692 | Ga0065704_101376922 | 355 |
| 293 | 3300005293 | Ga0065715_10000311 | Ga0065715_100003117 | 355 |
| 294 | 3300005295 | Ga0065707_10000468 | Ga0065707_1000046812 | 355 |
| 295 | 3300005295 | Ga0065707_10006314 | Ga0065707_100063143 | 355 |
| 296 | 3300005327 | Ga0070658_10011905 | Ga0070658_100119056 | 355 |
| 297 | 3300005331 | Ga0070670_100023631 | Ga0070670_1000236315 | 355 |
| 298 | 3300005336 | Ga0070680_100002694 | Ga0070680_10000269412 | 355 |
| 299 | 3300005336 | Ga0070680_100043723 | Ga0070680_1000437233 | 355 |
| 300 | 3300005336 | Ga0070680_100159948 | Ga0070680_1001599482 | 355 |
| 301 | 3300005338 | Ga0068868_100024633 | Ga0068868_1000246333 | 355 |
| 302 | 3300005339 | Ga0070660_100002009 | Ga0070660_1000020097 | 355 |
| 303 | 3300005343 | Ga0070687_100001943 | Ga0070687_1000019436 | 355 |
| 304 | 3300005353 | Ga0070669_100005298 | Ga0070669_1000052984 | 355 |
| 305 | 3300005354 | Ga0070675_100002894 | Ga0070675_10000289411 | 355 |
| 306 | 3300005364 | Ga0070673_100003226 | Ga0070673_1000032261 | 355 |
| 307 | 3300005367 | Ga0070667_100018360 | Ga0070667_1000183606 | 355 |
| 308 | 3300005438 | Ga0070701_10040588 | Ga0070701_100405883 | 355 |
| 309 | 3300005440 | Ga0070705_100002795 | Ga0070705_10000279510 | 355 |
| 310 | 3300005441 | Ga0070700_100007831 | Ga0070700_1000078316 | 355 |
| 311 | 3300005444 | Ga0070694_100018613 | Ga0070694_1000186133 | 355 |
| 312 | 3300005444 | Ga0070694_100056352 | Ga0070694_1000563523 | 355 |
| 313 | 3300005444 | Ga0070694_100218124 | Ga0070694_1002181241 | 355 |
| 314 | 3300005457 | Ga0070662_100039239 | Ga0070662_1000392392 | 355 |
| 315 | 3300005459 | Ga0068867_100003802 | Ga0068867_1000038025 | 355 |
| 316 | 3300005459 | Ga0068867_100012758 | Ga0068867_1000127585 | 355 |
| 317 | 3300005530 | Ga0070679_100017671 | Ga0070679_1000176714 | 355 |
| 318 | 3300005530 | Ga0070679_100119369 | Ga0070679_1001193693 | 355 |
| 319 | 3300005543 | Ga0070672_100009136 | Ga0070672_1000091366 | 355 |
| 320 | 3300005543 | Ga0070672_100020750 | Ga0070672_1000207503 | 355 |
| 321 | 3300005545 | Ga0070695_100004446 | Ga0070695_1000044468 | 355 |
| 322 | 3300005545 | Ga0070695_100009911 | Ga0070695_1000099113 | 355 |
| 323 | 3300005546 | Ga0070696_100008204 | Ga0070696_1000082044 | 355 |
| 324 | 3300005547 | Ga0070693_100001832 | Ga0070693_1000018327 | 355 |
| 325 | 3300005547 | Ga0070693_100047719 | Ga0070693_1000477192 | 355 |
| 326 | 3300005547 | Ga0070693_100128084 | Ga0070693_1001280842 | 355 |
| 327 | 3300005549 | Ga0070704_100029590 | Ga0070704_1000295904 | 355 |
| 328 | 3300005563 | Ga0068855_100193266 | Ga0068855_1001932662 | 355 |
| 329 | 3300005577 | Ga0068857_100000202 | Ga0068857_10000020221 | 355 |
| 330 | 3300005577 | Ga0068857_100087774 | Ga0068857_1000877742 | 355 |
| 331 | 3300005615 | Ga0070702_100005406 | Ga0070702_1000054066 | 355 |
| 332 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001677 | 355 |
| 333 | 3300005618 | Ga0068864_100050941 | Ga0068864_1000509411 | 355 |
| 334 | 3300005843 | Ga0068860_100015622 | Ga0068860_1000156225 | 355 |
| 335 | 3300005844 | Ga0068862_100009539 | Ga0068862_1000095395 | 355 |
| 336 | 3300005937 | Ga0081455_10001563 | Ga0081455_100015637 | 355 |
| 337 | 3300005937 | Ga0081455_10091056 | Ga0081455_100910563 | 355 |
| 338 | 3300006194 | Ga0075427_10001751 | Ga0075427_100017512 | 355 |
| 339 | 3300006237 | Ga0097621_100039789 | Ga0097621_1000397895 | 355 |
| 340 | 3300006844 | Ga0075428_100031193 | Ga0075428_1000311933 | 355 |
| 341 | 3300006844 | Ga0075428_100061051 | Ga0075428_1000610513 | 355 |
| 342 | 3300006846 | Ga0075430_100019455 | Ga0075430_1000194555 | 355 |
| 343 | 3300006847 | Ga0075431_100052886 | Ga0075431_1000528863 | 355 |
| 344 | 3300006852 | Ga0075433_10001199 | Ga0075433_100011999 | 355 |
| 345 | 3300006852 | Ga0075433_10304420 | Ga0075433_103044202 | 355 |
| 346 | 3300006871 | Ga0075434_100013393 | Ga0075434_1000133937 | 355 |
| 347 | 3300006880 | Ga0075429_100021754 | Ga0075429_1000217546 | 355 |
| 348 | 3300006880 | Ga0075429_100037148 | Ga0075429_1000371483 | 355 |
| 349 | 3300006881 | Ga0068865_100011657 | Ga0068865_1000116576 | 355 |
| 350 | 3300006881 | Ga0068865_100194332 | Ga0068865_1001943321 | 355 |
| 351 | 3300006914 | Ga0075436_100001494 | Ga0075436_10000149411 | 355 |
| 352 | 3300007076 | Ga0075435_100001664 | Ga0075435_1000016648 | 355 |
| 353 | 3300007076 | Ga0075435_100027360 | Ga0075435_1000273602 | 355 |
| 354 | 3300009093 | Ga0105240_10404324 | Ga0105240_104043242 | 355 |
| 355 | 3300009094 | Ga0111539_10017218 | Ga0111539_100172185 | 355 |
| 356 | 3300009147 | Ga0114129_10067799 | Ga0114129_100677992 | 355 |
| 357 | 3300009174 | Ga0105241_10013723 | Ga0105241_100137234 | 355 |
| 358 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002570 | 355 |
| 359 | 3300009545 | Ga0105237_10064979 | Ga0105237_100649792 | 355 |
| 360 | 3300009551 | Ga0105238_10069303 | Ga0105238_100693033 | 355 |
| 361 | 3300010375 | Ga0105239_10038118 | Ga0105239_100381182 | 355 |
| 362 | 3300011119 | Ga0105246_10007597 | Ga0105246_100075974 | 355 |
| 363 | 3300012473 | Ga0157340_1000098 | Ga0157340_10000981 | 355 |
| 364 | 3300012475 | Ga0157317_1000264 | Ga0157317_10002643 | 355 |
| 365 | 3300012481 | Ga0157320_1000028 | Ga0157320_10000283 | 355 |
| 366 | 3300012485 | Ga0157325_1000443 | Ga0157325_10004431 | 355 |
| 367 | 3300012492 | Ga0157335_1000211 | Ga0157335_10002112 | 355 |
| 368 | 3300012495 | Ga0157323_1000034 | Ga0157323_10000342 | 355 |
| 369 | 3300012498 | Ga0157345_1000325 | Ga0157345_10003256 | 355 |
| 370 | 3300012505 | Ga0157339_1000142 | Ga0157339_10001423 | 355 |
| 371 | 3300012507 | Ga0157342_1001355 | Ga0157342_10013552 | 355 |
| 372 | 3300012508 | Ga0157315_1000364 | Ga0157315_10003642 | 355 |
| 373 | 3300012513 | Ga0157326_1000169 | Ga0157326_10001699 | 355 |
| 374 | 3300012515 | Ga0157338_1000083 | Ga0157338_10000833 | 355 |
| 375 | 3300013102 | Ga0157371_10010875 | Ga0157371_100108756 | 355 |
| 376 | 3300013296 | Ga0157374_10008870 | Ga0157374_100088706 | 355 |
| 377 | 3300013297 | Ga0157378_10002128 | Ga0157378_1000212818 | 355 |
| 378 | 3300013307 | Ga0157372_10004085 | Ga0157372_1000408510 | 355 |
| 379 | 3300013307 | Ga0157372_10406229 | Ga0157372_104062292 | 355 |
| 380 | 3300014326 | Ga0157380_10019720 | Ga0157380_100197202 | 355 |
| 381 | 3300014326 | Ga0157380_10136915 | Ga0157380_101369152 | 355 |
| 382 | 3300017792 | Ga0163161_10090452 | Ga0163161_100904521 | 355 |
| 383 | 3300025294 | Ga0209025_1000043 | Ga0209025_1000043305 | 355 |
| 384 | 3300025315 | Ga0207697_10006971 | Ga0207697_100069714 | 355 |
| 385 | 3300025901 | Ga0207688_10000774 | Ga0207688_100007745 | 355 |
| 386 | 3300025901 | Ga0207688_10018685 | Ga0207688_100186852 | 355 |
| 387 | 3300025904 | Ga0207647_10000815 | Ga0207647_1000081520 | 355 |
| 388 | 3300025904 | Ga0207647_10009414 | Ga0207647_100094146 | 355 |
| 389 | 3300025907 | Ga0207645_10000612 | Ga0207645_1000061215 | 355 |
| 390 | 3300025908 | Ga0207643_10000173 | Ga0207643_100001737 | 355 |
| 391 | 3300025908 | Ga0207643_10174993 | Ga0207643_101749932 | 355 |
| 392 | 3300025909 | Ga0207705_10012562 | Ga0207705_100125627 | 355 |
| 393 | 3300025911 | Ga0207654_10008653 | Ga0207654_100086533 | 355 |
| 394 | 3300025912 | Ga0207707_10296908 | Ga0207707_102969081 | 355 |
| 395 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008675 | 355 |
| 396 | 3300025917 | Ga0207660_10001420 | Ga0207660_1000142011 | 355 |
| 397 | 3300025918 | Ga0207662_10016717 | Ga0207662_100167175 | 355 |
| 398 | 3300025919 | Ga0207657_10001623 | Ga0207657_1000162324 | 355 |
| 399 | 3300025921 | Ga0207652_10003166 | Ga0207652_1000316610 | 355 |
| 400 | 3300025923 | Ga0207681_10004468 | Ga0207681_100044686 | 355 |
| 401 | 3300025924 | Ga0207694_10043789 | Ga0207694_100437893 | 355 |
| 402 | 3300025932 | Ga0207690_10032776 | Ga0207690_100327762 | 355 |
| 403 | 3300025933 | Ga0207706_10002726 | Ga0207706_1000272612 | 355 |
| 404 | 3300025933 | Ga0207706_10015147 | Ga0207706_100151473 | 355 |
| 405 | 3300025933 | Ga0207706_10138548 | Ga0207706_101385483 | 355 |
| 406 | 3300025934 | Ga0207686_10154773 | Ga0207686_101547732 | 355 |
| 407 | 3300025938 | Ga0207704_10039841 | Ga0207704_100398413 | 355 |
| 408 | 3300025940 | Ga0207691_10003733 | Ga0207691_1000373314 | 355 |
| 409 | 3300025940 | Ga0207691_10043182 | Ga0207691_100431825 | 355 |
| 410 | 3300025940 | Ga0207691_10044409 | Ga0207691_100444092 | 355 |
| 411 | 3300025942 | Ga0207689_10002546 | Ga0207689_100025465 | 355 |
| 412 | 3300025942 | Ga0207689_10010938 | Ga0207689_100109382 | 355 |
| 413 | 3300025945 | Ga0207679_10119247 | Ga0207679_101192473 | 355 |
| 414 | 3300025961 | Ga0207712_10010121 | Ga0207712_100101213 | 355 |
| 415 | 3300025986 | Ga0207658_10031857 | Ga0207658_100318573 | 355 |
| 416 | 3300026075 | Ga0207708_10000131 | Ga0207708_1000013145 | 355 |
| 417 | 3300026075 | Ga0207708_10010892 | Ga0207708_100108923 | 355 |
| 418 | 3300026089 | Ga0207648_10001723 | Ga0207648_100017235 | 355 |
| 419 | 3300026089 | Ga0207648_10018497 | Ga0207648_100184974 | 355 |
| 420 | 3300026095 | Ga0207676_10054383 | Ga0207676_100543832 | 355 |
| 421 | 3300026116 | Ga0207674_10000866 | Ga0207674_1000086621 | 355 |
| 422 | 3300026116 | Ga0207674_10055650 | Ga0207674_100556502 | 355 |
| 423 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001628 | 355 |
| 424 | 3300027364 | Ga0209967_1000089 | Ga0209967_100008912 | 355 |
| 425 | 3300027378 | Ga0209981_1000714 | Ga0209981_10007144 | 355 |
| 426 | 3300027395 | Ga0209996_1000471 | Ga0209996_10004715 | 355 |
| 427 | 3300027462 | Ga0210000_1000394 | Ga0210000_10003943 | 355 |
| 428 | 3300027471 | Ga0209995_1000026 | Ga0209995_100002616 | 355 |
| 429 | 3300027543 | Ga0209999_1000072 | Ga0209999_100007210 | 355 |
| 430 | 3300027552 | Ga0209982_1000121 | Ga0209982_10001217 | 355 |
| 431 | 3300027614 | Ga0209970_1000189 | Ga0209970_10001896 | 355 |
| 432 | 3300027617 | Ga0210002_1000451 | Ga0210002_10004515 | 355 |
| 433 | 3300027682 | Ga0209971_1001594 | Ga0209971_10015945 | 355 |
| 434 | 3300027695 | Ga0209966_1000473 | Ga0209966_100047311 | 355 |
| 435 | 3300027876 | Ga0209974_10005170 | Ga0209974_100051704 | 355 |
| 436 | 3300027907 | Ga0207428_10000363 | Ga0207428_1000036324 | 355 |
| 437 | 3300027907 | Ga0207428_10000499 | Ga0207428_1000049941 | 355 |
| 438 | 3300027907 | Ga0207428_10004175 | Ga0207428_1000417516 | 355 |
| 439 | 3300028380 | Ga0268265_10028394 | Ga0268265_100283942 | 355 |
| 440 | 3300028800 | Ga0265338_10013602 | Ga0265338_100136026 | 355 |
| 441 | 3300028800 | Ga0265338_10080128 | Ga0265338_100801282 | 355 |
| 442 | 3300035114 | Ga0373939_0009240 | Ga0373939_0009240_657_1841 | 355 |
