F494251
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1477 | 526 | 1477 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_2276575|Ga0453684_2276575_65_370 |
| Length | 101 |
| Sequence | MAKKSVLERQKKREILVARRWKQREELRKKGVDASLTEEERQQARVALNKMPRDTSIIRLRTRCQCTGRARGVYKKFKLSRLCFRELALTGMIPGITKASW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 139 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 214 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 227 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 236 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 247 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 276 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 285 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 295 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 296 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 297 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 298 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 299 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 309 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 310 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 311 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 312 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 313 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 314 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 315 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 316 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 317 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 318 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 319 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 320 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 321 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 322 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 323 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 324 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 325 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 326 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 327 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 328 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 329 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 330 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 333 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 334 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 335 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 336 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 337 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 338 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 339 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 340 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 341 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 342 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 407 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 408 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 409 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 410 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 411 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 419 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 420 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 421 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 422 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 423 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 424 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 425 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 428 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 429 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 456 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 457 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 466 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 480 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 481 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 482 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 483 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 484 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 485 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 487 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 488 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 490 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 491 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 492 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 494 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 496 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 497 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 499 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 500 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 502 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 503 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 526 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.16 |
| Metatranscriptomes | 2.84 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.72 |
| Nodule | 0 |
| Rhizoplane | 4.6 |
| Rhizosphere | 86.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2458830 | 2162886007 | Bacteria | 2754 |
| 2 | SwRhRL2b_contig_305464 | 2162886007 | Bacteria | 3378 |
| 3 | LJNas_1009780 | 3300000546 | Unclassified | 1024 |
| 4 | rootL2_10298515 | 3300003322 | Bacteria | 1414 |
| 5 | Ga0065707_10083802 | 3300005295 | Bacteria | 8210 |
| 6 | Ga0070658_10257996 | 3300005327 | Bacteria | 1480 |
| 7 | Ga0070658_10295114 | 3300005327 | Bacteria | 1382 |
| 8 | Ga0070676_10073677 | 3300005328 | Bacteria | 2055 |
| 9 | Ga0070676_10479439 | 3300005328 | Bacteria | 879 |
| 10 | Ga0070676_11028069 | 3300005328 | Bacteria | 620 |
| 11 | Ga0070683_100880746 | 3300005329 | Bacteria | 859 |
| 12 | Ga0070683_100929438 | 3300005329 | Bacteria | 835 |
| 13 | Ga0070690_100185153 | 3300005330 | Bacteria | 1440 |
| 14 | Ga0070690_100818035 | 3300005330 | Bacteria | 724 |
| 15 | Ga0070670_100000015 | 3300005331 | Bacteria | 228819 |
| 16 | Ga0070670_100042316 | 3300005331 | Bacteria | 3915 |
| 17 | Ga0070670_100199450 | 3300005331 | Bacteria | 1738 |
| 18 | Ga0070670_100265999 | 3300005331 | Bacteria | 1495 |
| 19 | Ga0070670_100873049 | 3300005331 | Bacteria | 815 |
| 20 | Ga0070677_10072009 | 3300005333 | Bacteria | 1456 |
| 21 | Ga0070677_10097789 | 3300005333 | Bacteria | 1288 |
| 22 | Ga0068869_100157158 | 3300005334 | Bacteria | 1767 |
| 23 | Ga0068869_100185294 | 3300005334 | Bacteria | 1633 |
| 24 | Ga0068869_100227172 | 3300005334 | Bacteria | 1482 |
| 25 | Ga0068869_100263074 | 3300005334 | Bacteria | 1381 |
| 26 | Ga0068869_100263844 | 3300005334 | Bacteria | 1379 |
| 27 | Ga0068869_100272095 | 3300005334 | Bacteria | 1359 |
| 28 | Ga0068869_100482335 | 3300005334 | Bacteria | 1032 |
| 29 | Ga0068869_100800604 | 3300005334 | Bacteria | 810 |
| 30 | Ga0070666_10001446 | 3300005335 | Bacteria | 14396 |
| 31 | Ga0070666_10005025 | 3300005335 | Bacteria | 8088 |
| 32 | Ga0070666_10007123 | 3300005335 | Bacteria | 6896 |
| 33 | Ga0070666_10128706 | 3300005335 | Bacteria | 1758 |
| 34 | Ga0070666_10520393 | 3300005335 | Bacteria | 863 |
| 35 | Ga0070680_100040283 | 3300005336 | Bacteria | 3782 |
| 36 | Ga0070680_100105088 | 3300005336 | Bacteria | 2347 |
| 37 | Ga0070680_100262924 | 3300005336 | Bacteria | 1460 |
| 38 | Ga0070680_100391830 | 3300005336 | Bacteria | 1183 |
| 39 | Ga0070682_100093827 | 3300005337 | Bacteria | 1968 |
| 40 | Ga0070682_100196386 | 3300005337 | Bacteria | 1420 |
| 41 | Ga0070682_100295777 | 3300005337 | Bacteria | 1186 |
| 42 | Ga0070682_100522069 | 3300005337 | Bacteria | 924 |
| 43 | Ga0070682_101875204 | 3300005337 | Bacteria | 524 |
| 44 | Ga0070682_101957885 | 3300005337 | Bacteria | 514 |
| 45 | Ga0068868_100008294 | 3300005338 | Bacteria | 7438 |
| 46 | Ga0068868_100155721 | 3300005338 | Bacteria | 1884 |
| 47 | Ga0068868_100297572 | 3300005338 | Bacteria | 1370 |
| 48 | Ga0068868_100945844 | 3300005338 | Bacteria | 785 |
| 49 | Ga0070660_100218304 | 3300005339 | Bacteria | 1549 |
| 50 | Ga0070660_100822022 | 3300005339 | Bacteria | 782 |
| 51 | Ga0070660_101314308 | 3300005339 | Bacteria | 614 |
| 52 | Ga0070689_100015417 | 3300005340 | Bacteria | 5572 |
| 53 | Ga0070689_100194297 | 3300005340 | Bacteria | 1653 |
| 54 | Ga0070689_100639427 | 3300005340 | Bacteria | 924 |
| 55 | Ga0070689_100729449 | 3300005340 | Bacteria | 867 |
| 56 | Ga0070689_101539914 | 3300005340 | Bacteria | 603 |
| 57 | Ga0070687_100398813 | 3300005343 | Bacteria | 901 |
| 58 | Ga0070661_100043750 | 3300005344 | Bacteria | 3271 |
| 59 | Ga0070661_100405968 | 3300005344 | Bacteria | 1078 |
| 60 | Ga0070661_100476134 | 3300005344 | Bacteria | 996 |
| 61 | Ga0070692_10637538 | 3300005345 | Bacteria | 710 |
| 62 | Ga0070668_100015678 | 3300005347 | Bacteria | 5667 |
| 63 | Ga0070668_100304484 | 3300005347 | Bacteria | 1337 |
| 64 | Ga0070668_100553556 | 3300005347 | Bacteria | 1001 |
| 65 | Ga0070668_100701114 | 3300005347 | Bacteria | 893 |
| 66 | Ga0070668_101105513 | 3300005347 | Bacteria | 715 |
| 67 | Ga0070669_100004607 | 3300005353 | Bacteria | 9957 |
| 68 | Ga0070669_100068175 | 3300005353 | Bacteria | 2626 |
| 69 | Ga0070669_101167194 | 3300005353 | Bacteria | 664 |
| 70 | Ga0070675_100604755 | 3300005354 | Bacteria | 994 |
| 71 | Ga0070675_101450340 | 3300005354 | Bacteria | 633 |
| 72 | Ga0070675_101542601 | 3300005354 | Bacteria | 613 |
| 73 | Ga0070675_101975770 | 3300005354 | Bacteria | 538 |
| 74 | Ga0070671_100000013 | 3300005355 | Bacteria | 173287 |
| 75 | Ga0070671_100003161 | 3300005355 | Bacteria | 12839 |
| 76 | Ga0070671_100005400 | 3300005355 | Bacteria | 10190 |
| 77 | Ga0070671_100024367 | 3300005355 | Bacteria | 4953 |
| 78 | Ga0070671_100043910 | 3300005355 | Bacteria | 3714 |
| 79 | Ga0070671_100194729 | 3300005355 | Bacteria | 1718 |
| 80 | Ga0070671_100289073 | 3300005355 | Bacteria | 1395 |
| 81 | Ga0070671_100968024 | 3300005355 | Bacteria | 745 |
| 82 | Ga0070671_101230034 | 3300005355 | Bacteria | 659 |
| 83 | Ga0070674_100459821 | 3300005356 | Bacteria | 1052 |
| 84 | Ga0070674_100875519 | 3300005356 | Bacteria | 781 |
| 85 | Ga0070674_101181444 | 3300005356 | Bacteria | 678 |
| 86 | Ga0070673_100069532 | 3300005364 | Bacteria | 2822 |
| 87 | Ga0070673_100126122 | 3300005364 | Bacteria | 2142 |
| 88 | Ga0070673_101085747 | 3300005364 | Bacteria | 747 |
| 89 | Ga0070688_100001170 | 3300005365 | Bacteria | 13058 |
| 90 | Ga0070688_100100587 | 3300005365 | Bacteria | 1905 |
| 91 | Ga0070688_100224119 | 3300005365 | Bacteria | 1326 |
| 92 | Ga0070688_101429513 | 3300005365 | Bacteria | 561 |
| 93 | Ga0070659_100912333 | 3300005366 | Bacteria | 768 |
| 94 | Ga0070659_101332672 | 3300005366 | Bacteria | 637 |
| 95 | Ga0070667_100000015 | 3300005367 | Bacteria | 238203 |
| 96 | Ga0070667_100012347 | 3300005367 | Bacteria | 7064 |
| 97 | Ga0070667_100052533 | 3300005367 | Bacteria | 3439 |
| 98 | Ga0070667_100055472 | 3300005367 | Bacteria | 3346 |
| 99 | Ga0070667_100129962 | 3300005367 | Bacteria | 2197 |
| 100 | Ga0070667_100246143 | 3300005367 | Bacteria | 1597 |
| 101 | Ga0070667_100332046 | 3300005367 | Bacteria | 1374 |
| 102 | Ga0070667_100361652 | 3300005367 | Bacteria | 1315 |
| 103 | Ga0070667_100496374 | 3300005367 | Bacteria | 1119 |
| 104 | Ga0070667_100907096 | 3300005367 | Bacteria | 820 |
| 105 | Ga0070667_101053655 | 3300005367 | Bacteria | 759 |
| 106 | Ga0070667_101650388 | 3300005367 | Bacteria | 603 |
| 107 | Ga0070709_10009928 | 3300005434 | Bacteria | 5262 |
| 108 | Ga0070709_10015515 | 3300005434 | Bacteria | 4337 |
| 109 | Ga0070709_10540170 | 3300005434 | Bacteria | 891 |
| 110 | Ga0070709_11246486 | 3300005434 | Bacteria | 599 |
| 111 | Ga0070714_100009500 | 3300005435 | Bacteria | 7649 |
| 112 | Ga0070714_100039089 | 3300005435 | Bacteria | 3993 |
| 113 | Ga0070714_100118523 | 3300005435 | Bacteria | 2352 |
| 114 | Ga0070713_100001795 | 3300005436 | Bacteria | 13831 |
| 115 | Ga0070713_100006105 | 3300005436 | Bacteria | 8311 |
| 116 | Ga0070713_100143194 | 3300005436 | Bacteria | 2119 |
| 117 | Ga0070713_102210715 | 3300005436 | Bacteria | 533 |
| 118 | Ga0070710_10218779 | 3300005437 | Bacteria | 1211 |
| 119 | Ga0070710_10282913 | 3300005437 | Bacteria | 1077 |
| 120 | Ga0070710_10284586 | 3300005437 | Bacteria | 1074 |
| 121 | Ga0070710_10297749 | 3300005437 | Bacteria | 1052 |
| 122 | Ga0070710_10439812 | 3300005437 | Bacteria | 882 |
| 123 | Ga0070710_10509940 | 3300005437 | Bacteria | 825 |
| 124 | Ga0070701_10012276 | 3300005438 | Bacteria | 3858 |
| 125 | Ga0070701_10936903 | 3300005438 | Bacteria | 600 |
| 126 | Ga0070701_11077180 | 3300005438 | Bacteria | 564 |
| 127 | Ga0070711_100001465 | 3300005439 | Bacteria | 12963 |
| 128 | Ga0070711_100025752 | 3300005439 | Bacteria | 3851 |
| 129 | Ga0070711_100102588 | 3300005439 | Bacteria | 2083 |
| 130 | Ga0070711_101116594 | 3300005439 | Bacteria | 680 |
| 131 | Ga0070705_100026638 | 3300005440 | Bacteria | 3148 |
| 132 | Ga0070705_100959165 | 3300005440 | Bacteria | 692 |
| 133 | Ga0070705_101410545 | 3300005440 | Bacteria | 581 |
| 134 | Ga0070700_100108314 | 3300005441 | Bacteria | 1842 |
| 135 | Ga0070700_100111081 | 3300005441 | Bacteria | 1822 |
| 136 | Ga0070694_100203816 | 3300005444 | Bacteria | 1476 |
| 137 | Ga0070694_100266569 | 3300005444 | Bacteria | 1301 |
| 138 | Ga0070694_101631334 | 3300005444 | Bacteria | 548 |
| 139 | Ga0070663_100261291 | 3300005455 | Bacteria | 1373 |
| 140 | Ga0070663_100460622 | 3300005455 | Bacteria | 1050 |
| 141 | Ga0070663_100887224 | 3300005455 | Bacteria | 769 |
| 142 | Ga0070663_100961791 | 3300005455 | Bacteria | 741 |
| 143 | Ga0070678_100002594 | 3300005456 | Bacteria | 9934 |
| 144 | Ga0070678_100003045 | 3300005456 | Bacteria | 9285 |
| 145 | Ga0070662_100193386 | 3300005457 | Bacteria | 1610 |
| 146 | Ga0070662_100324196 | 3300005457 | Bacteria | 1257 |
| 147 | Ga0070662_100566273 | 3300005457 | Bacteria | 953 |
| 148 | Ga0070662_101037380 | 3300005457 | Bacteria | 703 |
| 149 | Ga0070681_10008976 | 3300005458 | Bacteria | 9830 |
| 150 | Ga0070681_10035786 | 3300005458 | Bacteria | 4988 |
| 151 | Ga0070681_10048581 | 3300005458 | Bacteria | 4239 |
| 152 | Ga0070681_10124955 | 3300005458 | Bacteria | 2505 |
| 153 | Ga0070681_10226323 | 3300005458 | Bacteria | 1785 |
| 154 | Ga0070681_10447630 | 3300005458 | Bacteria | 1203 |
| 155 | Ga0070681_10857361 | 3300005458 | Unclassified | 826 |
| 156 | Ga0068867_100034823 | 3300005459 | Bacteria | 3651 |
| 157 | Ga0068867_100284808 | 3300005459 | Bacteria | 1356 |
| 158 | Ga0068867_100308681 | 3300005459 | Bacteria | 1306 |
| 159 | Ga0068867_100582762 | 3300005459 | Bacteria | 973 |
| 160 | Ga0068867_102247104 | 3300005459 | Bacteria | 518 |
| 161 | Ga0070685_10000104 | 3300005466 | Bacteria | 53528 |
| 162 | Ga0070685_10075272 | 3300005466 | Bacteria | 2010 |
| 163 | Ga0070685_10359631 | 3300005466 | Bacteria | 997 |
| 164 | Ga0070685_10379550 | 3300005466 | Bacteria | 973 |
| 165 | Ga0070685_10694073 | 3300005466 | Bacteria | 741 |
| 166 | Ga0070706_100618727 | 3300005467 | Bacteria | 1006 |
| 167 | Ga0070698_100403358 | 3300005471 | Bacteria | 1301 |
| 168 | Ga0070699_100038586 | 3300005518 | Bacteria | 4136 |
| 169 | Ga0070699_101982475 | 3300005518 | Bacteria | 532 |
| 170 | Ga0070679_100017288 | 3300005530 | Bacteria | 6978 |
| 171 | Ga0070679_100103898 | 3300005530 | Bacteria | 2827 |
| 172 | Ga0070679_100392779 | 3300005530 | Bacteria | 1333 |
| 173 | Ga0070679_100461063 | 3300005530 | Bacteria | 1215 |
| 174 | Ga0070679_100979079 | 3300005530 | Bacteria | 790 |
| 175 | Ga0070684_100247020 | 3300005535 | Bacteria | 1631 |
| 176 | Ga0070684_100338267 | 3300005535 | Bacteria | 1384 |
| 177 | Ga0068853_100093611 | 3300005539 | Bacteria | 2646 |
| 178 | Ga0068853_100411250 | 3300005539 | Bacteria | 1267 |
| 179 | Ga0068853_100832908 | 3300005539 | Bacteria | 884 |
| 180 | Ga0068853_102131749 | 3300005539 | Bacteria | 543 |
| 181 | Ga0070672_100029396 | 3300005543 | Bacteria | 4120 |
| 182 | Ga0070672_100123866 | 3300005543 | Bacteria | 2119 |
| 183 | Ga0070672_101584022 | 3300005543 | Bacteria | 587 |
| 184 | Ga0070686_100033543 | 3300005544 | Bacteria | 3155 |
| 185 | Ga0070686_100067091 | 3300005544 | Bacteria | 2336 |
| 186 | Ga0070686_100304762 | 3300005544 | Bacteria | 1182 |
| 187 | Ga0070686_100328730 | 3300005544 | Bacteria | 1142 |
| 188 | Ga0070686_100331701 | 3300005544 | Bacteria | 1137 |
| 189 | Ga0070686_100427149 | 3300005544 | Bacteria | 1013 |
| 190 | Ga0070686_101294030 | 3300005544 | Bacteria | 609 |
| 191 | Ga0070695_100002554 | 3300005545 | Bacteria | 10512 |
| 192 | Ga0070695_100315217 | 3300005545 | Bacteria | 1161 |
| 193 | Ga0070696_100001443 | 3300005546 | Bacteria | 15552 |
| 194 | Ga0070696_100094917 | 3300005546 | Bacteria | 2129 |
| 195 | Ga0070696_100302416 | 3300005546 | Bacteria | 1226 |
| 196 | Ga0070696_100456680 | 3300005546 | Bacteria | 1009 |
| 197 | Ga0070693_100005307 | 3300005547 | Bacteria | 6176 |
| 198 | Ga0070693_100297442 | 3300005547 | Bacteria | 1087 |
| 199 | Ga0070693_100486805 | 3300005547 | Bacteria | 872 |
| 200 | Ga0070693_100898563 | 3300005547 | Bacteria | 664 |
| 201 | Ga0070665_100000175 | 3300005548 | Bacteria | 113874 |
| 202 | Ga0070665_100003465 | 3300005548 | Bacteria | 16812 |
| 203 | Ga0070665_100005442 | 3300005548 | Bacteria | 13132 |
| 204 | Ga0070665_100007665 | 3300005548 | Bacteria | 10970 |
| 205 | Ga0070665_100008007 | 3300005548 | Bacteria | 10704 |
| 206 | Ga0070665_100008860 | 3300005548 | Bacteria | 10186 |
| 207 | Ga0070665_100014481 | 3300005548 | Bacteria | 7909 |
| 208 | Ga0070665_100041345 | 3300005548 | Bacteria | 4633 |
| 209 | Ga0070665_100045273 | 3300005548 | Bacteria | 4419 |
| 210 | Ga0070665_100088333 | 3300005548 | Bacteria | 3105 |
| 211 | Ga0070665_100373744 | 3300005548 | Bacteria | 1432 |
| 212 | Ga0070665_101260584 | 3300005548 | Bacteria | 749 |
| 213 | Ga0070665_101569949 | 3300005548 | Bacteria | 666 |
| 214 | Ga0070665_101617870 | 3300005548 | Bacteria | 655 |
| 215 | Ga0070704_100096958 | 3300005549 | Bacteria | 2212 |
| 216 | Ga0070704_101225118 | 3300005549 | Bacteria | 685 |
| 217 | Ga0070704_101291132 | 3300005549 | Bacteria | 668 |
| 218 | Ga0068855_100008308 | 3300005563 | Bacteria | 12546 |
| 219 | Ga0068855_100032357 | 3300005563 | Bacteria | 6245 |
| 220 | Ga0068855_100065515 | 3300005563 | Bacteria | 4235 |
| 221 | Ga0068855_100114994 | 3300005563 | Bacteria | 3084 |
| 222 | Ga0068855_100271336 | 3300005563 | Bacteria | 1886 |
| 223 | Ga0068855_100285468 | 3300005563 | Bacteria | 1831 |
| 224 | Ga0068855_100428146 | 3300005563 | Bacteria | 1447 |
| 225 | Ga0068855_100586554 | 3300005563 | Bacteria | 1203 |
| 226 | Ga0068855_100685966 | 3300005563 | Bacteria | 1097 |
| 227 | Ga0070664_100047403 | 3300005564 | Bacteria | 3630 |
| 228 | Ga0070664_100155787 | 3300005564 | Bacteria | 2018 |
| 229 | Ga0070664_100380435 | 3300005564 | Bacteria | 1288 |
| 230 | Ga0070664_101172709 | 3300005564 | Bacteria | 724 |
| 231 | Ga0070664_101232379 | 3300005564 | Bacteria | 706 |
| 232 | Ga0070664_101274042 | 3300005564 | Bacteria | 694 |
| 233 | Ga0070664_101451379 | 3300005564 | Bacteria | 649 |
| 234 | Ga0070664_101766471 | 3300005564 | Bacteria | 586 |
| 235 | Ga0068857_100399905 | 3300005577 | Bacteria | 1278 |
| 236 | Ga0068857_100466980 | 3300005577 | Bacteria | 1181 |
| 237 | Ga0068857_101793026 | 3300005577 | Bacteria | 601 |
| 238 | Ga0068854_100120736 | 3300005578 | Bacteria | 1989 |
| 239 | Ga0068854_100126961 | 3300005578 | Bacteria | 1943 |
| 240 | Ga0068854_100585414 | 3300005578 | Bacteria | 951 |
| 241 | Ga0068854_100961944 | 3300005578 | Bacteria | 754 |
| 242 | Ga0068854_101178647 | 3300005578 | Bacteria | 685 |
| 243 | Ga0068854_101347674 | 3300005578 | Bacteria | 644 |
| 244 | Ga0068856_100006458 | 3300005614 | Bacteria | 11500 |
| 245 | Ga0068856_100042931 | 3300005614 | Bacteria | 4449 |
| 246 | Ga0068856_100047430 | 3300005614 | Bacteria | 4231 |
| 247 | Ga0068856_100065387 | 3300005614 | Bacteria | 3594 |
| 248 | Ga0068856_101019825 | 3300005614 | Bacteria | 846 |
| 249 | Ga0068856_101760333 | 3300005614 | Bacteria | 632 |
| 250 | Ga0070702_100447241 | 3300005615 | Bacteria | 936 |
| 251 | Ga0070702_100490995 | 3300005615 | Bacteria | 899 |
| 252 | Ga0070702_101506072 | 3300005615 | Bacteria | 554 |
| 253 | Ga0068852_100172880 | 3300005616 | Bacteria | 2026 |
| 254 | Ga0068852_100275903 | 3300005616 | Bacteria | 1619 |
| 255 | Ga0068852_100907747 | 3300005616 | Bacteria | 898 |
| 256 | Ga0068852_102181017 | 3300005616 | Bacteria | 575 |
| 257 | Ga0068859_100000641 | 3300005617 | Bacteria | 34946 |
| 258 | Ga0068859_100005854 | 3300005617 | Bacteria | 12474 |
| 259 | Ga0068859_100047020 | 3300005617 | Bacteria | 4334 |
| 260 | Ga0068859_100056515 | 3300005617 | Bacteria | 3950 |
| 261 | Ga0068859_100077312 | 3300005617 | Bacteria | 3369 |
| 262 | Ga0068859_100291710 | 3300005617 | Bacteria | 1724 |
| 263 | Ga0068859_100313859 | 3300005617 | Bacteria | 1661 |
| 264 | Ga0068859_101283777 | 3300005617 | Bacteria | 807 |
| 265 | Ga0068859_103057760 | 3300005617 | Bacteria | 510 |
| 266 | Ga0068864_100000056 | 3300005618 | Bacteria | 127891 |
| 267 | Ga0068864_100043033 | 3300005618 | Bacteria | 3866 |
| 268 | Ga0068864_100839782 | 3300005618 | Bacteria | 904 |
| 269 | Ga0068864_100858896 | 3300005618 | Bacteria | 894 |
| 270 | Ga0068864_101536866 | 3300005618 | Bacteria | 669 |
| 271 | Ga0068864_101545628 | 3300005618 | Bacteria | 667 |
| 272 | Ga0068866_10002031 | 3300005718 | Bacteria | 8429 |
| 273 | Ga0068866_10091532 | 3300005718 | Bacteria | 1657 |
| 274 | Ga0068866_10633009 | 3300005718 | Bacteria | 726 |
| 275 | Ga0068866_10784860 | 3300005718 | Bacteria | 661 |
| 276 | Ga0068861_100066380 | 3300005719 | Bacteria | 2781 |
| 277 | Ga0068861_100097092 | 3300005719 | Bacteria | 2336 |
| 278 | Ga0068861_100167386 | 3300005719 | Bacteria | 1819 |
| 279 | Ga0068861_100388924 | 3300005719 | Bacteria | 1234 |
| 280 | Ga0068861_101079416 | 3300005719 | Bacteria | 770 |
| 281 | Ga0068861_101116219 | 3300005719 | Bacteria | 758 |
| 282 | Ga0068861_101691155 | 3300005719 | Bacteria | 625 |
| 283 | Ga0068861_102259291 | 3300005719 | Bacteria | 545 |
| 284 | Ga0068851_10032527 | 3300005834 | Bacteria | 2595 |
| 285 | Ga0068851_10351588 | 3300005834 | Bacteria | 857 |
| 286 | Ga0068870_10001674 | 3300005840 | Bacteria | 9068 |
| 287 | Ga0068870_10164633 | 3300005840 | Bacteria | 1318 |
| 288 | Ga0068870_10629134 | 3300005840 | Bacteria | 732 |
| 289 | Ga0068870_10837143 | 3300005840 | Bacteria | 645 |
| 290 | Ga0068863_100008761 | 3300005841 | Bacteria | 9878 |
| 291 | Ga0068863_100069769 | 3300005841 | Bacteria | 3323 |
| 292 | Ga0068863_100075635 | 3300005841 | Bacteria | 3186 |
| 293 | Ga0068863_100154561 | 3300005841 | Bacteria | 2196 |
| 294 | Ga0068863_100156589 | 3300005841 | Bacteria | 2181 |
| 295 | Ga0068863_100181690 | 3300005841 | Bacteria | 2019 |
| 296 | Ga0068863_100368482 | 3300005841 | Bacteria | 1401 |
| 297 | Ga0068863_100649716 | 3300005841 | Bacteria | 1046 |
| 298 | Ga0068863_100731629 | 3300005841 | Bacteria | 984 |