| 443 | 3300035242 | Ga0373962_0004103 | Ga0373962_0004103_93_1277 | 355 |
| 444 | 3300042008 | Ga0439450_015473 | Ga0439450_015473_121_1314 | 355 |
| 445 | 3300042011 | Ga0439454_000032 | Ga0439454_000032_698_1891 | 355 |
| 446 | 3300042013 | Ga0439456_008594 | Ga0439456_008594_622_1815 | 355 |
| 447 | 3300042016 | Ga0439463_000765 | Ga0439463_000765_628_1821 | 355 |
| 448 | 3300042156 | Ga0439446_0021049 | Ga0439446_0021049_176_1372 | 355 |
| 449 | 3300042437 | Ga0439444_0000025 | Ga0439444_0000025_2498_3691 | 355 |
| 450 | 3300042439 | Ga0439464_0000769 | Ga0439464_0000769_2888_4081 | 355 |
| 451 | 3300042461 | Ga0439460_0002486 | Ga0439460_0002486_3100_4293 | 355 |
| 452 | 3300042876 | Ga0451577_0045908 | Ga0451577_0045908_1308_2492 | 355 |
| 453 | 3300042993 | Ga0439440_0002803 | Ga0439440_0002803_350_1549 | 355 |
| 454 | 3300042993 | Ga0439440_0008586 | Ga0439440_0008586_237_1430 | 355 |
| 455 | 3300042993 | Ga0439440_0027586 | Ga0439440_0027586_97_1281 | 355 |
| 456 | 3300045051 | Ga0451576_0015887 | Ga0451576_0015887_5132_6316 | 355 |
| 457 | 3300048903 | Ga0496100_0101817 | Ga0496100_0101817_469_1653 | 355 |
| 458 | 3300048905 | Ga0496102_0005400 | Ga0496102_0005400_3507_4691 | 355 |
| 459 | 3300048910 | Ga0496107_0035808 | Ga0496107_0035808_1715_2899 | 355 |
| 460 | 3300049568 | Ga0501031_0017408 | Ga0501031_0017408_485_1681 | 355 |
| 461 | 3300049572 | Ga0501036_0001043 | Ga0501036_0001043_17221_18414 | 355 |
| 462 | 3300049575 | Ga0501039_0003061 | Ga0501039_0003061_7180_8373 | 355 |
| 463 | 3300049575 | Ga0501039_0073825 | Ga0501039_0073825_806_2002 | 355 |
| 464 | 3300049576 | Ga0501040_0013555 | Ga0501040_0013555_1546_2739 | 355 |
| 465 | 3300049576 | Ga0501040_0057152 | Ga0501040_0057152_1052_2248 | 355 |
| 466 | 3300049577 | Ga0501041_0000144 | Ga0501041_0000144_4408_5601 | 355 |
| 467 | 3300049577 | Ga0501041_0024012 | Ga0501041_0024012_1647_2843 | 355 |
| 468 | 3300049578 | Ga0501042_0152935 | Ga0501042_0152935_35_1231 | 355 |
| 469 | 3300049582 | Ga0501048_0007809 | Ga0501048_0007809_3506_4702 | 355 |
| 470 | 3300049582 | Ga0501048_0116063 | Ga0501048_0116063_140_1333 | 355 |
| 471 | 3300049587 | Ga0501071_0000772 | Ga0501071_0000772_988_2181 | 355 |
| 472 | 3300049588 | Ga0501072_0001871 | Ga0501072_0001871_13498_14691 | 355 |
| 473 | 3300049591 | Ga0501075_0000617 | Ga0501075_0000617_6807_8000 | 355 |
| 474 | 3300049591 | Ga0501075_0076397 | Ga0501075_0076397_93_1289 | 355 |
| 475 | 3300049592 | Ga0501076_0000085 | Ga0501076_0000085_12444_13637 | 355 |
| 476 | 3300049592 | Ga0501076_0008106 | Ga0501076_0008106_3047_4243 | 355 |
| 477 | 3300049592 | Ga0501076_0062357 | Ga0501076_0062357_35_1231 | 355 |
| 478 | 3300049593 | Ga0501077_0004394 | Ga0501077_0004394_2220_3413 | 355 |
| 479 | 3300049741 | Ga0501079_0031309 | Ga0501079_0031309_2590_3783 | 355 |
| 480 | 3300049741 | Ga0501079_0046665 | Ga0501079_0046665_945_2141 | 355 |
| 481 | 3300049741 | Ga0501079_0134653 | Ga0501079_0134653_298_1482 | 355 |
| 482 | 3300049742 | Ga0501080_0006827 | Ga0501080_0006827_4077_5273 | 355 |
| 483 | 3300049743 | Ga0501081_0000813 | Ga0501081_0000813_4942_6135 | 355 |
| 484 | 3300049743 | Ga0501081_0058623 | Ga0501081_0058623_806_2002 | 355 |
| 485 | 3300049824 | Ga0501045_0005143 | Ga0501045_0005143_7274_8467 | 355 |
| 486 | 3300050491 | nmdc:mga00v17_19984_c1 | nmdc:mga00v17_19984_c1_421_1554 | 355 |
| 487 | 3300050507 | nmdc:mga05p37_87590_c1 | nmdc:mga05p37_87590_c1_1179_2378 | 355 |
| 488 | 3300050507 | nmdc:mga05p37_9333_c1 | nmdc:mga05p37_9333_c1_6672_7856 | 355 |
| 489 | 3300050508 | nmdc:mga09592_26389_c1 | nmdc:mga09592_26389_c1_1386_2579 | 355 |
| 490 | 3300050508 | nmdc:mga09592_4347_c1 | nmdc:mga09592_4347_c1_2661_3860 | 355 |
| 491 | 3300050508 | nmdc:mga09592_77020_c1 | nmdc:mga09592_77020_c1_649_1833 | 355 |
| 492 | 3300050508 | nmdc:mga09592_91436_c1 | nmdc:mga09592_91436_c1_446_1630 | 355 |
| 493 | 3300050509 | nmdc:mga0qj67_118804_c1 | nmdc:mga0qj67_118804_c1_748_1941 | 355 |
| 494 | 3300050509 | nmdc:mga0qj67_162225_c1 | nmdc:mga0qj67_162225_c1_14_1198 | 355 |
| 495 | 3300050510 | nmdc:mga06r32_8751_c1 | nmdc:mga06r32_8751_c1_7286_8470 | 355 |
| 496 | 3300050511 | nmdc:mga08y16_119701_c1 | nmdc:mga08y16_119701_c1_650_1834 | 355 |
| 497 | 3300050511 | nmdc:mga08y16_2858_c1 | nmdc:mga08y16_2858_c1_2694_3893 | 355 |
| 498 | 3300050511 | nmdc:mga08y16_4552_c1 | nmdc:mga08y16_4552_c1_5143_6327 | 355 |
| 499 | 3300050511 | nmdc:mga08y16_85361_c1 | nmdc:mga08y16_85361_c1_1366_2559 | 355 |
| 500 | 3300050512 | nmdc:mga0n895_155450_c1 | nmdc:mga0n895_155450_c1_124_1308 | 355 |
| 501 | 3300050512 | nmdc:mga0n895_287948_c1 | nmdc:mga0n895_287948_c1_465_1649 | 355 |
| 502 | 3300050512 | nmdc:mga0n895_75_c1 | nmdc:mga0n895_75_c1_15960_17144 | 355 |
| 503 | 3300050513 | nmdc:mga0rr50_7249_c1 | nmdc:mga0rr50_7249_c1_3948_5132 | 355 |
| 504 | 3300050514 | nmdc:mga08x19_848_c1 | nmdc:mga08x19_848_c1_4254_5438 | 355 |
| 505 | 3300050515 | nmdc:mga0a205_352601_c1 | nmdc:mga0a205_352601_c1_37_1221 | 355 |
| 506 | 3300050515 | nmdc:mga0a205_8161_c1 | nmdc:mga0a205_8161_c1_4076_5260 | 355 |
| 507 | 3300054114 | Ga0501084_0010109 | Ga0501084_0010109_2044_3237 | 355 |
| 508 | 3300054114 | Ga0501084_0014674 | Ga0501084_0014674_811_2007 | 355 |
| 509 | 3300054114 | Ga0501084_0032036 | Ga0501084_0032036_1738_2919 | 355 |
| 510 | 3300060353 | Ga0501082_0000374 | Ga0501082_0000374_19032_20225 | 355 |
| 511 | 3300061734 | Ga0530510_0003739 | Ga0530510_0003739_988_2181 | 355 |
| 512 | 3300061734 | Ga0530510_0017902 | Ga0530510_0017902_2197_3393 | 355 |
| 513 | iso_pu_bacteria | 2738543017 | 2739271253 | 355 |
| 514 | iso_pu_bacteria | 2757320391 | 2757567746 | 355 |
| 515 | iso_pu_bacteria | 2775507192 | 2777837994 | 355 |
| 516 | iso_pu_bacteria | 2808606364 | 2808871439 | 355 |
| 517 | iso_pu_bacteria | 2842805378 | 2842807646 | 355 |
| 518 | iso_pu_bacteria | 2857586860 | 2857590219 | 355 |
| 519 | iso_pu_bacteria | 2936340661 | 2936345374 | 355 |
| 520 | iso_pu_bacteria | 3006826541 | 3006831205 | 355 |
| 521 | 3300003187 | JGI25151J46595_10032883 | JGI25151J46595_100328832 | 356 |
| 522 | 3300009036 | Ga0105244_10074858 | Ga0105244_100748582 | 356 |
| 523 | 3300025229 | Ga0209147_101522 | Ga0209147_1015224 | 356 |
| 524 | 3300025284 | Ga0209130_1005357 | Ga0209130_10053573 | 356 |
| 525 | 3300025294 | Ga0209025_1001401 | Ga0209025_10014014 | 356 |
| 526 | 3300025294 | Ga0209025_1016363 | Ga0209025_10163633 | 356 |
| 527 | 3300025294 | Ga0209025_1016783 | Ga0209025_10167834 | 356 |
| 528 | 3300025294 | Ga0209025_1032565 | Ga0209025_10325653 | 356 |
| 529 | 3300025711 | Ga0207696_1027305 | Ga0207696_10273052 | 356 |
| 530 | 3300025728 | Ga0207655_1020062 | Ga0207655_10200622 | 356 |
| 531 | 3300030083 | Ga0237817_10467 | Ga0237817_104676 | 356 |
| 532 | 3300032002 | Ga0307416_100032296 | Ga0307416_1000322964 | 356 |
| 533 | 3300038705 | Ga0237819_01945 | Ga0237819_01945_2433_3584 | 356 |
| 534 | 3300038705 | Ga0237819_02348 | Ga0237819_02348_1392_2543 | 356 |
| 535 | 3300045976 | Ga0466967_0020054 | Ga0466967_0020054_2853_4004 | 356 |
| 536 | 3300048913 | Ga0496110_0000254 | Ga0496110_0000254_1676_2836 | 356 |
| 537 | 3300048913 | Ga0496110_0120635 | Ga0496110_0120635_852_2003 | 356 |
| 538 | iso_pu_bacteria | 2510065053 | 2510282657 | 356 |
| 539 | iso_pu_bacteria | 2510065055 | 2510295311 | 356 |
| 540 | iso_pu_bacteria | 2510065058 | 2510311063 | 356 |
| 541 | iso_pu_bacteria | 2511231004 | 2511253529 | 356 |
| 542 | iso_pu_bacteria | 2511231006 | 2511266971 | 356 |
| 543 | iso_pu_bacteria | 2511231007 | 2511269894 | 356 |
| 544 | iso_pu_bacteria | 2511231008 | 2511275283 | 356 |
| 545 | iso_pu_bacteria | 2511231010 | 2511289812 | 356 |
| 546 | iso_pu_bacteria | 2511231011 | 2511294314 | 356 |
| 547 | iso_pu_bacteria | 2511231012 | 2511300107 | 356 |
| 548 | iso_pu_bacteria | 2511231014 | 2511317022 | 356 |
| 549 | iso_pu_bacteria | 2511231015 | 2511318899 | 356 |
| 550 | iso_pu_bacteria | 2511231016 | 2511325134 | 356 |
| 551 | iso_pu_bacteria | 2511231017 | 2511332128 | 356 |
| 552 | iso_pu_bacteria | 2511231018 | 2511339230 | 356 |
| 553 | iso_pu_bacteria | 2511231019 | 2511343215 | 356 |
| 554 | iso_pu_bacteria | 2511231020 | 2511347902 | 356 |
| 555 | iso_pu_bacteria | 2511231021 | 2511359072 | 356 |
| 556 | iso_pu_bacteria | 2511231022 | 2511364317 | 356 |
| 557 | iso_pu_bacteria | 2511231023 | 2511367434 | 356 |
| 558 | iso_pu_bacteria | 2511231024 | 2511376590 | 356 |
| 559 | iso_pu_bacteria | 2511231031 | 2511416433 | 356 |
| 560 | iso_pu_bacteria | 2511231156 | 2511822084 | 356 |
| 561 | iso_pu_bacteria | 2512047018 | 2512326483 | 356 |
| 562 | iso_pu_bacteria | 2551306519 | 2553396048 | 356 |
| 563 | iso_pu_bacteria | 2554235132 | 2554818545 | 356 |
| 564 | iso_pu_bacteria | 2554235231 | 2555246466 | 356 |
| 565 | iso_pu_bacteria | 2554235341 | 2555673030 | 356 |
| 566 | iso_pu_bacteria | 2554235469 | 2556065507 | 356 |
| 567 | iso_pu_bacteria | 2582580891 | 2583795532 | 356 |
| 568 | iso_pu_bacteria | 2597489887 | 2597861085 | 356 |
| 569 | iso_pu_bacteria | 2597489888 | 2597866819 | 356 |
| 570 | iso_pu_bacteria | 2597489889 | 2597872677 | 356 |
| 571 | iso_pu_bacteria | 2599185155 | 2599327913 | 356 |
| 572 | iso_pu_bacteria | 2599185160 | 2599355765 | 356 |
| 573 | iso_pu_bacteria | 2599185161 | 2599362833 | 356 |
| 574 | iso_pu_bacteria | 2599185162 | 2599368861 | 356 |
| 575 | iso_pu_bacteria | 2599185163 | 2599375942 | 356 |
| 576 | iso_pu_bacteria | 2599185164 | 2599380871 | 356 |
| 577 | iso_pu_bacteria | 2599185165 | 2599387613 | 356 |
| 578 | iso_pu_bacteria | 2599185166 | 2599394800 | 356 |
| 579 | iso_pu_bacteria | 2599185167 | 2599400984 | 356 |
| 580 | iso_pu_bacteria | 2599185168 | 2599406565 | 356 |
| 581 | iso_pu_bacteria | 2599185179 | 2599449671 | 356 |
| 582 | iso_pu_bacteria | 2599185181 | 2599462599 | 356 |
| 583 | iso_pu_bacteria | 2599185182 | 2599467979 | 356 |
| 584 | iso_pu_bacteria | 2599185185 | 2599487208 | 356 |
| 585 | iso_pu_bacteria | 2599185186 | 2599491616 | 356 |
| 586 | iso_pu_bacteria | 2599185188 | 2599503663 | 356 |
| 587 | iso_pu_bacteria | 2599185189 | 2599505936 | 356 |
| 588 | iso_pu_bacteria | 2599185190 | 2599511743 | 356 |
| 589 | iso_pu_bacteria | 2599185191 | 2599516729 | 356 |
| 590 | iso_pu_bacteria | 2599185212 | 2599616115 | 356 |
| 591 | iso_pu_bacteria | 2599185248 | 2599767730 | 356 |
| 592 | iso_pu_bacteria | 2599185257 | 2599804466 | 356 |
| 593 | iso_pu_bacteria | 2599185288 | 2599879225 | 356 |
| 594 | iso_pu_bacteria | 2599185289 | 2599887956 | 356 |
| 595 | iso_pu_bacteria | 2599185290 | 2599893246 | 356 |
| 596 | iso_pu_bacteria | 2599185291 | 2599899353 | 356 |
| 597 | iso_pu_bacteria | 2599185300 | 2599933092 | 356 |