| 299 | Ga0068863_100936433 | 3300005841 | Bacteria | 867 |
| 300 | Ga0068863_101486838 | 3300005841 | Bacteria | 686 |
| 301 | Ga0068863_102334353 | 3300005841 | Bacteria | 545 |
| 302 | Ga0068858_100000125 | 3300005842 | Bacteria | 79795 |
| 303 | Ga0068858_100004270 | 3300005842 | Bacteria | 14053 |
| 304 | Ga0068858_100031324 | 3300005842 | Bacteria | 4939 |
| 305 | Ga0068858_100054829 | 3300005842 | Bacteria | 3686 |
| 306 | Ga0068858_100130358 | 3300005842 | Bacteria | 2357 |
| 307 | Ga0068858_100143953 | 3300005842 | Bacteria | 2238 |
| 308 | Ga0068858_100458094 | 3300005842 | Bacteria | 1230 |
| 309 | Ga0068858_101216752 | 3300005842 | Bacteria | 741 |
| 310 | Ga0068858_102467426 | 3300005842 | Bacteria | 514 |
| 311 | Ga0068860_100002410 | 3300005843 | Bacteria | 19616 |
| 312 | Ga0068860_100006244 | 3300005843 | Bacteria | 11972 |
| 313 | Ga0068860_100009263 | 3300005843 | Bacteria | 9789 |
| 314 | Ga0068860_100010872 | 3300005843 | Bacteria | 8977 |
| 315 | Ga0068860_100074726 | 3300005843 | Bacteria | 3223 |
| 316 | Ga0068860_100125358 | 3300005843 | Bacteria | 2461 |
| 317 | Ga0068860_100987493 | 3300005843 | Bacteria | 860 |
| 318 | Ga0068860_101441857 | 3300005843 | Bacteria | 710 |
| 319 | Ga0068860_102036230 | 3300005843 | Bacteria | 596 |
| 320 | Ga0068860_102307423 | 3300005843 | Bacteria | 559 |
| 321 | Ga0068862_100008335 | 3300005844 | Bacteria | 8578 |
| 322 | Ga0068862_100065242 | 3300005844 | Bacteria | 3136 |
| 323 | Ga0068862_100098243 | 3300005844 | Bacteria | 2557 |
| 324 | Ga0068862_100145559 | 3300005844 | Bacteria | 2106 |
| 325 | Ga0068862_100198509 | 3300005844 | Bacteria | 1808 |
| 326 | Ga0068862_100344838 | 3300005844 | Bacteria | 1380 |
| 327 | Ga0068862_101189284 | 3300005844 | Bacteria | 760 |
| 328 | Ga0081455_10008699 | 3300005937 | Bacteria | 10513 |
| 329 | Ga0081540_1179590 | 3300005983 | Bacteria | 794 |
| 330 | Ga0070717_10062172 | 3300006028 | Bacteria | 3096 |
| 331 | Ga0075368_10226039 | 3300006042 | Bacteria | 796 |
| 332 | Ga0070715_10000668 | 3300006163 | Bacteria | 9167 |
| 333 | Ga0070715_10111151 | 3300006163 | Bacteria | 1293 |
| 334 | Ga0070716_100004769 | 3300006173 | Bacteria | 6507 |
| 335 | Ga0070716_101570414 | 3300006173 | Bacteria | 540 |
| 336 | Ga0070712_100001456 | 3300006175 | Bacteria | 14428 |
| 337 | Ga0070712_100044366 | 3300006175 | Bacteria | 3065 |
| 338 | Ga0070712_100057768 | 3300006175 | Bacteria | 2727 |
| 339 | Ga0070712_100156187 | 3300006175 | Bacteria | 1757 |
| 340 | Ga0070712_100311663 | 3300006175 | Bacteria | 1277 |
| 341 | Ga0070712_100371053 | 3300006175 | Bacteria | 1176 |
| 342 | Ga0075362_10545825 | 3300006177 | Bacteria | 596 |
| 343 | Ga0075367_10328708 | 3300006178 | Bacteria | 964 |
| 344 | Ga0075367_10857991 | 3300006178 | Bacteria | 579 |
| 345 | Ga0075366_10043507 | 3300006195 | Bacteria | 2660 |
| 346 | Ga0075366_10096819 | 3300006195 | Bacteria | 1770 |
| 347 | Ga0075366_10184479 | 3300006195 | Bacteria | 1268 |
| 348 | Ga0075366_10344993 | 3300006195 | Bacteria | 913 |
| 349 | Ga0097621_100003525 | 3300006237 | Bacteria | 10812 |
| 350 | Ga0097621_100078362 | 3300006237 | Bacteria | 2745 |
| 351 | Ga0097621_100122525 | 3300006237 | Bacteria | 2207 |
| 352 | Ga0097621_100139427 | 3300006237 | Bacteria | 2071 |
| 353 | Ga0097621_100201163 | 3300006237 | Bacteria | 1729 |
| 354 | Ga0097621_100213968 | 3300006237 | Bacteria | 1677 |
| 355 | Ga0097621_100244548 | 3300006237 | Bacteria | 1569 |
| 356 | Ga0097621_100379215 | 3300006237 | Bacteria | 1263 |
| 357 | Ga0097621_100480099 | 3300006237 | Bacteria | 1123 |
| 358 | Ga0097621_100485288 | 3300006237 | Bacteria | 1117 |
| 359 | Ga0097621_100882874 | 3300006237 | Bacteria | 832 |
| 360 | Ga0075370_10203587 | 3300006353 | Bacteria | 1168 |
| 361 | Ga0075370_10434802 | 3300006353 | Bacteria | 789 |
| 362 | Ga0068871_100044280 | 3300006358 | Bacteria | 3578 |
| 363 | Ga0068871_100188243 | 3300006358 | Bacteria | 1777 |
| 364 | Ga0068871_100226252 | 3300006358 | Bacteria | 1622 |
| 365 | Ga0068871_100413993 | 3300006358 | Bacteria | 1202 |
| 366 | Ga0068871_100453812 | 3300006358 | Bacteria | 1149 |
| 367 | Ga0068871_100778809 | 3300006358 | Bacteria | 881 |
| 368 | Ga0068871_100810447 | 3300006358 | Bacteria | 863 |
| 369 | Ga0068871_100851851 | 3300006358 | Bacteria | 843 |
| 370 | Ga0068871_101325124 | 3300006358 | Bacteria | 677 |
| 371 | Ga0068871_101620222 | 3300006358 | Bacteria | 613 |
| 372 | Ga0075428_100802261 | 3300006844 | Bacteria | 1001 |
| 373 | Ga0075430_100218759 | 3300006846 | Bacteria | 1580 |
| 374 | Ga0075430_101708589 | 3300006846 | Bacteria | 516 |
| 375 | Ga0075433_10827216 | 3300006852 | Bacteria | 809 |
| 376 | Ga0075429_100593330 | 3300006880 | Bacteria | 971 |
| 377 | Ga0068865_100001214 | 3300006881 | Bacteria | 15025 |
| 378 | Ga0068865_100010514 | 3300006881 | Bacteria | 5763 |
| 379 | Ga0068865_100021451 | 3300006881 | Bacteria | 4200 |
| 380 | Ga0068865_100037315 | 3300006881 | Bacteria | 3281 |
| 381 | Ga0068865_100074556 | 3300006881 | Bacteria | 2417 |
| 382 | Ga0068865_100902572 | 3300006881 | Bacteria | 768 |
| 383 | Ga0068865_101185461 | 3300006881 | Bacteria | 675 |
| 384 | Ga0068865_101269991 | 3300006881 | Bacteria | 654 |
| 385 | Ga0097620_100000641 | 3300006931 | Bacteria | 34946 |
| 386 | Ga0097620_100005854 | 3300006931 | Bacteria | 12474 |
| 387 | Ga0097620_100047018 | 3300006931 | Bacteria | 4334 |
| 388 | Ga0097620_100056514 | 3300006931 | Bacteria | 3950 |
| 389 | Ga0097620_100077315 | 3300006931 | Bacteria | 3369 |
| 390 | Ga0097620_100291721 | 3300006931 | Bacteria | 1724 |
| 391 | Ga0097620_100313863 | 3300006931 | Bacteria | 1661 |
| 392 | Ga0097620_101283982 | 3300006931 | Bacteria | 807 |
| 393 | Ga0097620_103057767 | 3300006931 | Bacteria | 510 |
| 394 | Ga0075435_100074393 | 3300007076 | Bacteria | 2779 |
| 395 | Ga0099794_10074634 | 3300007265 | Bacteria | 1666 |
| 396 | Ga0099794_10524708 | 3300007265 | Bacteria | 624 |
| 397 | Ga0099795_10003084 | 3300007788 | Bacteria | 4070 |
| 398 | Ga0105240_10010598 | 3300009093 | Bacteria | 12954 |
| 399 | Ga0105240_10029309 | 3300009093 | Bacteria | 7174 |
| 400 | Ga0105240_10086135 | 3300009093 | Bacteria | 3848 |
| 401 | Ga0105240_10112936 | 3300009093 | Bacteria | 3283 |
| 402 | Ga0105240_10242587 | 3300009093 | Bacteria | 2088 |
| 403 | Ga0105240_10281671 | 3300009093 | Bacteria | 1909 |
| 404 | Ga0105240_10582231 | 3300009093 | Bacteria | 1234 |
| 405 | Ga0105240_10626335 | 3300009093 | Bacteria | 1182 |
| 406 | Ga0111539_10799285 | 3300009094 | Bacteria | 1098 |
| 407 | Ga0111539_11140813 | 3300009094 | Bacteria | 906 |
| 408 | Ga0111539_12212886 | 3300009094 | Bacteria | 638 |
| 409 | Ga0111539_12365742 | 3300009094 | Bacteria | 616 |
| 410 | Ga0105245_10087460 | 3300009098 | Bacteria | 2860 |
| 411 | Ga0105245_10099675 | 3300009098 | Bacteria | 2686 |
| 412 | Ga0105245_11037789 | 3300009098 | Bacteria | 865 |
| 413 | Ga0105247_10002466 | 3300009101 | Bacteria | 12578 |
| 414 | Ga0105247_10015909 | 3300009101 | Bacteria | 4504 |
| 415 | Ga0105247_10176946 | 3300009101 | Bacteria | 1422 |
| 416 | Ga0105247_10229055 | 3300009101 | Bacteria | 1261 |
| 417 | Ga0114129_12003029 | 3300009147 | Bacteria | 700 |
| 418 | Ga0105243_10194189 | 3300009148 | Bacteria | 1775 |
| 419 | Ga0105241_10011879 | 3300009174 | Bacteria | 6399 |
| 420 | Ga0105241_10113915 | 3300009174 | Bacteria | 2168 |
| 421 | Ga0105242_10003026 | 3300009176 | Bacteria | 13137 |
| 422 | Ga0105242_10003628 | 3300009176 | Bacteria | 12013 |
| 423 | Ga0105242_10206784 | 3300009176 | Bacteria | 1746 |
| 424 | Ga0105242_10313692 | 3300009176 | Bacteria | 1436 |
| 425 | Ga0105242_13064695 | 3300009176 | Bacteria | 518 |
| 426 | Ga0105248_10003146 | 3300009177 | Bacteria | 18265 |
| 427 | Ga0105248_10005842 | 3300009177 | Bacteria | 13527 |
| 428 | Ga0105248_10023564 | 3300009177 | Bacteria | 6838 |
| 429 | Ga0105248_11602520 | 3300009177 | Bacteria | 737 |
| 430 | Ga0105237_10044034 | 3300009545 | Bacteria | 4495 |
| 431 | Ga0105237_10096005 | 3300009545 | Bacteria | 2955 |
| 432 | Ga0105237_10099219 | 3300009545 | Bacteria | 2904 |
| 433 | Ga0105237_11401620 | 3300009545 | Bacteria | 705 |
| 434 | Ga0105237_12217420 | 3300009545 | Bacteria | 559 |
| 435 | Ga0105238_10022279 | 3300009551 | Bacteria | 6457 |
| 436 | Ga0105238_10406256 | 3300009551 | Bacteria | 1355 |
| 437 | Ga0105238_11488562 | 3300009551 | Bacteria | 705 |
| 438 | Ga0105238_11852273 | 3300009551 | Bacteria | 636 |
| 439 | Ga0105238_11939221 | 3300009551 | Bacteria | 622 |
| 440 | Ga0105238_11982085 | 3300009551 | Bacteria | 616 |
| 441 | Ga0105238_12008678 | 3300009551 | Bacteria | 612 |
| 442 | Ga0105249_10014582 | 3300009553 | Bacteria | 6947 |
| 443 | Ga0105249_12013929 | 3300009553 | Bacteria | 650 |
| 444 | Ga0105249_13085298 | 3300009553 | Bacteria | 535 |
| 445 | Ga0099796_10000013 | 3300010159 | Bacteria | 54630 |
| 446 | Ga0099796_10006593 | 3300010159 | Bacteria | 2983 |
| 447 | Ga0099796_10145978 | 3300010159 | Bacteria | 928 |
| 448 | Ga0099796_10174031 | 3300010159 | Bacteria | 860 |
| 449 | Ga0105239_10103797 | 3300010375 | Bacteria | 3147 |
| 450 | Ga0105239_10500212 | 3300010375 | Bacteria | 1382 |
| 451 | Ga0105239_10564741 | 3300010375 | Bacteria | 1296 |
| 452 | Ga0105239_11021932 | 3300010375 | Bacteria | 951 |
| 453 | Ga0105239_11149118 | 3300010375 | Bacteria | 894 |
| 454 | Ga0105246_10472133 | 3300011119 | Bacteria | 1059 |
| 455 | Ga0105246_10796721 | 3300011119 | Bacteria | 838 |
| 456 | Ga0105246_11577531 | 3300011119 | Bacteria | 619 |
| 457 | Ga0105246_12155952 | 3300011119 | Bacteria | 541 |
| 458 | Ga0157373_10162009 | 3300013100 | Bacteria | 1574 |
| 459 | Ga0157373_11037167 | 3300013100 | Bacteria | 613 |
| 460 | Ga0157371_11264455 | 3300013102 | Bacteria | 570 |
| 461 | Ga0157370_10262850 | 3300013104 | Bacteria | 1595 |
| 462 | Ga0157370_10299273 | 3300013104 | Bacteria | 1485 |
| 463 | Ga0157370_11797859 | 3300013104 | Bacteria | 550 |
| 464 | Ga0157369_10015323 | 3300013105 | Bacteria | 8645 |
| 465 | Ga0157369_10051835 | 3300013105 | Bacteria | 4441 |
| 466 | Ga0157369_10213528 | 3300013105 | Bacteria | 2022 |
| 467 | Ga0157369_10293856 | 3300013105 | Bacteria | 1691 |
| 468 | Ga0157369_10535674 | 3300013105 | Bacteria | 1211 |
| 469 | Ga0157369_10746078 | 3300013105 | Bacteria | 1007 |
| 470 | Ga0157374_10002813 | 3300013296 | Bacteria | 14598 |
| 471 | Ga0157374_10039033 | 3300013296 | Bacteria | 4368 |
| 472 | Ga0157374_10310346 | 3300013296 | Bacteria | 1561 |
| 473 | Ga0157374_10414545 | 3300013296 | Bacteria | 1345 |
| 474 | Ga0157378_10006374 | 3300013297 | Bacteria | 10319 |
| 475 | Ga0157378_10013575 | 3300013297 | Bacteria | 7124 |
| 476 | Ga0163162_10006236 | 3300013306 | Bacteria | 11558 |
| 477 | Ga0163162_10008705 | 3300013306 | Bacteria | 9877 |
| 478 | Ga0163162_10026596 | 3300013306 | Bacteria | 5720 |
| 479 | Ga0163162_10646134 | 3300013306 | Bacteria | 1182 |
| 480 | Ga0163162_10655282 | 3300013306 | Bacteria | 1173 |
| 481 | Ga0163162_11551272 | 3300013306 | Bacteria | 755 |
| 482 | Ga0163162_11693985 | 3300013306 | Bacteria | 722 |
| 483 | Ga0163162_12420139 | 3300013306 | Bacteria | 604 |
| 484 | Ga0163162_12778846 | 3300013306 | Bacteria | 563 |
| 485 | Ga0157372_10081320 | 3300013307 | Bacteria | 3667 |
| 486 | Ga0157372_10897157 | 3300013307 | Bacteria | 1029 |
| 487 | Ga0157372_11041560 | 3300013307 | Bacteria | 947 |
| 488 | Ga0157372_11995561 | 3300013307 | Bacteria | 667 |
| 489 | Ga0157375_10000319 | 3300013308 | Bacteria | 43172 |
| 490 | Ga0157375_10006856 | 3300013308 | Bacteria | 9930 |
| 491 | Ga0157375_10493225 | 3300013308 | Bacteria | 1389 |
| 492 | Ga0157375_10545902 | 3300013308 | Bacteria | 1321 |
| 493 | Ga0157375_11014123 | 3300013308 | Bacteria | 969 |
| 494 | Ga0157375_11627865 | 3300013308 | Bacteria | 764 |
| 495 | Ga0163163_10000199 | 3300014325 | Bacteria | 62045 |
| 496 | Ga0163163_10007457 | 3300014325 | Bacteria | 9652 |
| 497 | Ga0163163_10176222 | 3300014325 | Bacteria | 2185 |
| 498 | Ga0163163_10404151 | 3300014325 | Bacteria | 1424 |
| 499 | Ga0163163_10733157 | 3300014325 | Bacteria | 1052 |
| 500 | Ga0163163_11985108 | 3300014325 | Bacteria | 642 |
| 501 | Ga0157380_11708957 | 3300014326 | Bacteria | 687 |
| 502 | Ga0157380_12923379 | 3300014326 | Bacteria | 544 |
| 503 | Ga0157377_10941315 | 3300014745 | Bacteria | 649 |
| 504 | Ga0157379_10006918 | 3300014968 | Bacteria | 9807 |
| 505 | Ga0157379_10037733 | 3300014968 | Bacteria | 4309 |
| 506 | Ga0157379_10055138 | 3300014968 | Bacteria | 3552 |
| 507 | Ga0157379_10082681 | 3300014968 | Bacteria | 2877 |
| 508 | Ga0157379_10187423 | 3300014968 | Bacteria | 1870 |
| 509 | Ga0157379_10447257 | 3300014968 | Bacteria | 1192 |
| 510 | Ga0157379_10949746 | 3300014968 | Bacteria | 818 |
| 511 | Ga0157379_11261575 | 3300014968 | Bacteria | 712 |
| 512 | Ga0157379_12059406 | 3300014968 | Bacteria | 565 |
| 513 | Ga0157376_10131141 | 3300014969 | Bacteria | 2236 |
| 514 | Ga0157376_10278682 | 3300014969 | Bacteria | 1574 |
| 515 | Ga0157376_10280609 | 3300014969 | Bacteria | 1569 |
| 516 | Ga0157376_10447997 | 3300014969 | Bacteria | 1259 |
| 517 | Ga0157376_11563247 | 3300014969 | Bacteria | 693 |
| 518 | Ga0182007_10211695 | 3300015262 | Bacteria | 682 |
| 519 | Ga0163161_10205021 | 3300017792 | Bacteria | 1521 |
| 520 | Ga0163161_10501275 | 3300017792 | Bacteria | 989 |
| 521 | Ga0197907_10294975 | 3300020069 | Unclassified | 521 |
| 522 | Ga0206356_11568175 | 3300020070 | Bacteria | 1269 |
| 523 | Ga0206356_11640133 | 3300020070 | Bacteria | 2223 |
| 524 | Ga0206351_10700694 | 3300020077 | Bacteria | 1521 |
| 525 | Ga0206352_10349565 | 3300020078 | Bacteria | 725 |
| 526 | Ga0206354_11036454 | 3300020081 | Bacteria | 1025 |
| 527 | Ga0206353_10222205 | 3300020082 | Bacteria | 879 |
| 528 | Ga0213873_10261514 | 3300021358 | Bacteria | 550 |
| 529 | Ga0213874_10149716 | 3300021377 | Bacteria | 813 |
| 530 | Ga0213876_10032683 | 3300021384 | Bacteria | 2744 |
| 531 | Ga0213876_10099155 | 3300021384 | Bacteria | 1544 |
| 532 | Ga0213876_10222335 | 3300021384 | Bacteria | 1004 |
| 533 | Ga0213876_10564005 | 3300021384 | Bacteria | 606 |
| 534 | Ga0213875_10435923 | 3300021388 | Bacteria | 627 |
| 535 | Ga0213871_10014920 | 3300021441 | Bacteria | 1850 |
| 536 | Ga0213871_10270734 | 3300021441 | Bacteria | 543 |
| 537 | Ga0224712_10358615 | 3300022467 | Bacteria | 690 |
| 538 | Ga0224572_1011889 | 3300024225 | Bacteria | 1649 |
| 539 | Ga0224572_1076459 | 3300024225 | Bacteria | 618 |
| 540 | Ga0209233_1001951 | 3300025261 | Bacteria | 7860 |
| 541 | Ga0207666_1019476 | 3300025271 | Bacteria | 991 |
| 542 | Ga0207697_10027047 | 3300025315 | Bacteria | 2346 |
| 543 | Ga0207656_10044300 | 3300025321 | Bacteria | 1899 |
| 544 | Ga0207656_10182284 | 3300025321 | Bacteria | 1008 |
| 545 | Ga0207653_10133826 | 3300025885 | Bacteria | 902 |
| 546 | Ga0207692_10132931 | 3300025898 | Bacteria | 1407 |
| 547 | Ga0207692_10246844 | 3300025898 | Bacteria | 1068 |
| 548 | Ga0207692_10464853 | 3300025898 | Bacteria | 798 |
| 549 | Ga0207692_10698704 | 3300025898 | Bacteria | 658 |
| 550 | Ga0207692_11194148 | 3300025898 | Bacteria | 505 |
| 551 | Ga0207642_10016853 | 3300025899 | Bacteria | 2764 |
| 552 | Ga0207642_11013530 | 3300025899 | Bacteria | 535 |
| 553 | Ga0207710_10000332 | 3300025900 | Bacteria | 35424 |
| 554 | Ga0207710_10009562 | 3300025900 | Bacteria | 4077 |
| 555 | Ga0207710_10010376 | 3300025900 | Bacteria | 3923 |
| 556 | Ga0207710_10012607 | 3300025900 | Bacteria | 3557 |
| 557 | Ga0207710_10056714 | 3300025900 | Bacteria | 1768 |
| 558 | Ga0207710_10112208 | 3300025900 | Bacteria | 1295 |
| 559 | Ga0207688_10144333 | 3300025901 | Bacteria | 1402 |
| 560 | Ga0207680_10009301 | 3300025903 | Bacteria | 4869 |
| 561 | Ga0207680_10047575 | 3300025903 | Bacteria | 2542 |
| 562 | Ga0207680_10136511 | 3300025903 | Bacteria | 1622 |
| 563 | Ga0207680_10235304 | 3300025903 | Bacteria | 1260 |
| 564 | Ga0207680_10257091 | 3300025903 | Bacteria | 1208 |
| 565 | Ga0207647_10046204 | 3300025904 | Bacteria | 2714 |
| 566 | Ga0207647_10097771 | 3300025904 | Bacteria | 1745 |
| 567 | Ga0207685_10000121 | 3300025905 | Bacteria | 11820 |
| 568 | Ga0207685_10032092 | 3300025905 | Bacteria | 1887 |
| 569 | Ga0207685_10158287 | 3300025905 | Bacteria | 1032 |
| 570 | Ga0207699_10024184 | 3300025906 | Bacteria | 3318 |
| 571 | Ga0207699_10043471 | 3300025906 | Bacteria | 2610 |
| 572 | Ga0207699_10281638 | 3300025906 | Bacteria | 1155 |
| 573 | Ga0207699_10941374 | 3300025906 | Bacteria | 638 |
| 574 | Ga0207645_10015789 | 3300025907 | Bacteria | 5006 |
| 575 | Ga0207645_10027678 | 3300025907 | Bacteria | 3659 |
| 576 | Ga0207645_10186335 | 3300025907 | Bacteria | 1363 |
| 577 | Ga0207645_10620537 | 3300025907 | Bacteria | 734 |
| 578 | Ga0207643_10002762 | 3300025908 | Bacteria | 9490 |
| 579 | Ga0207643_10070432 | 3300025908 | Bacteria | 2011 |
| 580 | Ga0207643_10583790 | 3300025908 | Bacteria | 718 |
| 581 | Ga0207705_10385827 | 3300025909 | Bacteria | 1082 |
| 582 | Ga0207705_11159612 | 3300025909 | Bacteria | 594 |
| 583 | Ga0207684_10575909 | 3300025910 | Bacteria | 962 |
| 584 | Ga0207654_10034349 | 3300025911 | Bacteria | 2817 |
| 585 | Ga0207654_10062727 | 3300025911 | Bacteria | 2179 |
| 586 | Ga0207654_10327449 | 3300025911 | Bacteria | 1049 |
| 587 | Ga0207654_10644101 | 3300025911 | Bacteria | 758 |
| 588 | Ga0207707_10000276 | 3300025912 | Bacteria | 55321 |
| 589 | Ga0207707_10000410 | 3300025912 | Bacteria | 44977 |
| 590 | Ga0207707_10017188 | 3300025912 | Bacteria | 6305 |
| 591 | Ga0207707_10025066 | 3300025912 | Bacteria | 5218 |
| 592 | Ga0207707_10059190 | 3300025912 | Bacteria | 3333 |
| 593 | Ga0207707_10075513 | 3300025912 | Bacteria | 2941 |
| 594 | Ga0207707_10181062 | 3300025912 | Bacteria | 1840 |
| 595 | Ga0207707_10790462 | 3300025912 | Unclassified | 791 |
| 596 | Ga0207695_10003442 | 3300025913 | Bacteria | 22318 |
| 597 | Ga0207695_10042133 | 3300025913 | Bacteria | 4880 |
| 598 | Ga0207695_10049612 | 3300025913 | Bacteria | 4423 |
| 599 | Ga0207695_10052562 | 3300025913 | Bacteria | 4267 |
| 600 | Ga0207695_10072121 | 3300025913 | Bacteria | 3525 |
| 601 | Ga0207695_10083172 | 3300025913 | Bacteria | 3234 |
| 602 | Ga0207695_10097549 | 3300025913 | Bacteria | 2940 |
| 603 | Ga0207695_10234878 | 3300025913 | Bacteria | 1736 |
| 604 | Ga0207695_10317282 | 3300025913 | Bacteria | 1448 |
| 605 | Ga0207695_10339792 | 3300025913 | Bacteria | 1389 |
| 606 | Ga0207671_10010563 | 3300025914 | Bacteria | 7600 |
| 607 | Ga0207671_10073947 | 3300025914 | Bacteria | 2546 |
| 608 | Ga0207671_10157809 | 3300025914 | Bacteria | 1756 |
| 609 | Ga0207671_10168779 | 3300025914 | Bacteria | 1698 |
| 610 | Ga0207671_10190336 | 3300025914 | Bacteria | 1600 |
| 611 | Ga0207671_11074785 | 3300025914 | Bacteria | 633 |
| 612 | Ga0207693_10000448 | 3300025915 | Bacteria | 37696 |
| 613 | Ga0207693_10126708 | 3300025915 | Bacteria | 2007 |
| 614 | Ga0207693_10360999 | 3300025915 | Bacteria | 1137 |
| 615 | Ga0207693_10481430 | 3300025915 | Bacteria | 969 |
| 616 | Ga0207663_10030730 | 3300025916 | Bacteria | 3171 |
| 617 | Ga0207663_10045973 | 3300025916 | Bacteria | 2688 |
| 618 | Ga0207663_10112779 | 3300025916 | Bacteria | 1847 |
| 619 | Ga0207663_10369763 | 3300025916 | Bacteria | 1090 |
| 620 | Ga0207663_11285009 | 3300025916 | Bacteria | 589 |
| 621 | Ga0207663_11458397 | 3300025916 | Unclassified | 551 |
| 622 | Ga0207660_10002217 | 3300025917 | Bacteria | 12862 |
| 623 | Ga0207660_10415405 | 3300025917 | Bacteria | 1085 |
| 624 | Ga0207660_10441396 | 3300025917 | Bacteria | 1052 |
| 625 | Ga0207662_10036401 | 3300025918 | Bacteria | 2876 |
| 626 | Ga0207662_10201054 | 3300025918 | Bacteria | 1290 |
| 627 | Ga0207657_10063277 | 3300025919 | Bacteria | 3164 |
| 628 | Ga0207657_10218405 | 3300025919 | Bacteria | 1528 |
| 629 | Ga0207649_10183146 | 3300025920 | Bacteria | 1467 |
| 630 | Ga0207649_10584605 | 3300025920 | Unclassified | 857 |
| 631 | Ga0207649_11147799 | 3300025920 | Bacteria | 613 |
| 632 | Ga0207652_10003383 | 3300025921 | Bacteria | 13178 |
| 633 | Ga0207652_10088779 | 3300025921 | Bacteria | 2713 |
| 634 | Ga0207652_10266859 | 3300025921 | Bacteria | 1544 |
| 635 | Ga0207646_10580829 | 3300025922 | Bacteria | 1006 |
| 636 | Ga0207646_10803463 | 3300025922 | Bacteria | 838 |
| 637 | Ga0207681_10003213 | 3300025923 | Bacteria | 10254 |
| 638 | Ga0207681_10019048 | 3300025923 | Bacteria | 4332 |
| 639 | Ga0207681_10071603 | 3300025923 | Bacteria | 2418 |
| 640 | Ga0207681_11460364 | 3300025923 | Bacteria | 574 |
| 641 | Ga0207694_10003326 | 3300025924 | Bacteria | 12785 |
| 642 | Ga0207694_10850433 | 3300025924 | Bacteria | 771 |
| 643 | Ga0207694_10855851 | 3300025924 | Bacteria | 768 |
| 644 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 645 | Ga0207650_10018767 | 3300025925 | Bacteria | 4857 |
| 646 | Ga0207650_10054455 | 3300025925 | Bacteria | 2967 |
| 647 | Ga0207650_10221148 | 3300025925 | Bacteria | 1524 |
| 648 | Ga0207650_10653968 | 3300025925 | Bacteria | 886 |
| 649 | Ga0207650_11325316 | 3300025925 | Bacteria | 613 |
| 650 | Ga0207650_11625876 | 3300025925 | Bacteria | 548 |
| 651 | Ga0207659_10061691 | 3300025926 | Bacteria | 2703 |
| 652 | Ga0207687_10076669 | 3300025927 | Bacteria | 2402 |
| 653 | Ga0207687_11273253 | 3300025927 | Bacteria | 632 |
| 654 | Ga0207700_10003609 | 3300025928 | Bacteria | 9016 |
| 655 | Ga0207700_10647428 | 3300025928 | Bacteria | 942 |
| 656 | Ga0207700_10836972 | 3300025928 | Bacteria | 823 |
| 657 | Ga0207700_10862520 | 3300025928 | Bacteria | 810 |
| 658 | Ga0207700_11545406 | 3300025928 | Bacteria | 588 |
| 659 | Ga0207664_10007010 | 3300025929 | Bacteria | 7803 |
| 660 | Ga0207664_10051619 | 3300025929 | Bacteria | 3248 |
| 661 | Ga0207664_10350438 | 3300025929 | Bacteria | 1307 |
| 662 | Ga0207644_10000407 | 3300025931 | Bacteria | 28083 |
| 663 | Ga0207644_10000428 | 3300025931 | Bacteria | 27319 |
| 664 | Ga0207644_10004012 | 3300025931 | Bacteria | 9557 |
| 665 | Ga0207644_10093201 | 3300025931 | Bacteria | 2248 |
| 666 | Ga0207644_10179249 | 3300025931 | Bacteria | 1659 |
| 667 | Ga0207644_10573836 | 3300025931 | Bacteria | 935 |
| 668 | Ga0207644_11450954 | 3300025931 | Bacteria | 576 |
| 669 | Ga0207690_10156897 | 3300025932 | Bacteria | 1693 |
| 670 | Ga0207706_10375437 | 3300025933 | Bacteria | 1234 |
| 671 | Ga0207706_10498430 | 3300025933 | Bacteria | 1051 |
| 672 | Ga0207706_10597721 | 3300025933 | Bacteria | 948 |
| 673 | Ga0207706_11133911 | 3300025933 | Bacteria | 652 |
| 674 | Ga0207706_11570495 | 3300025933 | Bacteria | 534 |
| 675 | Ga0207686_10005014 | 3300025934 | Bacteria | 7128 |
| 676 | Ga0207686_10007583 | 3300025934 | Bacteria | 5844 |
| 677 | Ga0207686_10072816 | 3300025934 | Bacteria | 2215 |
| 678 | Ga0207686_10255208 | 3300025934 | Bacteria | 1283 |
| 679 | Ga0207686_11085111 | 3300025934 | Unclassified | 652 |
| 680 | Ga0207709_10431056 | 3300025935 | Bacteria | 1015 |
| 681 | Ga0207670_10126684 | 3300025936 | Bacteria | 1864 |
| 682 | Ga0207670_10684398 | 3300025936 | Bacteria | 848 |
| 683 | Ga0207670_10703399 | 3300025936 | Bacteria | 837 |