| 598 | iso_pu_bacteria | 2599185302 | 2599942158 | 356 |
| 599 | iso_pu_bacteria | 2599185303 | 2599948827 | 356 |
| 600 | iso_pu_bacteria | 2599185304 | 2599955138 | 356 |
| 601 | iso_pu_bacteria | 2599185305 | 2599963683 | 356 |
| 602 | iso_pu_bacteria | 2599185306 | 2599968744 | 356 |
| 603 | iso_pu_bacteria | 2599185307 | 2599972032 | 356 |
| 604 | iso_pu_bacteria | 2599185308 | 2599979887 | 356 |
| 605 | iso_pu_bacteria | 2599185309 | 2599984470 | 356 |
| 606 | iso_pu_bacteria | 2599185310 | 2599990749 | 356 |
| 607 | iso_pu_bacteria | 2599185311 | 2599997255 | 356 |
| 608 | iso_pu_bacteria | 2599185312 | 2600000672 | 356 |
| 609 | iso_pu_bacteria | 2599185313 | 2600007415 | 356 |
| 610 | iso_pu_bacteria | 2599185314 | 2600013706 | 356 |
| 611 | iso_pu_bacteria | 2599185315 | 2600021298 | 356 |
| 612 | iso_pu_bacteria | 2599185316 | 2600026780 | 356 |
| 613 | iso_pu_bacteria | 2599185317 | 2600032257 | 356 |
| 614 | iso_pu_bacteria | 2599185318 | 2600038594 | 356 |
| 615 | iso_pu_bacteria | 2599185319 | 2600043995 | 356 |
| 616 | iso_pu_bacteria | 2599185320 | 2600049733 | 356 |
| 617 | iso_pu_bacteria | 2599185321 | 2600056370 | 356 |
| 618 | iso_pu_bacteria | 2599185322 | 2600062441 | 356 |
| 619 | iso_pu_bacteria | 2599185323 | 2600065249 | 356 |
| 620 | iso_pu_bacteria | 2599185324 | 2600074327 | 356 |
| 621 | iso_pu_bacteria | 2599185325 | 2600080455 | 356 |
| 622 | iso_pu_bacteria | 2599185356 | 2600215223 | 356 |
| 623 | iso_pu_bacteria | 2600254930 | 2600361617 | 356 |
| 624 | iso_pu_bacteria | 2600254931 | 2600363352 | 356 |
| 625 | iso_pu_bacteria | 2600254954 | 2600444355 | 356 |
| 626 | iso_pu_bacteria | 2600255283 | 2601627607 | 356 |
| 627 | iso_pu_bacteria | 2600255296 | 2601693181 | 356 |
| 628 | iso_pu_bacteria | 2600255313 | 2601775389 | 356 |
| 629 | iso_pu_bacteria | 2600255318 | 2601798346 | 356 |
| 630 | iso_pu_bacteria | 2600255389 | 2602008166 | 356 |
| 631 | iso_pu_bacteria | 2603880185 | 2606077240 | 356 |
| 632 | iso_pu_bacteria | 2603880199 | 2606129514 | 356 |
| 633 | iso_pu_bacteria | 2606217733 | 2608384211 | 356 |
| 634 | iso_pu_bacteria | 2619619299 | 2621296655 | 356 |
| 635 | iso_pu_bacteria | 2623620443 | 2624483620 | 356 |
| 636 | iso_pu_bacteria | 2623620446 | 2624495198 | 356 |
| 637 | iso_pu_bacteria | 2643221565 | 2643843293 | 356 |
| 638 | iso_pu_bacteria | 2643221571 | 2643873404 | 356 |
| 639 | iso_pu_bacteria | 2643221589 | 2643956143 | 356 |
| 640 | iso_pu_bacteria | 2643221602 | 2644020265 | 356 |
| 641 | iso_pu_bacteria | 2643221633 | 2644184276 | 356 |
| 642 | iso_pu_bacteria | 2643221650 | 2644282803 | 356 |
| 643 | iso_pu_bacteria | 2643221713 | 2644621236 | 356 |
| 644 | iso_pu_bacteria | 2643221729 | 2644703706 | 356 |
| 645 | iso_pu_bacteria | 2643221730 | 2644712721 | 356 |
| 646 | iso_pu_bacteria | 2651869719 | 2652548806 | 356 |
| 647 | iso_pu_bacteria | 2667528170 | 2671091857 | 356 |
| 648 | iso_pu_bacteria | 2667528171 | 2671099474 | 356 |
| 649 | iso_pu_bacteria | 2667528176 | 2671129566 | 356 |
| 650 | iso_pu_bacteria | 2671180172 | 2671771474 | 356 |
| 651 | iso_pu_bacteria | 2675903420 | 2677900561 | 356 |
| 652 | iso_pu_bacteria | 2675903515 | 2678266564 | 356 |
| 653 | iso_pu_bacteria | 2684622632 | 2685148245 | 356 |
| 654 | iso_pu_bacteria | 2695420987 | 2698319483 | 356 |
| 655 | iso_pu_bacteria | 2695420987 | 2698324915 | 356 |
| 656 | iso_pu_bacteria | 2703719227 | 2705992182 | 356 |
| 657 | iso_pu_bacteria | 2711768088 | 2712197965 | 356 |
| 658 | iso_pu_bacteria | 2713897148 | 2715749625 | 356 |
| 659 | iso_pu_bacteria | 2713897149 | 2715754635 | 356 |
| 660 | iso_pu_bacteria | 2718217725 | 2718636817 | 356 |
| 661 | iso_pu_bacteria | 2718218445 | 2721503625 | 356 |
| 662 | iso_pu_bacteria | 2721755607 | 2723251550 | 356 |
| 663 | iso_pu_bacteria | 2728369097 | 2729148436 | 356 |
| 664 | iso_pu_bacteria | 2738541265 | 2738673590 | 356 |
| 665 | iso_pu_bacteria | 2738541271 | 2738690508 | 356 |
| 666 | iso_pu_bacteria | 2738541282 | 2738751983 | 356 |
| 667 | iso_pu_bacteria | 2738541294 | 2738807443 | 356 |
| 668 | iso_pu_bacteria | 2738541303 | 2738861024 | 356 |
| 669 | iso_pu_bacteria | 2738541309 | 2738894803 | 356 |
| 670 | iso_pu_bacteria | 2738541358 | 2739158725 | 356 |
| 671 | iso_pu_bacteria | 2738543004 | 2739201061 | 356 |
| 672 | iso_pu_bacteria | 2738543006 | 2739211563 | 356 |
| 673 | iso_pu_bacteria | 2738543015 | 2739260576 | 356 |
| 674 | iso_pu_bacteria | 2738543016 | 2739266282 | 356 |
| 675 | iso_pu_bacteria | 2738543020 | 2739285931 | 356 |
| 676 | iso_pu_bacteria | 2738543021 | 2739291244 | 356 |
| 677 | iso_pu_bacteria | 2738543025 | 2739312292 | 356 |
| 678 | iso_pu_bacteria | 2740892503 | 2743740624 | 356 |
| 679 | iso_pu_bacteria | 2744054620 | 2745007794 | 356 |
| 680 | iso_pu_bacteria | 2765235841 | 2765586736 | 356 |
| 681 | iso_pu_bacteria | 2773857670 | 2774118147 | 356 |
| 682 | iso_pu_bacteria | 2773857672 | 2774129144 | 356 |
| 683 | iso_pu_bacteria | 2773857673 | 2774136394 | 356 |
| 684 | iso_pu_bacteria | 2784132063 | 2784261610 | 356 |
| 685 | iso_pu_bacteria | 2784132072 | 2784316915 | 356 |
| 686 | iso_pu_bacteria | 2791355520 | 2794598973 | 356 |
| 687 | iso_pu_bacteria | 2806310737 | 2807410930 | 356 |
| 688 | iso_pu_bacteria | 2806310745 | 2807459271 | 356 |
| 689 | iso_pu_bacteria | 2808606361 | 2808856658 | 356 |
| 690 | iso_pu_bacteria | 2808606373 | 2808906097 | 356 |
| 691 | iso_pu_bacteria | 2808606376 | 2808925808 | 356 |
| 692 | iso_pu_bacteria | 2808606377 | 2808928239 | 356 |
| 693 | iso_pu_bacteria | 2808606378 | 2808936624 | 356 |
| 694 | iso_pu_bacteria | 2808606379 | 2808940233 | 356 |
| 695 | iso_pu_bacteria | 2808606380 | 2808947951 | 356 |
| 696 | iso_pu_bacteria | 2808606381 | 2808950579 | 356 |
| 697 | iso_pu_bacteria | 2808606382 | 2808961430 | 356 |
| 698 | iso_pu_bacteria | 2808606383 | 2808965083 | 356 |
| 699 | iso_pu_bacteria | 2808606385 | 2808976346 | 356 |
| 700 | iso_pu_bacteria | 2808606388 | 2808994194 | 356 |
| 701 | iso_pu_bacteria | 2808606389 | 2808999975 | 356 |
| 702 | iso_pu_bacteria | 2808606445 | 2809217430 | 356 |
| 703 | iso_pu_bacteria | 2811994881 | 2812369878 | 356 |
| 704 | iso_pu_bacteria | 2816332186 | 2816866139 | 356 |
| 705 | iso_pu_bacteria | 2816332298 | 2817494232 | 356 |
| 706 | iso_pu_bacteria | 2818991441 | 2819568248 | 356 |
| 707 | iso_pu_bacteria | 2818991443 | 2819584932 | 356 |
| 708 | iso_pu_bacteria | 2818991456 | 2819655338 | 356 |
| 709 | iso_pu_bacteria | 2818991464 | 2819704620 | 356 |
| 710 | iso_pu_bacteria | 2823421272 | 2823426009 | 356 |
| 711 | iso_pu_bacteria | 2825651385 | 2825654646 | 356 |
| 712 | iso_pu_bacteria | 2826581358 | 2826581624 | 356 |
| 713 | iso_pu_bacteria | 2834028612 | 2834031139 | 356 |
| 714 | iso_pu_bacteria | 2842682962 | 2842686229 | 356 |
| 715 | iso_pu_bacteria | 2842815866 | 2842817193 | 356 |
| 716 | iso_pu_bacteria | 2842826826 | 2842828583 | 356 |
| 717 | iso_pu_bacteria | 2842832357 | 2842833665 | 356 |
| 718 | iso_pu_bacteria | 2842837860 | 2842838083 | 356 |
| 719 | iso_pu_bacteria | 2842843487 | 2842845897 | 356 |
| 720 | iso_pu_bacteria | 2842849001 | 2842851922 | 356 |
| 721 | iso_pu_bacteria | 2842854478 | 2842855824 | 356 |
| 722 | iso_pu_bacteria | 2844665904 | 2844667298 | 356 |
| 723 | iso_pu_bacteria | 2849139964 | 2849141754 | 356 |
| 724 | iso_pu_bacteria | 2852612431 | 2852616541 | 356 |
| 725 | iso_pu_bacteria | 2852657418 | 2852660018 | 356 |
| 726 | iso_pu_bacteria | 2852667396 | 2852671509 | 356 |
| 727 | iso_pu_bacteria | 2857581216 | 2857585391 | 356 |
| 728 | iso_pu_bacteria | 2860339153 | 2860341922 | 356 |
| 729 | iso_pu_bacteria | 2860867994 | 2860873212 | 356 |
| 730 | iso_pu_bacteria | 2878029506 | 2878029624 | 356 |
| 731 | iso_pu_bacteria | 2880230671 | 2880236204 | 356 |
| 732 | iso_pu_bacteria | 2904518522 | 2904518748 | 356 |
| 733 | iso_pu_bacteria | 2904550169 | 2904553510 | 356 |
| 734 | iso_pu_bacteria | 2908446538 | 2908452809 | 356 |
| 735 | iso_pu_bacteria | 2912963787 | 2912969054 | 356 |
| 736 | iso_pu_bacteria | 2913036834 | 2913042751 | 356 |
| 737 | iso_pu_bacteria | 2917070673 | 2917076929 | 356 |
| 738 | iso_pu_bacteria | 2917832318 | 2917833271 | 356 |
| 739 | iso_pu_bacteria | 2919063839 | 2919068170 | 356 |
| 740 | iso_pu_bacteria | 2919125081 | 2919126189 | 356 |
| 741 | iso_pu_bacteria | 2919155634 | 2919156045 | 356 |
| 742 | iso_pu_bacteria | 2919385768 | 2919388986 | 356 |
| 743 | iso_pu_bacteria | 2919456309 | 2919457781 | 356 |
| 744 | iso_pu_bacteria | 2919481497 | 2919487169 | 356 |
| 745 | iso_pu_bacteria | 2919487758 | 2919487915 | 356 |
| 746 | iso_pu_bacteria | 2919501602 | 2919502754 | 356 |
| 747 | iso_pu_bacteria | 2919697872 | 2919702525 | 356 |
| 748 | iso_pu_bacteria | 2923153595 | 2923159720 | 356 |
| 749 | iso_pu_bacteria | 2923519811 | 2923523964 | 356 |
| 750 | iso_pu_bacteria | 2923586266 | 2923589420 | 356 |
| 751 | iso_pu_bacteria | 2926063275 | 2926064427 | 356 |
| 752 | iso_pu_bacteria | 2929144301 | 2929144428 | 356 |
| 753 | iso_pu_bacteria | 2929189879 | 2929195339 | 356 |
| 754 | iso_pu_bacteria | 2929233124 | 2929233485 | 356 |
| 755 | iso_pu_bacteria | 2931369376 | 2931372225 | 356 |
| 756 | iso_pu_bacteria | 2931390751 | 2931390853 | 356 |
| 757 | iso_pu_bacteria | 2931396565 | 2931398319 | 356 |
| 758 | iso_pu_bacteria | 2935353572 | 2935358104 | 356 |
| 759 | iso_pu_bacteria | 2938917290 | 2938917664 | 356 |
| 760 | iso_pu_bacteria | 2939636861 | 2939640635 | 356 |
| 761 | iso_pu_bacteria | 2939651529 | 2939654315 | 356 |
| 762 | iso_pu_bacteria | 2945928738 | 2945930724 | 356 |
| 763 | iso_pu_bacteria | 2945961074 | 2945967059 | 356 |
| 764 | iso_pu_bacteria | 2946006987 | 2946013069 | 356 |
| 765 | iso_pu_bacteria | 2946027586 | 2946028090 | 356 |
| 766 | iso_pu_bacteria | 2947233263 | 2947234618 | 356 |
| 767 | iso_pu_bacteria | 2947426588 | 2947426950 | 356 |
| 768 | iso_pu_bacteria | 2956897341 | 2956902187 | 356 |
| 769 | iso_pu_bacteria | 2965761152 | 2965761580 | 356 |
| 770 | iso_pu_bacteria | 2969304461 | 2969310424 | 356 |
| 771 | iso_pu_bacteria | 2974289157 | 2974293875 | 356 |
| 772 | iso_pu_bacteria | 2974298342 | 2974302412 | 356 |
| 773 | iso_pu_bacteria | 2979083700 | 2979083964 | 356 |
| 774 | iso_pu_bacteria | 2984286254 | 2984286397 | 356 |
| 775 | iso_pu_bacteria | 2984499530 | 2984500035 | 356 |
| 776 | iso_pu_bacteria | 2984504281 | 2984506587 | 356 |
| 777 | iso_pu_bacteria | 2988728565 | 2988731682 | 356 |
| 778 | iso_pu_bacteria | 2990196909 | 2990199852 | 356 |
| 779 | iso_pu_bacteria | 2998139840 | 2998139954 | 356 |
| 780 | iso_pu_bacteria | 3007252601 | 3007255052 | 356 |
| 781 | iso_pu_bacteria | 3007315729 | 3007316365 | 356 |