| 684 | Ga0207670_11102066 | 3300025936 | Bacteria | 670 |
| 685 | Ga0207670_11875155 | 3300025936 | Unclassified | 510 |
| 686 | Ga0207669_10068174 | 3300025937 | Bacteria | 2220 |
| 687 | Ga0207669_10419872 | 3300025937 | Bacteria | 1052 |
| 688 | Ga0207704_10002424 | 3300025938 | Bacteria | 8388 |
| 689 | Ga0207704_10014528 | 3300025938 | Bacteria | 3978 |
| 690 | Ga0207704_10040967 | 3300025938 | Bacteria | 2712 |
| 691 | Ga0207704_10188426 | 3300025938 | Bacteria | 1498 |
| 692 | Ga0207704_11518336 | 3300025938 | Bacteria | 575 |
| 693 | Ga0207665_10035902 | 3300025939 | Bacteria | 3293 |
| 694 | Ga0207665_10088305 | 3300025939 | Bacteria | 2145 |
| 695 | Ga0207691_10049133 | 3300025940 | Bacteria | 3865 |
| 696 | Ga0207691_10104939 | 3300025940 | Bacteria | 2518 |
| 697 | Ga0207691_10242604 | 3300025940 | Bacteria | 1557 |
| 698 | Ga0207691_10308562 | 3300025940 | Bacteria | 1358 |
| 699 | Ga0207691_10726901 | 3300025940 | Bacteria | 836 |
| 700 | Ga0207691_11290328 | 3300025940 | Bacteria | 603 |
| 701 | Ga0207711_10000194 | 3300025941 | Bacteria | 65127 |
| 702 | Ga0207711_10004185 | 3300025941 | Bacteria | 12357 |
| 703 | Ga0207711_10116126 | 3300025941 | Bacteria | 2385 |
| 704 | Ga0207711_10159847 | 3300025941 | Bacteria | 2038 |
| 705 | Ga0207711_11059250 | 3300025941 | Bacteria | 751 |
| 706 | Ga0207689_10127570 | 3300025942 | Bacteria | 2092 |
| 707 | Ga0207689_10224281 | 3300025942 | Bacteria | 1553 |
| 708 | Ga0207689_10232116 | 3300025942 | Bacteria | 1525 |
| 709 | Ga0207689_10460341 | 3300025942 | Bacteria | 1063 |
| 710 | Ga0207689_11099186 | 3300025942 | Bacteria | 670 |
| 711 | Ga0207661_10649510 | 3300025944 | Bacteria | 969 |
| 712 | Ga0207679_10093035 | 3300025945 | Bacteria | 2337 |
| 713 | Ga0207679_10127063 | 3300025945 | Bacteria | 2039 |
| 714 | Ga0207679_10268843 | 3300025945 | Bacteria | 1457 |
| 715 | Ga0207679_10564397 | 3300025945 | Bacteria | 1022 |
| 716 | Ga0207679_10948619 | 3300025945 | Bacteria | 788 |
| 717 | Ga0207679_11280853 | 3300025945 | Bacteria | 673 |
| 718 | Ga0207679_11886660 | 3300025945 | Bacteria | 545 |
| 719 | Ga0207667_10008242 | 3300025949 | Bacteria | 12403 |
| 720 | Ga0207667_10014175 | 3300025949 | Bacteria | 9098 |
| 721 | Ga0207667_10048865 | 3300025949 | Bacteria | 4472 |
| 722 | Ga0207667_10617984 | 3300025949 | Bacteria | 1091 |
| 723 | Ga0207667_10914561 | 3300025949 | Unclassified | 869 |
| 724 | Ga0207667_11023502 | 3300025949 | Bacteria | 812 |
| 725 | Ga0207667_12244332 | 3300025949 | Bacteria | 502 |
| 726 | Ga0207651_10007788 | 3300025960 | Bacteria | 5729 |
| 727 | Ga0207651_10025701 | 3300025960 | Bacteria | 3665 |
| 728 | Ga0207651_10049602 | 3300025960 | Bacteria | 2845 |
| 729 | Ga0207651_10056314 | 3300025960 | Bacteria | 2705 |
| 730 | Ga0207651_10312895 | 3300025960 | Bacteria | 1310 |
| 731 | Ga0207651_11776303 | 3300025960 | Bacteria | 555 |
| 732 | Ga0207712_10274654 | 3300025961 | Bacteria | 1373 |
| 733 | Ga0207712_11349038 | 3300025961 | Bacteria | 638 |
| 734 | Ga0207668_10008346 | 3300025972 | Bacteria | 6168 |
| 735 | Ga0207668_10264120 | 3300025972 | Bacteria | 1404 |
| 736 | Ga0207668_10498202 | 3300025972 | Bacteria | 1047 |
| 737 | Ga0207668_10544631 | 3300025972 | Bacteria | 1004 |
| 738 | Ga0207640_10264980 | 3300025981 | Bacteria | 1341 |
| 739 | Ga0207640_10361518 | 3300025981 | Bacteria | 1170 |
| 740 | Ga0207640_10419821 | 3300025981 | Bacteria | 1094 |
| 741 | Ga0207640_10785089 | 3300025981 | Bacteria | 824 |
| 742 | Ga0207640_11145885 | 3300025981 | Bacteria | 689 |
| 743 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 744 | Ga0207658_10004751 | 3300025986 | Bacteria | 9405 |
| 745 | Ga0207658_10108411 | 3300025986 | Bacteria | 2190 |
| 746 | Ga0207658_10175447 | 3300025986 | Bacteria | 1769 |
| 747 | Ga0207658_10437648 | 3300025986 | Bacteria | 1156 |
| 748 | Ga0207658_10625449 | 3300025986 | Bacteria | 969 |
| 749 | Ga0207658_10793713 | 3300025986 | Bacteria | 859 |
| 750 | Ga0207658_11262300 | 3300025986 | Bacteria | 675 |
| 751 | Ga0207677_10017062 | 3300026023 | Bacteria | 4318 |
| 752 | Ga0207677_10020677 | 3300026023 | Bacteria | 4002 |
| 753 | Ga0207677_10703153 | 3300026023 | Bacteria | 897 |
| 754 | Ga0207677_11066414 | 3300026023 | Bacteria | 735 |
| 755 | Ga0207703_10001524 | 3300026035 | Bacteria | 21042 |
| 756 | Ga0207703_10019203 | 3300026035 | Bacteria | 5338 |
| 757 | Ga0207703_10024678 | 3300026035 | Bacteria | 4730 |
| 758 | Ga0207703_10050143 | 3300026035 | Bacteria | 3377 |
| 759 | Ga0207703_10235714 | 3300026035 | Bacteria | 1643 |
| 760 | Ga0207703_10347890 | 3300026035 | Bacteria | 1364 |
| 761 | Ga0207639_10699382 | 3300026041 | Bacteria | 940 |
| 762 | Ga0207639_11770732 | 3300026041 | Bacteria | 578 |
| 763 | Ga0207639_11950144 | 3300026041 | Bacteria | 548 |
| 764 | Ga0207678_10005556 | 3300026067 | Bacteria | 11267 |
| 765 | Ga0207678_10267753 | 3300026067 | Bacteria | 1465 |
| 766 | Ga0207678_10276992 | 3300026067 | Bacteria | 1439 |
| 767 | Ga0207678_10372903 | 3300026067 | Bacteria | 1233 |
| 768 | Ga0207678_11429764 | 3300026067 | Bacteria | 611 |
| 769 | Ga0207708_10036414 | 3300026075 | Bacteria | 3746 |
| 770 | Ga0207708_10047577 | 3300026075 | Bacteria | 3265 |
| 771 | Ga0207708_10405882 | 3300026075 | Bacteria | 1128 |
| 772 | Ga0207702_10043700 | 3300026078 | Bacteria | 3764 |
| 773 | Ga0207702_10086751 | 3300026078 | Bacteria | 2730 |
| 774 | Ga0207702_10128657 | 3300026078 | Bacteria | 2276 |
| 775 | Ga0207702_11220565 | 3300026078 | Bacteria | 746 |
| 776 | Ga0207702_11309893 | 3300026078 | Bacteria | 718 |
| 777 | Ga0207641_10002325 | 3300026088 | Bacteria | 17632 |
| 778 | Ga0207641_10003553 | 3300026088 | Bacteria | 13779 |
| 779 | Ga0207641_10009230 | 3300026088 | Bacteria | 8134 |
| 780 | Ga0207641_10010988 | 3300026088 | Bacteria | 7422 |
| 781 | Ga0207641_10029923 | 3300026088 | Bacteria | 4505 |
| 782 | Ga0207641_10106203 | 3300026088 | Bacteria | 2481 |
| 783 | Ga0207641_10235301 | 3300026088 | Bacteria | 1704 |
| 784 | Ga0207641_10623681 | 3300026088 | Bacteria | 1057 |
| 785 | Ga0207641_11812483 | 3300026088 | Bacteria | 612 |
| 786 | Ga0207648_10052141 | 3300026089 | Bacteria | 3577 |
| 787 | Ga0207648_10052679 | 3300026089 | Bacteria | 3558 |
| 788 | Ga0207648_10307642 | 3300026089 | Bacteria | 1422 |
| 789 | Ga0207648_10388734 | 3300026089 | Bacteria | 1262 |
| 790 | Ga0207648_10407117 | 3300026089 | Bacteria | 1233 |
| 791 | Ga0207648_12189707 | 3300026089 | Bacteria | 514 |
| 792 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 793 | Ga0207676_10038749 | 3300026095 | Bacteria | 3640 |
| 794 | Ga0207676_10363333 | 3300026095 | Bacteria | 1342 |
| 795 | Ga0207676_11224328 | 3300026095 | Bacteria | 744 |
| 796 | Ga0207676_11780453 | 3300026095 | Bacteria | 614 |
| 797 | Ga0207674_10272624 | 3300026116 | Bacteria | 1640 |
| 798 | Ga0207674_10326743 | 3300026116 | Bacteria | 1483 |
| 799 | Ga0207674_10663830 | 3300026116 | Bacteria | 1007 |
| 800 | Ga0207674_10856467 | 3300026116 | Bacteria | 876 |
| 801 | Ga0207675_100080055 | 3300026118 | Bacteria | 3062 |
| 802 | Ga0207675_100132610 | 3300026118 | Bacteria | 2362 |
| 803 | Ga0207675_100142749 | 3300026118 | Bacteria | 2275 |
| 804 | Ga0207675_100375270 | 3300026118 | Bacteria | 1398 |
| 805 | Ga0207675_100632434 | 3300026118 | Bacteria | 1075 |
| 806 | Ga0207675_101701120 | 3300026118 | Bacteria | 651 |
| 807 | Ga0207675_102258542 | 3300026118 | Bacteria | 558 |
| 808 | Ga0207683_10002499 | 3300026121 | Bacteria | 16042 |
| 809 | Ga0207683_10022992 | 3300026121 | Bacteria | 5358 |
| 810 | Ga0207683_10141534 | 3300026121 | Bacteria | 2168 |
| 811 | Ga0207698_10091691 | 3300026142 | Bacteria | 2488 |
| 812 | Ga0207698_10257621 | 3300026142 | Bacteria | 1601 |
| 813 | Ga0207698_10433276 | 3300026142 | Bacteria | 1265 |
| 814 | Ga0207698_10610020 | 3300026142 | Bacteria | 1077 |
| 815 | Ga0207698_11385002 | 3300026142 | Bacteria | 718 |
| 816 | Ga0207698_11670797 | 3300026142 | Bacteria | 652 |
| 817 | Ga0209179_1000094 | 3300027512 | Bacteria | 12638 |
| 818 | Ga0209179_1000174 | 3300027512 | Bacteria | 6081 |
| 819 | Ga0209588_1045050 | 3300027671 | Bacteria | 1427 |
| 820 | Ga0209813_10164941 | 3300027866 | Bacteria | 801 |
| 821 | Ga0265356_1000652 | 3300028017 | Bacteria | 6018 |
| 822 | Ga0265357_1035170 | 3300028023 | Bacteria | 579 |
| 823 | Ga0268266_10000943 | 3300028379 | Bacteria | 37110 |
| 824 | Ga0268266_10002538 | 3300028379 | Bacteria | 19391 |
| 825 | Ga0268266_10005009 | 3300028379 | Bacteria | 12515 |
| 826 | Ga0268266_10010307 | 3300028379 | Bacteria | 8174 |
| 827 | Ga0268266_10013518 | 3300028379 | Bacteria | 7028 |
| 828 | Ga0268266_10018044 | 3300028379 | Bacteria | 6013 |
| 829 | Ga0268266_10019459 | 3300028379 | Bacteria | 5783 |
| 830 | Ga0268266_10078059 | 3300028379 | Bacteria | 2880 |
| 831 | Ga0268266_10082273 | 3300028379 | Bacteria | 2808 |
| 832 | Ga0268266_10165713 | 3300028379 | Bacteria | 2002 |
| 833 | Ga0268266_10421058 | 3300028379 | Bacteria | 1265 |
| 834 | Ga0268266_10925547 | 3300028379 | Bacteria | 843 |
| 835 | Ga0268266_11493521 | 3300028379 | Bacteria | 651 |
| 836 | Ga0268266_11521321 | 3300028379 | Bacteria | 645 |
| 837 | Ga0268265_10000383 | 3300028380 | Bacteria | 47354 |
| 838 | Ga0268265_10056316 | 3300028380 | Bacteria | 2990 |
| 839 | Ga0268265_10144177 | 3300028380 | Bacteria | 1998 |
| 840 | Ga0268265_10246003 | 3300028380 | Bacteria | 1581 |
| 841 | Ga0268265_10499903 | 3300028380 | Bacteria | 1145 |
| 842 | Ga0268265_10653004 | 3300028380 | Bacteria | 1011 |
| 843 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 844 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 845 | Ga0268264_10011424 | 3300028381 | Bacteria | 7332 |
| 846 | Ga0268264_10013393 | 3300028381 | Bacteria | 6749 |
| 847 | Ga0268264_10085143 | 3300028381 | Bacteria | 2713 |
| 848 | Ga0268264_10200275 | 3300028381 | Bacteria | 1826 |
| 849 | Ga0268264_10256879 | 3300028381 | Bacteria | 1626 |
| 850 | Ga0268264_10909714 | 3300028381 | Bacteria | 883 |
| 851 | Ga0268264_11527368 | 3300028381 | Bacteria | 678 |
| 852 | Ga0268264_12206416 | 3300028381 | Bacteria | 558 |
| 853 | Ga0268264_12206752 | 3300028381 | Bacteria | 558 |
| 854 | Ga0265326_10147255 | 3300028558 | Bacteria | 672 |
| 855 | Ga0265319_1002761 | 3300028563 | Bacteria | 9412 |
| 856 | Ga0265334_10000272 | 3300028573 | Bacteria | 29197 |
| 857 | Ga0265334_10001026 | 3300028573 | Bacteria | 13760 |
| 858 | Ga0265334_10104489 | 3300028573 | Bacteria | 1022 |
| 859 | Ga0265318_10000228 | 3300028577 | Bacteria | 48687 |
| 860 | Ga0265336_10019649 | 3300028666 | Bacteria | 2178 |
| 861 | Ga0307517_10266356 | 3300028786 | Bacteria | 990 |
| 862 | Ga0307515_10034640 | 3300028794 | Bacteria | 8252 |
| 863 | Ga0307515_10711569 | 3300028794 | Bacteria | 621 |
| 864 | Ga0307515_10840440 | 3300028794 | Bacteria | 544 |
| 865 | Ga0265338_10005919 | 3300028800 | Bacteria | 15752 |
| 866 | Ga0265338_10016309 | 3300028800 | Bacteria | 8091 |
| 867 | Ga0265338_10124432 | 3300028800 | Bacteria | 2049 |
| 868 | Ga0265338_10145015 | 3300028800 | Bacteria | 1853 |
| 869 | Ga0265338_10320714 | 3300028800 | Bacteria | 1122 |
| 870 | Ga0307511_10000235 | 3300030521 | Bacteria | 56564 |
| 871 | Ga0307511_10056308 | 3300030521 | Bacteria | 3076 |
| 872 | Ga0307511_10182269 | 3300030521 | Bacteria | 1129 |
| 873 | Ga0265770_1000452 | 3300030878 | Bacteria | 5652 |
| 874 | Ga0265771_1003521 | 3300031010 | Bacteria | 906 |
| 875 | Ga0265773_1003029 | 3300031018 | Bacteria | 1072 |
| 876 | Ga0265760_10001436 | 3300031090 | Bacteria | 7017 |
| 877 | Ga0265760_10016486 | 3300031090 | Bacteria | 2120 |
| 878 | Ga0265330_10004229 | 3300031235 | Bacteria | 7321 |
| 879 | Ga0265330_10027214 | 3300031235 | Bacteria | 2584 |
| 880 | Ga0265332_10001037 | 3300031238 | Bacteria | 16333 |
| 881 | Ga0265332_10086955 | 3300031238 | Bacteria | 1324 |
| 882 | Ga0265332_10356677 | 3300031238 | Bacteria | 603 |
| 883 | Ga0265328_10002988 | 3300031239 | Bacteria | 7548 |
| 884 | Ga0265328_10003225 | 3300031239 | Bacteria | 7230 |
| 885 | Ga0265328_10029110 | 3300031239 | Bacteria | 2065 |
| 886 | Ga0265328_10122277 | 3300031239 | Bacteria | 971 |
| 887 | Ga0265328_10197442 | 3300031239 | Bacteria | 763 |
| 888 | Ga0265320_10004080 | 3300031240 | Bacteria | 9592 |
| 889 | Ga0265320_10083511 | 3300031240 | Bacteria | 1488 |
| 890 | Ga0265320_10367736 | 3300031240 | Bacteria | 635 |
| 891 | Ga0265320_10430262 | 3300031240 | Bacteria | 583 |
| 892 | Ga0265325_10005189 | 3300031241 | Bacteria | 8094 |
| 893 | Ga0265329_10001451 | 3300031242 | Bacteria | 11427 |
| 894 | Ga0265340_10013162 | 3300031247 | Bacteria | 4354 |
| 895 | Ga0265340_10020617 | 3300031247 | Bacteria | 3384 |
| 896 | Ga0265340_10040021 | 3300031247 | Bacteria | 2310 |
| 897 | Ga0265340_10180734 | 3300031247 | Bacteria | 953 |
| 898 | Ga0265340_10233383 | 3300031247 | Bacteria | 822 |
| 899 | Ga0265340_10533645 | 3300031247 | Bacteria | 516 |
| 900 | Ga0265339_10014355 | 3300031249 | Bacteria | 4775 |
| 901 | Ga0265331_10004429 | 3300031250 | Bacteria | 8774 |
| 902 | Ga0265331_10018795 | 3300031250 | Bacteria | 3575 |
| 903 | Ga0265331_10149262 | 3300031250 | Bacteria | 1062 |
| 904 | Ga0265327_10000005 | 3300031251 | Bacteria | 790146 |
| 905 | Ga0265316_10013033 | 3300031344 | Bacteria | 7415 |
| 906 | Ga0265316_10277063 | 3300031344 | Bacteria | 1226 |
| 907 | Ga0265316_10800381 | 3300031344 | Bacteria | 661 |
| 908 | Ga0307513_10007825 | 3300031456 | Bacteria | 13780 |
| 909 | Ga0307513_10044257 | 3300031456 | Bacteria | 4878 |
| 910 | Ga0307513_10058418 | 3300031456 | Bacteria | 4100 |
| 911 | Ga0307513_10847699 | 3300031456 | Bacteria | 620 |
| 912 | Ga0307509_10565722 | 3300031507 | Bacteria | 813 |
| 913 | Ga0307408_100021417 | 3300031548 | Bacteria | 4375 |
| 914 | Ga0307408_100293830 | 3300031548 | Bacteria | 1358 |
| 915 | Ga0307408_100469453 | 3300031548 | Bacteria | 1095 |
| 916 | Ga0307408_100595029 | 3300031548 | Bacteria | 982 |
| 917 | Ga0265313_10001786 | 3300031595 | Bacteria | 19657 |
| 918 | Ga0265313_10438966 | 3300031595 | Bacteria | 508 |
| 919 | Ga0307508_10111635 | 3300031616 | Bacteria | 2334 |
| 920 | Ga0307514_10104256 | 3300031649 | Bacteria | 2029 |
| 921 | Ga0265314_10005233 | 3300031711 | Bacteria | 11760 |
| 922 | Ga0265314_10174330 | 3300031711 | Bacteria | 1295 |
| 923 | Ga0265314_10481917 | 3300031711 | Bacteria | 656 |
| 924 | Ga0265342_10002379 | 3300031712 | Bacteria | 16291 |
| 925 | Ga0307516_10398880 | 3300031730 | Bacteria | 1035 |
| 926 | Ga0307516_10507748 | 3300031730 | Bacteria | 860 |
| 927 | Ga0307516_10511254 | 3300031730 | Bacteria | 855 |
| 928 | Ga0307405_10286534 | 3300031731 | Bacteria | 1243 |
| 929 | Ga0307405_10640466 | 3300031731 | Bacteria | 873 |
| 930 | Ga0307405_10783047 | 3300031731 | Bacteria | 797 |
| 931 | Ga0307413_10001429 | 3300031824 | Bacteria | 9034 |
| 932 | Ga0307413_10035769 | 3300031824 | Bacteria | 2852 |
| 933 | Ga0307413_10180497 | 3300031824 | Bacteria | 1504 |
| 934 | Ga0307413_10206648 | 3300031824 | Bacteria | 1422 |
| 935 | Ga0307410_10002645 | 3300031852 | Bacteria | 8733 |
| 936 | Ga0307410_10718460 | 3300031852 | Bacteria | 843 |
| 937 | Ga0307410_10762095 | 3300031852 | Bacteria | 820 |
| 938 | Ga0307406_10214883 | 3300031901 | Bacteria | 1425 |
| 939 | Ga0307406_10862465 | 3300031901 | Bacteria | 768 |
| 940 | Ga0307406_11779662 | 3300031901 | Bacteria | 547 |
| 941 | Ga0307407_10007323 | 3300031903 | Bacteria | 4990 |
| 942 | Ga0307407_10367805 | 3300031903 | Bacteria | 1023 |
| 943 | Ga0307407_10401641 | 3300031903 | Bacteria | 983 |
| 944 | Ga0307412_10275217 | 3300031911 | Bacteria | 1319 |
| 945 | Ga0307412_10300299 | 3300031911 | Bacteria | 1269 |
| 946 | Ga0307409_100008471 | 3300031995 | Bacteria | 6245 |
| 947 | Ga0307409_100018987 | 3300031995 | Bacteria | 4642 |
| 948 | Ga0307409_100067110 | 3300031995 | Bacteria | 2831 |
| 949 | Ga0307409_100072562 | 3300031995 | Bacteria | 2742 |
| 950 | Ga0307409_100623909 | 3300031995 | Bacteria | 1068 |
| 951 | Ga0307416_100218253 | 3300032002 | Bacteria | 1826 |
| 952 | Ga0307416_100553375 | 3300032002 | Bacteria | 1224 |
| 953 | Ga0307416_100764931 | 3300032002 | Bacteria | 1059 |
| 954 | Ga0307416_101433336 | 3300032002 | Bacteria | 796 |
| 955 | Ga0307416_103094738 | 3300032002 | Bacteria | 556 |
| 956 | Ga0307416_103768426 | 3300032002 | Bacteria | 507 |
| 957 | Ga0307414_10283564 | 3300032004 | Bacteria | 1393 |
| 958 | Ga0307411_10001998 | 3300032005 | Bacteria | 8755 |
| 959 | Ga0307411_10034772 | 3300032005 | Bacteria | 3139 |
| 960 | Ga0307411_10354795 | 3300032005 | Bacteria | 1197 |
| 961 | Ga0307411_10535613 | 3300032005 | Bacteria | 996 |
| 962 | Ga0307411_11420539 | 3300032005 | Bacteria | 636 |
| 963 | Ga0307415_100068825 | 3300032126 | Bacteria | 2479 |
| 964 | Ga0307415_100098172 | 3300032126 | Bacteria | 2140 |
| 965 | Ga0307415_100210379 | 3300032126 | Bacteria | 1551 |
| 966 | Ga0307415_100843478 | 3300032126 | Bacteria | 840 |
| 967 | Ga0307415_102202861 | 3300032126 | Bacteria | 539 |
| 968 | Ga0307507_10414909 | 3300033179 | Bacteria | 759 |
| 969 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 970 | Ga0307510_10029950 | 3300033180 | Bacteria | 6180 |
| 971 | Ga0307510_10083840 | 3300033180 | Bacteria | 3074 |
| 972 | Ga0373928_0116950 | 3300035084 | Bacteria | 711 |
| 973 | Ga0373934_0198021 | 3300035086 | Bacteria | 827 |
| 974 | Ga0373944_0040350 | 3300035089 | Bacteria | 1440 |
| 975 | Ga0373952_0094250 | 3300035092 | Bacteria | 782 |
| 976 | Ga0373923_0030963 | 3300035111 | Bacteria | 2154 |
| 977 | Ga0373923_0093456 | 3300035111 | Bacteria | 1319 |
| 978 | Ga0373936_0035525 | 3300035113 | Bacteria | 1984 |
| 979 | Ga0373936_0036445 | 3300035113 | Bacteria | 1962 |
| 980 | Ga0373936_0068071 | 3300035113 | Bacteria | 1464 |
| 981 | Ga0373936_0384330 | 3300035113 | Bacteria | 643 |
| 982 | Ga0373936_0431473 | 3300035113 | Bacteria | 608 |
| 983 | Ga0373936_0582413 | 3300035113 | Bacteria | 525 |
| 984 | Ga0373939_0195557 | 3300035114 | Bacteria | 762 |
| 985 | Ga0373945_0139007 | 3300035116 | Bacteria | 978 |
| 986 | Ga0373945_0229516 | 3300035116 | Bacteria | 779 |
| 987 | Ga0373953_0270691 | 3300035117 | Bacteria | 740 |
| 988 | Ga0373953_0288935 | 3300035117 | Bacteria | 715 |
| 989 | Ga0373954_0124223 | 3300035118 | Bacteria | 1254 |
| 990 | Ga0373956_0132597 | 3300035119 | Bacteria | 1167 |
| 991 | Ga0373957_0044948 | 3300035120 | Bacteria | 1672 |
| 992 | Ga0373957_0057320 | 3300035120 | Bacteria | 1502 |
| 993 | Ga0373960_0227138 | 3300035121 | Bacteria | 670 |
| 994 | Ga0373943_0114904 | 3300035170 | Bacteria | 1424 |
| 995 | Ga0373943_0404474 | 3300035170 | Bacteria | 788 |
| 996 | Ga0373946_0057466 | 3300035171 | Bacteria | 1646 |
| 997 | Ga0373946_0323051 | 3300035171 | Bacteria | 767 |
| 998 | Ga0373955_0018160 | 3300035172 | Bacteria | 3494 |
| 999 | Ga0373955_0018691 | 3300035172 | Bacteria | 3452 |
| 1000 | Ga0373955_0046500 | 3300035172 | Bacteria | 2346 |
| 1001 | Ga0373955_0714756 | 3300035172 | Bacteria | 615 |
| 1002 | Ga0373955_0835562 | 3300035172 | Bacteria | 566 |
| 1003 | Ga0373942_0133951 | 3300035207 | Bacteria | 784 |
| 1004 | Ga0373961_0201024 | 3300035241 | Bacteria | 703 |
| 1005 | Ga0373931_0677189 | 3300035691 | Bacteria | 680 |
| 1006 | Ga0373935_0338218 | 3300035692 | Bacteria | 1071 |
| 1007 | Ga0373935_0930979 | 3300035692 | Bacteria | 644 |
| 1008 | Ga0373927_0009161 | 3300035695 | Bacteria | 6644 |
| 1009 | Ga0373933_0134605 | 3300035724 | Bacteria | 1556 |
| 1010 | Ga0373933_0663875 | 3300035724 | Bacteria | 685 |
| 1011 | Ga0373933_0815132 | 3300035724 | Bacteria | 614 |
| 1012 | Ga0373933_0985631 | 3300035724 | Bacteria | 555 |
| 1013 | Ga0373947_0254326 | 3300035725 | Bacteria | 1162 |
| 1014 | Ga0373947_0716259 | 3300035725 | Bacteria | 683 |
| 1015 | Ga0373937_0065988 | 3300036401 | Bacteria | 3332 |
| 1016 | Ga0373937_0086972 | 3300036401 | Bacteria | 2892 |
| 1017 | Ga0373937_0107062 | 3300036401 | Bacteria | 2599 |
| 1018 | Ga0373937_0120811 | 3300036401 | Bacteria | 2441 |
| 1019 | Ga0373937_0241467 | 3300036401 | Bacteria | 1702 |
| 1020 | Ga0373937_1298504 | 3300036401 | Bacteria | 676 |
| 1021 | Ga0373925_0026649 | 3300037068 | Bacteria | 4230 |
| 1022 | Ga0373925_0747219 | 3300037068 | Bacteria | 806 |
| 1023 | Ga0395899_0377597 | 3300037312 | Bacteria | 943 |
| 1024 | Ga0395900_0328446 | 3300037418 | Bacteria | 1508 |
| 1025 | Ga0395898_0014841 | 3300037466 | Bacteria | 7998 |
| 1026 | Ga0395898_0039994 | 3300037466 | Bacteria | 4639 |
| 1027 | Ga0395898_0742163 | 3300037466 | Bacteria | 923 |
| 1028 | Ga0436364_0966198 | 3300037853 | Bacteria | 1000 |
| 1029 | Ga0436364_1119394 | 3300037853 | Bacteria | 1000 |
| 1030 | Ga0436365_0032067 | 3300039437 | Bacteria | 3787 |
| 1031 | Ga0436365_0123496 | 3300039437 | Bacteria | 3393 |
| 1032 | Ga0436365_0309009 | 3300039437 | Bacteria | 1091 |
| 1033 | Ga0436365_0574996 | 3300039437 | Bacteria | 738 |
| 1034 | Ga0436365_0588607 | 3300039437 | Bacteria | 729 |
| 1035 | Ga0436365_1106216 | 3300039437 | Bacteria | 1073 |
| 1036 | Ga0436365_1107339 | 3300039437 | Bacteria | 1102 |
| 1037 | Ga0436365_1277090 | 3300039437 | Bacteria | 882 |
| 1038 | Ga0436360_0226775 | 3300039438 | Bacteria | 2277 |
| 1039 | Ga0436360_0397350 | 3300039438 | Bacteria | 1255 |
| 1040 | Ga0436360_0552698 | 3300039438 | Bacteria | 830 |
| 1041 | Ga0436360_0749057 | 3300039438 | Bacteria | 2001 |
| 1042 | Ga0436360_0999940 | 3300039438 | Unclassified | 513 |
| 1043 | Ga0436360_1375355 | 3300039438 | Bacteria | 1443 |
| 1044 | Ga0436361_0031697 | 3300039447 | Bacteria | 733 |
| 1045 | Ga0436361_0734175 | 3300039447 | Bacteria | 887 |
| 1046 | Ga0436363_0052657 | 3300039450 | Unclassified | 617 |
| 1047 | Ga0436363_0193457 | 3300039450 | Bacteria | 1244 |
| 1048 | Ga0436363_0498253 | 3300039450 | Bacteria | 9613 |
| 1049 | Ga0436363_0603378 | 3300039450 | Bacteria | 1047 |
| 1050 | Ga0436363_0620486 | 3300039450 | Bacteria | 2806 |
| 1051 | Ga0436363_0854207 | 3300039450 | Bacteria | 3337 |
| 1052 | Ga0436363_1530821 | 3300039450 | Bacteria | 2990 |
| 1053 | Ga0436362_0241992 | 3300039453 | Bacteria | 639 |
| 1054 | Ga0436362_0610762 | 3300039453 | Bacteria | 787 |
| 1055 | Ga0436362_0693496 | 3300039453 | Bacteria | 3146 |
| 1056 | Ga0436362_0820035 | 3300039453 | Bacteria | 1513 |
| 1057 | Ga0436362_1267612 | 3300039453 | Bacteria | 746 |
| 1058 | Ga0439439_0151535 | 3300041406 | Bacteria | 659 |
| 1059 | Ga0451787_619150 | 3300041441 | Bacteria | 592 |
| 1060 | Ga0451789_0038452 | 3300041443 | Bacteria | 539 |
| 1061 | Ga0451789_0348250 | 3300041443 | Bacteria | 671 |
| 1062 | Ga0451791_0414676 | 3300041451 | Bacteria | 730 |
| 1063 | Ga0451791_0421855 | 3300041451 | Bacteria | 872 |
| 1064 | Ga0451791_1468289 | 3300041451 | Bacteria | 823 |
| 1065 | Ga0451793_1713978 | 3300041452 | Bacteria | 861 |
| 1066 | Ga0451797_0463910 | 3300041453 | Bacteria | 961 |
| 1067 | Ga0451797_1066747 | 3300041453 | Bacteria | 895 |
| 1068 | Ga0451797_1136816 | 3300041453 | Bacteria | 908 |
| 1069 | Ga0451798_0614515 | 3300041458 | Bacteria | 758 |
| 1070 | Ga0451800_0475520 | 3300041459 | Bacteria | 1521 |