| 782 | iso_pu_bacteria | 3007395558 | 3007399199 | 356 |
| 783 | iso_pu_bacteria | 3007419365 | 3007419476 | 356 |
| 784 | iso_pu_bacteria | 3007511990 | 3007517380 | 356 |
| 785 | iso_pu_bacteria | 3007614139 | 3007615816 | 356 |
| 786 | iso_pu_bacteria | 3007619802 | 3007622659 | 356 |
| 787 | iso_pu_bacteria | 3007718800 | 3007723078 | 356 |
| 788 | iso_pu_bacteria | 3007803356 | 3007805915 | 356 |
| 789 | iso_pu_bacteria | 3007855910 | 3007859400 | 356 |
| 790 | iso_pu_bacteria | 3007861166 | 3007864891 | 356 |
| 791 | iso_pu_bacteria | 3007866637 | 3007871555 | 356 |
| 792 | iso_pu_bacteria | 3007872151 | 3007873167 | 356 |
| 793 | iso_pu_bacteria | 637000220 | 637323460 | 356 |
| 794 | iso_pu_bacteria | 640427133 | 640486159 | 356 |
| 795 | iso_pu_bacteria | 8011350971 | 8011354540 | 356 |
| 796 | iso_pu_bacteria | 8015687852 | 8015693813 | 356 |
| 797 | iso_pu_bacteria | 8019769354 | 8019769578 | 356 |
| 798 | iso_pu_bacteria | 8019775933 | 8019779747 | 356 |
| 799 | iso_pu_bacteria | 8022792930 | 8022793786 | 356 |
| 800 | iso_pu_bacteria | 8023438354 | 8023438560 | 356 |
| 801 | iso_pu_bacteria | 8023444577 | 8023450112 | 356 |
| 802 | iso_pu_bacteria | 8029995093 | 8029995299 | 356 |
| 803 | iso_pu_bacteria | 8034962539 | 8034965328 | 356 |
| 804 | iso_pu_bacteria | 8052494512 | 8052494688 | 356 |
| 805 | iso_pu_bacteria | 8054285046 | 8054287146 | 356 |
| 806 | iso_pu_bacteria | 8054347763 | 8054349399 | 356 |
| 807 | iso_pu_bacteria | 8054503363 | 8054503460 | 356 |
| 808 | iso_pu_bacteria | 8054929484 | 8054929734 | 356 |
| 809 | iso_pu_bacteria | 8055770955 | 8055777075 | 356 |
| 810 | iso_pu_bacteria | 8055817908 | 8055824097 | 356 |
| 811 | iso_pu_bacteria | 8055878733 | 8055881722 | 356 |
| 812 | iso_pu_bacteria | 8056115690 | 8056116386 | 356 |
| 813 | iso_pu_bacteria | 8056120720 | 8056125845 | 356 |
| 814 | iso_pu_bacteria | 8056125926 | 8056125990 | 356 |
| 815 | iso_pu_bacteria | 8056131705 | 8056131799 | 356 |
| 816 | iso_pu_bacteria | 8056137416 | 8056142964 | 356 |
| 817 | iso_pu_bacteria | 8056143049 | 8056143154 | 356 |
| 818 | iso_pu_bacteria | 8056148874 | 8056151306 | 356 |
| 819 | iso_pu_bacteria | 8056155041 | 8056159952 | 356 |
| 820 | iso_pu_bacteria | 8056161164 | 8056163816 | 356 |
| 821 | iso_pu_bacteria | 8056166840 | 8056171097 | 356 |
| 822 | iso_pu_bacteria | 8056172158 | 8056177219 | 356 |
| 823 | iso_pu_bacteria | 8056177738 | 8056182308 | 356 |
| 824 | iso_pu_bacteria | 8056569372 | 8056570676 | 356 |
| 825 | iso_pu_bacteria | 8057582654 | 8057583006 | 356 |
| 826 | iso_pu_bacteria | 8057632132 | 8057632806 | 356 |
| 827 | iso_pu_bacteria | 8057798959 | 8057802137 | 356 |
| 828 | 3300005435 | Ga0070714_100002598 | Ga0070714_1000025985 | 358 |
| 829 | 3300044694 | Ga0466963_0002599 | Ga0466963_0002599_4168_5328 | 358 |
| 830 | 3300044842 | Ga0466957_0007862 | Ga0466957_0007862_4049_5209 | 358 |
| 831 | 3300045836 | Ga0466958_0002591 | Ga0466958_0002591_4943_6103 | 358 |
| 832 | 3300048927 | Ga0496124_0006802 | Ga0496124_0006802_4455_5531 | 358 |
| 833 | 3300013104 | Ga0157370_10009550 | Ga0157370_100095502 | 359 |
| 834 | 3300028794 | Ga0307515_10017677 | Ga0307515_100176778 | 359 |
| 835 | 3300031456 | Ga0307513_10113714 | Ga0307513_101137141 | 359 |
| 836 | 3300044684 | Ga0466966_0010386 | Ga0466966_0010386_3112_4260 | 359 |
| 837 | 3300046507 | Ga0495606_0001158 | Ga0495606_0001158_22066_23145 | 359 |
| 838 | 3300046519 | Ga0495632_0057560 | Ga0495632_0057560_461_1558 | 359 |
| 839 | 3300046522 | Ga0495643_0002637 | Ga0495643_0002637_9767_10846 | 359 |
| 840 | 3300046694 | Ga0495649_0001815 | Ga0495649_0001815_2255_3334 | 359 |
| 841 | 3300053092 | Ga0500583_0029764 | Ga0500583_0029764_1078_2175 | 359 |
| 842 | 3300053093 | Ga0500651_0108059 | Ga0500651_0108059_588_1685 | 359 |
| 843 | 3300053096 | Ga0500641_0048344 | Ga0500641_0048344_228_1325 | 359 |
| 844 | 3300053156 | Ga0500622_0013825 | Ga0500622_0013825_2745_3842 | 359 |
| 845 | 2124908027 | MRS2a_Contig_41 | MRS2a_00299870 | 360 |
| 846 | 3300001915 | JGI24741J21665_1002517 | JGI24741J21665_10025176 | 360 |
| 847 | 3300002737 | JGI25162J39368_1000082 | JGI25162J39368_100008234 | 360 |
| 848 | 3300002737 | JGI25162J39368_1000282 | JGI25162J39368_100028219 | 360 |
| 849 | 3300002771 | JGI25163J39215_1002227 | JGI25163J39215_10022273 | 360 |
| 850 | 3300002771 | JGI25163J39215_1002252 | JGI25163J39215_10022522 | 360 |
| 851 | 3300002772 | JGI25164J39214_1000058 | JGI25164J39214_100005834 | 360 |
| 852 | 3300002772 | JGI25164J39214_1000212 | JGI25164J39214_100021219 | 360 |
| 853 | 3300003214 | JGI25165J46597_1000154 | JGI25165J46597_100015434 | 360 |
| 854 | 3300003214 | JGI25165J46597_1000383 | JGI25165J46597_100038326 | 360 |
| 855 | 3300003323 | rootH1_10196566 | rootH1_101965663 | 360 |
| 856 | 3300003751 | Ga0055538_1000012 | Ga0055538_1000012200 | 360 |
| 857 | 3300003752 | Ga0055539_1000017 | Ga0055539_1000017200 | 360 |
| 858 | 3300003756 | Ga0055533_1000021 | Ga0055533_1000021200 | 360 |
| 859 | 3300003758 | Ga0055532_1000020 | Ga0055532_100002042 | 360 |
| 860 | 3300003759 | Ga0055525_1000078 | Ga0055525_100007872 | 360 |
| 861 | 3300003781 | Ga0055536_1004543 | Ga0055536_10045431 | 360 |
| 862 | 3300003781 | Ga0055536_1009458 | Ga0055536_10094582 | 360 |
| 863 | 3300003791 | Ga0055530_10005470 | Ga0055530_100054702 | 360 |
| 864 | 3300003791 | Ga0055530_10008701 | Ga0055530_100087012 | 360 |
| 865 | 3300003792 | Ga0055540_1004724 | Ga0055540_10047242 | 360 |
| 866 | 3300003792 | Ga0055540_1007682 | Ga0055540_10076825 | 360 |
| 867 | 3300003792 | Ga0055540_1007709 | Ga0055540_10077092 | 360 |
| 868 | 3300003794 | Ga0055531_10018175 | Ga0055531_100181752 | 360 |
| 869 | 3300003841 | Ga0055541_1000012 | Ga0055541_1000012200 | 360 |
| 870 | 3300003856 | Ga0058692_1002657 | Ga0058692_10026577 | 360 |
| 871 | 3300005288 | Ga0065714_10000267 | Ga0065714_100002672 | 360 |
| 872 | 3300005288 | Ga0065714_10002271 | Ga0065714_1000227132 | 360 |
| 873 | 3300005288 | Ga0065714_10079463 | Ga0065714_100794633 | 360 |
| 874 | 3300005288 | Ga0065714_10092917 | Ga0065714_100929171 | 360 |
| 875 | 3300005288 | Ga0065714_10094068 | Ga0065714_100940683 | 360 |
| 876 | 3300005288 | Ga0065714_10098654 | Ga0065714_100986543 | 360 |
| 877 | 3300005288 | Ga0065714_10115267 | Ga0065714_101152672 | 360 |
| 878 | 3300005289 | Ga0065704_10015230 | Ga0065704_100152302 | 360 |
| 879 | 3300005289 | Ga0065704_10075102 | Ga0065704_100751022 | 360 |
| 880 | 3300005289 | Ga0065704_10109318 | Ga0065704_101093182 | 360 |
| 881 | 3300005290 | Ga0065712_10067981 | Ga0065712_1006798115 | 360 |
| 882 | 3300005331 | Ga0070670_100032384 | Ga0070670_1000323846 | 360 |
| 883 | 3300005331 | Ga0070670_100090345 | Ga0070670_1000903453 | 360 |
| 884 | 3300005344 | Ga0070661_100004654 | Ga0070661_1000046546 | 360 |
| 885 | 3300005353 | Ga0070669_100000186 | Ga0070669_10000018626 | 360 |
| 886 | 3300005353 | Ga0070669_100005487 | Ga0070669_1000054878 | 360 |
| 887 | 3300005366 | Ga0070659_100176840 | Ga0070659_1001768402 | 360 |
| 888 | 3300005539 | Ga0068853_100000102 | Ga0068853_10000010227 | 360 |
| 889 | 3300005548 | Ga0070665_100018309 | Ga0070665_1000183092 | 360 |
| 890 | 3300005548 | Ga0070665_100268266 | Ga0070665_1002682661 | 360 |
| 891 | 3300005564 | Ga0070664_100000292 | Ga0070664_10000029224 | 360 |
| 892 | 3300005564 | Ga0070664_100069489 | Ga0070664_1000694894 | 360 |
| 893 | 3300005834 | Ga0068851_10000039 | Ga0068851_1000003910 | 360 |
| 894 | 3300006058 | Ga0075432_10005388 | Ga0075432_100053881 | 360 |
| 895 | 3300006058 | Ga0075432_10007561 | Ga0075432_100075611 | 360 |
| 896 | 3300006058 | Ga0075432_10011898 | Ga0075432_100118981 | 360 |
| 897 | 3300006058 | Ga0075432_10066334 | Ga0075432_100663341 | 360 |
| 898 | 3300006944 | Ga0099823_1033941 | Ga0099823_10339415 | 360 |
| 899 | 3300006946 | Ga0079104_1000783 | Ga0079104_10007836 | 360 |
| 900 | 3300006946 | Ga0079104_1001850 | Ga0079104_10018509 | 360 |
| 901 | 3300006946 | Ga0079104_1007967 | Ga0079104_10079672 | 360 |
| 902 | 3300006946 | Ga0079104_1025604 | Ga0079104_10256042 | 360 |
| 903 | 3300006948 | Ga0099826_10018325 | Ga0099826_100183253 | 360 |
| 904 | 3300009011 | Ga0105251_10000089 | Ga0105251_100000896 | 360 |
| 905 | 3300009011 | Ga0105251_10000309 | Ga0105251_100003092 | 360 |
| 906 | 3300009011 | Ga0105251_10001733 | Ga0105251_1000173316 | 360 |
| 907 | 3300009011 | Ga0105251_10002983 | Ga0105251_100029839 | 360 |
| 908 | 3300009011 | Ga0105251_10008371 | Ga0105251_100083712 | 360 |
| 909 | 3300009011 | Ga0105251_10008769 | Ga0105251_100087697 | 360 |
| 910 | 3300009011 | Ga0105251_10008839 | Ga0105251_100088396 | 360 |
| 911 | 3300009011 | Ga0105251_10011986 | Ga0105251_100119864 | 360 |
| 912 | 3300009011 | Ga0105251_10016631 | Ga0105251_100166315 | 360 |
| 913 | 3300009011 | Ga0105251_10031611 | Ga0105251_100316113 | 360 |
| 914 | 3300009036 | Ga0105244_10000073 | Ga0105244_1000007336 | 360 |
| 915 | 3300009036 | Ga0105244_10008948 | Ga0105244_100089487 | 360 |
| 916 | 3300009036 | Ga0105244_10019839 | Ga0105244_100198395 | 360 |
| 917 | 3300009036 | Ga0105244_10026498 | Ga0105244_100264983 | 360 |
| 918 | 3300009036 | Ga0105244_10040778 | Ga0105244_100407781 | 360 |
| 919 | 3300009036 | Ga0105244_10053285 | Ga0105244_100532852 | 360 |
| 920 | 3300009036 | Ga0105244_10056111 | Ga0105244_100561112 | 360 |
| 921 | 3300009036 | Ga0105244_10069855 | Ga0105244_100698552 | 360 |
| 922 | 3300009036 | Ga0105244_10081426 | Ga0105244_100814262 | 360 |
| 923 | 3300009036 | Ga0105244_10134339 | Ga0105244_101343392 | 360 |
| 924 | 3300009092 | Ga0105250_10001135 | Ga0105250_1000113511 | 360 |
| 925 | 3300009092 | Ga0105250_10004905 | Ga0105250_100049057 | 360 |
| 926 | 3300009092 | Ga0105250_10012182 | Ga0105250_100121825 | 360 |
| 927 | 3300009092 | Ga0105250_10023887 | Ga0105250_100238873 | 360 |
| 928 | 3300009092 | Ga0105250_10054760 | Ga0105250_100547602 | 360 |
| 929 | 3300009148 | Ga0105243_10005333 | Ga0105243_100053338 | 360 |
| 930 | 3300009148 | Ga0105243_10005730 | Ga0105243_100057305 | 360 |
| 931 | 3300009148 | Ga0105243_10006305 | Ga0105243_100063055 | 360 |
| 932 | 3300009148 | Ga0105243_10013497 | Ga0105243_100134977 | 360 |
| 933 | 3300009148 | Ga0105243_10013630 | Ga0105243_100136301 | 360 |
| 934 | 3300009176 | Ga0105242_10001069 | Ga0105242_100010693 | 360 |
| 935 | 3300009177 | Ga0105248_10006628 | Ga0105248_100066283 | 360 |
| 936 | 3300009545 | Ga0105237_10001100 | Ga0105237_1000110024 | 360 |
| 937 | 3300009553 | Ga0105249_10007620 | Ga0105249_100076203 | 360 |
| 938 | 3300011119 | Ga0105246_10002522 | Ga0105246_100025229 | 360 |
| 939 | 3300011119 | Ga0105246_10006273 | Ga0105246_100062732 | 360 |
| 940 | 3300011119 | Ga0105246_10012251 | Ga0105246_100122513 | 360 |
| 941 | 3300011119 | Ga0105246_10028338 | Ga0105246_100283385 | 360 |
| 942 | 3300011119 | Ga0105246_10061654 | Ga0105246_100616543 | 360 |
| 943 | 3300013100 | Ga0157373_10014293 | Ga0157373_100142937 | 360 |
| 944 | 3300013100 | Ga0157373_10014510 | Ga0157373_100145106 | 360 |
| 945 | 3300013100 | Ga0157373_10015065 | Ga0157373_100150657 | 360 |
| 946 | 3300013100 | Ga0157373_10015661 | Ga0157373_100156616 | 360 |
| 947 | 3300013100 | Ga0157373_10066263 | Ga0157373_100662632 | 360 |
| 948 | 3300013100 | Ga0157373_10226937 | Ga0157373_102269371 | 360 |
| 949 | 3300013102 | Ga0157371_10000109 | Ga0157371_1000010971 | 360 |
| 950 | 3300013102 | Ga0157371_10009858 | Ga0157371_100098583 | 360 |
| 951 | 3300013102 | Ga0157371_10036088 | Ga0157371_100360881 | 360 |
| 952 | 3300013102 | Ga0157371_10132087 | Ga0157371_101320872 | 360 |
| 953 | 3300013104 | Ga0157370_10027707 | Ga0157370_100277072 | 360 |
| 954 | 3300013104 | Ga0157370_10037357 | Ga0157370_100373576 | 360 |
| 955 | 3300013104 | Ga0157370_10039769 | Ga0157370_100397694 | 360 |
| 956 | 3300013104 | Ga0157370_10215823 | Ga0157370_102158231 | 360 |
| 957 | 3300013105 | Ga0157369_10001968 | Ga0157369_1000196819 | 360 |
| 958 | 3300013105 | Ga0157369_10028227 | Ga0157369_100282272 | 360 |
| 959 | 3300013105 | Ga0157369_10031841 | Ga0157369_100318412 | 360 |
| 960 | 3300013306 | Ga0163162_10015186 | Ga0163162_100151866 | 360 |
| 961 | 3300013307 | Ga0157372_10003284 | Ga0157372_100032846 | 360 |
| 962 | 3300013307 | Ga0157372_10028128 | Ga0157372_100281287 | 360 |
| 963 | 3300014497 | Ga0182008_10007384 | Ga0182008_100073842 | 360 |
| 964 | 3300014497 | Ga0182008_10007985 | Ga0182008_100079857 | 360 |
| 965 | 3300014497 | Ga0182008_10009595 | Ga0182008_100095951 | 360 |
| 966 | 3300014497 | Ga0182008_10009942 | Ga0182008_100099426 | 360 |
| 967 | 3300014497 | Ga0182008_10141110 | Ga0182008_101411101 | 360 |
| 968 | 3300015261 | Ga0182006_1004027 | Ga0182006_10040276 | 360 |
| 969 | 3300015261 | Ga0182006_1004263 | Ga0182006_10042639 | 360 |
| 970 | 3300015261 | Ga0182006_1005362 | Ga0182006_10053622 | 360 |
| 971 | 3300015261 | Ga0182006_1006516 | Ga0182006_10065161 | 360 |
| 972 | 3300015261 | Ga0182006_1026738 | Ga0182006_10267384 | 360 |
| 973 | 3300015261 | Ga0182006_1044443 | Ga0182006_10444431 | 360 |
| 974 | 3300015262 | Ga0182007_10005678 | Ga0182007_100056781 | 360 |
| 975 | 3300015265 | Ga0182005_1002764 | Ga0182005_10027646 | 360 |
| 976 | 3300015265 | Ga0182005_1003401 | Ga0182005_10034016 | 360 |
| 977 | 3300017792 | Ga0163161_10032067 | Ga0163161_100320675 | 360 |
| 978 | 3300017792 | Ga0163161_10056408 | Ga0163161_100564081 | 360 |
| 979 | 3300017792 | Ga0163161_10247925 | Ga0163161_102479251 | 360 |
| 980 | 3300025206 | Ga0209435_100579 | Ga0209435_1005797 | 360 |
| 981 | 3300025207 | Ga0209760_100160 | Ga0209760_10016037 | 360 |
| 982 | 3300025207 | Ga0209760_100475 | Ga0209760_1004754 | 360 |
| 983 | 3300025224 | Ga0209784_100007 | Ga0209784_100007200 | 360 |
| 984 | 3300025225 | Ga0209566_100009 | Ga0209566_100009200 | 360 |
| 985 | 3300025226 | Ga0209674_100021 | Ga0209674_100021200 | 360 |
| 986 | 3300025229 | Ga0209147_100009 | Ga0209147_100009200 | 360 |
| 987 | 3300025230 | Ga0209563_100018 | Ga0209563_100018200 | 360 |
| 988 | 3300025230 | Ga0209563_100368 | Ga0209563_1003683 | 360 |
| 989 | 3300025231 | Ga0207427_100005 | Ga0207427_100005522 | 360 |
| 990 | 3300025231 | Ga0207427_100006 | Ga0207427_100006220 | 360 |
| 991 | 3300025233 | Ga0209437_100013 | Ga0209437_100013220 | 360 |
| 992 | 3300025233 | Ga0209437_100018 | Ga0209437_100018432 | 360 |
| 993 | 3300025233 | Ga0209437_105686 | Ga0209437_1056862 | 360 |
| 994 | 3300025242 | Ga0209258_100321 | Ga0209258_10032129 | 360 |
| 995 | 3300025246 | Ga0209646_1000787 | Ga0209646_10007879 | 360 |
| 996 | 3300025253 | Ga0209677_100012 | Ga0209677_100012200 | 360 |
| 997 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021522 | 360 |
| 998 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022220 | 360 |
| 999 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015210 | 360 |
| 1000 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030464 | 360 |
| 1001 | 3300025292 | Ga0209676_1000278 | Ga0209676_100027869 | 360 |
| 1002 | 3300025292 | Ga0209676_1020849 | Ga0209676_10208492 | 360 |
| 1003 | 3300025298 | Ga0209050_1000030 | Ga0209050_1000030228 | 360 |
| 1004 | 3300025298 | Ga0209050_1000061 | Ga0209050_100006146 | 360 |
| 1005 | 3300025298 | Ga0209050_1000241 | Ga0209050_10002419 | 360 |
| 1006 | 3300025298 | Ga0209050_1007643 | Ga0209050_10076436 | 360 |
| 1007 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012469 | 360 |
| 1008 | 3300025303 | Ga0209051_1000519 | Ga0209051_100051945 | 360 |
| 1009 | 3300025303 | Ga0209051_1000572 | Ga0209051_100057246 | 360 |
| 1010 | 3300025304 | Ga0209257_1000143 | Ga0209257_1000143128 | 360 |
| 1011 | 3300025304 | Ga0209257_1008653 | Ga0209257_10086532 | 360 |
| 1012 | 3300025321 | Ga0207656_10000009 | Ga0207656_10000009201 | 360 |
| 1013 | 3300025711 | Ga0207696_1000055 | Ga0207696_100005557 | 360 |
| 1014 | 3300025711 | Ga0207696_1000078 | Ga0207696_100007872 | 360 |
| 1015 | 3300025711 | Ga0207696_1000080 | Ga0207696_1000080106 | 360 |
| 1016 | 3300025711 | Ga0207696_1000204 | Ga0207696_10002045 | 360 |
| 1017 | 3300025711 | Ga0207696_1009751 | Ga0207696_10097513 | 360 |
| 1018 | 3300025711 | Ga0207696_1019315 | Ga0207696_10193153 | 360 |
| 1019 | 3300025711 | Ga0207696_1030235 | Ga0207696_10302353 | 360 |
| 1020 | 3300025728 | Ga0207655_1000033 | Ga0207655_1000033269 | 360 |
| 1021 | 3300025728 | Ga0207655_1000116 | Ga0207655_100011674 | 360 |
| 1022 | 3300025728 | Ga0207655_1000541 | Ga0207655_10005414 | 360 |
| 1023 | 3300025728 | Ga0207655_1002134 | Ga0207655_10021346 | 360 |
| 1024 | 3300025728 | Ga0207655_1003636 | Ga0207655_10036361 | 360 |
| 1025 | 3300025728 | Ga0207655_1003780 | Ga0207655_100378011 | 360 |
| 1026 | 3300025728 | Ga0207655_1003858 | Ga0207655_10038589 | 360 |
| 1027 | 3300025728 | Ga0207655_1004732 | Ga0207655_10047322 | 360 |
| 1028 | 3300025728 | Ga0207655_1006294 | Ga0207655_100629410 | 360 |
| 1029 | 3300025728 | Ga0207655_1014070 | Ga0207655_10140704 | 360 |
| 1030 | 3300025728 | Ga0207655_1016130 | Ga0207655_10161302 | 360 |
| 1031 | 3300025728 | Ga0207655_1029363 | Ga0207655_10293633 | 360 |
| 1032 | 3300025728 | Ga0207655_1030510 | Ga0207655_10305104 | 360 |
| 1033 | 3300025728 | Ga0207655_1031354 | Ga0207655_10313541 | 360 |
| 1034 | 3300025728 | Ga0207655_1031805 | Ga0207655_10318052 | 360 |
| 1035 | 3300025728 | Ga0207655_1075271 | Ga0207655_10752711 | 360 |
| 1036 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010433 | 360 |
| 1037 | 3300025735 | Ga0207713_1000707 | Ga0207713_100070717 | 360 |
| 1038 | 3300025735 | Ga0207713_1000912 | Ga0207713_10009125 | 360 |
| 1039 | 3300025735 | Ga0207713_1001898 | Ga0207713_100189815 | 360 |
| 1040 | 3300025735 | Ga0207713_1002747 | Ga0207713_10027472 | 360 |
| 1041 | 3300025735 | Ga0207713_1004151 | Ga0207713_10041516 | 360 |
| 1042 | 3300025735 | Ga0207713_1004464 | Ga0207713_10044647 | 360 |
| 1043 | 3300025735 | Ga0207713_1004468 | Ga0207713_10044685 | 360 |
| 1044 | 3300025735 | Ga0207713_1005294 | Ga0207713_10052948 | 360 |
| 1045 | 3300025735 | Ga0207713_1005979 | Ga0207713_10059794 | 360 |
| 1046 | 3300025735 | Ga0207713_1025432 | Ga0207713_10254323 | 360 |
| 1047 | 3300025914 | Ga0207671_10000027 | Ga0207671_10000027121 | 360 |
| 1048 | 3300025920 | Ga0207649_10000007 | Ga0207649_1000000753 | 360 |
| 1049 | 3300025923 | Ga0207681_10000059 | Ga0207681_1000005924 | 360 |
| 1050 | 3300025923 | Ga0207681_10031926 | Ga0207681_100319264 | 360 |
| 1051 | 3300025925 | Ga0207650_10000044 | Ga0207650_1000004484 | 360 |
| 1052 | 3300025925 | Ga0207650_10000089 | Ga0207650_1000008986 | 360 |
| 1053 | 3300025933 | Ga0207706_10002297 | Ga0207706_100022973 | 360 |
| 1054 | 3300025934 | Ga0207686_10003528 | Ga0207686_100035288 | 360 |
| 1055 | 3300025934 | Ga0207686_10060840 | Ga0207686_100608403 | 360 |
| 1056 | 3300025935 | Ga0207709_10000061 | Ga0207709_1000006174 | 360 |
| 1057 | 3300025935 | Ga0207709_10000063 | Ga0207709_1000006395 | 360 |
| 1058 | 3300025935 | Ga0207709_10000545 | Ga0207709_1000054516 | 360 |
| 1059 | 3300025935 | Ga0207709_10006915 | Ga0207709_100069157 | 360 |
| 1060 | 3300025935 | Ga0207709_10011028 | Ga0207709_100110285 | 360 |
| 1061 | 3300025945 | Ga0207679_10000013 | Ga0207679_10000013251 | 360 |
| 1062 | 3300025945 | Ga0207679_10019106 | Ga0207679_100191066 | 360 |
| 1063 | 3300025961 | Ga0207712_10010833 | Ga0207712_100108333 | 360 |
| 1064 | 3300026041 | Ga0207639_10000091 | Ga0207639_1000009127 | 360 |
| 1065 | 3300026067 | Ga0207678_10048930 | Ga0207678_100489303 | 360 |
| 1066 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016469 | 360 |
| 1067 | 3300027111 | Ga0209281_1000019 | Ga0209281_100001936 | 360 |
| 1068 | 3300027111 | Ga0209281_1006992 | Ga0209281_10069923 | 360 |
| 1069 | 3300027296 | Ga0209389_1000036 | Ga0209389_100003653 | 360 |
| 1070 | 3300027312 | Ga0209371_1000066 | Ga0209371_100006613 | 360 |
| 1071 | 3300027312 | Ga0209371_1000632 | Ga0209371_10006324 | 360 |
| 1072 | 3300027360 | Ga0209969_1002764 | Ga0209969_10027642 | 360 |
| 1073 | 3300027378 | Ga0209981_1006009 | Ga0209981_10060092 | 360 |
| 1074 | 3300027395 | Ga0209996_1001591 | Ga0209996_10015913 | 360 |
| 1075 | 3300027665 | Ga0209983_1001713 | Ga0209983_10017134 | 360 |
| 1076 | 3300027682 | Ga0209971_1009875 | Ga0209971_10098752 | 360 |
| 1077 | 3300027876 | Ga0209974_10007695 | Ga0209974_100076952 | 360 |
| 1078 | 3300027907 | Ga0207428_10008051 | Ga0207428_100080514 | 360 |
| 1079 | 3300027907 | Ga0207428_10010019 | Ga0207428_100100194 | 360 |
| 1080 | 3300027907 | Ga0207428_10034796 | Ga0207428_100347963 | 360 |
| 1081 | 3300027907 | Ga0207428_10136120 | Ga0207428_101361201 | 360 |
| 1082 | 3300028786 | Ga0307517_10097154 | Ga0307517_100971542 | 360 |
| 1083 | 3300030500 | Ga0268256_1000063 | Ga0268256_100006313 | 360 |
| 1084 | 3300030500 | Ga0268256_1000247 | Ga0268256_10002474 | 360 |
| 1085 | 3300030521 | Ga0307511_10125920 | Ga0307511_101259202 | 360 |
| 1086 | 3300030734 | Ga0316179_1002654 | Ga0316179_10026547 | 360 |
| 1087 | 3300030735 | Ga0316178_1047147 | Ga0316178_104714792 | 360 |
| 1088 | 3300030742 | Ga0316183_1059891 | Ga0316183_10598913 | 360 |
| 1089 | 3300030744 | Ga0316181_1001658 | Ga0316181_10016582 | 360 |
| 1090 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002669 | 360 |
| 1091 | 3300031548 | Ga0307408_100030241 | Ga0307408_1000302414 | 360 |