| 1071 | Ga0451802_1195489 | 3300041460 | Bacteria | 1135 |
| 1072 | Ga0451807_0772385 | 3300041486 | Bacteria | 988 |
| 1073 | Ga0451807_2713173 | 3300041486 | Bacteria | 852 |
| 1074 | Ga0451835_0527541 | 3300041492 | Bacteria | 1016 |
| 1075 | Ga0451837_0095635 | 3300041494 | Bacteria | 523 |
| 1076 | Ga0451837_0361166 | 3300041494 | Bacteria | 856 |
| 1077 | Ga0451839_0596168 | 3300041496 | Bacteria | 509 |
| 1078 | Ga0451847_0947723 | 3300041503 | Bacteria | 767 |
| 1079 | Ga0451849_1081235 | 3300041505 | Bacteria | 870 |
| 1080 | Ga0451851_0606114 | 3300041507 | Bacteria | 632 |
| 1081 | Ga0451843_0028636 | 3300041509 | Bacteria | 1011 |
| 1082 | Ga0451853_0730695 | 3300041512 | Bacteria | 683 |
| 1083 | Ga0451853_1933935 | 3300041512 | Bacteria | 706 |
| 1084 | Ga0451853_2732029 | 3300041512 | Bacteria | 632 |
| 1085 | Ga0439445_0180438 | 3300042004 | Bacteria | 620 |
| 1086 | Ga0450890_010652 | 3300042127 | Bacteria | 1184 |
| 1087 | Ga0450894_029561 | 3300042131 | Bacteria | 761 |
| 1088 | Ga0450896_096353 | 3300042133 | Bacteria | 509 |
| 1089 | Ga0450898_051332 | 3300042134 | Bacteria | 797 |
| 1090 | Ga0439446_0167783 | 3300042156 | Bacteria | 729 |
| 1091 | Ga0439446_0249342 | 3300042156 | Bacteria | 612 |
| 1092 | Ga0439458_0102221 | 3300042157 | Bacteria | 745 |
| 1093 | Ga0439434_0308825 | 3300042435 | Bacteria | 548 |
| 1094 | Ga0439435_0010142 | 3300042436 | Bacteria | 2228 |
| 1095 | Ga0439459_0133243 | 3300042438 | Bacteria | 636 |
| 1096 | Ga0450916_025576 | 3300042530 | Bacteria | 834 |
| 1097 | Ga0451577_0008727 | 3300042876 | Bacteria | 9827 |
| 1098 | Ga0451577_0145274 | 3300042876 | Bacteria | 2132 |
| 1099 | Ga0466969_0003941 | 3300044656 | Bacteria | 7881 |
| 1100 | Ga0466969_0195423 | 3300044656 | Bacteria | 924 |
| 1101 | Ga0466972_0472510 | 3300044658 | Bacteria | 589 |
| 1102 | Ga0453683_0375398 | 3300044673 | Bacteria | 915 |
| 1103 | Ga0466966_0002570 | 3300044684 | Bacteria | 11886 |
| 1104 | Ga0466966_0015541 | 3300044684 | Bacteria | 5032 |
| 1105 | Ga0466966_0484215 | 3300044684 | Bacteria | 744 |
| 1106 | Ga0466961_0021828 | 3300044693 | Bacteria | 4118 |
| 1107 | Ga0466964_0000625 | 3300044706 | Bacteria | 11251 |
| 1108 | Ga0453684_0052092 | 3300044712 | Bacteria | 5356 |
| 1109 | Ga0453684_0195515 | 3300044712 | Bacteria | 2362 |
| 1110 | Ga0453684_0332911 | 3300044712 | Bacteria | 1716 |
| 1111 | Ga0453684_0340103 | 3300044712 | Bacteria | 1695 |
| 1112 | Ga0453684_2276575 | 3300044712 | Unclassified | 539 |
| 1113 | Ga0466971_0001102 | 3300044719 | Bacteria | 11213 |
| 1114 | Ga0466968_0018375 | 3300044735 | Bacteria | 2804 |
| 1115 | Ga0466970_0283586 | 3300044765 | Unclassified | 932 |
| 1116 | Ga0466957_0014712 | 3300044842 | Bacteria | 4559 |
| 1117 | Ga0466959_0002822 | 3300045049 | Bacteria | 11197 |
| 1118 | Ga0466959_0027151 | 3300045049 | Bacteria | 4246 |
| 1119 | Ga0466959_0103445 | 3300045049 | Bacteria | 2037 |
| 1120 | Ga0466959_0257685 | 3300045049 | Bacteria | 1201 |
| 1121 | Ga0451576_0079035 | 3300045051 | Bacteria | 3422 |
| 1122 | Ga0451576_0231550 | 3300045051 | Bacteria | 1930 |
| 1123 | Ga0451576_0488431 | 3300045051 | Bacteria | 1293 |
| 1124 | Ga0451576_0879117 | 3300045051 | Bacteria | 940 |
| 1125 | Ga0451576_1507074 | 3300045051 | Bacteria | 699 |
| 1126 | Ga0466967_0269226 | 3300045976 | Bacteria | 1632 |
| 1127 | Ga0495617_066779 | 3300046452 | Bacteria | 1185 |
| 1128 | Ga0495592_0259242 | 3300046454 | Bacteria | 1146 |
| 1129 | Ga0495603_0163745 | 3300046455 | Bacteria | 1290 |
| 1130 | Ga0495590_0063883 | 3300046457 | Bacteria | 1288 |
| 1131 | Ga0495629_0159354 | 3300046459 | Bacteria | 1568 |
| 1132 | Ga0495629_0235336 | 3300046459 | Bacteria | 1262 |
| 1133 | Ga0495638_0020600 | 3300046460 | Bacteria | 4356 |
| 1134 | Ga0495638_0023580 | 3300046460 | Bacteria | 4022 |
| 1135 | Ga0495638_0074489 | 3300046460 | Bacteria | 2071 |
| 1136 | Ga0495638_0116034 | 3300046460 | Bacteria | 1586 |
| 1137 | Ga0495641_0101699 | 3300046461 | Bacteria | 1282 |
| 1138 | Ga0495651_0986344 | 3300046462 | Bacteria | 512 |
| 1139 | Ga0495650_0256828 | 3300046471 | Bacteria | 593 |
| 1140 | Ga0495580_0992791 | 3300046472 | Bacteria | 535 |
| 1141 | Ga0495582_0021138 | 3300046473 | Bacteria | 3564 |
| 1142 | Ga0495582_0218917 | 3300046473 | Bacteria | 1089 |
| 1143 | Ga0495639_0023140 | 3300046475 | Bacteria | 2729 |
| 1144 | Ga0495664_0661920 | 3300046477 | Bacteria | 618 |
| 1145 | Ga0495585_0124260 | 3300046492 | Bacteria | 1363 |
| 1146 | Ga0495583_0022468 | 3300046506 | Bacteria | 3218 |
| 1147 | Ga0495583_0142270 | 3300046506 | Bacteria | 998 |
| 1148 | Ga0495583_0207707 | 3300046506 | Bacteria | 794 |
| 1149 | Ga0495610_0096636 | 3300046512 | Bacteria | 1330 |
| 1150 | Ga0495616_0006494 | 3300046513 | Bacteria | 7072 |
| 1151 | Ga0495616_0093680 | 3300046513 | Bacteria | 1418 |
| 1152 | Ga0495616_0338126 | 3300046513 | Bacteria | 629 |
| 1153 | Ga0495618_0091215 | 3300046514 | Bacteria | 1948 |
| 1154 | Ga0495618_0263098 | 3300046514 | Bacteria | 1080 |
| 1155 | Ga0495620_0086369 | 3300046515 | Bacteria | 1263 |
| 1156 | Ga0495628_0530413 | 3300046516 | Bacteria | 847 |
| 1157 | Ga0495630_0140489 | 3300046517 | Bacteria | 1836 |
| 1158 | Ga0495630_0656731 | 3300046517 | Bacteria | 803 |
| 1159 | Ga0495630_0913251 | 3300046517 | Bacteria | 669 |
| 1160 | Ga0495632_0093981 | 3300046519 | Bacteria | 1418 |
| 1161 | Ga0495632_0113435 | 3300046519 | Bacteria | 1271 |
| 1162 | Ga0495632_0123602 | 3300046519 | Bacteria | 1208 |
| 1163 | Ga0495632_0489639 | 3300046519 | Unclassified | 531 |
| 1164 | Ga0495637_0119817 | 3300046520 | Bacteria | 1014 |
| 1165 | Ga0495663_0091107 | 3300046525 | Bacteria | 994 |
| 1166 | Ga0495652_0220478 | 3300046529 | Bacteria | 1426 |
| 1167 | Ga0495640_0102492 | 3300046533 | Bacteria | 1878 |
| 1168 | Ga0495586_0869142 | 3300046535 | Bacteria | 520 |
| 1169 | Ga0495587_0105962 | 3300046536 | Bacteria | 1617 |
| 1170 | Ga0495598_0186638 | 3300046537 | Bacteria | 742 |
| 1171 | Ga0495609_0186064 | 3300046538 | Bacteria | 873 |
| 1172 | Ga0495597_0317500 | 3300046542 | Bacteria | 602 |
| 1173 | Ga0495645_0354218 | 3300046543 | Bacteria | 945 |
| 1174 | Ga0495645_0522972 | 3300046543 | Bacteria | 739 |
| 1175 | Ga0495622_0117795 | 3300046557 | Bacteria | 1214 |
| 1176 | Ga0495668_0164067 | 3300046616 | Bacteria | 1217 |
| 1177 | Ga0495634_0149361 | 3300046642 | Bacteria | 1479 |
| 1178 | Ga0495634_0227438 | 3300046642 | Bacteria | 1149 |
| 1179 | Ga0495625_0020303 | 3300046660 | Bacteria | 5131 |
| 1180 | Ga0495625_0102533 | 3300046660 | Bacteria | 1964 |
| 1181 | Ga0495625_0138933 | 3300046660 | Bacteria | 1640 |
| 1182 | Ga0495625_0220280 | 3300046660 | Bacteria | 1244 |
| 1183 | Ga0495625_0377859 | 3300046660 | Bacteria | 890 |
| 1184 | Ga0495625_0441025 | 3300046660 | Bacteria | 806 |
| 1185 | Ga0495625_0595743 | 3300046660 | Bacteria | 664 |
| 1186 | Ga0495659_0077302 | 3300046664 | Bacteria | 1257 |
| 1187 | Ga0495599_0086546 | 3300046678 | Bacteria | 1957 |
| 1188 | Ga0495599_0385745 | 3300046678 | Bacteria | 836 |
| 1189 | Ga0495623_0376314 | 3300046679 | Bacteria | 769 |
| 1190 | Ga0495647_0090860 | 3300046681 | Bacteria | 1252 |
| 1191 | Ga0495647_0179329 | 3300046681 | Bacteria | 921 |
| 1192 | Ga0495647_0180487 | 3300046681 | Bacteria | 918 |
| 1193 | Ga0495658_0011888 | 3300046683 | Bacteria | 4392 |
| 1194 | Ga0495658_0027894 | 3300046683 | Bacteria | 3043 |
| 1195 | Ga0495658_0166619 | 3300046683 | Bacteria | 1362 |
| 1196 | Ga0495613_0215026 | 3300046689 | Bacteria | 1351 |
| 1197 | Ga0495613_0724512 | 3300046689 | Bacteria | 653 |
| 1198 | Ga0495624_0670704 | 3300046690 | Bacteria | 616 |
| 1199 | Ga0495670_0042455 | 3300046691 | Bacteria | 2269 |
| 1200 | Ga0495670_0564651 | 3300046691 | Bacteria | 619 |
| 1201 | Ga0495671_0253568 | 3300046692 | Bacteria | 849 |
| 1202 | Ga0495671_0295587 | 3300046692 | Bacteria | 779 |
| 1203 | Ga0495649_0509840 | 3300046694 | Bacteria | 598 |
| 1204 | Ga0495589_0119441 | 3300046794 | Bacteria | 1270 |
| 1205 | Ga0495589_0389293 | 3300046794 | Bacteria | 640 |
| 1206 | Ga0495600_0123643 | 3300046809 | Bacteria | 1683 |
| 1207 | Ga0495660_0528220 | 3300046810 | Bacteria | 502 |
| 1208 | Ga0495604_0208301 | 3300047317 | Bacteria | 1352 |
| 1209 | Ga0495604_0502222 | 3300047317 | Bacteria | 787 |
| 1210 | Ga0495674_0250348 | 3300047319 | Bacteria | 1458 |
| 1211 | Ga0495672_0312795 | 3300047320 | Bacteria | 740 |
| 1212 | Ga0495672_0437206 | 3300047320 | Bacteria | 592 |
| 1213 | Ga0495672_0555305 | 3300047320 | Bacteria | 503 |
| 1214 | Ga0495680_0062566 | 3300047322 | Bacteria | 2861 |
| 1215 | Ga0495680_0383518 | 3300047322 | Bacteria | 973 |
| 1216 | Ga0495683_0243794 | 3300047323 | Bacteria | 792 |
| 1217 | Ga0495683_0288146 | 3300047323 | Bacteria | 709 |
| 1218 | Ga0495687_032507 | 3300047443 | Bacteria | 2380 |
| 1219 | Ga0495675_0613493 | 3300047444 | Bacteria | 616 |
| 1220 | Ga0495677_0276222 | 3300047445 | Bacteria | 659 |
| 1221 | Ga0495673_0204943 | 3300047469 | Bacteria | 736 |
| 1222 | Ga0495673_0242607 | 3300047469 | Bacteria | 660 |
| 1223 | Ga0495684_0193885 | 3300047471 | Bacteria | 1501 |
| 1224 | Ga0495686_0177695 | 3300047472 | Bacteria | 1235 |
| 1225 | Ga0495602_0721799 | 3300048088 | Bacteria | 675 |
| 1226 | Ga0495602_0984899 | 3300048088 | Bacteria | 557 |
| 1227 | Ga0495626_0105620 | 3300048091 | Bacteria | 1224 |
| 1228 | Ga0496100_0003550 | 3300048903 | Bacteria | 8145 |
| 1229 | Ga0496100_0774048 | 3300048903 | Bacteria | 751 |
| 1230 | Ga0496100_0965158 | 3300048903 | Bacteria | 670 |
| 1231 | Ga0496100_1206157 | 3300048903 | Bacteria | 597 |
| 1232 | Ga0496101_0018936 | 3300048904 | Bacteria | 4690 |
| 1233 | Ga0496101_0777477 | 3300048904 | Bacteria | 755 |
| 1234 | Ga0496101_1211394 | 3300048904 | Bacteria | 591 |
| 1235 | Ga0496102_0006276 | 3300048905 | Bacteria | 10133 |
| 1236 | Ga0496102_0162163 | 3300048905 | Bacteria | 2103 |
| 1237 | Ga0496102_0199613 | 3300048905 | Bacteria | 1885 |
| 1238 | Ga0496102_0397339 | 3300048905 | Bacteria | 1296 |
| 1239 | Ga0496103_0004906 | 3300048906 | Bacteria | 8077 |
| 1240 | Ga0496103_0425100 | 3300048906 | Bacteria | 853 |
| 1241 | Ga0496103_0714653 | 3300048906 | Bacteria | 635 |
| 1242 | Ga0496104_0000099 | 3300048907 | Bacteria | 84201 |
| 1243 | Ga0496104_0043605 | 3300048907 | Bacteria | 4212 |
| 1244 | Ga0496104_0054136 | 3300048907 | Bacteria | 3792 |
| 1245 | Ga0496104_0327787 | 3300048907 | Bacteria | 1444 |
| 1246 | Ga0496105_0000021 | 3300048908 | Bacteria | 164255 |
| 1247 | Ga0496105_0003469 | 3300048908 | Bacteria | 11665 |
| 1248 | Ga0496105_0010900 | 3300048908 | Bacteria | 7160 |
| 1249 | Ga0496105_0686706 | 3300048908 | Bacteria | 787 |
| 1250 | Ga0496106_0004678 | 3300048909 | Bacteria | 10148 |
| 1251 | Ga0496106_0066543 | 3300048909 | Bacteria | 2745 |
| 1252 | Ga0496106_0183397 | 3300048909 | Bacteria | 1662 |
| 1253 | Ga0496106_0915163 | 3300048909 | Bacteria | 692 |
| 1254 | Ga0496107_0001576 | 3300048910 | Bacteria | 14181 |
| 1255 | Ga0496107_0039998 | 3300048910 | Bacteria | 3365 |
| 1256 | Ga0496108_0002086 | 3300048911 | Bacteria | 15999 |
| 1257 | Ga0496108_0140105 | 3300048911 | Bacteria | 2084 |
| 1258 | Ga0496108_0168503 | 3300048911 | Bacteria | 1894 |
| 1259 | Ga0496108_0397727 | 3300048911 | Bacteria | 1203 |
| 1260 | Ga0496109_0006030 | 3300048912 | Bacteria | 10183 |
| 1261 | Ga0496109_0618045 | 3300048912 | Bacteria | 1020 |
| 1262 | Ga0496109_0653774 | 3300048912 | Bacteria | 988 |
| 1263 | Ga0496110_0005639 | 3300048913 | Bacteria | 9824 |
| 1264 | Ga0496111_0003878 | 3300048914 | Bacteria | 9354 |
| 1265 | Ga0496112_0009054 | 3300048915 | Bacteria | 8943 |
| 1266 | Ga0496112_0574714 | 3300048915 | Bacteria | 1060 |
| 1267 | Ga0496112_0588092 | 3300048915 | Bacteria | 1045 |
| 1268 | Ga0496112_1343895 | 3300048915 | Bacteria | 630 |
| 1269 | Ga0496113_0106557 | 3300048916 | Bacteria | 2177 |
| 1270 | Ga0496113_0536021 | 3300048916 | Bacteria | 939 |
| 1271 | Ga0496114_0002220 | 3300048917 | Bacteria | 14800 |
| 1272 | Ga0496114_0009046 | 3300048917 | Bacteria | 7897 |
| 1273 | Ga0496114_0017246 | 3300048917 | Bacteria | 5825 |
| 1274 | Ga0496114_1184832 | 3300048917 | Bacteria | 650 |
| 1275 | Ga0496115_0005471 | 3300048918 | Bacteria | 9241 |
| 1276 | Ga0496115_0137279 | 3300048918 | Bacteria | 2016 |
| 1277 | Ga0496115_0201742 | 3300048918 | Bacteria | 1643 |
| 1278 | Ga0496115_0259538 | 3300048918 | Bacteria | 1429 |
| 1279 | Ga0496115_0355670 | 3300048918 | Bacteria | 1194 |
| 1280 | Ga0496115_0884241 | 3300048918 | Bacteria | 690 |
| 1281 | Ga0496116_0276692 | 3300048919 | Bacteria | 816 |
| 1282 | Ga0496117_0548477 | 3300048920 | Bacteria | 551 |
| 1283 | Ga0496118_0013267 | 3300048921 | Bacteria | 7811 |
| 1284 | Ga0496118_0609783 | 3300048921 | Bacteria | 520 |
| 1285 | Ga0496119_0281602 | 3300048922 | Bacteria | 826 |
| 1286 | Ga0496119_0530017 | 3300048922 | Bacteria | 544 |
| 1287 | Ga0496120_0269452 | 3300048923 | Bacteria | 791 |
| 1288 | Ga0496120_0413403 | 3300048923 | Bacteria | 594 |
| 1289 | Ga0496121_0000704 | 3300048924 | Bacteria | 62218 |
| 1290 | Ga0496124_0370756 | 3300048927 | Bacteria | 1005 |
| 1291 | Ga0496125_0005100 | 3300048928 | Bacteria | 14779 |
| 1292 | Ga0496125_0050036 | 3300048928 | Bacteria | 3465 |
| 1293 | Ga0496125_0124580 | 3300048928 | Bacteria | 1829 |
| 1294 | Ga0496125_0419979 | 3300048928 | Bacteria | 775 |
| 1295 | Ga0496126_0004928 | 3300048929 | Bacteria | 15582 |
| 1296 | Ga0496126_0098679 | 3300048929 | Bacteria | 2559 |
| 1297 | Ga0495682_0049136 | 3300049460 | Bacteria | 1537 |
| 1298 | Ga0501031_0579094 | 3300049568 | Bacteria | 722 |
| 1299 | Ga0501032_0186687 | 3300049569 | Bacteria | 1356 |
| 1300 | Ga0501032_0911698 | 3300049569 | Bacteria | 553 |
| 1301 | Ga0501032_1037062 | 3300049569 | Bacteria | 515 |
| 1302 | Ga0501033_0049659 | 3300049570 | Bacteria | 3114 |
| 1303 | Ga0501033_0290223 | 3300049570 | Bacteria | 1153 |
| 1304 | Ga0501036_0023621 | 3300049572 | Bacteria | 5181 |
| 1305 | Ga0501036_0048255 | 3300049572 | Bacteria | 3605 |
| 1306 | Ga0501037_0024581 | 3300049573 | Bacteria | 4455 |
| 1307 | Ga0501037_0071416 | 3300049573 | Bacteria | 2525 |
| 1308 | Ga0501038_0015092 | 3300049574 | Bacteria | 7031 |
| 1309 | Ga0501038_0090870 | 3300049574 | Bacteria | 2558 |
| 1310 | Ga0501038_0189643 | 3300049574 | Bacteria | 1655 |
| 1311 | Ga0501039_0021546 | 3300049575 | Bacteria | 4943 |
| 1312 | Ga0501039_0115981 | 3300049575 | Bacteria | 2096 |
| 1313 | Ga0501039_0451889 | 3300049575 | Bacteria | 1009 |
| 1314 | Ga0501039_0702981 | 3300049575 | Bacteria | 790 |
| 1315 | Ga0501040_0008066 | 3300049576 | Bacteria | 6839 |
| 1316 | Ga0501040_0044091 | 3300049576 | Bacteria | 3040 |
| 1317 | Ga0501041_0001598 | 3300049577 | Bacteria | 12636 |
| 1318 | Ga0501041_0119305 | 3300049577 | Bacteria | 1638 |
| 1319 | Ga0501042_0001373 | 3300049578 | Bacteria | 14288 |
| 1320 | Ga0501042_0158721 | 3300049578 | Bacteria | 1631 |
| 1321 | Ga0501043_0418507 | 3300049579 | Bacteria | 1010 |
| 1322 | Ga0501046_0015243 | 3300049580 | Bacteria | 6464 |
| 1323 | Ga0501046_0105554 | 3300049580 | Bacteria | 2157 |
| 1324 | Ga0501047_0148132 | 3300049581 | Bacteria | 2224 |
| 1325 | Ga0501047_0364875 | 3300049581 | Bacteria | 1280 |
| 1326 | Ga0501048_0009558 | 3300049582 | Bacteria | 7281 |
| 1327 | Ga0501048_0067468 | 3300049582 | Bacteria | 2528 |
| 1328 | Ga0501048_0309943 | 3300049582 | Bacteria | 1124 |
| 1329 | Ga0501067_0031483 | 3300049583 | Bacteria | 2943 |
| 1330 | Ga0501067_0138286 | 3300049583 | Bacteria | 1356 |
| 1331 | Ga0501067_0163247 | 3300049583 | Bacteria | 1241 |
| 1332 | Ga0501068_0001465 | 3300049584 | Bacteria | 12558 |
| 1333 | Ga0501068_0041518 | 3300049584 | Bacteria | 2764 |
| 1334 | Ga0501068_0404347 | 3300049584 | Bacteria | 880 |
| 1335 | Ga0501069_0392696 | 3300049585 | Bacteria | 820 |
| 1336 | Ga0501070_0044235 | 3300049586 | Bacteria | 3706 |
| 1337 | Ga0501071_0003527 | 3300049587 | Bacteria | 9786 |
| 1338 | Ga0501071_0024289 | 3300049587 | Bacteria | 4238 |
| 1339 | Ga0501071_0144858 | 3300049587 | Bacteria | 1770 |
| 1340 | Ga0501072_0025385 | 3300049588 | Bacteria | 4617 |
| 1341 | Ga0501072_0063312 | 3300049588 | Bacteria | 2917 |
| 1342 | Ga0501073_0000525 | 3300049589 | Bacteria | 26880 |
| 1343 | Ga0501073_0122379 | 3300049589 | Bacteria | 1803 |
| 1344 | Ga0501074_0001124 | 3300049590 | Bacteria | 17502 |
| 1345 | Ga0501074_0089815 | 3300049590 | Bacteria | 2200 |
| 1346 | Ga0501074_0222352 | 3300049590 | Bacteria | 1344 |
| 1347 | Ga0501075_0015597 | 3300049591 | Bacteria | 5453 |
| 1348 | Ga0501075_0055471 | 3300049591 | Bacteria | 2981 |
| 1349 | Ga0501075_0231797 | 3300049591 | Bacteria | 1408 |
| 1350 | Ga0501076_0004639 | 3300049592 | Bacteria | 9791 |
| 1351 | Ga0501076_0022764 | 3300049592 | Bacteria | 4818 |
| 1352 | Ga0501076_0028505 | 3300049592 | Bacteria | 4336 |
| 1353 | Ga0501077_0002875 | 3300049593 | Bacteria | 10325 |
| 1354 | Ga0501077_0007629 | 3300049593 | Bacteria | 6677 |
| 1355 | Ga0501077_0029086 | 3300049593 | Bacteria | 3512 |
| 1356 | Ga0501221_202380 | 3300049704 | Bacteria | 552 |
| 1357 | Ga0501229_020387 | 3300049706 | Bacteria | 877 |
| 1358 | Ga0501079_0004772 | 3300049741 | Bacteria | 10039 |
| 1359 | Ga0501079_0006996 | 3300049741 | Bacteria | 8503 |
| 1360 | Ga0501079_0179169 | 3300049741 | Bacteria | 1653 |
| 1361 | Ga0501080_0001373 | 3300049742 | Bacteria | 20360 |
| 1362 | Ga0501080_0011395 | 3300049742 | Bacteria | 8144 |
| 1363 | Ga0501080_0037660 | 3300049742 | Bacteria | 4517 |
| 1364 | Ga0501080_0794587 | 3300049742 | Bacteria | 830 |
| 1365 | Ga0501080_0865037 | 3300049742 | Bacteria | 790 |
| 1366 | Ga0501080_1063857 | 3300049742 | Bacteria | 700 |
| 1367 | Ga0501081_0006719 | 3300049743 | Bacteria | 7480 |
| 1368 | Ga0501081_0018126 | 3300049743 | Bacteria | 4672 |
| 1369 | Ga0501083_0004501 | 3300049744 | Bacteria | 9845 |
| 1370 | Ga0501083_0032077 | 3300049744 | Bacteria | 3604 |
| 1371 | Ga0501083_0067453 | 3300049744 | Bacteria | 2382 |
| 1372 | Ga0501083_0079781 | 3300049744 | Bacteria | 2170 |
| 1373 | Ga0501035_0416594 | 3300049822 | Bacteria | 1115 |
| 1374 | Ga0501035_0532215 | 3300049822 | Bacteria | 964 |
| 1375 | Ga0501035_0950616 | 3300049822 | Bacteria | 678 |
| 1376 | Ga0501044_0413807 | 3300049823 | Bacteria | 1259 |
| 1377 | Ga0501044_1078751 | 3300049823 | Bacteria | 673 |
| 1378 | Ga0501045_0008747 | 3300049824 | Bacteria | 7062 |
| 1379 | Ga0501045_0084307 | 3300049824 | Bacteria | 2344 |
| 1380 | nmdc:mga00v17_416636_c1 | 3300050491 | Bacteria | 872 |
| 1381 | nmdc:mga0k408_129650_c1 | 3300050493 | Bacteria | 1497 |
| 1382 | nmdc:mga0k408_210024_c1 | 3300050493 | Bacteria | 1162 |
| 1383 | nmdc:mga0k408_403038_c1 | 3300050493 | Bacteria | 814 |
| 1384 | nmdc:mga0k408_620355_c1 | 3300050493 | Bacteria | 637 |
| 1385 | nmdc:mga0k408_65172_c1 | 3300050493 | Bacteria | 2120 |
| 1386 | nmdc:mga06z11_249605_c1 | 3300050494 | Bacteria | 1044 |
| 1387 | nmdc:mga06z11_526216_c1 | 3300050494 | Bacteria | 717 |
| 1388 | nmdc:mga04h51_191481_c1 | 3300050495 | Bacteria | 800 |
| 1389 | nmdc:mga07m45_427265_c1 | 3300050496 | Bacteria | 768 |
| 1390 | nmdc:mga07m45_463706_c1 | 3300050496 | Bacteria | 734 |
| 1391 | nmdc:mga07m45_490894_c1 | 3300050496 | Bacteria | 711 |
| 1392 | nmdc:mga07m45_826988_c1 | 3300050496 | Bacteria | 530 |
| 1393 | nmdc:mga09592_404099_c1 | 3300050508 | Bacteria | 1180 |
| 1394 | nmdc:mga0qj67_1159723_c1 | 3300050509 | Bacteria | 602 |
| 1395 | nmdc:mga0qj67_1182304_c1 | 3300050509 | Bacteria | 595 |
| 1396 | nmdc:mga08y16_397291_c1 | 3300050511 | Bacteria | 1411 |
| 1397 | nmdc:mga0rr50_62474_c1 | 3300050513 | Bacteria | 2810 |
| 1398 | nmdc:mga0a205_803976_c1 | 3300050515 | Bacteria | 788 |
| 1399 | Ga0495601_0301989 | 3300053077 | Bacteria | 1043 |
| 1400 | Ga0495601_0375658 | 3300053077 | Bacteria | 923 |
| 1401 | Ga0495612_0422317 | 3300053078 | Bacteria | 607 |
| 1402 | Ga0495655_0027539 | 3300053083 | Bacteria | 1349 |
| 1403 | Ga0495619_0091313 | 3300053085 | Bacteria | 2062 |
| 1404 | Ga0500644_0024450 | 3300053088 | Bacteria | 1847 |
| 1405 | Ga0500644_0061778 | 3300053088 | Bacteria | 1322 |
| 1406 | Ga0500644_0093414 | 3300053088 | Bacteria | 1130 |
| 1407 | Ga0500646_0034024 | 3300053090 | Bacteria | 1412 |
| 1408 | Ga0500583_0002507 | 3300053092 | Bacteria | 5535 |
| 1409 | Ga0500583_0041097 | 3300053092 | Bacteria | 2098 |
| 1410 | Ga0500641_0069032 | 3300053096 | Bacteria | 1484 |
| 1411 | Ga0500641_0105565 | 3300053096 | Bacteria | 1210 |
| 1412 | Ga0500641_0180809 | 3300053096 | Bacteria | 905 |
| 1413 | Ga0500648_185932 | 3300053097 | Bacteria | 1063 |
| 1414 | Ga0500569_074574 | 3300053109 | Bacteria | 1074 |
| 1415 | Ga0500594_0090275 | 3300053118 | Bacteria | 929 |
| 1416 | Ga0500597_287311 | 3300053120 | Bacteria | 661 |
| 1417 | Ga0500621_165278 | 3300053126 | Bacteria | 817 |
| 1418 | Ga0500621_239922 | 3300053126 | Bacteria | 616 |
| 1419 | Ga0500623_241004 | 3300053127 | Unclassified | 616 |
| 1420 | Ga0500642_0084229 | 3300053130 | Bacteria | 1464 |
| 1421 | Ga0500642_0147518 | 3300053130 | Bacteria | 1104 |
| 1422 | Ga0500652_095300 | 3300053131 | Bacteria | 1243 |
| 1423 | Ga0500568_0017821 | 3300053139 | Bacteria | 3124 |
| 1424 | Ga0500589_240462 | 3300053147 | Bacteria | 670 |
| 1425 | Ga0500616_0000499 | 3300053153 | Bacteria | 50346 |
| 1426 | Ga0500616_0007626 | 3300053153 | Bacteria | 6839 |
| 1427 | Ga0500622_0003284 | 3300053156 | Bacteria | 10962 |
| 1428 | Ga0500627_0283306 | 3300053158 | Bacteria | 727 |
| 1429 | Ga0500630_113114 | 3300053159 | Bacteria | 1216 |
| 1430 | Ga0500639_292615 | 3300053163 | Bacteria | 618 |
| 1431 | Ga0500636_0329121 | 3300053177 | Bacteria | 739 |
| 1432 | Ga0500637_0239922 | 3300053178 | Bacteria | 1016 |
| 1433 | Ga0500611_066042 | 3300053727 | Bacteria | 869 |
| 1434 | Ga0501084_0008704 | 3300054114 | Bacteria | 8394 |
| 1435 | Ga0501084_0022568 | 3300054114 | Bacteria | 5252 |
| 1436 | Ga0501084_0144399 | 3300054114 | Bacteria | 2004 |
| 1437 | Ga0501084_1367973 | 3300054114 | Bacteria | 593 |
| 1438 | Ga0590075_024840 | 3300059424 | Bacteria | 1505 |
| 1439 | Ga0590075_092399 | 3300059424 | Bacteria | 785 |
| 1440 | Ga0590077_032183 | 3300059426 | Bacteria | 1148 |
| 1441 | Ga0590077_115504 | 3300059426 | Bacteria | 633 |
| 1442 | Ga0587066_011018 | 3300059490 | Bacteria | 1318 |
| 1443 | Ga0587070_211754 | 3300059491 | Bacteria | 521 |
| 1444 | Ga0587073_0063602 | 3300059492 | Bacteria | 872 |
| 1445 | Ga0587073_0206325 | 3300059492 | Bacteria | 592 |
| 1446 | Ga0587077_005133 | 3300059493 | Bacteria | 1771 |
| 1447 | Ga0587077_020561 | 3300059493 | Bacteria | 1162 |
| 1448 | Ga0587080_004278 | 3300059503 | Bacteria | 1842 |
| 1449 | Ga0587083_0015822 | 3300059505 | Bacteria | 1323 |
| 1450 | Ga0587083_0029935 | 3300059505 | Bacteria | 1076 |
| 1451 | Ga0587088_005875 | 3300059508 | Bacteria | 1633 |
| 1452 | Ga0587090_007160 | 3300059510 | Bacteria | 1457 |
| 1453 | Ga0587094_013915 | 3300059513 | Bacteria | 1093 |
| 1454 | Ga0587106_017423 | 3300059605 | Bacteria | 1027 |
| 1455 | Ga0587109_008544 | 3300059624 | Bacteria | 1584 |