| 1092 | 3300031731 | Ga0307405_10014813 | Ga0307405_100148135 | 360 |
| 1093 | 3300031731 | Ga0307405_10139706 | Ga0307405_101397062 | 360 |
| 1094 | 3300031731 | Ga0307405_10167710 | Ga0307405_101677102 | 360 |
| 1095 | 3300031824 | Ga0307413_10069955 | Ga0307413_100699552 | 360 |
| 1096 | 3300032002 | Ga0307416_100081686 | Ga0307416_1000816862 | 360 |
| 1097 | 3300032004 | Ga0307414_10015714 | Ga0307414_100157143 | 360 |
| 1098 | 3300033180 | Ga0307510_10024600 | Ga0307510_100246008 | 360 |
| 1099 | 3300033180 | Ga0307510_10126867 | Ga0307510_101268673 | 360 |
| 1100 | 3300038705 | Ga0237819_00416 | Ga0237819_00416_9037_10119 | 360 |
| 1101 | 3300041404 | Ga0439436_0000094 | Ga0439436_0000094_2093_3178 | 360 |
| 1102 | 3300041405 | Ga0439438_002010 | Ga0439438_002010_3277_4359 | 360 |
| 1103 | 3300041405 | Ga0439438_003391 | Ga0439438_003391_4211_5296 | 360 |
| 1104 | 3300041405 | Ga0439438_003796 | Ga0439438_003796_4296_5378 | 360 |
| 1105 | 3300041405 | Ga0439438_024700 | Ga0439438_024700_363_1445 | 360 |
| 1106 | 3300041405 | Ga0439438_026050 | Ga0439438_026050_444_1526 | 360 |
| 1107 | 3300041407 | Ga0439447_007063 | Ga0439447_007063_1584_2669 | 360 |
| 1108 | 3300041407 | Ga0439447_011576 | Ga0439447_011576_443_1525 | 360 |
| 1109 | 3300041407 | Ga0439447_023361 | Ga0439447_023361_139_1221 | 360 |
| 1110 | 3300041411 | Ga0439466_0002316 | Ga0439466_0002316_4215_5297 | 360 |
| 1111 | 3300041411 | Ga0439466_0003713 | Ga0439466_0003713_1650_2732 | 360 |
| 1112 | 3300041411 | Ga0439466_0006210 | Ga0439466_0006210_359_1441 | 360 |
| 1113 | 3300041411 | Ga0439466_0008448 | Ga0439466_0008448_2399_3481 | 360 |
| 1114 | 3300041411 | Ga0439466_0015260 | Ga0439466_0015260_244_1326 | 360 |
| 1115 | 3300041411 | Ga0439466_0020320 | Ga0439466_0020320_665_1747 | 360 |
| 1116 | 3300041411 | Ga0439466_0038106 | Ga0439466_0038106_101_1183 | 360 |
| 1117 | 3300042000 | Ga0439437_000861 | Ga0439437_000861_177_1259 | 360 |
| 1118 | 3300042006 | Ga0439432_000757 | Ga0439432_000757_10850_11935 | 360 |
| 1119 | 3300042006 | Ga0439432_001455 | Ga0439432_001455_4832_5914 | 360 |
| 1120 | 3300042006 | Ga0439432_003124 | Ga0439432_003124_446_1531 | 360 |
| 1121 | 3300042006 | Ga0439432_038536 | Ga0439432_038536_17_1099 | 360 |
| 1122 | 3300042009 | Ga0439451_010195 | Ga0439451_010195_429_1511 | 360 |
| 1123 | 3300042010 | Ga0439452_002183 | Ga0439452_002183_4365_5447 | 360 |
| 1124 | 3300042010 | Ga0439452_002265 | Ga0439452_002265_1291_2376 | 360 |
| 1125 | 3300042010 | Ga0439452_002419 | Ga0439452_002419_562_1644 | 360 |
| 1126 | 3300042010 | Ga0439452_003104 | Ga0439452_003104_4424_5506 | 360 |
| 1127 | 3300042010 | Ga0439452_007546 | Ga0439452_007546_1924_3006 | 360 |
| 1128 | 3300042013 | Ga0439456_000080 | Ga0439456_000080_27898_28980 | 360 |
| 1129 | 3300042013 | Ga0439456_006404 | Ga0439456_006404_373_1455 | 360 |
| 1130 | 3300042013 | Ga0439456_017964 | Ga0439456_017964_250_1332 | 360 |
| 1131 | 3300042016 | Ga0439463_000261 | Ga0439463_000261_12847_13929 | 360 |
| 1132 | 3300042016 | Ga0439463_000477 | Ga0439463_000477_2415_3497 | 360 |
| 1133 | 3300042016 | Ga0439463_002267 | Ga0439463_002267_3426_4508 | 360 |
| 1134 | 3300042115 | Ga0450911_000011 | Ga0450911_000011_11393_12475 | 360 |
| 1135 | 3300042115 | Ga0450911_001296 | Ga0450911_001296_4427_5509 | 360 |
| 1136 | 3300042122 | Ga0450920_000286 | Ga0450920_000286_3805_4887 | 360 |
| 1137 | 3300042124 | Ga0450922_000446 | Ga0450922_000446_438_1520 | 360 |
| 1138 | 3300042137 | Ga0450902_003051 | Ga0450902_003051_1011_2093 | 360 |
| 1139 | 3300042137 | Ga0450902_004332 | Ga0450902_004332_607_1689 | 360 |
| 1140 | 3300042138 | Ga0450903_001699 | Ga0450903_001699_35_1117 | 360 |
| 1141 | 3300042139 | Ga0450904_000115 | Ga0450904_000115_12319_13401 | 360 |
| 1142 | 3300042145 | Ga0450906_000355 | Ga0450906_000355_3702_4784 | 360 |
| 1143 | 3300042146 | Ga0450907_000520 | Ga0450907_000520_2006_3088 | 360 |
| 1144 | 3300042146 | Ga0450907_000867 | Ga0450907_000867_4092_5174 | 360 |
| 1145 | 3300042147 | Ga0450910_000137 | Ga0450910_000137_3888_4970 | 360 |
| 1146 | 3300042156 | Ga0439446_0001927 | Ga0439446_0001927_2802_3887 | 360 |
| 1147 | 3300042156 | Ga0439446_0003287 | Ga0439446_0003287_238_1323 | 360 |
| 1148 | 3300042156 | Ga0439446_0003992 | Ga0439446_0003992_426_1508 | 360 |
| 1149 | 3300042184 | Ga0450908_000962 | Ga0450908_000962_4335_5417 | 360 |
| 1150 | 3300042435 | Ga0439434_0001117 | Ga0439434_0001117_6235_7317 | 360 |
| 1151 | 3300042435 | Ga0439434_0001196 | Ga0439434_0001196_4744_5829 | 360 |
| 1152 | 3300042438 | Ga0439459_0006118 | Ga0439459_0006118_326_1408 | 360 |
| 1153 | 3300042439 | Ga0439464_0006763 | Ga0439464_0006763_521_1606 | 360 |
| 1154 | 3300042461 | Ga0439460_0004700 | Ga0439460_0004700_1934_3016 | 360 |
| 1155 | 3300042461 | Ga0439460_0027644 | Ga0439460_0027644_442_1524 | 360 |
| 1156 | 3300042876 | Ga0451577_0038790 | Ga0451577_0038790_1435_2517 | 360 |
| 1157 | 3300046452 | Ga0495617_002371 | Ga0495617_002371_2003_3085 | 360 |
| 1158 | 3300046452 | Ga0495617_006750 | Ga0495617_006750_763_1845 | 360 |
| 1159 | 3300046452 | Ga0495617_007712 | Ga0495617_007712_42_1124 | 360 |
| 1160 | 3300046452 | Ga0495617_040143 | Ga0495617_040143_418_1500 | 360 |
| 1161 | 3300046453 | Ga0495627_000115 | Ga0495627_000115_53715_54797 | 360 |
| 1162 | 3300046453 | Ga0495627_002716 | Ga0495627_002716_2583_3665 | 360 |
| 1163 | 3300046453 | Ga0495627_014628 | Ga0495627_014628_1485_2567 | 360 |
| 1164 | 3300046453 | Ga0495627_024550 | Ga0495627_024550_375_1457 | 360 |
| 1165 | 3300046455 | Ga0495603_0104203 | Ga0495603_0104203_228_1310 | 360 |
| 1166 | 3300046457 | Ga0495590_0001555 | Ga0495590_0001555_6016_7098 | 360 |
| 1167 | 3300046457 | Ga0495590_0013497 | Ga0495590_0013497_273_1355 | 360 |
| 1168 | 3300046457 | Ga0495590_0015791 | Ga0495590_0015791_210_1292 | 360 |
| 1169 | 3300046458 | Ga0495591_000061 | Ga0495591_000061_58990_60072 | 360 |
| 1170 | 3300046458 | Ga0495591_000769 | Ga0495591_000769_19280_20362 | 360 |
| 1171 | 3300046458 | Ga0495591_004633 | Ga0495591_004633_1857_2939 | 360 |
| 1172 | 3300046458 | Ga0495591_005294 | Ga0495591_005294_441_1523 | 360 |
| 1173 | 3300046458 | Ga0495591_007208 | Ga0495591_007208_1229_2311 | 360 |
| 1174 | 3300046458 | Ga0495591_008860 | Ga0495591_008860_1740_2822 | 360 |
| 1175 | 3300046458 | Ga0495591_009117 | Ga0495591_009117_2552_3634 | 360 |
| 1176 | 3300046458 | Ga0495591_013638 | Ga0495591_013638_121_1203 | 360 |
| 1177 | 3300046458 | Ga0495591_020715 | Ga0495591_020715_596_1678 | 360 |
| 1178 | 3300046460 | Ga0495638_0015492 | Ga0495638_0015492_3285_4367 | 360 |
| 1179 | 3300046460 | Ga0495638_0023151 | Ga0495638_0023151_2960_4042 | 360 |
| 1180 | 3300046460 | Ga0495638_0024593 | Ga0495638_0024593_825_1907 | 360 |
| 1181 | 3300046460 | Ga0495638_0038782 | Ga0495638_0038782_562_1644 | 360 |
| 1182 | 3300046463 | Ga0495653_0028233 | Ga0495653_0028233_173_1255 | 360 |
| 1183 | 3300046463 | Ga0495653_0032916 | Ga0495653_0032916_2745_3827 | 360 |
| 1184 | 3300046463 | Ga0495653_0049907 | Ga0495653_0049907_430_1512 | 360 |
| 1185 | 3300046463 | Ga0495653_0091619 | Ga0495653_0091619_410_1492 | 360 |
| 1186 | 3300046471 | Ga0495650_0001411 | Ga0495650_0001411_15801_16883 | 360 |
| 1187 | 3300046471 | Ga0495650_0003915 | Ga0495650_0003915_6732_7814 | 360 |
| 1188 | 3300046471 | Ga0495650_0006927 | Ga0495650_0006927_3954_5036 | 360 |
| 1189 | 3300046471 | Ga0495650_0030700 | Ga0495650_0030700_375_1457 | 360 |
| 1190 | 3300046471 | Ga0495650_0040440 | Ga0495650_0040440_367_1449 | 360 |
| 1191 | 3300046474 | Ga0495605_0000079 | Ga0495605_0000079_44442_45524 | 360 |
| 1192 | 3300046474 | Ga0495605_0000441 | Ga0495605_0000441_514_1596 | 360 |
| 1193 | 3300046474 | Ga0495605_0002193 | Ga0495605_0002193_10528_11610 | 360 |
| 1194 | 3300046474 | Ga0495605_0002696 | Ga0495605_0002696_6092_7174 | 360 |
| 1195 | 3300046474 | Ga0495605_0010405 | Ga0495605_0010405_561_1643 | 360 |
| 1196 | 3300046474 | Ga0495605_0024924 | Ga0495605_0024924_1561_2643 | 360 |
| 1197 | 3300046474 | Ga0495605_0026038 | Ga0495605_0026038_1520_2602 | 360 |
| 1198 | 3300046474 | Ga0495605_0039963 | Ga0495605_0039963_1202_2284 | 360 |
| 1199 | 3300046474 | Ga0495605_0040798 | Ga0495605_0040798_494_1576 | 360 |
| 1200 | 3300046474 | Ga0495605_0097812 | Ga0495605_0097812_209_1291 | 360 |
| 1201 | 3300046475 | Ga0495639_0004422 | Ga0495639_0004422_440_1522 | 360 |
| 1202 | 3300046491 | Ga0495584_0006922 | Ga0495584_0006922_4408_5490 | 360 |
| 1203 | 3300046491 | Ga0495584_0006997 | Ga0495584_0006997_4383_5465 | 360 |
| 1204 | 3300046491 | Ga0495584_0007121 | Ga0495584_0007121_4416_5498 | 360 |
| 1205 | 3300046491 | Ga0495584_0007934 | Ga0495584_0007934_93_1175 | 360 |
| 1206 | 3300046491 | Ga0495584_0008025 | Ga0495584_0008025_4313_5395 | 360 |
| 1207 | 3300046491 | Ga0495584_0016043 | Ga0495584_0016043_195_1277 | 360 |
| 1208 | 3300046492 | Ga0495585_0009311 | Ga0495585_0009311_442_1524 | 360 |
| 1209 | 3300046499 | Ga0495594_0018026 | Ga0495594_0018026_148_1230 | 360 |
| 1210 | 3300046500 | Ga0495596_0000257 | Ga0495596_0000257_31599_32681 | 360 |
| 1211 | 3300046500 | Ga0495596_0007840 | Ga0495596_0007840_2466_3548 | 360 |
| 1212 | 3300046501 | Ga0495607_0000147 | Ga0495607_0000147_17740_18822 | 360 |
| 1213 | 3300046501 | Ga0495607_0001158 | Ga0495607_0001158_12125_13207 | 360 |
| 1214 | 3300046501 | Ga0495607_0003466 | Ga0495607_0003466_511_1593 | 360 |
| 1215 | 3300046501 | Ga0495607_0007687 | Ga0495607_0007687_4380_5462 | 360 |
| 1216 | 3300046501 | Ga0495607_0007858 | Ga0495607_0007858_3376_4458 | 360 |
| 1217 | 3300046501 | Ga0495607_0073243 | Ga0495607_0073243_743_1825 | 360 |
| 1218 | 3300046501 | Ga0495607_0109322 | Ga0495607_0109322_245_1327 | 360 |
| 1219 | 3300046506 | Ga0495583_0000763 | Ga0495583_0000763_27663_28745 | 360 |
| 1220 | 3300046506 | Ga0495583_0002078 | Ga0495583_0002078_14204_15286 | 360 |
| 1221 | 3300046506 | Ga0495583_0002814 | Ga0495583_0002814_2744_3826 | 360 |
| 1222 | 3300046506 | Ga0495583_0002975 | Ga0495583_0002975_2055_3137 | 360 |
| 1223 | 3300046506 | Ga0495583_0007538 | Ga0495583_0007538_1125_2207 | 360 |
| 1224 | 3300046506 | Ga0495583_0009278 | Ga0495583_0009278_4776_5861 | 360 |
| 1225 | 3300046506 | Ga0495583_0032210 | Ga0495583_0032210_440_1522 | 360 |
| 1226 | 3300046507 | Ga0495606_0000139 | Ga0495606_0000139_33188_34270 | 360 |
| 1227 | 3300046507 | Ga0495606_0005994 | Ga0495606_0005994_297_1379 | 360 |
| 1228 | 3300046507 | Ga0495606_0009824 | Ga0495606_0009824_4157_5239 | 360 |
| 1229 | 3300046507 | Ga0495606_0018173 | Ga0495606_0018173_3644_4726 | 360 |
| 1230 | 3300046507 | Ga0495606_0021237 | Ga0495606_0021237_206_1288 | 360 |