| 1456 | Ga0587128_094305 | 3300059630 | Bacteria | 618 |
| 1457 | Ga0587130_039456 | 3300059631 | Unclassified | 567 |
| 1458 | Ga0587062_011923 | 3300059639 | Bacteria | 1106 |
| 1459 | Ga0587067_014519 | 3300059640 | Bacteria | 1264 |
| 1460 | Ga0587067_021127 | 3300059640 | Bacteria | 1120 |
| 1461 | Ga0587068_042614 | 3300059641 | Bacteria | 826 |
| 1462 | Ga0587068_045700 | 3300059641 | Bacteria | 805 |
| 1463 | Ga0587075_018539 | 3300059644 | Bacteria | 1011 |
| 1464 | Ga0587076_014586 | 3300059645 | Bacteria | 1212 |
| 1465 | Ga0587076_038507 | 3300059645 | Bacteria | 883 |
| 1466 | Ga0587076_157098 | 3300059645 | Bacteria | 556 |
| 1467 | Ga0587110_028294 | 3300059654 | Bacteria | 672 |
| 1468 | Ga0587071_070132 | 3300060344 | Bacteria | 762 |
| 1469 | Ga0587111_0035975 | 3300060346 | Bacteria | 1035 |
| 1470 | Ga0587111_0190869 | 3300060346 | Bacteria | 575 |
| 1471 | Ga0501082_0004231 | 3300060353 | Bacteria | 12537 |
| 1472 | Ga0501082_0043889 | 3300060353 | Bacteria | 3857 |
| 1473 | Ga0501082_0087089 | 3300060353 | Bacteria | 2694 |
| 1474 | Ga0466962_0001207 | 3300061719 | Bacteria | 11873 |
| 1475 | Ga0530510_0007174 | 3300061734 | Bacteria | 7756 |
| 1476 | Ga0530510_0170978 | 3300061734 | Bacteria | 1609 |
| 1477 | Ga0530510_0398438 | 3300061734 | Bacteria | 1037 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 2162886007 | SwRhRL2b_contig_2458830 | SwRhRL2b_0662.00000660 | 101 |
| 2 | 2162886007 | SwRhRL2b_contig_305464 | SwRhRL2b_0013.00005770 | 101 |
| 3 | 3300000546 | LJNas_1009780 | LJNas_10097802 | 101 |
| 4 | 3300003322 | rootL2_10298515 | rootL2_102985152 | 101 |
| 5 | 3300005295 | Ga0065707_10083802 | Ga0065707_1008380211 | 101 |
| 6 | 3300005327 | Ga0070658_10257996 | Ga0070658_102579962 | 101 |
| 7 | 3300005327 | Ga0070658_10295114 | Ga0070658_102951143 | 101 |
| 8 | 3300005328 | Ga0070676_10073677 | Ga0070676_100736773 | 101 |
| 9 | 3300005328 | Ga0070676_10479439 | Ga0070676_104794392 | 101 |
| 10 | 3300005328 | Ga0070676_11028069 | Ga0070676_110280691 | 101 |
| 11 | 3300005329 | Ga0070683_100880746 | Ga0070683_1008807462 | 101 |
| 12 | 3300005329 | Ga0070683_100929438 | Ga0070683_1009294382 | 101 |
| 13 | 3300005330 | Ga0070690_100185153 | Ga0070690_1001851532 | 101 |
| 14 | 3300005330 | Ga0070690_100818035 | Ga0070690_1008180351 | 101 |
| 15 | 3300005331 | Ga0070670_100000015 | Ga0070670_10000001516 | 101 |
| 16 | 3300005331 | Ga0070670_100042316 | Ga0070670_1000423168 | 101 |
| 17 | 3300005331 | Ga0070670_100199450 | Ga0070670_1001994502 | 101 |
| 18 | 3300005331 | Ga0070670_100265999 | Ga0070670_1002659993 | 101 |
| 19 | 3300005331 | Ga0070670_100873049 | Ga0070670_1008730492 | 101 |
| 20 | 3300005333 | Ga0070677_10072009 | Ga0070677_100720093 | 101 |
| 21 | 3300005333 | Ga0070677_10097789 | Ga0070677_100977893 | 101 |
| 22 | 3300005334 | Ga0068869_100157158 | Ga0068869_1001571584 | 101 |
| 23 | 3300005334 | Ga0068869_100185294 | Ga0068869_1001852944 | 101 |
| 24 | 3300005334 | Ga0068869_100227172 | Ga0068869_1002271722 | 101 |
| 25 | 3300005334 | Ga0068869_100263074 | Ga0068869_1002630742 | 101 |
| 26 | 3300005334 | Ga0068869_100263844 | Ga0068869_1002638442 | 101 |
| 27 | 3300005334 | Ga0068869_100272095 | Ga0068869_1002720951 | 101 |
| 28 | 3300005334 | Ga0068869_100482335 | Ga0068869_1004823351 | 101 |
| 29 | 3300005334 | Ga0068869_100800604 | Ga0068869_1008006042 | 101 |
| 30 | 3300005335 | Ga0070666_10001446 | Ga0070666_1000144616 | 101 |
| 31 | 3300005335 | Ga0070666_10005025 | Ga0070666_100050258 | 101 |
| 32 | 3300005335 | Ga0070666_10007123 | Ga0070666_100071239 | 101 |
| 33 | 3300005335 | Ga0070666_10128706 | Ga0070666_101287064 | 101 |
| 34 | 3300005335 | Ga0070666_10520393 | Ga0070666_105203931 | 101 |
| 35 | 3300005336 | Ga0070680_100040283 | Ga0070680_1000402839 | 101 |
| 36 | 3300005336 | Ga0070680_100105088 | Ga0070680_1001050881 | 101 |
| 37 | 3300005336 | Ga0070680_100262924 | Ga0070680_1002629244 | 101 |
| 38 | 3300005336 | Ga0070680_100391830 | Ga0070680_1003918303 | 101 |
| 39 | 3300005337 | Ga0070682_100093827 | Ga0070682_1000938275 | 101 |
| 40 | 3300005337 | Ga0070682_100196386 | Ga0070682_1001963864 | 101 |
| 41 | 3300005337 | Ga0070682_100295777 | Ga0070682_1002957773 | 101 |
| 42 | 3300005337 | Ga0070682_100522069 | Ga0070682_1005220691 | 101 |
| 43 | 3300005337 | Ga0070682_101875204 | Ga0070682_1018752041 | 101 |
| 44 | 3300005337 | Ga0070682_101957885 | Ga0070682_1019578852 | 101 |
| 45 | 3300005338 | Ga0068868_100008294 | Ga0068868_1000082945 | 101 |
| 46 | 3300005338 | Ga0068868_100155721 | Ga0068868_1001557213 | 101 |
| 47 | 3300005338 | Ga0068868_100297572 | Ga0068868_1002975723 | 101 |
| 48 | 3300005338 | Ga0068868_100945844 | Ga0068868_1009458441 | 101 |
| 49 | 3300005339 | Ga0070660_100218304 | Ga0070660_1002183043 | 101 |
| 50 | 3300005339 | Ga0070660_100822022 | Ga0070660_1008220222 | 101 |
| 51 | 3300005339 | Ga0070660_101314308 | Ga0070660_1013143081 | 101 |
| 52 | 3300005340 | Ga0070689_100015417 | Ga0070689_10001541710 | 101 |
| 53 | 3300005340 | Ga0070689_100194297 | Ga0070689_1001942974 | 101 |
| 54 | 3300005340 | Ga0070689_100639427 | Ga0070689_1006394272 | 101 |
| 55 | 3300005340 | Ga0070689_100729449 | Ga0070689_1007294492 | 101 |
| 56 | 3300005340 | Ga0070689_101539914 | Ga0070689_1015399141 | 101 |
| 57 | 3300005343 | Ga0070687_100398813 | Ga0070687_1003988132 | 101 |
| 58 | 3300005344 | Ga0070661_100043750 | Ga0070661_1000437504 | 101 |
| 59 | 3300005344 | Ga0070661_100405968 | Ga0070661_1004059682 | 101 |
| 60 | 3300005344 | Ga0070661_100476134 | Ga0070661_1004761343 | 101 |
| 61 | 3300005345 | Ga0070692_10637538 | Ga0070692_106375381 | 101 |
| 62 | 3300005347 | Ga0070668_100015678 | Ga0070668_10001567811 | 101 |
| 63 | 3300005347 | Ga0070668_100304484 | Ga0070668_1003044842 | 101 |
| 64 | 3300005347 | Ga0070668_100553556 | Ga0070668_1005535562 | 101 |
| 65 | 3300005347 | Ga0070668_100701114 | Ga0070668_1007011142 | 101 |
| 66 | 3300005347 | Ga0070668_101105513 | Ga0070668_1011055132 | 101 |
| 67 | 3300005353 | Ga0070669_100004607 | Ga0070669_10000460716 | 101 |
| 68 | 3300005353 | Ga0070669_100068175 | Ga0070669_1000681754 | 101 |
| 69 | 3300005353 | Ga0070669_101167194 | Ga0070669_1011671941 | 101 |
| 70 | 3300005354 | Ga0070675_100604755 | Ga0070675_1006047552 | 101 |
| 71 | 3300005354 | Ga0070675_101450340 | Ga0070675_1014503401 | 101 |
| 72 | 3300005354 | Ga0070675_101542601 | Ga0070675_1015426011 | 101 |
| 73 | 3300005354 | Ga0070675_101975770 | Ga0070675_1019757701 | 101 |
| 74 | 3300005355 | Ga0070671_100000013 | Ga0070671_10000001316 | 101 |
| 75 | 3300005355 | Ga0070671_100003161 | Ga0070671_10000316111 | 101 |
| 76 | 3300005355 | Ga0070671_100005400 | Ga0070671_10000540015 | 101 |
| 77 | 3300005355 | Ga0070671_100024367 | Ga0070671_1000243678 | 101 |
| 78 | 3300005355 | Ga0070671_100043910 | Ga0070671_1000439108 | 101 |
| 79 | 3300005355 | Ga0070671_100194729 | Ga0070671_1001947293 | 101 |
| 80 | 3300005355 | Ga0070671_100289073 | Ga0070671_1002890732 | 101 |
| 81 | 3300005355 | Ga0070671_100968024 | Ga0070671_1009680242 | 101 |
| 82 | 3300005355 | Ga0070671_101230034 | Ga0070671_1012300341 | 101 |
| 83 | 3300005356 | Ga0070674_100459821 | Ga0070674_1004598212 | 101 |
| 84 | 3300005356 | Ga0070674_100875519 | Ga0070674_1008755191 | 101 |
| 85 | 3300005356 | Ga0070674_101181444 | Ga0070674_1011814441 | 101 |
| 86 | 3300005364 | Ga0070673_100069532 | Ga0070673_1000695321 | 101 |
| 87 | 3300005364 | Ga0070673_100126122 | Ga0070673_1001261224 | 101 |
| 88 | 3300005364 | Ga0070673_101085747 | Ga0070673_1010857472 | 101 |
| 89 | 3300005365 | Ga0070688_100001170 | Ga0070688_1000011707 | 101 |
| 90 | 3300005365 | Ga0070688_100100587 | Ga0070688_1001005872 | 101 |
| 91 | 3300005365 | Ga0070688_100224119 | Ga0070688_1002241191 | 101 |
| 92 | 3300005365 | Ga0070688_101429513 | Ga0070688_1014295131 | 101 |
| 93 | 3300005366 | Ga0070659_100912333 | Ga0070659_1009123332 | 101 |
| 94 | 3300005366 | Ga0070659_101332672 | Ga0070659_1013326722 | 101 |
| 95 | 3300005367 | Ga0070667_100000015 | Ga0070667_100000015199 | 101 |
| 96 | 3300005367 | Ga0070667_100012347 | Ga0070667_10001234711 | 101 |
| 97 | 3300005367 | Ga0070667_100052533 | Ga0070667_1000525333 | 101 |
| 98 | 3300005367 | Ga0070667_100055472 | Ga0070667_1000554722 | 101 |
| 99 | 3300005367 | Ga0070667_100129962 | Ga0070667_1001299625 | 101 |
| 100 | 3300005367 | Ga0070667_100246143 | Ga0070667_1002461433 | 101 |
| 101 | 3300005367 | Ga0070667_100332046 | Ga0070667_1003320463 | 101 |
| 102 | 3300005367 | Ga0070667_100361652 | Ga0070667_1003616522 | 101 |
| 103 | 3300005367 | Ga0070667_100496374 | Ga0070667_1004963742 | 101 |
| 104 | 3300005367 | Ga0070667_100907096 | Ga0070667_1009070961 | 101 |
| 105 | 3300005367 | Ga0070667_101053655 | Ga0070667_1010536551 | 101 |
| 106 | 3300005367 | Ga0070667_101650388 | Ga0070667_1016503882 | 101 |
| 107 | 3300005434 | Ga0070709_10009928 | Ga0070709_100099287 | 101 |
| 108 | 3300005434 | Ga0070709_10015515 | Ga0070709_100155155 | 101 |
| 109 | 3300005434 | Ga0070709_10540170 | Ga0070709_105401702 | 101 |
| 110 | 3300005434 | Ga0070709_11246486 | Ga0070709_112464862 | 101 |
| 111 | 3300005435 | Ga0070714_100009500 | Ga0070714_1000095009 | 101 |
| 112 | 3300005435 | Ga0070714_100039089 | Ga0070714_1000390894 | 101 |
| 113 | 3300005435 | Ga0070714_100118523 | Ga0070714_1001185233 | 101 |
| 114 | 3300005436 | Ga0070713_100001795 | Ga0070713_10000179517 | 101 |
| 115 | 3300005436 | Ga0070713_100006105 | Ga0070713_10000610516 | 101 |
| 116 | 3300005436 | Ga0070713_100143194 | Ga0070713_1001431944 | 101 |
| 117 | 3300005436 | Ga0070713_102210715 | Ga0070713_1022107151 | 101 |
| 118 | 3300005437 | Ga0070710_10218779 | Ga0070710_102187792 | 101 |
| 119 | 3300005437 | Ga0070710_10282913 | Ga0070710_102829133 | 101 |
| 120 | 3300005437 | Ga0070710_10284586 | Ga0070710_102845863 | 101 |
| 121 | 3300005437 | Ga0070710_10297749 | Ga0070710_102977493 | 101 |
| 122 | 3300005437 | Ga0070710_10439812 | Ga0070710_104398122 | 101 |
| 123 | 3300005437 | Ga0070710_10509940 | Ga0070710_105099402 | 101 |
| 124 | 3300005438 | Ga0070701_10012276 | Ga0070701_100122763 | 101 |
| 125 | 3300005438 | Ga0070701_10936903 | Ga0070701_109369032 | 101 |
| 126 | 3300005438 | Ga0070701_11077180 | Ga0070701_110771802 | 101 |
| 127 | 3300005439 | Ga0070711_100001465 | Ga0070711_10000146514 | 101 |
| 128 | 3300005439 | Ga0070711_100025752 | Ga0070711_1000257525 | 101 |
| 129 | 3300005439 | Ga0070711_100102588 | Ga0070711_1001025882 | 101 |
| 130 | 3300005439 | Ga0070711_101116594 | Ga0070711_1011165942 | 101 |
| 131 | 3300005440 | Ga0070705_100026638 | Ga0070705_1000266382 | 101 |
| 132 | 3300005440 | Ga0070705_100959165 | Ga0070705_1009591651 | 101 |
| 133 | 3300005440 | Ga0070705_101410545 | Ga0070705_1014105451 | 101 |
| 134 | 3300005441 | Ga0070700_100108314 | Ga0070700_1001083143 | 101 |
| 135 | 3300005441 | Ga0070700_100111081 | Ga0070700_1001110813 | 101 |
| 136 | 3300005444 | Ga0070694_100203816 | Ga0070694_1002038162 | 101 |
| 137 | 3300005444 | Ga0070694_100266569 | Ga0070694_1002665693 | 101 |
| 138 | 3300005444 | Ga0070694_101631334 | Ga0070694_1016313341 | 101 |
| 139 | 3300005455 | Ga0070663_100261291 | Ga0070663_1002612913 | 101 |
| 140 | 3300005455 | Ga0070663_100460622 | Ga0070663_1004606222 | 101 |
| 141 | 3300005455 | Ga0070663_100887224 | Ga0070663_1008872242 | 101 |
| 142 | 3300005455 | Ga0070663_100961791 | Ga0070663_1009617911 | 101 |
| 143 | 3300005456 | Ga0070678_100002594 | Ga0070678_1000025948 | 101 |
| 144 | 3300005456 | Ga0070678_100003045 | Ga0070678_1000030454 | 101 |
| 145 | 3300005457 | Ga0070662_100193386 | Ga0070662_1001933863 | 101 |
| 146 | 3300005457 | Ga0070662_100324196 | Ga0070662_1003241963 | 101 |
| 147 | 3300005457 | Ga0070662_100566273 | Ga0070662_1005662732 | 101 |
| 148 | 3300005457 | Ga0070662_101037380 | Ga0070662_1010373802 | 101 |
| 149 | 3300005458 | Ga0070681_10008976 | Ga0070681_1000897612 | 101 |
| 150 | 3300005458 | Ga0070681_10035786 | Ga0070681_100357867 | 101 |
| 151 | 3300005458 | Ga0070681_10048581 | Ga0070681_100485818 | 101 |
| 152 | 3300005458 | Ga0070681_10124955 | Ga0070681_101249556 | 101 |
| 153 | 3300005458 | Ga0070681_10226323 | Ga0070681_102263234 | 101 |
| 154 | 3300005458 | Ga0070681_10447630 | Ga0070681_104476301 | 101 |
| 155 | 3300005458 | Ga0070681_10857361 | Ga0070681_108573612 | 101 |
| 156 | 3300005459 | Ga0068867_100034823 | Ga0068867_1000348237 | 101 |
| 157 | 3300005459 | Ga0068867_100284808 | Ga0068867_1002848082 | 101 |
| 158 | 3300005459 | Ga0068867_100308681 | Ga0068867_1003086813 | 101 |
| 159 | 3300005459 | Ga0068867_100582762 | Ga0068867_1005827622 | 101 |
| 160 | 3300005459 | Ga0068867_102247104 | Ga0068867_1022471041 | 101 |
| 161 | 3300005466 | Ga0070685_10000104 | Ga0070685_1000010415 | 101 |
| 162 | 3300005466 | Ga0070685_10075272 | Ga0070685_100752722 | 101 |
| 163 | 3300005466 | Ga0070685_10359631 | Ga0070685_103596311 | 101 |
| 164 | 3300005466 | Ga0070685_10379550 | Ga0070685_103795502 | 101 |
| 165 | 3300005466 | Ga0070685_10694073 | Ga0070685_106940731 | 101 |
| 166 | 3300005467 | Ga0070706_100618727 | Ga0070706_1006187272 | 101 |
| 167 | 3300005471 | Ga0070698_100403358 | Ga0070698_1004033582 | 101 |
| 168 | 3300005518 | Ga0070699_100038586 | Ga0070699_1000385864 | 101 |
| 169 | 3300005518 | Ga0070699_101982475 | Ga0070699_1019824751 | 101 |
| 170 | 3300005530 | Ga0070679_100017288 | Ga0070679_1000172882 | 101 |
| 171 | 3300005530 | Ga0070679_100103898 | Ga0070679_1001038981 | 101 |
| 172 | 3300005530 | Ga0070679_100392779 | Ga0070679_1003927791 | 101 |
| 173 | 3300005530 | Ga0070679_100461063 | Ga0070679_1004610631 | 101 |
| 174 | 3300005530 | Ga0070679_100979079 | Ga0070679_1009790792 | 101 |
| 175 | 3300005535 | Ga0070684_100247020 | Ga0070684_1002470202 | 101 |
| 176 | 3300005535 | Ga0070684_100338267 | Ga0070684_1003382673 | 101 |
| 177 | 3300005539 | Ga0068853_100093611 | Ga0068853_1000936117 | 101 |
| 178 | 3300005539 | Ga0068853_100411250 | Ga0068853_1004112503 | 101 |
| 179 | 3300005539 | Ga0068853_100832908 | Ga0068853_1008329082 | 101 |
| 180 | 3300005539 | Ga0068853_102131749 | Ga0068853_1021317492 | 101 |
| 181 | 3300005543 | Ga0070672_100029396 | Ga0070672_1000293968 | 101 |
| 182 | 3300005543 | Ga0070672_100123866 | Ga0070672_1001238664 | 101 |
| 183 | 3300005543 | Ga0070672_101584022 | Ga0070672_1015840222 | 101 |
| 184 | 3300005544 | Ga0070686_100033543 | Ga0070686_1000335438 | 101 |
| 185 | 3300005544 | Ga0070686_100067091 | Ga0070686_1000670912 | 101 |
| 186 | 3300005544 | Ga0070686_100304762 | Ga0070686_1003047621 | 101 |
| 187 | 3300005544 | Ga0070686_100328730 | Ga0070686_1003287302 | 101 |
| 188 | 3300005544 | Ga0070686_100331701 | Ga0070686_1003317011 | 101 |
| 189 | 3300005544 | Ga0070686_100427149 | Ga0070686_1004271491 | 101 |
| 190 | 3300005544 | Ga0070686_101294030 | Ga0070686_1012940301 | 101 |
| 191 | 3300005545 | Ga0070695_100002554 | Ga0070695_1000025545 | 101 |
| 192 | 3300005545 | Ga0070695_100315217 | Ga0070695_1003152171 | 101 |
| 193 | 3300005546 | Ga0070696_100001443 | Ga0070696_10000144316 | 101 |
| 194 | 3300005546 | Ga0070696_100094917 | Ga0070696_1000949173 | 101 |
| 195 | 3300005546 | Ga0070696_100302416 | Ga0070696_1003024163 | 101 |
| 196 | 3300005546 | Ga0070696_100456680 | Ga0070696_1004566802 | 101 |
| 197 | 3300005547 | Ga0070693_100005307 | Ga0070693_1000053074 | 101 |
| 198 | 3300005547 | Ga0070693_100297442 | Ga0070693_1002974423 | 101 |
| 199 | 3300005547 | Ga0070693_100486805 | Ga0070693_1004868052 | 101 |
| 200 | 3300005547 | Ga0070693_100898563 | Ga0070693_1008985632 | 101 |
| 201 | 3300005548 | Ga0070665_100000175 | Ga0070665_10000017599 | 101 |
| 202 | 3300005548 | Ga0070665_100003465 | Ga0070665_10000346512 | 101 |
| 203 | 3300005548 | Ga0070665_100005442 | Ga0070665_10000544213 | 101 |
| 204 | 3300005548 | Ga0070665_100007665 | Ga0070665_1000076657 | 101 |
| 205 | 3300005548 | Ga0070665_100008007 | Ga0070665_1000080072 | 101 |
| 206 | 3300005548 | Ga0070665_100008860 | Ga0070665_1000088608 | 101 |
| 207 | 3300005548 | Ga0070665_100014481 | Ga0070665_10001448111 | 101 |
| 208 | 3300005548 | Ga0070665_100041345 | Ga0070665_1000413451 | 101 |
| 209 | 3300005548 | Ga0070665_100045273 | Ga0070665_1000452738 | 101 |
| 210 | 3300005548 | Ga0070665_100088333 | Ga0070665_1000883335 | 101 |
| 211 | 3300005548 | Ga0070665_100373744 | Ga0070665_1003737444 | 101 |
| 212 | 3300005548 | Ga0070665_101260584 | Ga0070665_1012605842 | 101 |
| 213 | 3300005548 | Ga0070665_101569949 | Ga0070665_1015699492 | 101 |
| 214 | 3300005548 | Ga0070665_101617870 | Ga0070665_1016178701 | 101 |
| 215 | 3300005549 | Ga0070704_100096958 | Ga0070704_1000969582 | 101 |
| 216 | 3300005549 | Ga0070704_101225118 | Ga0070704_1012251182 | 101 |
| 217 | 3300005549 | Ga0070704_101291132 | Ga0070704_1012911321 | 101 |
| 218 | 3300005563 | Ga0068855_100008308 | Ga0068855_10000830813 | 101 |
| 219 | 3300005563 | Ga0068855_100032357 | Ga0068855_1000323572 | 101 |
| 220 | 3300005563 | Ga0068855_100065515 | Ga0068855_1000655153 | 101 |
| 221 | 3300005563 | Ga0068855_100114994 | Ga0068855_1001149945 | 101 |
| 222 | 3300005563 | Ga0068855_100271336 | Ga0068855_1002713365 | 101 |
| 223 | 3300005563 | Ga0068855_100285468 | Ga0068855_1002854681 | 101 |
| 224 | 3300005563 | Ga0068855_100428146 | Ga0068855_1004281461 | 101 |
| 225 | 3300005563 | Ga0068855_100586554 | Ga0068855_1005865541 | 101 |
| 226 | 3300005563 | Ga0068855_100685966 | Ga0068855_1006859663 | 101 |
| 227 | 3300005564 | Ga0070664_100047403 | Ga0070664_1000474036 | 101 |
| 228 | 3300005564 | Ga0070664_100155787 | Ga0070664_1001557874 | 101 |
| 229 | 3300005564 | Ga0070664_100380435 | Ga0070664_1003804352 | 101 |
| 230 | 3300005564 | Ga0070664_101172709 | Ga0070664_1011727092 | 101 |
| 231 | 3300005564 | Ga0070664_101232379 | Ga0070664_1012323792 | 101 |
| 232 | 3300005564 | Ga0070664_101274042 | Ga0070664_1012740422 | 101 |
| 233 | 3300005564 | Ga0070664_101451379 | Ga0070664_1014513792 | 101 |
| 234 | 3300005564 | Ga0070664_101766471 | Ga0070664_1017664712 | 101 |
| 235 | 3300005577 | Ga0068857_100399905 | Ga0068857_1003999053 | 101 |
| 236 | 3300005577 | Ga0068857_100466980 | Ga0068857_1004669803 | 101 |
| 237 | 3300005577 | Ga0068857_101793026 | Ga0068857_1017930262 | 101 |
| 238 | 3300005578 | Ga0068854_100120736 | Ga0068854_1001207364 | 101 |
| 239 | 3300005578 | Ga0068854_100126961 | Ga0068854_1001269614 | 101 |
| 240 | 3300005578 | Ga0068854_100585414 | Ga0068854_1005854142 | 101 |
| 241 | 3300005578 | Ga0068854_100961944 | Ga0068854_1009619442 | 101 |
| 242 | 3300005578 | Ga0068854_101178647 | Ga0068854_1011786471 | 101 |
| 243 | 3300005578 | Ga0068854_101347674 | Ga0068854_1013476742 | 101 |
| 244 | 3300005614 | Ga0068856_100006458 | Ga0068856_10000645819 | 101 |
| 245 | 3300005614 | Ga0068856_100042931 | Ga0068856_1000429314 | 101 |
| 246 | 3300005614 | Ga0068856_100047430 | Ga0068856_1000474305 | 101 |
| 247 | 3300005614 | Ga0068856_100065387 | Ga0068856_1000653875 | 101 |
| 248 | 3300005614 | Ga0068856_101019825 | Ga0068856_1010198252 | 101 |
| 249 | 3300005614 | Ga0068856_101760333 | Ga0068856_1017603332 | 101 |
| 250 | 3300005615 | Ga0070702_100447241 | Ga0070702_1004472412 | 101 |
| 251 | 3300005615 | Ga0070702_100490995 | Ga0070702_1004909951 | 101 |
| 252 | 3300005615 | Ga0070702_101506072 | Ga0070702_1015060721 | 101 |
| 253 | 3300005616 | Ga0068852_100172880 | Ga0068852_1001728805 | 101 |
| 254 | 3300005616 | Ga0068852_100275903 | Ga0068852_1002759031 | 101 |
| 255 | 3300005616 | Ga0068852_100907747 | Ga0068852_1009077472 | 101 |
| 256 | 3300005616 | Ga0068852_102181017 | Ga0068852_1021810171 | 101 |
| 257 | 3300005617 | Ga0068859_100000641 | Ga0068859_10000064116 | 101 |
| 258 | 3300005617 | Ga0068859_100005854 | Ga0068859_10000585413 | 101 |
| 259 | 3300005617 | Ga0068859_100047020 | Ga0068859_1000470205 | 101 |
| 260 | 3300005617 | Ga0068859_100056515 | Ga0068859_1000565155 | 101 |
| 261 | 3300005617 | Ga0068859_100077312 | Ga0068859_1000773125 | 101 |
| 262 | 3300005617 | Ga0068859_100291710 | Ga0068859_1002917101 | 101 |
| 263 | 3300005617 | Ga0068859_100313859 | Ga0068859_1003138593 | 101 |
| 264 | 3300005617 | Ga0068859_101283777 | Ga0068859_1012837772 | 101 |
| 265 | 3300005617 | Ga0068859_103057760 | Ga0068859_1030577602 | 101 |
| 266 | 3300005618 | Ga0068864_100000056 | Ga0068864_100000056100 | 101 |
| 267 | 3300005618 | Ga0068864_100043033 | Ga0068864_1000430338 | 101 |
| 268 | 3300005618 | Ga0068864_100839782 | Ga0068864_1008397822 | 101 |
| 269 | 3300005618 | Ga0068864_100858896 | Ga0068864_1008588962 | 101 |
| 270 | 3300005618 | Ga0068864_101536866 | Ga0068864_1015368662 | 101 |
| 271 | 3300005618 | Ga0068864_101545628 | Ga0068864_1015456282 | 101 |
| 272 | 3300005718 | Ga0068866_10002031 | Ga0068866_100020317 | 101 |
| 273 | 3300005718 | Ga0068866_10091532 | Ga0068866_100915322 | 101 |
| 274 | 3300005718 | Ga0068866_10633009 | Ga0068866_106330092 | 101 |
| 275 | 3300005718 | Ga0068866_10784860 | Ga0068866_107848602 | 101 |
| 276 | 3300005719 | Ga0068861_100066380 | Ga0068861_1000663801 | 101 |
| 277 | 3300005719 | Ga0068861_100097092 | Ga0068861_1000970924 | 101 |
| 278 | 3300005719 | Ga0068861_100167386 | Ga0068861_1001673863 | 101 |
| 279 | 3300005719 | Ga0068861_100388924 | Ga0068861_1003889242 | 101 |
| 280 | 3300005719 | Ga0068861_101079416 | Ga0068861_1010794162 | 101 |
| 281 | 3300005719 | Ga0068861_101116219 | Ga0068861_1011162192 | 101 |
| 282 | 3300005719 | Ga0068861_101691155 | Ga0068861_1016911552 | 101 |
| 283 | 3300005719 | Ga0068861_102259291 | Ga0068861_1022592912 | 101 |
| 284 | 3300005834 | Ga0068851_10032527 | Ga0068851_100325275 | 101 |
| 285 | 3300005834 | Ga0068851_10351588 | Ga0068851_103515882 | 101 |
| 286 | 3300005840 | Ga0068870_10001674 | Ga0068870_1000167414 | 101 |
| 287 | 3300005840 | Ga0068870_10164633 | Ga0068870_101646333 | 101 |
| 288 | 3300005840 | Ga0068870_10629134 | Ga0068870_106291341 | 101 |
| 289 | 3300005840 | Ga0068870_10837143 | Ga0068870_108371431 | 101 |
| 290 | 3300005841 | Ga0068863_100008761 | Ga0068863_10000876111 | 101 |
| 291 | 3300005841 | Ga0068863_100069769 | Ga0068863_1000697697 | 101 |
| 292 | 3300005841 | Ga0068863_100075635 | Ga0068863_1000756354 | 101 |
| 293 | 3300005841 | Ga0068863_100154561 | Ga0068863_1001545614 | 101 |
| 294 | 3300005841 | Ga0068863_100156589 | Ga0068863_1001565895 | 101 |
| 295 | 3300005841 | Ga0068863_100181690 | Ga0068863_1001816902 | 101 |
| 296 | 3300005841 | Ga0068863_100368482 | Ga0068863_1003684823 | 101 |
| 297 | 3300005841 | Ga0068863_100649716 | Ga0068863_1006497162 | 101 |
| 298 | 3300005841 | Ga0068863_100731629 | Ga0068863_1007316292 | 101 |
| 299 | 3300005841 | Ga0068863_100936433 | Ga0068863_1009364332 | 101 |
| 300 | 3300005841 | Ga0068863_101486838 | Ga0068863_1014868381 | 101 |
| 301 | 3300005841 | Ga0068863_102334353 | Ga0068863_1023343532 | 101 |
| 302 | 3300005842 | Ga0068858_100000125 | Ga0068858_10000012548 | 101 |
| 303 | 3300005842 | Ga0068858_100004270 | Ga0068858_10000427014 | 101 |
| 304 | 3300005842 | Ga0068858_100031324 | Ga0068858_1000313247 | 101 |
| 305 | 3300005842 | Ga0068858_100054829 | Ga0068858_1000548297 | 101 |