| 1231 | 3300046507 | Ga0495606_0050347 | Ga0495606_0050347_78_1160 | 360 |
| 1232 | 3300046512 | Ga0495610_0011258 | Ga0495610_0011258_42_1124 | 360 |
| 1233 | 3300046512 | Ga0495610_0019562 | Ga0495610_0019562_2269_3351 | 360 |
| 1234 | 3300046512 | Ga0495610_0020042 | Ga0495610_0020042_2079_3161 | 360 |
| 1235 | 3300046512 | Ga0495610_0023220 | Ga0495610_0023220_2253_3335 | 360 |
| 1236 | 3300046512 | Ga0495610_0057660 | Ga0495610_0057660_283_1365 | 360 |
| 1237 | 3300046513 | Ga0495616_0005952 | Ga0495616_0005952_432_1514 | 360 |
| 1238 | 3300046513 | Ga0495616_0019034 | Ga0495616_0019034_72_1154 | 360 |
| 1239 | 3300046513 | Ga0495616_0032604 | Ga0495616_0032604_42_1124 | 360 |
| 1240 | 3300046513 | Ga0495616_0043199 | Ga0495616_0043199_526_1608 | 360 |
| 1241 | 3300046513 | Ga0495616_0052465 | Ga0495616_0052465_772_1854 | 360 |
| 1242 | 3300046513 | Ga0495616_0073767 | Ga0495616_0073767_102_1184 | 360 |
| 1243 | 3300046515 | Ga0495620_0000044 | Ga0495620_0000044_35709_36791 | 360 |
| 1244 | 3300046515 | Ga0495620_0000270 | Ga0495620_0000270_14445_15527 | 360 |
| 1245 | 3300046515 | Ga0495620_0000538 | Ga0495620_0000538_14087_15169 | 360 |
| 1246 | 3300046515 | Ga0495620_0000724 | Ga0495620_0000724_17559_18641 | 360 |
| 1247 | 3300046515 | Ga0495620_0006866 | Ga0495620_0006866_2642_3724 | 360 |
| 1248 | 3300046515 | Ga0495620_0015829 | Ga0495620_0015829_2206_3288 | 360 |
| 1249 | 3300046517 | Ga0495630_0023231 | Ga0495630_0023231_3079_4161 | 360 |
| 1250 | 3300046517 | Ga0495630_0066550 | Ga0495630_0066550_1368_2450 | 360 |
| 1251 | 3300046518 | Ga0495631_0006682 | Ga0495631_0006682_444_1526 | 360 |
| 1252 | 3300046518 | Ga0495631_0010667 | Ga0495631_0010667_3176_4258 | 360 |
| 1253 | 3300046519 | Ga0495632_0001693 | Ga0495632_0001693_2694_3776 | 360 |
| 1254 | 3300046519 | Ga0495632_0006009 | Ga0495632_0006009_4143_5225 | 360 |
| 1255 | 3300046519 | Ga0495632_0006158 | Ga0495632_0006158_4863_5945 | 360 |
| 1256 | 3300046519 | Ga0495632_0006308 | Ga0495632_0006308_4442_5524 | 360 |
| 1257 | 3300046519 | Ga0495632_0009750 | Ga0495632_0009750_42_1124 | 360 |
| 1258 | 3300046519 | Ga0495632_0010862 | Ga0495632_0010862_2421_3503 | 360 |
| 1259 | 3300046519 | Ga0495632_0013427 | Ga0495632_0013427_2933_4015 | 360 |
| 1260 | 3300046519 | Ga0495632_0046623 | Ga0495632_0046623_72_1154 | 360 |
| 1261 | 3300046520 | Ga0495637_0000066 | Ga0495637_0000066_76633_77715 | 360 |
| 1262 | 3300046520 | Ga0495637_0000239 | Ga0495637_0000239_31127_32209 | 360 |
| 1263 | 3300046520 | Ga0495637_0007048 | Ga0495637_0007048_446_1528 | 360 |
| 1264 | 3300046520 | Ga0495637_0014325 | Ga0495637_0014325_2558_3640 | 360 |
| 1265 | 3300046520 | Ga0495637_0019951 | Ga0495637_0019951_104_1186 | 360 |
| 1266 | 3300046520 | Ga0495637_0044385 | Ga0495637_0044385_375_1457 | 360 |
| 1267 | 3300046520 | Ga0495637_0046621 | Ga0495637_0046621_478_1560 | 360 |
| 1268 | 3300046520 | Ga0495637_0055494 | Ga0495637_0055494_501_1583 | 360 |
| 1269 | 3300046522 | Ga0495643_0000763 | Ga0495643_0000763_32312_33394 | 360 |
| 1270 | 3300046522 | Ga0495643_0001974 | Ga0495643_0001974_12298_13380 | 360 |
| 1271 | 3300046522 | Ga0495643_0008586 | Ga0495643_0008586_486_1568 | 360 |
| 1272 | 3300046522 | Ga0495643_0032256 | Ga0495643_0032256_44_1126 | 360 |
| 1273 | 3300046522 | Ga0495643_0040785 | Ga0495643_0040785_474_1556 | 360 |
| 1274 | 3300046522 | Ga0495643_0145759 | Ga0495643_0145759_63_1145 | 360 |
| 1275 | 3300046523 | Ga0495644_0000476 | Ga0495644_0000476_8108_9190 | 360 |
| 1276 | 3300046524 | Ga0495648_0002285 | Ga0495648_0002285_2747_3829 | 360 |
| 1277 | 3300046524 | Ga0495648_0007380 | Ga0495648_0007380_2826_3911 | 360 |
| 1278 | 3300046524 | Ga0495648_0008468 | Ga0495648_0008468_2701_3783 | 360 |
| 1279 | 3300046524 | Ga0495648_0013321 | Ga0495648_0013321_596_1678 | 360 |
| 1280 | 3300046524 | Ga0495648_0020185 | Ga0495648_0020185_1672_2754 | 360 |
| 1281 | 3300046524 | Ga0495648_0025964 | Ga0495648_0025964_2050_3132 | 360 |
| 1282 | 3300046524 | Ga0495648_0088112 | Ga0495648_0088112_235_1317 | 360 |
| 1283 | 3300046524 | Ga0495648_0139033 | Ga0495648_0139033_28_1110 | 360 |
| 1284 | 3300046526 | Ga0495666_0054702 | Ga0495666_0054702_749_1831 | 360 |
| 1285 | 3300046526 | Ga0495666_0098701 | Ga0495666_0098701_277_1359 | 360 |
| 1286 | 3300046528 | Ga0495642_0003701 | Ga0495642_0003701_433_1515 | 360 |
| 1287 | 3300046528 | Ga0495642_0003845 | Ga0495642_0003845_388_1470 | 360 |
| 1288 | 3300046530 | Ga0495654_0001913 | Ga0495654_0001913_6507_7589 | 360 |
| 1289 | 3300046530 | Ga0495654_0007275 | Ga0495654_0007275_5083_6168 | 360 |
| 1290 | 3300046530 | Ga0495654_0008103 | Ga0495654_0008103_4333_5415 | 360 |
| 1291 | 3300046530 | Ga0495654_0014487 | Ga0495654_0014487_1844_2926 | 360 |
| 1292 | 3300046530 | Ga0495654_0019319 | Ga0495654_0019319_443_1525 | 360 |
| 1293 | 3300046530 | Ga0495654_0021353 | Ga0495654_0021353_2248_3330 | 360 |
| 1294 | 3300046530 | Ga0495654_0062522 | Ga0495654_0062522_72_1154 | 360 |
| 1295 | 3300046530 | Ga0495654_0071585 | Ga0495654_0071585_462_1544 | 360 |
| 1296 | 3300046530 | Ga0495654_0077161 | Ga0495654_0077161_63_1145 | 360 |
| 1297 | 3300046536 | Ga0495587_0079919 | Ga0495587_0079919_742_1824 | 360 |
| 1298 | 3300046538 | Ga0495609_0000098 | Ga0495609_0000098_54767_55849 | 360 |
| 1299 | 3300046538 | Ga0495609_0000323 | Ga0495609_0000323_7260_8342 | 360 |
| 1300 | 3300046538 | Ga0495609_0000398 | Ga0495609_0000398_2735_3817 | 360 |
| 1301 | 3300046542 | Ga0495597_0000137 | Ga0495597_0000137_45070_46152 | 360 |
| 1302 | 3300046542 | Ga0495597_0019474 | Ga0495597_0019474_229_1311 | 360 |
| 1303 | 3300046542 | Ga0495597_0022178 | Ga0495597_0022178_384_1466 | 360 |
| 1304 | 3300046542 | Ga0495597_0022986 | Ga0495597_0022986_211_1293 | 360 |
| 1305 | 3300046557 | Ga0495622_0005353 | Ga0495622_0005353_2860_3942 | 360 |
| 1306 | 3300046557 | Ga0495622_0006837 | Ga0495622_0006837_103_1185 | 360 |
| 1307 | 3300046557 | Ga0495622_0019242 | Ga0495622_0019242_140_1222 | 360 |
| 1308 | 3300046558 | Ga0495633_0000440 | Ga0495633_0000440_6104_7186 | 360 |
| 1309 | 3300046558 | Ga0495633_0004409 | Ga0495633_0004409_1951_3033 | 360 |
| 1310 | 3300046616 | Ga0495668_0033998 | Ga0495668_0033998_1709_2791 | 360 |
| 1311 | 3300046616 | Ga0495668_0040891 | Ga0495668_0040891_1201_2283 | 360 |
| 1312 | 3300046616 | Ga0495668_0041083 | Ga0495668_0041083_532_1614 | 360 |
| 1313 | 3300046616 | Ga0495668_0058460 | Ga0495668_0058460_72_1154 | 360 |
| 1314 | 3300046642 | Ga0495634_0037677 | Ga0495634_0037677_387_1469 | 360 |
| 1315 | 3300046648 | Ga0495611_0001266 | Ga0495611_0001266_11425_12507 | 360 |
| 1316 | 3300046648 | Ga0495611_0004728 | Ga0495611_0004728_4751_5833 | 360 |
| 1317 | 3300046648 | Ga0495611_0010879 | Ga0495611_0010879_2451_3533 | 360 |
| 1318 | 3300046648 | Ga0495611_0016386 | Ga0495611_0016386_1583_2665 | 360 |
| 1319 | 3300046648 | Ga0495611_0031597 | Ga0495611_0031597_922_2004 | 360 |
| 1320 | 3300046660 | Ga0495625_0000113 | Ga0495625_0000113_47317_48399 | 360 |
| 1321 | 3300046660 | Ga0495625_0013708 | Ga0495625_0013708_2820_3902 | 360 |
| 1322 | 3300046660 | Ga0495625_0027708 | Ga0495625_0027708_1179_2261 | 360 |
| 1323 | 3300046660 | Ga0495625_0039549 | Ga0495625_0039549_1931_3013 | 360 |
| 1324 | 3300046663 | Ga0495635_0014354 | Ga0495635_0014354_72_1154 | 360 |
| 1325 | 3300046664 | Ga0495659_0001791 | Ga0495659_0001791_4249_5331 | 360 |
| 1326 | 3300046665 | Ga0495661_0000112 | Ga0495661_0000112_76624_77706 | 360 |
| 1327 | 3300046665 | Ga0495661_0000237 | Ga0495661_0000237_47150_48232 | 360 |
| 1328 | 3300046665 | Ga0495661_0000633 | Ga0495661_0000633_12171_13253 | 360 |
| 1329 | 3300046665 | Ga0495661_0006107 | Ga0495661_0006107_7000_8085 | 360 |
| 1330 | 3300046665 | Ga0495661_0016928 | Ga0495661_0016928_3315_4397 | 360 |
| 1331 | 3300046665 | Ga0495661_0102617 | Ga0495661_0102617_404_1486 | 360 |
| 1332 | 3300046665 | Ga0495661_0171753 | Ga0495661_0171753_32_1114 | 360 |
| 1333 | 3300046674 | Ga0495588_0079410 | Ga0495588_0079410_609_1691 | 360 |
| 1334 | 3300046679 | Ga0495623_0010236 | Ga0495623_0010236_375_1457 | 360 |
| 1335 | 3300046684 | Ga0495669_0002201 | Ga0495669_0002201_4910_5992 | 360 |
| 1336 | 3300046689 | Ga0495613_0103782 | Ga0495613_0103782_548_1630 | 360 |
| 1337 | 3300046691 | Ga0495670_0003539 | Ga0495670_0003539_1779_2861 | 360 |
| 1338 | 3300046691 | Ga0495670_0023021 | Ga0495670_0023021_1421_2503 | 360 |
| 1339 | 3300046691 | Ga0495670_0024154 | Ga0495670_0024154_1711_2793 | 360 |
| 1340 | 3300046692 | Ga0495671_0007515 | Ga0495671_0007515_3092_4174 | 360 |
| 1341 | 3300046692 | Ga0495671_0008147 | Ga0495671_0008147_4416_5498 | 360 |
| 1342 | 3300046692 | Ga0495671_0028508 | Ga0495671_0028508_1197_2279 | 360 |
| 1343 | 3300046692 | Ga0495671_0029779 | Ga0495671_0029779_442_1524 | 360 |
| 1344 | 3300046692 | Ga0495671_0045586 | Ga0495671_0045586_382_1464 | 360 |
| 1345 | 3300046692 | Ga0495671_0071760 | Ga0495671_0071760_325_1407 | 360 |
| 1346 | 3300046692 | Ga0495671_0087557 | Ga0495671_0087557_385_1467 | 360 |
| 1347 | 3300046692 | Ga0495671_0099779 | Ga0495671_0099779_296_1378 | 360 |
| 1348 | 3300046694 | Ga0495649_0002055 | Ga0495649_0002055_9508_10590 | 360 |
| 1349 | 3300046694 | Ga0495649_0009532 | Ga0495649_0009532_4238_5320 | 360 |
| 1350 | 3300046694 | Ga0495649_0010872 | Ga0495649_0010872_2433_3515 | 360 |
| 1351 | 3300046694 | Ga0495649_0011731 | Ga0495649_0011731_2692_3774 | 360 |
| 1352 | 3300046694 | Ga0495649_0021128 | Ga0495649_0021128_2101_3183 | 360 |
| 1353 | 3300046694 | Ga0495649_0022205 | Ga0495649_0022205_1833_2915 | 360 |
| 1354 | 3300046694 | Ga0495649_0031256 | Ga0495649_0031256_1293_2375 | 360 |
| 1355 | 3300046694 | Ga0495649_0040018 | Ga0495649_0040018_199_1281 | 360 |
| 1356 | 3300046794 | Ga0495589_0004591 | Ga0495589_0004591_1920_3002 | 360 |
| 1357 | 3300046794 | Ga0495589_0038319 | Ga0495589_0038319_1045_2127 | 360 |
| 1358 | 3300046809 | Ga0495600_0018130 | Ga0495600_0018130_3138_4220 | 360 |
| 1359 | 3300046810 | Ga0495660_0000190 | Ga0495660_0000190_63194_64276 | 360 |
| 1360 | 3300046810 | Ga0495660_0049616 | Ga0495660_0049616_1193_2275 | 360 |
| 1361 | 3300046810 | Ga0495660_0088728 | Ga0495660_0088728_140_1222 | 360 |
| 1362 | 3300046810 | Ga0495660_0096705 | Ga0495660_0096705_42_1124 | 360 |
| 1363 | 3300047317 | Ga0495604_0023499 | Ga0495604_0023499_366_1448 | 360 |
| 1364 | 3300047320 | Ga0495672_0008328 | Ga0495672_0008328_4065_5147 | 360 |
| 1365 | 3300047320 | Ga0495672_0010702 | Ga0495672_0010702_3516_4598 | 360 |
| 1366 | 3300047320 | Ga0495672_0011678 | Ga0495672_0011678_2278_3360 | 360 |
| 1367 | 3300047320 | Ga0495672_0011796 | Ga0495672_0011796_4516_5598 | 360 |
| 1368 | 3300047320 | Ga0495672_0013936 | Ga0495672_0013936_2546_3628 | 360 |