| 306 | 3300005842 | Ga0068858_100130358 | Ga0068858_1001303581 | 101 |
| 307 | 3300005842 | Ga0068858_100143953 | Ga0068858_1001439535 | 101 |
| 308 | 3300005842 | Ga0068858_100458094 | Ga0068858_1004580941 | 101 |
| 309 | 3300005842 | Ga0068858_101216752 | Ga0068858_1012167521 | 101 |
| 310 | 3300005842 | Ga0068858_102467426 | Ga0068858_1024674261 | 101 |
| 311 | 3300005843 | Ga0068860_100002410 | Ga0068860_10000241027 | 101 |
| 312 | 3300005843 | Ga0068860_100006244 | Ga0068860_1000062448 | 101 |
| 313 | 3300005843 | Ga0068860_100009263 | Ga0068860_10000926317 | 101 |
| 314 | 3300005843 | Ga0068860_100010872 | Ga0068860_10001087213 | 101 |
| 315 | 3300005843 | Ga0068860_100074726 | Ga0068860_1000747265 | 101 |
| 316 | 3300005843 | Ga0068860_100125358 | Ga0068860_1001253584 | 101 |
| 317 | 3300005843 | Ga0068860_100987493 | Ga0068860_1009874932 | 101 |
| 318 | 3300005843 | Ga0068860_101441857 | Ga0068860_1014418572 | 101 |
| 319 | 3300005843 | Ga0068860_102036230 | Ga0068860_1020362302 | 101 |
| 320 | 3300005843 | Ga0068860_102307423 | Ga0068860_1023074232 | 101 |
| 321 | 3300005844 | Ga0068862_100008335 | Ga0068862_1000083354 | 101 |
| 322 | 3300005844 | Ga0068862_100065242 | Ga0068862_1000652422 | 101 |
| 323 | 3300005844 | Ga0068862_100098243 | Ga0068862_1000982433 | 101 |
| 324 | 3300005844 | Ga0068862_100145559 | Ga0068862_1001455593 | 101 |
| 325 | 3300005844 | Ga0068862_100198509 | Ga0068862_1001985092 | 101 |
| 326 | 3300005844 | Ga0068862_100344838 | Ga0068862_1003448382 | 101 |
| 327 | 3300005844 | Ga0068862_101189284 | Ga0068862_1011892841 | 101 |
| 328 | 3300005937 | Ga0081455_10008699 | Ga0081455_1000869911 | 101 |
| 329 | 3300005983 | Ga0081540_1179590 | Ga0081540_11795902 | 101 |
| 330 | 3300006028 | Ga0070717_10062172 | Ga0070717_100621722 | 101 |
| 331 | 3300006042 | Ga0075368_10226039 | Ga0075368_102260392 | 101 |
| 332 | 3300006163 | Ga0070715_10000668 | Ga0070715_1000066815 | 101 |
| 333 | 3300006163 | Ga0070715_10111151 | Ga0070715_101111512 | 101 |
| 334 | 3300006173 | Ga0070716_100004769 | Ga0070716_1000047693 | 101 |
| 335 | 3300006173 | Ga0070716_101570414 | Ga0070716_1015704141 | 101 |
| 336 | 3300006175 | Ga0070712_100001456 | Ga0070712_10000145614 | 101 |
| 337 | 3300006175 | Ga0070712_100044366 | Ga0070712_1000443663 | 101 |
| 338 | 3300006175 | Ga0070712_100057768 | Ga0070712_1000577682 | 101 |
| 339 | 3300006175 | Ga0070712_100156187 | Ga0070712_1001561874 | 101 |
| 340 | 3300006175 | Ga0070712_100311663 | Ga0070712_1003116632 | 101 |
| 341 | 3300006175 | Ga0070712_100371053 | Ga0070712_1003710532 | 101 |
| 342 | 3300006177 | Ga0075362_10545825 | Ga0075362_105458252 | 101 |
| 343 | 3300006178 | Ga0075367_10328708 | Ga0075367_103287082 | 101 |
| 344 | 3300006178 | Ga0075367_10857991 | Ga0075367_108579912 | 101 |
| 345 | 3300006195 | Ga0075366_10043507 | Ga0075366_100435072 | 101 |
| 346 | 3300006195 | Ga0075366_10096819 | Ga0075366_100968193 | 101 |
| 347 | 3300006195 | Ga0075366_10184479 | Ga0075366_101844793 | 101 |
| 348 | 3300006195 | Ga0075366_10344993 | Ga0075366_103449931 | 101 |
| 349 | 3300006237 | Ga0097621_100003525 | Ga0097621_10000352513 | 101 |
| 350 | 3300006237 | Ga0097621_100078362 | Ga0097621_1000783623 | 101 |
| 351 | 3300006237 | Ga0097621_100122525 | Ga0097621_1001225253 | 101 |
| 352 | 3300006237 | Ga0097621_100139427 | Ga0097621_1001394273 | 101 |
| 353 | 3300006237 | Ga0097621_100201163 | Ga0097621_1002011634 | 101 |
| 354 | 3300006237 | Ga0097621_100213968 | Ga0097621_1002139682 | 101 |
| 355 | 3300006237 | Ga0097621_100244548 | Ga0097621_1002445481 | 101 |
| 356 | 3300006237 | Ga0097621_100379215 | Ga0097621_1003792153 | 101 |
| 357 | 3300006237 | Ga0097621_100480099 | Ga0097621_1004800993 | 101 |
| 358 | 3300006237 | Ga0097621_100485288 | Ga0097621_1004852882 | 101 |
| 359 | 3300006237 | Ga0097621_100882874 | Ga0097621_1008828742 | 101 |
| 360 | 3300006353 | Ga0075370_10203587 | Ga0075370_102035873 | 101 |
| 361 | 3300006353 | Ga0075370_10434802 | Ga0075370_104348022 | 101 |
| 362 | 3300006358 | Ga0068871_100044280 | Ga0068871_1000442804 | 101 |
| 363 | 3300006358 | Ga0068871_100188243 | Ga0068871_1001882433 | 101 |
| 364 | 3300006358 | Ga0068871_100226252 | Ga0068871_1002262523 | 101 |
| 365 | 3300006358 | Ga0068871_100413993 | Ga0068871_1004139932 | 101 |
| 366 | 3300006358 | Ga0068871_100453812 | Ga0068871_1004538122 | 101 |
| 367 | 3300006358 | Ga0068871_100778809 | Ga0068871_1007788092 | 101 |
| 368 | 3300006358 | Ga0068871_100810447 | Ga0068871_1008104472 | 101 |
| 369 | 3300006358 | Ga0068871_100851851 | Ga0068871_1008518512 | 101 |
| 370 | 3300006358 | Ga0068871_101325124 | Ga0068871_1013251242 | 101 |
| 371 | 3300006358 | Ga0068871_101620222 | Ga0068871_1016202222 | 101 |
| 372 | 3300006844 | Ga0075428_100802261 | Ga0075428_1008022611 | 101 |
| 373 | 3300006846 | Ga0075430_100218759 | Ga0075430_1002187593 | 101 |
| 374 | 3300006846 | Ga0075430_101708589 | Ga0075430_1017085892 | 101 |
| 375 | 3300006852 | Ga0075433_10827216 | Ga0075433_108272162 | 101 |
| 376 | 3300006880 | Ga0075429_100593330 | Ga0075429_1005933302 | 101 |
| 377 | 3300006881 | Ga0068865_100001214 | Ga0068865_10000121416 | 101 |
| 378 | 3300006881 | Ga0068865_100010514 | Ga0068865_1000105148 | 101 |
| 379 | 3300006881 | Ga0068865_100021451 | Ga0068865_1000214517 | 101 |
| 380 | 3300006881 | Ga0068865_100037315 | Ga0068865_1000373156 | 101 |
| 381 | 3300006881 | Ga0068865_100074556 | Ga0068865_1000745567 | 101 |
| 382 | 3300006881 | Ga0068865_100902572 | Ga0068865_1009025722 | 101 |
| 383 | 3300006881 | Ga0068865_101185461 | Ga0068865_1011854612 | 101 |
| 384 | 3300006881 | Ga0068865_101269991 | Ga0068865_1012699912 | 101 |
| 385 | 3300006931 | Ga0097620_100000641 | Ga0097620_10000064116 | 101 |
| 386 | 3300006931 | Ga0097620_100005854 | Ga0097620_10000585413 | 101 |
| 387 | 3300006931 | Ga0097620_100047018 | Ga0097620_1000470187 | 101 |
| 388 | 3300006931 | Ga0097620_100056514 | Ga0097620_1000565147 | 101 |
| 389 | 3300006931 | Ga0097620_100077315 | Ga0097620_1000773155 | 101 |
| 390 | 3300006931 | Ga0097620_100291721 | Ga0097620_1002917211 | 101 |
| 391 | 3300006931 | Ga0097620_100313863 | Ga0097620_1003138632 | 101 |
| 392 | 3300006931 | Ga0097620_101283982 | Ga0097620_1012839822 | 101 |
| 393 | 3300006931 | Ga0097620_103057767 | Ga0097620_1030577671 | 101 |
| 394 | 3300007076 | Ga0075435_100074393 | Ga0075435_1000743932 | 101 |
| 395 | 3300007265 | Ga0099794_10074634 | Ga0099794_100746343 | 101 |
| 396 | 3300007265 | Ga0099794_10524708 | Ga0099794_105247081 | 101 |
| 397 | 3300007788 | Ga0099795_10003084 | Ga0099795_100030849 | 101 |
| 398 | 3300009093 | Ga0105240_10010598 | Ga0105240_1001059816 | 101 |
| 399 | 3300009093 | Ga0105240_10029309 | Ga0105240_1002930911 | 101 |
| 400 | 3300009093 | Ga0105240_10086135 | Ga0105240_100861358 | 101 |
| 401 | 3300009093 | Ga0105240_10112936 | Ga0105240_101129368 | 101 |
| 402 | 3300009093 | Ga0105240_10242587 | Ga0105240_102425872 | 101 |
| 403 | 3300009093 | Ga0105240_10281671 | Ga0105240_102816713 | 101 |
| 404 | 3300009093 | Ga0105240_10582231 | Ga0105240_105822311 | 101 |
| 405 | 3300009093 | Ga0105240_10626335 | Ga0105240_106263353 | 101 |
| 406 | 3300009094 | Ga0111539_10799285 | Ga0111539_107992852 | 101 |
| 407 | 3300009094 | Ga0111539_11140813 | Ga0111539_111408131 | 101 |
| 408 | 3300009094 | Ga0111539_12212886 | Ga0111539_122128862 | 101 |
| 409 | 3300009094 | Ga0111539_12365742 | Ga0111539_123657421 | 101 |
| 410 | 3300009098 | Ga0105245_10087460 | Ga0105245_100874603 | 101 |
| 411 | 3300009098 | Ga0105245_10099675 | Ga0105245_100996755 | 101 |
| 412 | 3300009098 | Ga0105245_11037789 | Ga0105245_110377892 | 101 |
| 413 | 3300009101 | Ga0105247_10002466 | Ga0105247_1000246616 | 101 |
| 414 | 3300009101 | Ga0105247_10015909 | Ga0105247_100159097 | 101 |
| 415 | 3300009101 | Ga0105247_10176946 | Ga0105247_101769462 | 101 |
| 416 | 3300009101 | Ga0105247_10229055 | Ga0105247_102290551 | 101 |
| 417 | 3300009147 | Ga0114129_12003029 | Ga0114129_120030292 | 101 |
| 418 | 3300009148 | Ga0105243_10194189 | Ga0105243_101941894 | 101 |
| 419 | 3300009174 | Ga0105241_10011879 | Ga0105241_1001187910 | 101 |
| 420 | 3300009174 | Ga0105241_10113915 | Ga0105241_101139152 | 101 |
| 421 | 3300009176 | Ga0105242_10003026 | Ga0105242_1000302616 | 101 |
| 422 | 3300009176 | Ga0105242_10003628 | Ga0105242_1000362817 | 101 |
| 423 | 3300009176 | Ga0105242_10206784 | Ga0105242_102067842 | 101 |
| 424 | 3300009176 | Ga0105242_10313692 | Ga0105242_103136921 | 101 |
| 425 | 3300009176 | Ga0105242_13064695 | Ga0105242_130646951 | 101 |
| 426 | 3300009177 | Ga0105248_10003146 | Ga0105248_1000314616 | 101 |
| 427 | 3300009177 | Ga0105248_10005842 | Ga0105248_1000584214 | 101 |
| 428 | 3300009177 | Ga0105248_10023564 | Ga0105248_1002356413 | 101 |
| 429 | 3300009177 | Ga0105248_11602520 | Ga0105248_116025202 | 101 |
| 430 | 3300009545 | Ga0105237_10044034 | Ga0105237_100440347 | 101 |
| 431 | 3300009545 | Ga0105237_10096005 | Ga0105237_100960055 | 101 |
| 432 | 3300009545 | Ga0105237_10099219 | Ga0105237_100992197 | 101 |
| 433 | 3300009545 | Ga0105237_11401620 | Ga0105237_114016202 | 101 |
| 434 | 3300009545 | Ga0105237_12217420 | Ga0105237_122174202 | 101 |
| 435 | 3300009551 | Ga0105238_10022279 | Ga0105238_100222793 | 101 |
| 436 | 3300009551 | Ga0105238_10406256 | Ga0105238_104062563 | 101 |
| 437 | 3300009551 | Ga0105238_11488562 | Ga0105238_114885622 | 101 |
| 438 | 3300009551 | Ga0105238_11852273 | Ga0105238_118522731 | 101 |
| 439 | 3300009551 | Ga0105238_11939221 | Ga0105238_119392212 | 101 |
| 440 | 3300009551 | Ga0105238_11982085 | Ga0105238_119820852 | 101 |
| 441 | 3300009551 | Ga0105238_12008678 | Ga0105238_120086782 | 101 |
| 442 | 3300009553 | Ga0105249_10014582 | Ga0105249_1001458211 | 101 |
| 443 | 3300009553 | Ga0105249_12013929 | Ga0105249_120139292 | 101 |
| 444 | 3300009553 | Ga0105249_13085298 | Ga0105249_130852981 | 101 |
| 445 | 3300010159 | Ga0099796_10000013 | Ga0099796_100000137 | 101 |
| 446 | 3300010159 | Ga0099796_10006593 | Ga0099796_100065932 | 101 |
| 447 | 3300010159 | Ga0099796_10145978 | Ga0099796_101459782 | 101 |
| 448 | 3300010159 | Ga0099796_10174031 | Ga0099796_101740312 | 101 |
| 449 | 3300010375 | Ga0105239_10103797 | Ga0105239_101037973 | 101 |
| 450 | 3300010375 | Ga0105239_10500212 | Ga0105239_105002124 | 101 |
| 451 | 3300010375 | Ga0105239_10564741 | Ga0105239_105647411 | 101 |
| 452 | 3300010375 | Ga0105239_11021932 | Ga0105239_110219322 | 101 |
| 453 | 3300010375 | Ga0105239_11149118 | Ga0105239_111491181 | 101 |
| 454 | 3300011119 | Ga0105246_10472133 | Ga0105246_104721332 | 101 |
| 455 | 3300011119 | Ga0105246_10796721 | Ga0105246_107967212 | 101 |
| 456 | 3300011119 | Ga0105246_11577531 | Ga0105246_115775311 | 101 |
| 457 | 3300011119 | Ga0105246_12155952 | Ga0105246_121559521 | 101 |
| 458 | 3300013100 | Ga0157373_10162009 | Ga0157373_101620092 | 101 |
| 459 | 3300013100 | Ga0157373_11037167 | Ga0157373_110371671 | 101 |
| 460 | 3300013102 | Ga0157371_11264455 | Ga0157371_112644552 | 101 |
| 461 | 3300013104 | Ga0157370_10262850 | Ga0157370_102628502 | 101 |
| 462 | 3300013104 | Ga0157370_10299273 | Ga0157370_102992732 | 101 |
| 463 | 3300013104 | Ga0157370_11797859 | Ga0157370_117978592 | 101 |
| 464 | 3300013105 | Ga0157369_10015323 | Ga0157369_100153235 | 101 |
| 465 | 3300013105 | Ga0157369_10051835 | Ga0157369_100518358 | 101 |
| 466 | 3300013105 | Ga0157369_10213528 | Ga0157369_102135284 | 101 |
| 467 | 3300013105 | Ga0157369_10293856 | Ga0157369_102938564 | 101 |
| 468 | 3300013105 | Ga0157369_10535674 | Ga0157369_105356741 | 101 |
| 469 | 3300013105 | Ga0157369_10746078 | Ga0157369_107460782 | 101 |
| 470 | 3300013296 | Ga0157374_10002813 | Ga0157374_1000281318 | 101 |
| 471 | 3300013296 | Ga0157374_10039033 | Ga0157374_100390339 | 101 |
| 472 | 3300013296 | Ga0157374_10310346 | Ga0157374_103103463 | 101 |
| 473 | 3300013296 | Ga0157374_10414545 | Ga0157374_104145454 | 101 |
| 474 | 3300013297 | Ga0157378_10006374 | Ga0157378_100063748 | 101 |
| 475 | 3300013297 | Ga0157378_10013575 | Ga0157378_1001357515 | 101 |
| 476 | 3300013306 | Ga0163162_10006236 | Ga0163162_1000623616 | 101 |
| 477 | 3300013306 | Ga0163162_10008705 | Ga0163162_100087058 | 101 |
| 478 | 3300013306 | Ga0163162_10026596 | Ga0163162_100265968 | 101 |
| 479 | 3300013306 | Ga0163162_10646134 | Ga0163162_106461343 | 101 |
| 480 | 3300013306 | Ga0163162_10655282 | Ga0163162_106552822 | 101 |
| 481 | 3300013306 | Ga0163162_11551272 | Ga0163162_115512722 | 101 |
| 482 | 3300013306 | Ga0163162_11693985 | Ga0163162_116939851 | 101 |
| 483 | 3300013306 | Ga0163162_12420139 | Ga0163162_124201391 | 101 |
| 484 | 3300013306 | Ga0163162_12778846 | Ga0163162_127788462 | 101 |
| 485 | 3300013307 | Ga0157372_10081320 | Ga0157372_100813202 | 101 |
| 486 | 3300013307 | Ga0157372_10897157 | Ga0157372_108971572 | 101 |
| 487 | 3300013307 | Ga0157372_11041560 | Ga0157372_110415602 | 101 |
| 488 | 3300013307 | Ga0157372_11995561 | Ga0157372_119955612 | 101 |
| 489 | 3300013308 | Ga0157375_10000319 | Ga0157375_1000031915 | 101 |
| 490 | 3300013308 | Ga0157375_10006856 | Ga0157375_100068567 | 101 |
| 491 | 3300013308 | Ga0157375_10493225 | Ga0157375_104932252 | 101 |
| 492 | 3300013308 | Ga0157375_10545902 | Ga0157375_105459022 | 101 |
| 493 | 3300013308 | Ga0157375_11014123 | Ga0157375_110141232 | 101 |
| 494 | 3300013308 | Ga0157375_11627865 | Ga0157375_116278652 | 101 |
| 495 | 3300014325 | Ga0163163_10000199 | Ga0163163_1000019941 | 101 |
| 496 | 3300014325 | Ga0163163_10007457 | Ga0163163_1000745711 | 101 |
| 497 | 3300014325 | Ga0163163_10176222 | Ga0163163_101762223 | 101 |
| 498 | 3300014325 | Ga0163163_10404151 | Ga0163163_104041513 | 101 |
| 499 | 3300014325 | Ga0163163_10733157 | Ga0163163_107331572 | 101 |
| 500 | 3300014325 | Ga0163163_11985108 | Ga0163163_119851082 | 101 |
| 501 | 3300014326 | Ga0157380_11708957 | Ga0157380_117089571 | 101 |
| 502 | 3300014326 | Ga0157380_12923379 | Ga0157380_129233791 | 101 |
| 503 | 3300014745 | Ga0157377_10941315 | Ga0157377_109413151 | 101 |
| 504 | 3300014968 | Ga0157379_10006918 | Ga0157379_1000691813 | 101 |
| 505 | 3300014968 | Ga0157379_10037733 | Ga0157379_100377333 | 101 |
| 506 | 3300014968 | Ga0157379_10055138 | Ga0157379_100551386 | 101 |
| 507 | 3300014968 | Ga0157379_10082681 | Ga0157379_100826814 | 101 |
| 508 | 3300014968 | Ga0157379_10187423 | Ga0157379_101874232 | 101 |
| 509 | 3300014968 | Ga0157379_10447257 | Ga0157379_104472572 | 101 |
| 510 | 3300014968 | Ga0157379_10949746 | Ga0157379_109497462 | 101 |
| 511 | 3300014968 | Ga0157379_11261575 | Ga0157379_112615752 | 101 |
| 512 | 3300014968 | Ga0157379_12059406 | Ga0157379_120594061 | 101 |
| 513 | 3300014969 | Ga0157376_10131141 | Ga0157376_101311414 | 101 |
| 514 | 3300014969 | Ga0157376_10278682 | Ga0157376_102786821 | 101 |
| 515 | 3300014969 | Ga0157376_10280609 | Ga0157376_102806092 | 101 |
| 516 | 3300014969 | Ga0157376_10447997 | Ga0157376_104479972 | 101 |
| 517 | 3300014969 | Ga0157376_11563247 | Ga0157376_115632472 | 101 |
| 518 | 3300015262 | Ga0182007_10211695 | Ga0182007_102116951 | 101 |
| 519 | 3300017792 | Ga0163161_10205021 | Ga0163161_102050213 | 101 |
| 520 | 3300017792 | Ga0163161_10501275 | Ga0163161_105012752 | 101 |
| 521 | 3300020069 | Ga0197907_10294975 | Ga0197907_102949752 | 101 |
| 522 | 3300020070 | Ga0206356_11568175 | Ga0206356_115681753 | 101 |
| 523 | 3300020070 | Ga0206356_11640133 | Ga0206356_116401335 | 101 |
| 524 | 3300020077 | Ga0206351_10700694 | Ga0206351_107006942 | 101 |
| 525 | 3300020078 | Ga0206352_10349565 | Ga0206352_103495652 | 101 |
| 526 | 3300020081 | Ga0206354_11036454 | Ga0206354_110364542 | 101 |
| 527 | 3300020082 | Ga0206353_10222205 | Ga0206353_102222052 | 101 |
| 528 | 3300021358 | Ga0213873_10261514 | Ga0213873_102615142 | 101 |
| 529 | 3300021377 | Ga0213874_10149716 | Ga0213874_101497162 | 101 |
| 530 | 3300021384 | Ga0213876_10032683 | Ga0213876_100326837 | 101 |
| 531 | 3300021384 | Ga0213876_10099155 | Ga0213876_100991552 | 101 |
| 532 | 3300021384 | Ga0213876_10222335 | Ga0213876_102223353 | 101 |
| 533 | 3300021384 | Ga0213876_10564005 | Ga0213876_105640052 | 101 |
| 534 | 3300021388 | Ga0213875_10435923 | Ga0213875_104359232 | 101 |
| 535 | 3300021441 | Ga0213871_10014920 | Ga0213871_100149202 | 101 |
| 536 | 3300021441 | Ga0213871_10270734 | Ga0213871_102707342 | 101 |
| 537 | 3300022467 | Ga0224712_10358615 | Ga0224712_103586152 | 101 |
| 538 | 3300024225 | Ga0224572_1011889 | Ga0224572_10118894 | 101 |
| 539 | 3300024225 | Ga0224572_1076459 | Ga0224572_10764591 | 101 |
| 540 | 3300025261 | Ga0209233_1001951 | Ga0209233_100195111 | 101 |
| 541 | 3300025271 | Ga0207666_1019476 | Ga0207666_10194762 | 101 |
| 542 | 3300025315 | Ga0207697_10027047 | Ga0207697_100270473 | 101 |
| 543 | 3300025321 | Ga0207656_10044300 | Ga0207656_100443004 | 101 |
| 544 | 3300025321 | Ga0207656_10182284 | Ga0207656_101822842 | 101 |
| 545 | 3300025885 | Ga0207653_10133826 | Ga0207653_101338262 | 101 |
| 546 | 3300025898 | Ga0207692_10132931 | Ga0207692_101329312 | 101 |
| 547 | 3300025898 | Ga0207692_10246844 | Ga0207692_102468442 | 101 |
| 548 | 3300025898 | Ga0207692_10464853 | Ga0207692_104648532 | 101 |
| 549 | 3300025898 | Ga0207692_10698704 | Ga0207692_106987041 | 101 |
| 550 | 3300025898 | Ga0207692_11194148 | Ga0207692_111941482 | 101 |
| 551 | 3300025899 | Ga0207642_10016853 | Ga0207642_100168532 | 101 |
| 552 | 3300025899 | Ga0207642_11013530 | Ga0207642_110135301 | 101 |
| 553 | 3300025900 | Ga0207710_10000332 | Ga0207710_1000033239 | 101 |
| 554 | 3300025900 | Ga0207710_10009562 | Ga0207710_100095628 | 101 |
| 555 | 3300025900 | Ga0207710_10010376 | Ga0207710_100103766 | 101 |
| 556 | 3300025900 | Ga0207710_10012607 | Ga0207710_100126077 | 101 |
| 557 | 3300025900 | Ga0207710_10056714 | Ga0207710_100567144 | 101 |
| 558 | 3300025900 | Ga0207710_10112208 | Ga0207710_101122082 | 101 |
| 559 | 3300025901 | Ga0207688_10144333 | Ga0207688_101443332 | 101 |
| 560 | 3300025903 | Ga0207680_10009301 | Ga0207680_100093017 | 101 |
| 561 | 3300025903 | Ga0207680_10047575 | Ga0207680_100475752 | 101 |
| 562 | 3300025903 | Ga0207680_10136511 | Ga0207680_101365112 | 101 |
| 563 | 3300025903 | Ga0207680_10235304 | Ga0207680_102353042 | 101 |
| 564 | 3300025903 | Ga0207680_10257091 | Ga0207680_102570912 | 101 |
| 565 | 3300025904 | Ga0207647_10046204 | Ga0207647_100462047 | 101 |
| 566 | 3300025904 | Ga0207647_10097771 | Ga0207647_100977712 | 101 |
| 567 | 3300025905 | Ga0207685_10000121 | Ga0207685_1000012114 | 101 |
| 568 | 3300025905 | Ga0207685_10032092 | Ga0207685_100320923 | 101 |
| 569 | 3300025905 | Ga0207685_10158287 | Ga0207685_101582873 | 101 |
| 570 | 3300025906 | Ga0207699_10024184 | Ga0207699_100241847 | 101 |
| 571 | 3300025906 | Ga0207699_10043471 | Ga0207699_100434717 | 101 |
| 572 | 3300025906 | Ga0207699_10281638 | Ga0207699_102816382 | 101 |
| 573 | 3300025906 | Ga0207699_10941374 | Ga0207699_109413742 | 101 |
| 574 | 3300025907 | Ga0207645_10015789 | Ga0207645_100157897 | 101 |
| 575 | 3300025907 | Ga0207645_10027678 | Ga0207645_100276784 | 101 |
| 576 | 3300025907 | Ga0207645_10186335 | Ga0207645_101863353 | 101 |
| 577 | 3300025907 | Ga0207645_10620537 | Ga0207645_106205372 | 101 |
| 578 | 3300025908 | Ga0207643_10002762 | Ga0207643_1000276214 | 101 |
| 579 | 3300025908 | Ga0207643_10070432 | Ga0207643_100704323 | 101 |
| 580 | 3300025908 | Ga0207643_10583790 | Ga0207643_105837902 | 101 |
| 581 | 3300025909 | Ga0207705_10385827 | Ga0207705_103858272 | 101 |
| 582 | 3300025909 | Ga0207705_11159612 | Ga0207705_111596122 | 101 |
| 583 | 3300025910 | Ga0207684_10575909 | Ga0207684_105759092 | 101 |
| 584 | 3300025911 | Ga0207654_10034349 | Ga0207654_100343494 | 101 |
| 585 | 3300025911 | Ga0207654_10062727 | Ga0207654_100627273 | 101 |
| 586 | 3300025911 | Ga0207654_10327449 | Ga0207654_103274492 | 101 |
| 587 | 3300025911 | Ga0207654_10644101 | Ga0207654_106441012 | 101 |
| 588 | 3300025912 | Ga0207707_10000276 | Ga0207707_1000027628 | 101 |
| 589 | 3300025912 | Ga0207707_10000410 | Ga0207707_1000041035 | 101 |
| 590 | 3300025912 | Ga0207707_10017188 | Ga0207707_100171881 | 101 |
| 591 | 3300025912 | Ga0207707_10025066 | Ga0207707_100250667 | 101 |
| 592 | 3300025912 | Ga0207707_10059190 | Ga0207707_100591907 | 101 |
| 593 | 3300025912 | Ga0207707_10075513 | Ga0207707_100755137 | 101 |
| 594 | 3300025912 | Ga0207707_10181062 | Ga0207707_101810624 | 101 |
| 595 | 3300025912 | Ga0207707_10790462 | Ga0207707_107904622 | 101 |
| 596 | 3300025913 | Ga0207695_10003442 | Ga0207695_100034424 | 101 |
| 597 | 3300025913 | Ga0207695_10042133 | Ga0207695_100421337 | 101 |
| 598 | 3300025913 | Ga0207695_10049612 | Ga0207695_100496123 | 101 |
| 599 | 3300025913 | Ga0207695_10052562 | Ga0207695_100525629 | 101 |
| 600 | 3300025913 | Ga0207695_10072121 | Ga0207695_100721216 | 101 |
| 601 | 3300025913 | Ga0207695_10083172 | Ga0207695_100831728 | 101 |
| 602 | 3300025913 | Ga0207695_10097549 | Ga0207695_100975496 | 101 |
| 603 | 3300025913 | Ga0207695_10234878 | Ga0207695_102348784 | 101 |
| 604 | 3300025913 | Ga0207695_10317282 | Ga0207695_103172822 | 101 |
| 605 | 3300025913 | Ga0207695_10339792 | Ga0207695_103397923 | 101 |
| 606 | 3300025914 | Ga0207671_10010563 | Ga0207671_1001056311 | 101 |
| 607 | 3300025914 | Ga0207671_10073947 | Ga0207671_100739473 | 101 |
| 608 | 3300025914 | Ga0207671_10157809 | Ga0207671_101578095 | 101 |
| 609 | 3300025914 | Ga0207671_10168779 | Ga0207671_101687792 | 101 |
| 610 | 3300025914 | Ga0207671_10190336 | Ga0207671_101903362 | 101 |
| 611 | 3300025914 | Ga0207671_11074785 | Ga0207671_110747852 | 101 |
| 612 | 3300025915 | Ga0207693_10000448 | Ga0207693_1000044816 | 101 |
| 613 | 3300025915 | Ga0207693_10126708 | Ga0207693_101267084 | 101 |
| 614 | 3300025915 | Ga0207693_10360999 | Ga0207693_103609992 | 101 |
| 615 | 3300025915 | Ga0207693_10481430 | Ga0207693_104814302 | 101 |
| 616 | 3300025916 | Ga0207663_10030730 | Ga0207663_100307303 | 101 |
| 617 | 3300025916 | Ga0207663_10045973 | Ga0207663_100459734 | 101 |
| 618 | 3300025916 | Ga0207663_10112779 | Ga0207663_101127793 | 101 |
| 619 | 3300025916 | Ga0207663_10369763 | Ga0207663_103697632 | 101 |
| 620 | 3300025916 | Ga0207663_11285009 | Ga0207663_112850091 | 101 |
| 621 | 3300025916 | Ga0207663_11458397 | Ga0207663_114583971 | 101 |
| 622 | 3300025917 | Ga0207660_10002217 | Ga0207660_100022172 | 101 |
| 623 | 3300025917 | Ga0207660_10415405 | Ga0207660_104154053 | 101 |
| 624 | 3300025917 | Ga0207660_10441396 | Ga0207660_104413962 | 101 |
| 625 | 3300025918 | Ga0207662_10036401 | Ga0207662_100364015 | 101 |
| 626 | 3300025918 | Ga0207662_10201054 | Ga0207662_102010543 | 101 |
| 627 | 3300025919 | Ga0207657_10063277 | Ga0207657_100632772 | 101 |
| 628 | 3300025919 | Ga0207657_10218405 | Ga0207657_102184054 | 101 |
| 629 | 3300025920 | Ga0207649_10183146 | Ga0207649_101831461 | 101 |
| 630 | 3300025920 | Ga0207649_10584605 | Ga0207649_105846052 | 101 |
| 631 | 3300025920 | Ga0207649_11147799 | Ga0207649_111477992 | 101 |
| 632 | 3300025921 | Ga0207652_10003383 | Ga0207652_1000338314 | 101 |
| 633 | 3300025921 | Ga0207652_10088779 | Ga0207652_100887796 | 101 |
| 634 | 3300025921 | Ga0207652_10266859 | Ga0207652_102668594 | 101 |
| 635 | 3300025922 | Ga0207646_10580829 | Ga0207646_105808292 | 101 |
| 636 | 3300025922 | Ga0207646_10803463 | Ga0207646_108034632 | 101 |
| 637 | 3300025923 | Ga0207681_10003213 | Ga0207681_1000321313 | 101 |
| 638 | 3300025923 | Ga0207681_10019048 | Ga0207681_100190485 | 101 |
| 639 | 3300025923 | Ga0207681_10071603 | Ga0207681_100716035 | 101 |
| 640 | 3300025923 | Ga0207681_11460364 | Ga0207681_114603642 | 101 |
| 641 | 3300025924 | Ga0207694_10003326 | Ga0207694_1000332612 | 101 |
| 642 | 3300025924 | Ga0207694_10850433 | Ga0207694_108504332 | 101 |
| 643 | 3300025924 | Ga0207694_10855851 | Ga0207694_108558512 | 101 |
| 644 | 3300025925 | Ga0207650_10000013 | Ga0207650_10000013186 | 101 |
| 645 | 3300025925 | Ga0207650_10018767 | Ga0207650_100187672 | 101 |
| 646 | 3300025925 | Ga0207650_10054455 | Ga0207650_100544555 | 101 |
| 647 | 3300025925 | Ga0207650_10221148 | Ga0207650_102211483 | 101 |
| 648 | 3300025925 | Ga0207650_10653968 | Ga0207650_106539682 | 101 |
| 649 | 3300025925 | Ga0207650_11325316 | Ga0207650_113253162 | 101 |
| 650 | 3300025925 | Ga0207650_11625876 | Ga0207650_116258762 | 101 |
| 651 | 3300025926 | Ga0207659_10061691 | Ga0207659_100616917 | 101 |
| 652 | 3300025927 | Ga0207687_10076669 | Ga0207687_100766693 | 101 |
| 653 | 3300025927 | Ga0207687_11273253 | Ga0207687_112732532 | 101 |
| 654 | 3300025928 | Ga0207700_10003609 | Ga0207700_1000360913 | 101 |
| 655 | 3300025928 | Ga0207700_10647428 | Ga0207700_106474282 | 101 |
| 656 | 3300025928 | Ga0207700_10836972 | Ga0207700_108369722 | 101 |
| 657 | 3300025928 | Ga0207700_10862520 | Ga0207700_108625201 | 101 |
| 658 | 3300025928 | Ga0207700_11545406 | Ga0207700_115454062 | 101 |
| 659 | 3300025929 | Ga0207664_10007010 | Ga0207664_100070108 | 101 |
| 660 | 3300025929 | Ga0207664_10051619 | Ga0207664_100516193 | 101 |
| 661 | 3300025929 | Ga0207664_10350438 | Ga0207664_103504382 | 101 |
| 662 | 3300025931 | Ga0207644_10000407 | Ga0207644_1000040716 | 101 |
| 663 | 3300025931 | Ga0207644_10000428 | Ga0207644_1000042818 | 101 |
| 664 | 3300025931 | Ga0207644_10004012 | Ga0207644_1000401214 | 101 |
| 665 | 3300025931 | Ga0207644_10093201 | Ga0207644_100932012 | 101 |
| 666 | 3300025931 | Ga0207644_10179249 | Ga0207644_101792494 | 101 |
| 667 | 3300025931 | Ga0207644_10573836 | Ga0207644_105738362 | 101 |
| 668 | 3300025931 | Ga0207644_11450954 | Ga0207644_114509541 | 101 |
| 669 | 3300025932 | Ga0207690_10156897 | Ga0207690_101568974 | 101 |
| 670 | 3300025933 | Ga0207706_10375437 | Ga0207706_103754373 | 101 |
| 671 | 3300025933 | Ga0207706_10498430 | Ga0207706_104984302 | 101 |
| 672 | 3300025933 | Ga0207706_10597721 | Ga0207706_105977211 | 101 |
| 673 | 3300025933 | Ga0207706_11133911 | Ga0207706_111339112 | 101 |
| 674 | 3300025933 | Ga0207706_11570495 | Ga0207706_115704951 | 101 |
| 675 | 3300025934 | Ga0207686_10005014 | Ga0207686_1000501415 | 101 |
| 676 | 3300025934 | Ga0207686_10007583 | Ga0207686_100075838 | 101 |
| 677 | 3300025934 | Ga0207686_10072816 | Ga0207686_100728164 | 101 |
| 678 | 3300025934 | Ga0207686_10255208 | Ga0207686_102552082 | 101 |
| 679 | 3300025934 | Ga0207686_11085111 | Ga0207686_110851112 | 101 |
| 680 | 3300025935 | Ga0207709_10431056 | Ga0207709_104310562 | 101 |
| 681 | 3300025936 | Ga0207670_10126684 | Ga0207670_101266844 | 101 |
| 682 | 3300025936 | Ga0207670_10684398 | Ga0207670_106843982 | 101 |
| 683 | 3300025936 | Ga0207670_10703399 | Ga0207670_107033992 | 101 |
| 684 | 3300025936 | Ga0207670_11102066 | Ga0207670_111020662 | 101 |
| 685 | 3300025936 | Ga0207670_11875155 | Ga0207670_118751552 | 101 |
| 686 | 3300025937 | Ga0207669_10068174 | Ga0207669_100681743 | 101 |
| 687 | 3300025937 | Ga0207669_10419872 | Ga0207669_104198722 | 101 |
| 688 | 3300025938 | Ga0207704_10002424 | Ga0207704_100024243 | 101 |
| 689 | 3300025938 | Ga0207704_10014528 | Ga0207704_100145288 | 101 |
| 690 | 3300025938 | Ga0207704_10040967 | Ga0207704_100409672 | 101 |
| 691 | 3300025938 | Ga0207704_10188426 | Ga0207704_101884262 | 101 |
| 692 | 3300025938 | Ga0207704_11518336 | Ga0207704_115183362 | 101 |
| 693 | 3300025939 | Ga0207665_10035902 | Ga0207665_100359023 | 101 |
| 694 | 3300025939 | Ga0207665_10088305 | Ga0207665_100883053 | 101 |
| 695 | 3300025940 | Ga0207691_10049133 | Ga0207691_100491331 | 101 |
| 696 | 3300025940 | Ga0207691_10104939 | Ga0207691_101049393 | 101 |
| 697 | 3300025940 | Ga0207691_10242604 | Ga0207691_102426043 | 101 |
| 698 | 3300025940 | Ga0207691_10308562 | Ga0207691_103085622 | 101 |
| 699 | 3300025940 | Ga0207691_10726901 | Ga0207691_107269012 | 101 |
| 700 | 3300025940 | Ga0207691_11290328 | Ga0207691_112903282 | 101 |
| 701 | 3300025941 | Ga0207711_10000194 | Ga0207711_1000019421 | 101 |
| 702 | 3300025941 | Ga0207711_10004185 | Ga0207711_1000418514 | 101 |
| 703 | 3300025941 | Ga0207711_10116126 | Ga0207711_101161262 | 101 |
| 704 | 3300025941 | Ga0207711_10159847 | Ga0207711_101598472 | 101 |
| 705 | 3300025941 | Ga0207711_11059250 | Ga0207711_110592502 | 101 |
| 706 | 3300025942 | Ga0207689_10127570 | Ga0207689_101275703 | 101 |
| 707 | 3300025942 | Ga0207689_10224281 | Ga0207689_102242813 | 101 |
| 708 | 3300025942 | Ga0207689_10232116 | Ga0207689_102321163 | 101 |
| 709 | 3300025942 | Ga0207689_10460341 | Ga0207689_104603412 | 101 |
| 710 | 3300025942 | Ga0207689_11099186 | Ga0207689_110991862 | 101 |
| 711 | 3300025944 | Ga0207661_10649510 | Ga0207661_106495102 | 101 |
| 712 | 3300025945 | Ga0207679_10093035 | Ga0207679_100930355 | 101 |
| 713 | 3300025945 | Ga0207679_10127063 | Ga0207679_101270633 | 101 |
| 714 | 3300025945 | Ga0207679_10268843 | Ga0207679_102688433 | 101 |
| 715 | 3300025945 | Ga0207679_10564397 | Ga0207679_105643972 | 101 |
| 716 | 3300025945 | Ga0207679_10948619 | Ga0207679_109486192 | 101 |
| 717 | 3300025945 | Ga0207679_11280853 | Ga0207679_112808532 | 101 |
| 718 | 3300025945 | Ga0207679_11886660 | Ga0207679_118866601 | 101 |
| 719 | 3300025949 | Ga0207667_10008242 | Ga0207667_1000824216 | 101 |
| 720 | 3300025949 | Ga0207667_10014175 | Ga0207667_100141756 | 101 |
| 721 | 3300025949 | Ga0207667_10048865 | Ga0207667_100488659 | 101 |
| 722 | 3300025949 | Ga0207667_10617984 | Ga0207667_106179842 | 101 |
| 723 | 3300025949 | Ga0207667_10914561 | Ga0207667_109145612 | 101 |
| 724 | 3300025949 | Ga0207667_11023502 | Ga0207667_110235021 | 101 |
| 725 | 3300025949 | Ga0207667_12244332 | Ga0207667_122443322 | 101 |
| 726 | 3300025960 | Ga0207651_10007788 | Ga0207651_100077883 | 101 |
| 727 | 3300025960 | Ga0207651_10025701 | Ga0207651_100257018 | 101 |
| 728 | 3300025960 | Ga0207651_10049602 | Ga0207651_100496026 | 101 |
| 729 | 3300025960 | Ga0207651_10056314 | Ga0207651_100563145 | 101 |
| 730 | 3300025960 | Ga0207651_10312895 | Ga0207651_103128951 | 101 |
| 731 | 3300025960 | Ga0207651_11776303 | Ga0207651_117763032 | 101 |
| 732 | 3300025961 | Ga0207712_10274654 | Ga0207712_102746542 | 101 |
| 733 | 3300025961 | Ga0207712_11349038 | Ga0207712_113490382 | 101 |
| 734 | 3300025972 | Ga0207668_10008346 | Ga0207668_1000834611 | 101 |
| 735 | 3300025972 | Ga0207668_10264120 | Ga0207668_102641202 | 101 |
| 736 | 3300025972 | Ga0207668_10498202 | Ga0207668_104982022 | 101 |
| 737 | 3300025972 | Ga0207668_10544631 | Ga0207668_105446312 | 101 |
| 738 | 3300025981 | Ga0207640_10264980 | Ga0207640_102649802 | 101 |
| 739 | 3300025981 | Ga0207640_10361518 | Ga0207640_103615183 | 101 |
| 740 | 3300025981 | Ga0207640_10419821 | Ga0207640_104198212 | 101 |
| 741 | 3300025981 | Ga0207640_10785089 | Ga0207640_107850892 | 101 |
| 742 | 3300025981 | Ga0207640_11145885 | Ga0207640_111458852 | 101 |
| 743 | 3300025986 | Ga0207658_10000005 | Ga0207658_10000005187 | 101 |
| 744 | 3300025986 | Ga0207658_10004751 | Ga0207658_100047517 | 101 |
| 745 | 3300025986 | Ga0207658_10108411 | Ga0207658_101084115 | 101 |
| 746 | 3300025986 | Ga0207658_10175447 | Ga0207658_101754473 | 101 |
| 747 | 3300025986 | Ga0207658_10437648 | Ga0207658_104376481 | 101 |
| 748 | 3300025986 | Ga0207658_10625449 | Ga0207658_106254491 | 101 |
| 749 | 3300025986 | Ga0207658_10793713 | Ga0207658_107937132 | 101 |
| 750 | 3300025986 | Ga0207658_11262300 | Ga0207658_112623002 | 101 |
| 751 | 3300026023 | Ga0207677_10017062 | Ga0207677_100170627 | 101 |
| 752 | 3300026023 | Ga0207677_10020677 | Ga0207677_100206773 | 101 |
| 753 | 3300026023 | Ga0207677_10703153 | Ga0207677_107031532 | 101 |
| 754 | 3300026023 | Ga0207677_11066414 | Ga0207677_110664141 | 101 |
| 755 | 3300026035 | Ga0207703_10001524 | Ga0207703_1000152419 | 101 |
| 756 | 3300026035 | Ga0207703_10019203 | Ga0207703_100192038 | 101 |
| 757 | 3300026035 | Ga0207703_10024678 | Ga0207703_100246787 | 101 |
| 758 | 3300026035 | Ga0207703_10050143 | Ga0207703_100501433 | 101 |
| 759 | 3300026035 | Ga0207703_10235714 | Ga0207703_102357144 | 101 |
| 760 | 3300026035 | Ga0207703_10347890 | Ga0207703_103478901 | 101 |
| 761 | 3300026041 | Ga0207639_10699382 | Ga0207639_106993822 | 101 |
| 762 | 3300026041 | Ga0207639_11770732 | Ga0207639_117707322 | 101 |
| 763 | 3300026041 | Ga0207639_11950144 | Ga0207639_119501442 | 101 |
| 764 | 3300026067 | Ga0207678_10005556 | Ga0207678_100055567 | 101 |
| 765 | 3300026067 | Ga0207678_10267753 | Ga0207678_102677531 | 101 |
| 766 | 3300026067 | Ga0207678_10276992 | Ga0207678_102769922 | 101 |
| 767 | 3300026067 | Ga0207678_10372903 | Ga0207678_103729032 | 101 |
| 768 | 3300026067 | Ga0207678_11429764 | Ga0207678_114297642 | 101 |
| 769 | 3300026075 | Ga0207708_10036414 | Ga0207708_100364144 | 101 |
| 770 | 3300026075 | Ga0207708_10047577 | Ga0207708_100475773 | 101 |
| 771 | 3300026075 | Ga0207708_10405882 | Ga0207708_104058822 | 101 |
| 772 | 3300026078 | Ga0207702_10043700 | Ga0207702_100437007 | 101 |
| 773 | 3300026078 | Ga0207702_10086751 | Ga0207702_100867517 | 101 |
| 774 | 3300026078 | Ga0207702_10128657 | Ga0207702_101286577 | 101 |
| 775 | 3300026078 | Ga0207702_11220565 | Ga0207702_112205652 | 101 |
| 776 | 3300026078 | Ga0207702_11309893 | Ga0207702_113098932 | 101 |
| 777 | 3300026088 | Ga0207641_10002325 | Ga0207641_1000232516 | 101 |
| 778 | 3300026088 | Ga0207641_10003553 | Ga0207641_1000355316 | 101 |
| 779 | 3300026088 | Ga0207641_10009230 | Ga0207641_100092305 | 101 |
| 780 | 3300026088 | Ga0207641_10010988 | Ga0207641_100109887 | 101 |
| 781 | 3300026088 | Ga0207641_10029923 | Ga0207641_100299239 | 101 |
| 782 | 3300026088 | Ga0207641_10106203 | Ga0207641_101062036 | 101 |
| 783 | 3300026088 | Ga0207641_10235301 | Ga0207641_102353014 | 101 |
| 784 | 3300026088 | Ga0207641_10623681 | Ga0207641_106236812 | 101 |
| 785 | 3300026088 | Ga0207641_11812483 | Ga0207641_118124832 | 101 |
| 786 | 3300026089 | Ga0207648_10052141 | Ga0207648_100521415 | 101 |
| 787 | 3300026089 | Ga0207648_10052679 | Ga0207648_100526792 | 101 |
| 788 | 3300026089 | Ga0207648_10307642 | Ga0207648_103076422 | 101 |
| 789 | 3300026089 | Ga0207648_10388734 | Ga0207648_103887341 | 101 |
| 790 | 3300026089 | Ga0207648_10407117 | Ga0207648_104071172 | 101 |
| 791 | 3300026089 | Ga0207648_12189707 | Ga0207648_121897071 | 101 |
| 792 | 3300026095 | Ga0207676_10000010 | Ga0207676_10000010284 | 101 |
| 793 | 3300026095 | Ga0207676_10038749 | Ga0207676_100387498 | 101 |
| 794 | 3300026095 | Ga0207676_10363333 | Ga0207676_103633331 | 101 |
| 795 | 3300026095 | Ga0207676_11224328 | Ga0207676_112243282 | 101 |
| 796 | 3300026095 | Ga0207676_11780453 | Ga0207676_117804531 | 101 |
| 797 | 3300026116 | Ga0207674_10272624 | Ga0207674_102726242 | 101 |
| 798 | 3300026116 | Ga0207674_10326743 | Ga0207674_103267433 | 101 |
| 799 | 3300026116 | Ga0207674_10663830 | Ga0207674_106638302 | 101 |
| 800 | 3300026116 | Ga0207674_10856467 | Ga0207674_108564672 | 101 |
| 801 | 3300026118 | Ga0207675_100080055 | Ga0207675_1000800558 | 101 |
| 802 | 3300026118 | Ga0207675_100132610 | Ga0207675_1001326103 | 101 |
| 803 | 3300026118 | Ga0207675_100142749 | Ga0207675_1001427493 | 101 |
| 804 | 3300026118 | Ga0207675_100375270 | Ga0207675_1003752701 | 101 |
| 805 | 3300026118 | Ga0207675_100632434 | Ga0207675_1006324343 | 101 |
| 806 | 3300026118 | Ga0207675_101701120 | Ga0207675_1017011202 | 101 |
| 807 | 3300026118 | Ga0207675_102258542 | Ga0207675_1022585421 | 101 |
| 808 | 3300026121 | Ga0207683_10002499 | Ga0207683_1000249915 | 101 |
| 809 | 3300026121 | Ga0207683_10022992 | Ga0207683_100229928 | 101 |
| 810 | 3300026121 | Ga0207683_10141534 | Ga0207683_101415345 | 101 |
| 811 | 3300026142 | Ga0207698_10091691 | Ga0207698_100916912 | 101 |
| 812 | 3300026142 | Ga0207698_10257621 | Ga0207698_102576214 | 101 |
| 813 | 3300026142 | Ga0207698_10433276 | Ga0207698_104332761 | 101 |
| 814 | 3300026142 | Ga0207698_10610020 | Ga0207698_106100202 | 101 |
| 815 | 3300026142 | Ga0207698_11385002 | Ga0207698_113850022 | 101 |
| 816 | 3300026142 | Ga0207698_11670797 | Ga0207698_116707971 | 101 |
| 817 | 3300027512 | Ga0209179_1000094 | Ga0209179_100009410 | 101 |
| 818 | 3300027512 | Ga0209179_1000174 | Ga0209179_10001742 | 101 |
| 819 | 3300027671 | Ga0209588_1045050 | Ga0209588_10450502 | 101 |
| 820 | 3300027866 | Ga0209813_10164941 | Ga0209813_101649412 | 101 |
| 821 | 3300028017 | Ga0265356_1000652 | Ga0265356_100065212 | 101 |
| 822 | 3300028023 | Ga0265357_1035170 | Ga0265357_10351701 | 101 |
| 823 | 3300028379 | Ga0268266_10000943 | Ga0268266_1000094315 | 101 |
| 824 | 3300028379 | Ga0268266_10002538 | Ga0268266_1000253816 | 101 |
| 825 | 3300028379 | Ga0268266_10005009 | Ga0268266_100050094 | 101 |
| 826 | 3300028379 | Ga0268266_10010307 | Ga0268266_100103074 | 101 |
| 827 | 3300028379 | Ga0268266_10013518 | Ga0268266_1001351811 | 101 |
| 828 | 3300028379 | Ga0268266_10018044 | Ga0268266_100180447 | 101 |
| 829 | 3300028379 | Ga0268266_10019459 | Ga0268266_1001945911 | 101 |
| 830 | 3300028379 | Ga0268266_10078059 | Ga0268266_100780592 | 101 |
| 831 | 3300028379 | Ga0268266_10082273 | Ga0268266_100822734 | 101 |
| 832 | 3300028379 | Ga0268266_10165713 | Ga0268266_101657133 | 101 |
| 833 | 3300028379 | Ga0268266_10421058 | Ga0268266_104210582 | 101 |
| 834 | 3300028379 | Ga0268266_10925547 | Ga0268266_109255472 | 101 |
| 835 | 3300028379 | Ga0268266_11493521 | Ga0268266_114935211 | 101 |
| 836 | 3300028379 | Ga0268266_11521321 | Ga0268266_115213212 | 101 |
| 837 | 3300028380 | Ga0268265_10000383 | Ga0268265_1000038342 | 101 |
| 838 | 3300028380 | Ga0268265_10056316 | Ga0268265_100563168 | 101 |
| 839 | 3300028380 | Ga0268265_10144177 | Ga0268265_101441775 | 101 |
| 840 | 3300028380 | Ga0268265_10246003 | Ga0268265_102460033 | 101 |
| 841 | 3300028380 | Ga0268265_10499903 | Ga0268265_104999033 | 101 |
| 842 | 3300028380 | Ga0268265_10653004 | Ga0268265_106530043 | 101 |
| 843 | 3300028381 | Ga0268264_10000036 | Ga0268264_10000036334 | 101 |
| 844 | 3300028381 | Ga0268264_10000102 | Ga0268264_1000010216 | 101 |
| 845 | 3300028381 | Ga0268264_10011424 | Ga0268264_100114244 | 101 |
| 846 | 3300028381 | Ga0268264_10013393 | Ga0268264_100133938 | 101 |
| 847 | 3300028381 | Ga0268264_10085143 | Ga0268264_100851437 | 101 |
| 848 | 3300028381 | Ga0268264_10200275 | Ga0268264_102002752 | 101 |
| 849 | 3300028381 | Ga0268264_10256879 | Ga0268264_102568794 | 101 |
| 850 | 3300028381 | Ga0268264_10909714 | Ga0268264_109097142 | 101 |
| 851 | 3300028381 | Ga0268264_11527368 | Ga0268264_115273682 | 101 |
| 852 | 3300028381 | Ga0268264_12206416 | Ga0268264_122064161 | 101 |
| 853 | 3300028381 | Ga0268264_12206752 | Ga0268264_122067522 | 101 |
| 854 | 3300028558 | Ga0265326_10147255 | Ga0265326_101472552 | 101 |
| 855 | 3300028563 | Ga0265319_1002761 | Ga0265319_10027618 | 101 |
| 856 | 3300028573 | Ga0265334_10000272 | Ga0265334_1000027227 | 101 |
| 857 | 3300028573 | Ga0265334_10001026 | Ga0265334_1000102616 | 101 |
| 858 | 3300028573 | Ga0265334_10104489 | Ga0265334_101044892 | 101 |
| 859 | 3300028577 | Ga0265318_10000228 | Ga0265318_1000022828 | 101 |
| 860 | 3300028666 | Ga0265336_10019649 | Ga0265336_100196493 | 101 |
| 861 | 3300028786 | Ga0307517_10266356 | Ga0307517_102663562 | 101 |
| 862 | 3300028794 | Ga0307515_10034640 | Ga0307515_100346403 | 101 |
| 863 | 3300028794 | Ga0307515_10711569 | Ga0307515_107115692 | 101 |
| 864 | 3300028794 | Ga0307515_10840440 | Ga0307515_108404402 | 101 |
| 865 | 3300028800 | Ga0265338_10005919 | Ga0265338_1000591911 | 101 |
| 866 | 3300028800 | Ga0265338_10016309 | Ga0265338_1001630914 | 101 |
| 867 | 3300028800 | Ga0265338_10124432 | Ga0265338_101244322 | 101 |
| 868 | 3300028800 | Ga0265338_10145015 | Ga0265338_101450155 | 101 |
| 869 | 3300028800 | Ga0265338_10320714 | Ga0265338_103207142 | 101 |
| 870 | 3300030521 | Ga0307511_10000235 | Ga0307511_1000023549 | 101 |
| 871 | 3300030521 | Ga0307511_10056308 | Ga0307511_100563087 | 101 |
| 872 | 3300030521 | Ga0307511_10182269 | Ga0307511_101822693 | 101 |
| 873 | 3300030878 | Ga0265770_1000452 | Ga0265770_10004527 | 101 |
| 874 | 3300031010 | Ga0265771_1003521 | Ga0265771_10035212 | 101 |
| 875 | 3300031018 | Ga0265773_1003029 | Ga0265773_10030292 | 101 |
| 876 | 3300031090 | Ga0265760_10001436 | Ga0265760_1000143610 | 101 |
| 877 | 3300031090 | Ga0265760_10016486 | Ga0265760_100164863 | 101 |
| 878 | 3300031235 | Ga0265330_10004229 | Ga0265330_1000422910 | 101 |
| 879 | 3300031235 | Ga0265330_10027214 | Ga0265330_100272143 | 101 |
| 880 | 3300031238 | Ga0265332_10001037 | Ga0265332_1000103716 | 101 |
| 881 | 3300031238 | Ga0265332_10086955 | Ga0265332_100869553 | 101 |
| 882 | 3300031238 | Ga0265332_10356677 | Ga0265332_103566772 | 101 |
| 883 | 3300031239 | Ga0265328_10002988 | Ga0265328_100029889 | 101 |
| 884 | 3300031239 | Ga0265328_10003225 | Ga0265328_100032257 | 101 |
| 885 | 3300031239 | Ga0265328_10029110 | Ga0265328_100291103 | 101 |
| 886 | 3300031239 | Ga0265328_10122277 | Ga0265328_101222772 | 101 |
| 887 | 3300031239 | Ga0265328_10197442 | Ga0265328_101974421 | 101 |
| 888 | 3300031240 | Ga0265320_10004080 | Ga0265320_1000408012 | 101 |
| 889 | 3300031240 | Ga0265320_10083511 | Ga0265320_100835112 | 101 |
| 890 | 3300031240 | Ga0265320_10367736 | Ga0265320_103677362 | 101 |
| 891 | 3300031240 | Ga0265320_10430262 | Ga0265320_104302621 | 101 |
| 892 | 3300031241 | Ga0265325_10005189 | Ga0265325_1000518911 | 101 |
| 893 | 3300031242 | Ga0265329_10001451 | Ga0265329_100014518 | 101 |
| 894 | 3300031247 | Ga0265340_10013162 | Ga0265340_100131623 | 101 |
| 895 | 3300031247 | Ga0265340_10020617 | Ga0265340_100206174 | 101 |
| 896 | 3300031247 | Ga0265340_10040021 | Ga0265340_100400215 | 101 |
| 897 | 3300031247 | Ga0265340_10180734 | Ga0265340_101807342 | 101 |
| 898 | 3300031247 | Ga0265340_10233383 | Ga0265340_102333832 | 101 |
| 899 | 3300031247 | Ga0265340_10533645 | Ga0265340_105336452 | 101 |
| 900 | 3300031249 | Ga0265339_10014355 | Ga0265339_100143552 | 101 |
| 901 | 3300031250 | Ga0265331_10004429 | Ga0265331_100044299 | 101 |
| 902 | 3300031250 | Ga0265331_10018795 | Ga0265331_100187957 | 101 |
| 903 | 3300031250 | Ga0265331_10149262 | Ga0265331_101492622 | 101 |
| 904 | 3300031251 | Ga0265327_10000005 | Ga0265327_10000005191 | 101 |
| 905 | 3300031344 | Ga0265316_10013033 | Ga0265316_1001303314 | 101 |
| 906 | 3300031344 | Ga0265316_10277063 | Ga0265316_102770633 | 101 |
| 907 | 3300031344 | Ga0265316_10800381 | Ga0265316_108003812 | 101 |
| 908 | 3300031456 | Ga0307513_10007825 | Ga0307513_100078258 | 101 |
| 909 | 3300031456 | Ga0307513_10044257 | Ga0307513_100442579 | 101 |
| 910 | 3300031456 | Ga0307513_10058418 | Ga0307513_100584188 | 101 |
| 911 | 3300031456 | Ga0307513_10847699 | Ga0307513_108476992 | 101 |
| 912 | 3300031507 | Ga0307509_10565722 | Ga0307509_105657222 | 101 |
| 913 | 3300031548 | Ga0307408_100021417 | Ga0307408_1000214171 | 101 |
| 914 | 3300031548 | Ga0307408_100293830 | Ga0307408_1002938302 | 101 |
| 915 | 3300031548 | Ga0307408_100469453 | Ga0307408_1004694531 | 101 |
| 916 | 3300031548 | Ga0307408_100595029 | Ga0307408_1005950292 | 101 |
| 917 | 3300031595 | Ga0265313_10001786 | Ga0265313_1000178614 | 101 |
| 918 | 3300031595 | Ga0265313_10438966 | Ga0265313_104389661 | 101 |
| 919 | 3300031616 | Ga0307508_10111635 | Ga0307508_101116352 | 101 |
| 920 | 3300031649 | Ga0307514_10104256 | Ga0307514_101042565 | 101 |
| 921 | 3300031711 | Ga0265314_10005233 | Ga0265314_1000523310 | 101 |
| 922 | 3300031711 | Ga0265314_10174330 | Ga0265314_101743302 | 101 |
| 923 | 3300031711 | Ga0265314_10481917 | Ga0265314_104819172 | 101 |
| 924 | 3300031712 | Ga0265342_10002379 | Ga0265342_1000237915 | 101 |
| 925 | 3300031730 | Ga0307516_10398880 | Ga0307516_103988803 | 101 |
| 926 | 3300031730 | Ga0307516_10507748 | Ga0307516_105077482 | 101 |
| 927 | 3300031730 | Ga0307516_10511254 | Ga0307516_105112541 | 101 |
| 928 | 3300031731 | Ga0307405_10286534 | Ga0307405_102865343 | 101 |
| 929 | 3300031731 | Ga0307405_10640466 | Ga0307405_106404662 | 101 |
| 930 | 3300031731 | Ga0307405_10783047 | Ga0307405_107830472 | 101 |
| 931 | 3300031824 | Ga0307413_10001429 | Ga0307413_1000142914 | 101 |
| 932 | 3300031824 | Ga0307413_10035769 | Ga0307413_100357694 | 101 |
| 933 | 3300031824 | Ga0307413_10180497 | Ga0307413_101804972 | 101 |
| 934 | 3300031824 | Ga0307413_10206648 | Ga0307413_102066482 | 101 |
| 935 | 3300031852 | Ga0307410_10002645 | Ga0307410_1000264515 | 101 |
| 936 | 3300031852 | Ga0307410_10718460 | Ga0307410_107184602 | 101 |
| 937 | 3300031852 | Ga0307410_10762095 | Ga0307410_107620952 | 101 |
| 938 | 3300031901 | Ga0307406_10214883 | Ga0307406_102148833 | 101 |
| 939 | 3300031901 | Ga0307406_10862465 | Ga0307406_108624652 | 101 |
| 940 | 3300031901 | Ga0307406_11779662 | Ga0307406_117796622 | 101 |
| 941 | 3300031903 | Ga0307407_10007323 | Ga0307407_100073233 | 101 |
| 942 | 3300031903 | Ga0307407_10367805 | Ga0307407_103678053 | 101 |
| 943 | 3300031903 | Ga0307407_10401641 | Ga0307407_104016412 | 101 |
| 944 | 3300031911 | Ga0307412_10275217 | Ga0307412_102752171 | 101 |
| 945 | 3300031911 | Ga0307412_10300299 | Ga0307412_103002992 | 101 |
| 946 | 3300031995 | Ga0307409_100008471 | Ga0307409_10000847114 | 101 |
| 947 | 3300031995 | Ga0307409_100018987 | Ga0307409_1000189874 | 101 |
| 948 | 3300031995 | Ga0307409_100067110 | Ga0307409_1000671108 | 101 |
| 949 | 3300031995 | Ga0307409_100072562 | Ga0307409_1000725623 | 101 |
| 950 | 3300031995 | Ga0307409_100623909 | Ga0307409_1006239093 | 101 |
| 951 | 3300032002 | Ga0307416_100218253 | Ga0307416_1002182532 | 101 |
| 952 | 3300032002 | Ga0307416_100553375 | Ga0307416_1005533752 | 101 |
| 953 | 3300032002 | Ga0307416_100764931 | Ga0307416_1007649313 | 101 |
| 954 | 3300032002 | Ga0307416_101433336 | Ga0307416_1014333362 | 101 |
| 955 | 3300032002 | Ga0307416_103094738 | Ga0307416_1030947382 | 101 |
| 956 | 3300032002 | Ga0307416_103768426 | Ga0307416_1037684261 | 101 |
| 957 | 3300032004 | Ga0307414_10283564 | Ga0307414_102835643 | 101 |
| 958 | 3300032005 | Ga0307411_10001998 | Ga0307411_1000199815 | 101 |
| 959 | 3300032005 | Ga0307411_10034772 | Ga0307411_100347727 | 101 |
| 960 | 3300032005 | Ga0307411_10354795 | Ga0307411_103547953 | 101 |
| 961 | 3300032005 | Ga0307411_10535613 | Ga0307411_105356132 | 101 |
| 962 | 3300032005 | Ga0307411_11420539 | Ga0307411_114205392 | 101 |
| 963 | 3300032126 | Ga0307415_100068825 | Ga0307415_1000688257 | 101 |
| 964 | 3300032126 | Ga0307415_100098172 | Ga0307415_1000981726 | 101 |
| 965 | 3300032126 | Ga0307415_100210379 | Ga0307415_1002103794 | 101 |
| 966 | 3300032126 | Ga0307415_100843478 | Ga0307415_1008434782 | 101 |
| 967 | 3300032126 | Ga0307415_102202861 | Ga0307415_1022028612 | 101 |
| 968 | 3300033179 | Ga0307507_10414909 | Ga0307507_104149092 | 101 |
| 969 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006347 | 101 |
| 970 | 3300033180 | Ga0307510_10029950 | Ga0307510_100299508 | 101 |
| 971 | 3300033180 | Ga0307510_10083840 | Ga0307510_100838403 | 101 |
| 972 | 3300035084 | Ga0373928_0116950 | Ga0373928_0116950_322_627 | 101 |
| 973 | 3300035086 | Ga0373934_0198021 | Ga0373934_0198021_420_725 | 101 |
| 974 | 3300035089 | Ga0373944_0040350 | Ga0373944_0040350_245_550 | 101 |
| 975 | 3300035092 | Ga0373952_0094250 | Ga0373952_0094250_71_376 | 101 |
| 976 | 3300035111 | Ga0373923_0030963 | Ga0373923_0030963_567_872 | 101 |
| 977 | 3300035111 | Ga0373923_0093456 | Ga0373923_0093456_795_1100 | 101 |
| 978 | 3300035113 | Ga0373936_0035525 | Ga0373936_0035525_880_1185 | 101 |
| 979 | 3300035113 | Ga0373936_0036445 | Ga0373936_0036445_413_718 | 101 |
| 980 | 3300035113 | Ga0373936_0068071 | Ga0373936_0068071_779_1084 | 101 |
| 981 | 3300035113 | Ga0373936_0384330 | Ga0373936_0384330_61_366 | 101 |
| 982 | 3300035113 | Ga0373936_0431473 | Ga0373936_0431473_54_359 | 101 |
| 983 | 3300035113 | Ga0373936_0582413 | Ga0373936_0582413_93_398 | 101 |
| 984 | 3300035114 | Ga0373939_0195557 | Ga0373939_0195557_271_576 | 101 |
| 985 | 3300035116 | Ga0373945_0139007 | Ga0373945_0139007_567_872 | 101 |
| 986 | 3300035116 | Ga0373945_0229516 | Ga0373945_0229516_269_574 | 101 |
| 987 | 3300035117 | Ga0373953_0270691 | Ga0373953_0270691_412_717 | 101 |
| 988 | 3300035117 | Ga0373953_0288935 | Ga0373953_0288935_289_594 | 101 |
| 989 | 3300035118 | Ga0373954_0124223 | Ga0373954_0124223_549_854 | 101 |
| 990 | 3300035119 | Ga0373956_0132597 | Ga0373956_0132597_69_374 | 101 |
| 991 | 3300035120 | Ga0373957_0044948 | Ga0373957_0044948_1195_1500 | 101 |
| 992 | 3300035120 | Ga0373957_0057320 | Ga0373957_0057320_1094_1399 | 101 |
| 993 | 3300035121 | Ga0373960_0227138 | Ga0373960_0227138_220_525 | 101 |
| 994 | 3300035170 | Ga0373943_0114904 | Ga0373943_0114904_135_440 | 101 |
| 995 | 3300035170 | Ga0373943_0404474 | Ga0373943_0404474_410_715 | 101 |
| 996 | 3300035171 | Ga0373946_0057466 | Ga0373946_0057466_1265_1570 | 101 |
| 997 | 3300035171 | Ga0373946_0323051 | Ga0373946_0323051_239_544 | 101 |
| 998 | 3300035172 | Ga0373955_0018160 | Ga0373955_0018160_2158_2463 | 101 |
| 999 | 3300035172 | Ga0373955_0018691 | Ga0373955_0018691_1059_1364 | 101 |
| 1000 | 3300035172 | Ga0373955_0046500 | Ga0373955_0046500_1347_1652 | 101 |
| 1001 | 3300035172 | Ga0373955_0714756 | Ga0373955_0714756_216_590 | 101 |
| 1002 | 3300035172 | Ga0373955_0835562 | Ga0373955_0835562_71_376 | 101 |
| 1003 | 3300035207 | Ga0373942_0133951 | Ga0373942_0133951_436_741 | 101 |
| 1004 | 3300035241 | Ga0373961_0201024 | Ga0373961_0201024_47_352 | 101 |
| 1005 | 3300035691 | Ga0373931_0677189 | Ga0373931_0677189_48_353 | 101 |
| 1006 | 3300035692 | Ga0373935_0338218 | Ga0373935_0338218_384_689 | 101 |
| 1007 | 3300035692 | Ga0373935_0930979 | Ga0373935_0930979_188_493 | 101 |
| 1008 | 3300035695 | Ga0373927_0009161 | Ga0373927_0009161_2940_3245 | 101 |
| 1009 | 3300035724 | Ga0373933_0134605 | Ga0373933_0134605_978_1283 | 101 |
| 1010 | 3300035724 | Ga0373933_0663875 | Ga0373933_0663875_207_512 | 101 |
| 1011 | 3300035724 | Ga0373933_0815132 | Ga0373933_0815132_277_582 | 101 |
| 1012 | 3300035724 | Ga0373933_0985631 | Ga0373933_0985631_61_366 | 101 |
| 1013 | 3300035725 | Ga0373947_0254326 | Ga0373947_0254326_784_1089 | 101 |
| 1014 | 3300035725 | Ga0373947_0716259 | Ga0373947_0716259_153_458 | 101 |
| 1015 | 3300036401 | Ga0373937_0065988 | Ga0373937_0065988_1648_1953 | 101 |
| 1016 | 3300036401 | Ga0373937_0086972 | Ga0373937_0086972_722_1027 | 101 |
| 1017 | 3300036401 | Ga0373937_0107062 | Ga0373937_0107062_431_736 | 101 |
| 1018 | 3300036401 | Ga0373937_0120811 | Ga0373937_0120811_1699_2004 | 101 |
| 1019 | 3300036401 | Ga0373937_0241467 | Ga0373937_0241467_1124_1429 | 101 |
| 1020 | 3300036401 | Ga0373937_1298504 | Ga0373937_1298504_250_555 | 101 |
| 1021 | 3300037068 | Ga0373925_0026649 | Ga0373925_0026649_896_1201 | 101 |
| 1022 | 3300037068 | Ga0373925_0747219 | Ga0373925_0747219_424_729 | 101 |
| 1023 | 3300037312 | Ga0395899_0377597 | Ga0395899_0377597_132_437 | 101 |
| 1024 | 3300037418 | Ga0395900_0328446 | Ga0395900_0328446_1148_1453 | 101 |
| 1025 | 3300037466 | Ga0395898_0014841 | Ga0395898_0014841_2935_3240 | 101 |
| 1026 | 3300037466 | Ga0395898_0039994 | Ga0395898_0039994_4043_4348 | 101 |
| 1027 | 3300037466 | Ga0395898_0742163 | Ga0395898_0742163_50_355 | 101 |
| 1028 | 3300037853 | Ga0436364_0966198 | Ga0436364_0966198_18_323 | 101 |
| 1029 | 3300037853 | Ga0436364_1119394 | Ga0436364_1119394_629_934 | 101 |
| 1030 | 3300039437 | Ga0436365_0032067 | Ga0436365_0032067_1988_2293 | 101 |
| 1031 | 3300039437 | Ga0436365_0123496 | Ga0436365_0123496_2625_2930 | 101 |
| 1032 | 3300039437 | Ga0436365_0309009 | Ga0436365_0309009_110_415 | 101 |
| 1033 | 3300039437 | Ga0436365_0574996 | Ga0436365_0574996_262_567 | 101 |
| 1034 | 3300039437 | Ga0436365_0588607 | Ga0436365_0588607_137_442 | 101 |
| 1035 | 3300039437 | Ga0436365_1106216 | Ga0436365_1106216_225_530 | 101 |
| 1036 | 3300039437 | Ga0436365_1107339 | Ga0436365_1107339_407_712 | 101 |
| 1037 | 3300039437 | Ga0436365_1277090 | Ga0436365_1277090_32_337 | 101 |
| 1038 | 3300039438 | Ga0436360_0226775 | Ga0436360_0226775_1413_1718 | 101 |
| 1039 | 3300039438 | Ga0436360_0397350 | Ga0436360_0397350_253_558 | 101 |
| 1040 | 3300039438 | Ga0436360_0552698 | Ga0436360_0552698_216_521 | 101 |
| 1041 | 3300039438 | Ga0436360_0749057 | Ga0436360_0749057_1336_1641 | 101 |
| 1042 | 3300039438 | Ga0436360_0999940 | Ga0436360_0999940_157_462 | 101 |
| 1043 | 3300039438 | Ga0436360_1375355 | Ga0436360_1375355_775_1080 | 101 |
| 1044 | 3300039447 | Ga0436361_0031697 | Ga0436361_0031697_418_723 | 101 |
| 1045 | 3300039447 | Ga0436361_0734175 | Ga0436361_0734175_82_387 | 101 |
| 1046 | 3300039450 | Ga0436363_0052657 | Ga0436363_0052657_152_457 | 101 |
| 1047 | 3300039450 | Ga0436363_0193457 | Ga0436363_0193457_726_1031 | 101 |
| 1048 | 3300039450 | Ga0436363_0498253 | Ga0436363_0498253_6504_6809 | 101 |
| 1049 | 3300039450 | Ga0436363_0603378 | Ga0436363_0603378_726_1031 | 101 |
| 1050 | 3300039450 | Ga0436363_0620486 | Ga0436363_0620486_2076_2381 | 101 |
| 1051 | 3300039450 | Ga0436363_0854207 | Ga0436363_0854207_2943_3248 | 101 |
| 1052 | 3300039450 | Ga0436363_1530821 | Ga0436363_1530821_2674_2979 | 101 |
| 1053 | 3300039453 | Ga0436362_0241992 | Ga0436362_0241992_173_478 | 101 |
| 1054 | 3300039453 | Ga0436362_0610762 | Ga0436362_0610762_319_624 | 101 |
| 1055 | 3300039453 | Ga0436362_0693496 | Ga0436362_0693496_924_1229 | 101 |
| 1056 | 3300039453 | Ga0436362_0820035 | Ga0436362_0820035_832_1137 | 101 |
| 1057 | 3300039453 | Ga0436362_1267612 | Ga0436362_1267612_225_530 | 101 |
| 1058 | 3300041406 | Ga0439439_0151535 | Ga0439439_0151535_109_414 | 101 |
| 1059 | 3300041441 | Ga0451787_619150 | Ga0451787_619150_14_319 | 101 |
| 1060 | 3300041443 | Ga0451789_0038452 | Ga0451789_0038452_169_474 | 101 |
| 1061 | 3300041443 | Ga0451789_0348250 | Ga0451789_0348250_312_617 | 101 |
| 1062 | 3300041451 | Ga0451791_0414676 | Ga0451791_0414676_95_400 | 101 |
| 1063 | 3300041451 | Ga0451791_0421855 | Ga0451791_0421855_546_851 | 101 |
| 1064 | 3300041451 | Ga0451791_1468289 | Ga0451791_1468289_420_725 | 101 |
| 1065 | 3300041452 | Ga0451793_1713978 | Ga0451793_1713978_189_494 | 101 |
| 1066 | 3300041453 | Ga0451797_0463910 | Ga0451797_0463910_106_411 | 101 |
| 1067 | 3300041453 | Ga0451797_1066747 | Ga0451797_1066747_398_703 | 101 |
| 1068 | 3300041453 | Ga0451797_1136816 | Ga0451797_1136816_390_695 | 101 |
| 1069 | 3300041458 | Ga0451798_0614515 | Ga0451798_0614515_419_724 | 101 |
| 1070 | 3300041459 | Ga0451800_0475520 | Ga0451800_0475520_387_692 | 101 |
| 1071 | 3300041460 | Ga0451802_1195489 | Ga0451802_1195489_161_466 | 101 |
| 1072 | 3300041486 | Ga0451807_0772385 | Ga0451807_0772385_408_713 | 101 |
| 1073 | 3300041486 | Ga0451807_2713173 | Ga0451807_2713173_128_433 | 101 |
| 1074 | 3300041492 | Ga0451835_0527541 | Ga0451835_0527541_202_507 | 101 |
| 1075 | 3300041494 | Ga0451837_0095635 | Ga0451837_0095635_186_491 | 101 |
| 1076 | 3300041494 | Ga0451837_0361166 | Ga0451837_0361166_409_714 | 101 |
| 1077 | 3300041496 | Ga0451839_0596168 | Ga0451839_0596168_172_477 | 101 |
| 1078 | 3300041503 | Ga0451847_0947723 | Ga0451847_0947723_441_746 | 101 |
| 1079 | 3300041505 | Ga0451849_1081235 | Ga0451849_1081235_293_598 | 101 |
| 1080 | 3300041507 | Ga0451851_0606114 | Ga0451851_0606114_155_460 | 101 |
| 1081 | 3300041509 | Ga0451843_0028636 | Ga0451843_0028636_525_830 | 101 |
| 1082 | 3300041512 | Ga0451853_0730695 | Ga0451853_0730695_272_577 | 101 |
| 1083 | 3300041512 | Ga0451853_1933935 | Ga0451853_1933935_321_626 | 101 |
| 1084 | 3300041512 | Ga0451853_2732029 | Ga0451853_2732029_106_411 | 101 |
| 1085 | 3300042004 | Ga0439445_0180438 | Ga0439445_0180438_203_508 | 101 |
| 1086 | 3300042127 | Ga0450890_010652 | Ga0450890_010652_700_1005 | 101 |
| 1087 | 3300042131 | Ga0450894_029561 | Ga0450894_029561_125_430 | 101 |
| 1088 | 3300042133 | Ga0450896_096353 | Ga0450896_096353_71_376 | 101 |
| 1089 | 3300042134 | Ga0450898_051332 | Ga0450898_051332_382_687 | 101 |
| 1090 | 3300042156 | Ga0439446_0167783 | Ga0439446_0167783_126_431 | 101 |
| 1091 | 3300042156 | Ga0439446_0249342 | Ga0439446_0249342_284_589 | 101 |
| 1092 | 3300042157 | Ga0439458_0102221 | Ga0439458_0102221_210_515 | 101 |
| 1093 | 3300042435 | Ga0439434_0308825 | Ga0439434_0308825_52_357 | 101 |
| 1094 | 3300042436 | Ga0439435_0010142 | Ga0439435_0010142_824_1129 | 101 |
| 1095 | 3300042438 | Ga0439459_0133243 | Ga0439459_0133243_81_386 | 101 |
| 1096 | 3300042530 | Ga0450916_025576 | Ga0450916_025576_481_786 | 101 |
| 1097 | 3300042876 | Ga0451577_0008727 | Ga0451577_0008727_3771_4076 | 101 |
| 1098 | 3300042876 | Ga0451577_0145274 | Ga0451577_0145274_1362_1667 | 101 |
| 1099 | 3300044656 | Ga0466969_0003941 | Ga0466969_0003941_4300_4605 | 101 |
| 1100 | 3300044656 | Ga0466969_0195423 | Ga0466969_0195423_79_384 | 101 |
| 1101 | 3300044658 | Ga0466972_0472510 | Ga0466972_0472510_38_343 | 101 |
| 1102 | 3300044673 | Ga0453683_0375398 | Ga0453683_0375398_226_531 | 101 |
| 1103 | 3300044684 | Ga0466966_0002570 | Ga0466966_0002570_7770_8075 | 101 |
| 1104 | 3300044684 | Ga0466966_0015541 | Ga0466966_0015541_189_494 | 101 |
| 1105 | 3300044684 | Ga0466966_0484215 | Ga0466966_0484215_200_505 | 101 |
| 1106 | 3300044693 | Ga0466961_0021828 | Ga0466961_0021828_3182_3487 | 101 |
| 1107 | 3300044706 | Ga0466964_0000625 | Ga0466964_0000625_4656_4961 | 101 |
| 1108 | 3300044712 | Ga0453684_0052092 | Ga0453684_0052092_2453_2758 | 101 |
| 1109 | 3300044712 | Ga0453684_0195515 | Ga0453684_0195515_929_1234 | 101 |
| 1110 | 3300044712 | Ga0453684_0332911 | Ga0453684_0332911_459_764 | 101 |
| 1111 | 3300044712 | Ga0453684_0340103 | Ga0453684_0340103_960_1265 | 101 |
| 1112 | 3300044712 | Ga0453684_2276575 | Ga0453684_2276575_65_370 | 101 |
| 1113 | 3300044719 | Ga0466971_0001102 | Ga0466971_0001102_5866_6171 | 101 |
| 1114 | 3300044735 | Ga0466968_0018375 | Ga0466968_0018375_113_418 | 101 |
| 1115 | 3300044765 | Ga0466970_0283586 | Ga0466970_0283586_516_821 | 101 |
| 1116 | 3300044842 | Ga0466957_0014712 | Ga0466957_0014712_3756_4061 | 101 |
| 1117 | 3300045049 | Ga0466959_0002822 | Ga0466959_0002822_6939_7244 | 101 |
| 1118 | 3300045049 | Ga0466959_0027151 | Ga0466959_0027151_3182_3487 | 101 |
| 1119 | 3300045049 | Ga0466959_0103445 | Ga0466959_0103445_680_985 | 101 |
| 1120 | 3300045049 | Ga0466959_0257685 | Ga0466959_0257685_175_480 | 101 |
| 1121 | 3300045051 | Ga0451576_0079035 | Ga0451576_0079035_2652_2957 | 101 |
| 1122 | 3300045051 | Ga0451576_0231550 | Ga0451576_0231550_1161_1466 | 101 |
| 1123 | 3300045051 | Ga0451576_0488431 | Ga0451576_0488431_921_1226 | 101 |
| 1124 | 3300045051 | Ga0451576_0879117 | Ga0451576_0879117_477_782 | 101 |
| 1125 | 3300045051 | Ga0451576_1507074 | Ga0451576_1507074_125_430 | 101 |
| 1126 | 3300045976 | Ga0466967_0269226 | Ga0466967_0269226_609_914 | 101 |
| 1127 | 3300046452 | Ga0495617_066779 | Ga0495617_066779_478_783 | 101 |
| 1128 | 3300046454 | Ga0495592_0259242 | Ga0495592_0259242_389_694 | 101 |
| 1129 | 3300046455 | Ga0495603_0163745 | Ga0495603_0163745_791_1096 | 101 |
| 1130 | 3300046457 | Ga0495590_0063883 | Ga0495590_0063883_351_656 | 101 |
| 1131 | 3300046459 | Ga0495629_0159354 | Ga0495629_0159354_794_1099 | 101 |
| 1132 | 3300046459 | Ga0495629_0235336 | Ga0495629_0235336_639_944 | 101 |
| 1133 | 3300046460 | Ga0495638_0020600 | Ga0495638_0020600_3657_3962 | 101 |
| 1134 | 3300046460 | Ga0495638_0023580 | Ga0495638_0023580_79_384 | 101 |
| 1135 | 3300046460 | Ga0495638_0074489 | Ga0495638_0074489_737_1042 | 101 |
| 1136 | 3300046460 | Ga0495638_0116034 | Ga0495638_0116034_1250_1555 | 101 |
| 1137 | 3300046461 | Ga0495641_0101699 | Ga0495641_0101699_760_1065 | 101 |
| 1138 | 3300046462 | Ga0495651_0986344 | Ga0495651_0986344_66_371 | 101 |
| 1139 | 3300046471 | Ga0495650_0256828 | Ga0495650_0256828_69_374 | 101 |
| 1140 | 3300046472 | Ga0495580_0992791 | Ga0495580_0992791_75_380 | 101 |
| 1141 | 3300046473 | Ga0495582_0021138 | Ga0495582_0021138_1260_1565 | 101 |
| 1142 | 3300046473 | Ga0495582_0218917 | Ga0495582_0218917_733_1038 | 101 |
| 1143 | 3300046475 | Ga0495639_0023140 | Ga0495639_0023140_1282_1587 | 101 |
| 1144 | 3300046477 | Ga0495664_0661920 | Ga0495664_0661920_268_573 | 101 |
| 1145 | 3300046492 | Ga0495585_0124260 | Ga0495585_0124260_622_927 | 101 |
| 1146 | 3300046506 | Ga0495583_0022468 | Ga0495583_0022468_1592_1897 | 101 |
| 1147 | 3300046506 | Ga0495583_0142270 | Ga0495583_0142270_236_541 | 101 |
| 1148 | 3300046506 | Ga0495583_0207707 | Ga0495583_0207707_170_475 | 101 |
| 1149 | 3300046512 | Ga0495610_0096636 | Ga0495610_0096636_529_834 | 101 |
| 1150 | 3300046513 | Ga0495616_0006494 | Ga0495616_0006494_2625_2930 | 101 |
| 1151 | 3300046513 | Ga0495616_0093680 | Ga0495616_0093680_981_1286 | 101 |
| 1152 | 3300046513 | Ga0495616_0338126 | Ga0495616_0338126_21_326 | 101 |
| 1153 | 3300046514 | Ga0495618_0091215 | Ga0495618_0091215_89_394 | 101 |
| 1154 | 3300046514 | Ga0495618_0263098 | Ga0495618_0263098_659_964 | 101 |
| 1155 | 3300046515 | Ga0495620_0086369 | Ga0495620_0086369_425_730 | 101 |
| 1156 | 3300046516 | Ga0495628_0530413 | Ga0495628_0530413_486_791 | 101 |
| 1157 | 3300046517 | Ga0495630_0140489 | Ga0495630_0140489_1092_1397 | 101 |
| 1158 | 3300046517 | Ga0495630_0656731 | Ga0495630_0656731_47_352 | 101 |
| 1159 | 3300046517 | Ga0495630_0913251 | Ga0495630_0913251_304_609 | 101 |
| 1160 | 3300046519 | Ga0495632_0093981 | Ga0495632_0093981_334_639 | 101 |
| 1161 | 3300046519 | Ga0495632_0113435 | Ga0495632_0113435_867_1172 | 101 |
| 1162 | 3300046519 | Ga0495632_0123602 | Ga0495632_0123602_259_564 | 101 |
| 1163 | 3300046519 | Ga0495632_0489639 | Ga0495632_0489639_169_474 | 101 |
| 1164 | 3300046520 | Ga0495637_0119817 | Ga0495637_0119817_406_711 | 101 |
| 1165 | 3300046525 | Ga0495663_0091107 | Ga0495663_0091107_56_361 | 101 |
| 1166 | 3300046529 | Ga0495652_0220478 | Ga0495652_0220478_950_1255 | 101 |
| 1167 | 3300046533 | Ga0495640_0102492 | Ga0495640_0102492_1184_1489 | 101 |
| 1168 | 3300046535 | Ga0495586_0869142 | Ga0495586_0869142_37_342 | 101 |
| 1169 | 3300046536 | Ga0495587_0105962 | Ga0495587_0105962_659_964 | 101 |
| 1170 | 3300046537 | Ga0495598_0186638 | Ga0495598_0186638_191_496 | 101 |
| 1171 | 3300046538 | Ga0495609_0186064 | Ga0495609_0186064_268_573 | 101 |
| 1172 | 3300046542 | Ga0495597_0317500 | Ga0495597_0317500_283_588 | 101 |
| 1173 | 3300046543 | Ga0495645_0354218 | Ga0495645_0354218_441_746 | 101 |
| 1174 | 3300046543 | Ga0495645_0522972 | Ga0495645_0522972_228_533 | 101 |
| 1175 | 3300046557 | Ga0495622_0117795 | Ga0495622_0117795_210_515 | 101 |
| 1176 | 3300046616 | Ga0495668_0164067 | Ga0495668_0164067_18_323 | 101 |
| 1177 | 3300046642 | Ga0495634_0149361 | Ga0495634_0149361_497_802 | 101 |
| 1178 | 3300046642 | Ga0495634_0227438 | Ga0495634_0227438_183_488 | 101 |
| 1179 | 3300046660 | Ga0495625_0020303 | Ga0495625_0020303_1101_1406 | 101 |
| 1180 | 3300046660 | Ga0495625_0102533 | Ga0495625_0102533_874_1179 | 101 |
| 1181 | 3300046660 | Ga0495625_0138933 | Ga0495625_0138933_241_546 | 101 |
| 1182 | 3300046660 | Ga0495625_0220280 | Ga0495625_0220280_170_475 | 101 |
| 1183 | 3300046660 | Ga0495625_0377859 | Ga0495625_0377859_166_471 | 101 |
| 1184 | 3300046660 | Ga0495625_0441025 | Ga0495625_0441025_153_458 | 101 |
| 1185 | 3300046660 | Ga0495625_0595743 | Ga0495625_0595743_108_413 | 101 |
| 1186 | 3300046664 | Ga0495659_0077302 | Ga0495659_0077302_521_826 | 101 |
| 1187 | 3300046678 | Ga0495599_0086546 | Ga0495599_0086546_706_1011 | 101 |
| 1188 | 3300046678 | Ga0495599_0385745 | Ga0495599_0385745_81_386 | 101 |
| 1189 | 3300046679 | Ga0495623_0376314 | Ga0495623_0376314_37_342 | 101 |
| 1190 | 3300046681 | Ga0495647_0090860 | Ga0495647_0090860_209_514 | 101 |
| 1191 | 3300046681 | Ga0495647_0179329 | Ga0495647_0179329_172_477 | 101 |
| 1192 | 3300046681 | Ga0495647_0180487 | Ga0495647_0180487_567_872 | 101 |
| 1193 | 3300046683 | Ga0495658_0011888 | Ga0495658_0011888_3608_3913 | 101 |
| 1194 | 3300046683 | Ga0495658_0027894 | Ga0495658_0027894_459_764 | 101 |
| 1195 | 3300046683 | Ga0495658_0166619 | Ga0495658_0166619_302_607 | 101 |
| 1196 | 3300046689 | Ga0495613_0215026 | Ga0495613_0215026_743_1048 | 101 |
| 1197 | 3300046689 | Ga0495613_0724512 | Ga0495613_0724512_183_488 | 101 |
| 1198 | 3300046690 | Ga0495624_0670704 | Ga0495624_0670704_254_559 | 101 |
| 1199 | 3300046691 | Ga0495670_0042455 | Ga0495670_0042455_332_637 | 101 |
| 1200 | 3300046691 | Ga0495670_0564651 | Ga0495670_0564651_199_504 | 101 |
| 1201 | 3300046692 | Ga0495671_0253568 | Ga0495671_0253568_264_569 | 101 |
| 1202 | 3300046692 | Ga0495671_0295587 | Ga0495671_0295587_51_356 | 101 |
| 1203 | 3300046694 | Ga0495649_0509840 | Ga0495649_0509840_43_348 | 101 |
| 1204 | 3300046794 | Ga0495589_0119441 | Ga0495589_0119441_841_1146 | 101 |
| 1205 | 3300046794 | Ga0495589_0389293 | Ga0495589_0389293_196_501 | 101 |
| 1206 | 3300046809 | Ga0495600_0123643 | Ga0495600_0123643_305_610 | 101 |
| 1207 | 3300046810 | Ga0495660_0528220 | Ga0495660_0528220_133_438 | 101 |
| 1208 | 3300047317 | Ga0495604_0208301 | Ga0495604_0208301_1024_1329 | 101 |
| 1209 | 3300047317 | Ga0495604_0502222 | Ga0495604_0502222_337_642 | 101 |
| 1210 | 3300047319 | Ga0495674_0250348 | Ga0495674_0250348_519_824 | 101 |
| 1211 | 3300047320 | Ga0495672_0312795 | Ga0495672_0312795_93_398 | 101 |
| 1212 | 3300047320 | Ga0495672_0437206 | Ga0495672_0437206_188_493 | 101 |
| 1213 | 3300047320 | Ga0495672_0555305 | Ga0495672_0555305_56_361 | 101 |
| 1214 | 3300047322 | Ga0495680_0062566 | Ga0495680_0062566_1050_1355 | 101 |
| 1215 | 3300047322 | Ga0495680_0383518 | Ga0495680_0383518_242_547 | 101 |
| 1216 | 3300047323 | Ga0495683_0243794 | Ga0495683_0243794_157_462 | 101 |
| 1217 | 3300047323 | Ga0495683_0288146 | Ga0495683_0288146_96_401 | 101 |
| 1218 | 3300047443 | Ga0495687_032507 | Ga0495687_032507_860_1165 | 101 |
| 1219 | 3300047444 | Ga0495675_0613493 | Ga0495675_0613493_168_473 | 101 |
| 1220 | 3300047445 | Ga0495677_0276222 | Ga0495677_0276222_133_438 | 101 |
| 1221 | 3300047469 | Ga0495673_0204943 | Ga0495673_0204943_247_552 | 101 |
| 1222 | 3300047469 | Ga0495673_0242607 | Ga0495673_0242607_129_434 | 101 |
| 1223 | 3300047471 | Ga0495684_0193885 | Ga0495684_0193885_90_395 | 101 |
| 1224 | 3300047472 | Ga0495686_0177695 | Ga0495686_0177695_242_547 | 101 |
| 1225 | 3300048088 | Ga0495602_0721799 | Ga0495602_0721799_108_413 | 101 |
| 1226 | 3300048088 | Ga0495602_0984899 | Ga0495602_0984899_23_328 | 101 |
| 1227 | 3300048091 | Ga0495626_0105620 | Ga0495626_0105620_566_871 | 101 |
| 1228 | 3300048903 | Ga0496100_0003550 | Ga0496100_0003550_5661_5966 | 101 |
| 1229 | 3300048903 | Ga0496100_0774048 | Ga0496100_0774048_116_421 | 101 |
| 1230 | 3300048903 | Ga0496100_0965158 | Ga0496100_0965158_242_547 | 101 |
| 1231 | 3300048903 | Ga0496100_1206157 | Ga0496100_1206157_177_482 | 101 |
| 1232 | 3300048904 | Ga0496101_0018936 | Ga0496101_0018936_2305_2610 | 101 |
| 1233 | 3300048904 | Ga0496101_0777477 | Ga0496101_0777477_187_492 | 101 |
| 1234 | 3300048904 | Ga0496101_1211394 | Ga0496101_1211394_112_417 | 101 |
| 1235 | 3300048905 | Ga0496102_0006276 | Ga0496102_0006276_9129_9434 | 101 |
| 1236 | 3300048905 | Ga0496102_0162163 | Ga0496102_0162163_528_833 | 101 |
| 1237 | 3300048905 | Ga0496102_0199613 | Ga0496102_0199613_1189_1494 | 101 |
| 1238 | 3300048905 | Ga0496102_0397339 | Ga0496102_0397339_451_756 | 101 |
| 1239 | 3300048906 | Ga0496103_0004906 | Ga0496103_0004906_3803_4108 | 101 |
| 1240 | 3300048906 | Ga0496103_0425100 | Ga0496103_0425100_15_320 | 101 |
| 1241 | 3300048906 | Ga0496103_0714653 | Ga0496103_0714653_285_590 | 101 |
| 1242 | 3300048907 | Ga0496104_0000099 | Ga0496104_0000099_6904_7209 | 101 |
| 1243 | 3300048907 | Ga0496104_0043605 | Ga0496104_0043605_1969_2274 | 101 |
| 1244 | 3300048907 | Ga0496104_0054136 | Ga0496104_0054136_459_764 | 101 |
| 1245 | 3300048907 | Ga0496104_0327787 | Ga0496104_0327787_760_1065 | 101 |
| 1246 | 3300048908 | Ga0496105_0000021 | Ga0496105_0000021_86933_87238 | 101 |
| 1247 | 3300048908 | Ga0496105_0003469 | Ga0496105_0003469_4455_4760 | 101 |
| 1248 | 3300048908 | Ga0496105_0010900 | Ga0496105_0010900_1089_1394 | 101 |
| 1249 | 3300048908 | Ga0496105_0686706 | Ga0496105_0686706_306_611 | 101 |
| 1250 | 3300048909 | Ga0496106_0004678 | Ga0496106_0004678_2211_2516 | 101 |
| 1251 | 3300048909 | Ga0496106_0066543 | Ga0496106_0066543_1689_1994 | 101 |
| 1252 | 3300048909 | Ga0496106_0183397 | Ga0496106_0183397_796_1101 | 101 |
| 1253 | 3300048909 | Ga0496106_0915163 | Ga0496106_0915163_43_348 | 101 |
| 1254 | 3300048910 | Ga0496107_0001576 | Ga0496107_0001576_10758_11063 | 101 |
| 1255 | 3300048910 | Ga0496107_0039998 | Ga0496107_0039998_701_1006 | 101 |
| 1256 | 3300048911 | Ga0496108_0002086 | Ga0496108_0002086_3318_3623 | 101 |
| 1257 | 3300048911 | Ga0496108_0140105 | Ga0496108_0140105_167_472 | 101 |
| 1258 | 3300048911 | Ga0496108_0168503 | Ga0496108_0168503_1199_1504 | 101 |
| 1259 | 3300048911 | Ga0496108_0397727 | Ga0496108_0397727_327_632 | 101 |
| 1260 | 3300048912 | Ga0496109_0006030 | Ga0496109_0006030_7458_7763 | 101 |
| 1261 | 3300048912 | Ga0496109_0618045 | Ga0496109_0618045_445_750 | 101 |
| 1262 | 3300048912 | Ga0496109_0653774 | Ga0496109_0653774_251_556 | 101 |
| 1263 | 3300048913 | Ga0496110_0005639 | Ga0496110_0005639_2091_2396 | 101 |
| 1264 | 3300048914 | Ga0496111_0003878 | Ga0496111_0003878_4844_5149 | 101 |
| 1265 | 3300048915 | Ga0496112_0009054 