| 1369 | 3300047320 | Ga0495672_0019532 | Ga0495672_0019532_120_1202 | 360 |
| 1370 | 3300047320 | Ga0495672_0033191 | Ga0495672_0033191_1699_2781 | 360 |
| 1371 | 3300047321 | Ga0495676_0000032 | Ga0495676_0000032_78299_79381 | 360 |
| 1372 | 3300047321 | Ga0495676_0013185 | Ga0495676_0013185_5260_6342 | 360 |
| 1373 | 3300047322 | Ga0495680_0022986 | Ga0495680_0022986_562_1644 | 360 |
| 1374 | 3300047322 | Ga0495680_0084248 | Ga0495680_0084248_1296_2378 | 360 |
| 1375 | 3300047323 | Ga0495683_0000055 | Ga0495683_0000055_27852_28934 | 360 |
| 1376 | 3300047323 | Ga0495683_0000236 | Ga0495683_0000236_6244_7326 | 360 |
| 1377 | 3300047323 | Ga0495683_0004276 | Ga0495683_0004276_4373_5455 | 360 |
| 1378 | 3300047323 | Ga0495683_0007387 | Ga0495683_0007387_4429_5511 | 360 |
| 1379 | 3300047323 | Ga0495683_0008977 | Ga0495683_0008977_36_1118 | 360 |
| 1380 | 3300047323 | Ga0495683_0011955 | Ga0495683_0011955_1636_2718 | 360 |
| 1381 | 3300047443 | Ga0495687_009435 | Ga0495687_009435_12_1094 | 360 |
| 1382 | 3300047443 | Ga0495687_013719 | Ga0495687_013719_2689_3771 | 360 |
| 1383 | 3300047443 | Ga0495687_090065 | Ga0495687_090065_83_1165 | 360 |
| 1384 | 3300047444 | Ga0495675_0007905 | Ga0495675_0007905_1124_2206 | 360 |
| 1385 | 3300047446 | Ga0495679_043940 | Ga0495679_043940_134_1216 | 360 |
| 1386 | 3300047469 | Ga0495673_0001256 | Ga0495673_0001256_16368_17450 | 360 |
| 1387 | 3300047469 | Ga0495673_0002288 | Ga0495673_0002288_10499_11581 | 360 |
| 1388 | 3300047469 | Ga0495673_0005066 | Ga0495673_0005066_5033_6115 | 360 |
| 1389 | 3300047469 | Ga0495673_0014221 | Ga0495673_0014221_2145_3227 | 360 |
| 1390 | 3300047469 | Ga0495673_0024272 | Ga0495673_0024272_437_1519 | 360 |
| 1391 | 3300047469 | Ga0495673_0030031 | Ga0495673_0030031_441_1523 | 360 |
| 1392 | 3300047469 | Ga0495673_0039165 | Ga0495673_0039165_487_1569 | 360 |
| 1393 | 3300047469 | Ga0495673_0061992 | Ga0495673_0061992_132_1214 | 360 |
| 1394 | 3300047469 | Ga0495673_0073270 | Ga0495673_0073270_300_1382 | 360 |
| 1395 | 3300047469 | Ga0495673_0081441 | Ga0495673_0081441_223_1305 | 360 |
| 1396 | 3300047469 | Ga0495673_0086996 | Ga0495673_0086996_54_1136 | 360 |
| 1397 | 3300047470 | Ga0495681_0009856 | Ga0495681_0009856_4410_5492 | 360 |
| 1398 | 3300047470 | Ga0495681_0013570 | Ga0495681_0013570_1676_2758 | 360 |
| 1399 | 3300047470 | Ga0495681_0020409 | Ga0495681_0020409_36_1118 | 360 |
| 1400 | 3300047470 | Ga0495681_0029047 | Ga0495681_0029047_1225_2307 | 360 |
| 1401 | 3300047470 | Ga0495681_0109114 | Ga0495681_0109114_93_1175 | 360 |
| 1402 | 3300047471 | Ga0495684_0038420 | Ga0495684_0038420_2157_3239 | 360 |
| 1403 | 3300047472 | Ga0495686_0012681 | Ga0495686_0012681_472_1554 | 360 |
| 1404 | 3300047472 | Ga0495686_0047370 | Ga0495686_0047370_431_1513 | 360 |
| 1405 | 3300047673 | Ga0495593_0013908 | Ga0495593_0013908_3136_4218 | 360 |
| 1406 | 3300047673 | Ga0495593_0052038 | Ga0495593_0052038_390_1472 | 360 |
| 1407 | 3300048091 | Ga0495626_0000024 | Ga0495626_0000024_76420_77502 | 360 |
| 1408 | 3300048091 | Ga0495626_0004732 | Ga0495626_0004732_2838_3920 | 360 |
| 1409 | 3300048091 | Ga0495626_0005414 | Ga0495626_0005414_1885_2967 | 360 |
| 1410 | 3300048091 | Ga0495626_0007792 | Ga0495626_0007792_4380_5462 | 360 |
| 1411 | 3300048091 | Ga0495626_0016287 | Ga0495626_0016287_2251_3333 | 360 |
| 1412 | 3300048091 | Ga0495626_0027792 | Ga0495626_0027792_1036_2118 | 360 |
| 1413 | 3300048905 | Ga0496102_0020156 | Ga0496102_0020156_393_1475 | 360 |
| 1414 | 3300048913 | Ga0496110_0048183 | Ga0496110_0048183_130_1212 | 360 |
| 1415 | 3300048913 | Ga0496110_0164361 | Ga0496110_0164361_388_1470 | 360 |
| 1416 | 3300048914 | Ga0496111_0170923 | Ga0496111_0170923_423_1505 | 360 |
| 1417 | 3300048917 | Ga0496114_0143955 | Ga0496114_0143955_221_1303 | 360 |
| 1418 | 3300048919 | Ga0496116_0001725 | Ga0496116_0001725_7799_8881 | 360 |
| 1419 | 3300048919 | Ga0496116_0011675 | Ga0496116_0011675_4238_5320 | 360 |
| 1420 | 3300048919 | Ga0496116_0025706 | Ga0496116_0025706_2894_3976 | 360 |
| 1421 | 3300048920 | Ga0496117_0006500 | Ga0496117_0006500_7761_8843 | 360 |
| 1422 | 3300048920 | Ga0496117_0007309 | Ga0496117_0007309_382_1464 | 360 |
| 1423 | 3300048920 | Ga0496117_0008713 | Ga0496117_0008713_529_1611 | 360 |
| 1424 | 3300048920 | Ga0496117_0009017 | Ga0496117_0009017_81_1163 | 360 |
| 1425 | 3300048920 | Ga0496117_0017029 | Ga0496117_0017029_442_1527 | 360 |
| 1426 | 3300048920 | Ga0496117_0018515 | Ga0496117_0018515_4278_5360 | 360 |
| 1427 | 3300048920 | Ga0496117_0030449 | Ga0496117_0030449_2620_3705 | 360 |
| 1428 | 3300048920 | Ga0496117_0125530 | Ga0496117_0125530_119_1201 | 360 |
| 1429 | 3300048921 | Ga0496118_0028798 | Ga0496118_0028798_979_2061 | 360 |
| 1430 | 3300048921 | Ga0496118_0031832 | Ga0496118_0031832_377_1459 | 360 |
| 1431 | 3300048921 | Ga0496118_0033154 | Ga0496118_0033154_2733_3815 | 360 |
| 1432 | 3300048921 | Ga0496118_0042110 | Ga0496118_0042110_440_1525 | 360 |
| 1433 | 3300048921 | Ga0496118_0075233 | Ga0496118_0075233_312_1394 | 360 |
| 1434 | 3300048922 | Ga0496119_0000506 | Ga0496119_0000506_40518_41600 | 360 |
| 1435 | 3300048922 | Ga0496119_0071609 | Ga0496119_0071609_386_1468 | 360 |
| 1436 | 3300048923 | Ga0496120_0001362 | Ga0496120_0001362_2667_3749 | 360 |
| 1437 | 3300048924 | Ga0496121_0005168 | Ga0496121_0005168_65_1147 | 360 |
| 1438 | 3300048924 | Ga0496121_0006488 | Ga0496121_0006488_2729_3811 | 360 |
| 1439 | 3300048924 | Ga0496121_0014652 | Ga0496121_0014652_2719_3801 | 360 |
| 1440 | 3300048924 | Ga0496121_0022108 | Ga0496121_0022108_4097_5179 | 360 |
| 1441 | 3300048924 | Ga0496121_0096953 | Ga0496121_0096953_344_1429 | 360 |
| 1442 | 3300048925 | Ga0496122_0001565 | Ga0496122_0001565_32257_33339 | 360 |
| 1443 | 3300048925 | Ga0496122_0007408 | Ga0496122_0007408_5475_6557 | 360 |
| 1444 | 3300048925 | Ga0496122_0021592 | Ga0496122_0021592_437_1519 | 360 |
| 1445 | 3300048925 | Ga0496122_0088032 | Ga0496122_0088032_439_1521 | 360 |
| 1446 | 3300048926 | Ga0496123_0001258 | Ga0496123_0001258_32521_33603 | 360 |
| 1447 | 3300048926 | Ga0496123_0005881 | Ga0496123_0005881_1771_2853 | 360 |
| 1448 | 3300048926 | Ga0496123_0024029 | Ga0496123_0024029_3345_4427 | 360 |
| 1449 | 3300048926 | Ga0496123_0031632 | Ga0496123_0031632_1550_2632 | 360 |
| 1450 | 3300048927 | Ga0496124_0000279 | Ga0496124_0000279_74051_75133 | 360 |
| 1451 | 3300048927 | Ga0496124_0003507 | Ga0496124_0003507_5627_6709 | 360 |
| 1452 | 3300048927 | Ga0496124_0007177 | Ga0496124_0007177_485_1567 | 360 |
| 1453 | 3300048927 | Ga0496124_0013149 | Ga0496124_0013149_4507_5589 | 360 |
| 1454 | 3300048927 | Ga0496124_0035067 | Ga0496124_0035067_165_1247 | 360 |
| 1455 | 3300048927 | Ga0496124_0041751 | Ga0496124_0041751_254_1336 | 360 |
| 1456 | 3300048927 | Ga0496124_0105578 | Ga0496124_0105578_472_1554 | 360 |
| 1457 | 3300048927 | Ga0496124_0121323 | Ga0496124_0121323_27_1109 | 360 |
| 1458 | 3300048928 | Ga0496125_0014065 | Ga0496125_0014065_6211_7293 | 360 |
| 1459 | 3300048928 | Ga0496125_0015865 | Ga0496125_0015865_5738_6823 | 360 |
| 1460 | 3300048928 | Ga0496125_0040690 | Ga0496125_0040690_444_1526 | 360 |
| 1461 | 3300048928 | Ga0496125_0087462 | Ga0496125_0087462_268_1350 | 360 |
| 1462 | 3300048929 | Ga0496126_0043641 | Ga0496126_0043641_105_1187 | 360 |
| 1463 | 3300048929 | Ga0496126_0056657 | Ga0496126_0056657_429_1514 | 360 |
| 1464 | 3300048929 | Ga0496126_0160922 | Ga0496126_0160922_256_1338 | 360 |
| 1465 | 3300049459 | Ga0495678_000054 | Ga0495678_000054_35741_36823 | 360 |
| 1466 | 3300049459 | Ga0495678_000078 | Ga0495678_000078_80000_81082 | 360 |
| 1467 | 3300049459 | Ga0495678_005003 | Ga0495678_005003_4383_5465 | 360 |
| 1468 | 3300049459 | Ga0495678_006344 | Ga0495678_006344_2666_3748 | 360 |
| 1469 | 3300049459 | Ga0495678_007286 | Ga0495678_007286_369_1451 | 360 |
| 1470 | 3300049459 | Ga0495678_011543 | Ga0495678_011543_2076_3158 | 360 |
| 1471 | 3300049459 | Ga0495678_061005 | Ga0495678_061005_193_1275 | 360 |
| 1472 | 3300049460 | Ga0495682_0001399 | Ga0495682_0001399_2737_3819 | 360 |
| 1473 | 3300049460 | Ga0495682_0001713 | Ga0495682_0001713_9021_10103 | 360 |
| 1474 | 3300049460 | Ga0495682_0030254 | Ga0495682_0030254_483_1565 | 360 |
| 1475 | 3300049460 | Ga0495682_0069278 | Ga0495682_0069278_111_1193 | 360 |
| 1476 | 3300049569 | Ga0501032_0011796 | Ga0501032_0011796_3153_4238 | 360 |
| 1477 | 3300049571 | Ga0501034_0000136 | Ga0501034_0000136_92879_93961 | 360 |
| 1478 | 3300049581 | Ga0501047_0215307 | Ga0501047_0215307_576_1661 | 360 |
| 1479 | 3300049853 | Ga0501226_000060 | Ga0501226_000060_10617_11699 | 360 |
| 1480 | 3300053098 | Ga0500650_0000224 | Ga0500650_0000224_4352_5440 | 360 |
| 1481 | 3300053138 | Ga0500564_007906 | Ga0500564_007906_2105_3190 | 360 |
| 1482 | 3300055283 | Ga0500661_012745 | Ga0500661_012745_349_1431 | 360 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aw8-assembly1.cif.gz_B | crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 | 0.9571 | 3 | 359 |
| 4ma5-assembly1.cif.gz_A-2 | the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. | 0.9548 | 1 | 358 |
| 4ma0-assembly1.cif.gz_A | the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp | 0.9517 | 1 | 358 |
| 4ma5-assembly1.cif.gz_A-2 | the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. | 0.9496 | 1 | 358 |
| 4e4t-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria | 0.9473 | 2 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54QE4_620_731_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9775 | 2 | 100 | 3.40.50.20 |
| 3v4sB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9694 | 2 | 105 | 3.40.50.20 |
| 3aw8B03 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9684 | 176 | 359 | 3.30.470.20 |
| 3aw8B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9631 | 3 | 94 | 3.40.50.20 |
| 4izoA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9578 | 2 | 105 | 3.40.50.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A359EMS6-F1-model_v4 | deleted | 0.9988 | 1 | 71 |
|
| AF-A0A101DAU9-F1-model_v4 | Phosphoribosylaminoimidazole carboxylase ATPase subunit | 0.9985 | 148 | 358 |
GO:0003824
GO:0005524 GO:0005829 GO:0046872 |
| AF-A0A355R742-F1-model_v4 | 5-(Carboxyamino)imidazole ribonucleotide synthase (EC 4.1.1.21) | 0.9957 | 1 | 95 |
GO:0004638
GO:0005829 |
| AF-A0A259SD53-F1-model_v4 | 5-(Carboxyamino)imidazole ribonucleotide synthase | 0.9932 | 193 | 345 |
GO:0003824
GO:0005524 GO:0005829 GO:0046872 |
| AF-A0A2E2J851-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) | 0.986 | 1 | 358 |
GO:0004638
GO:0005524 GO:0005829 GO:0006189 GO:0034028 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar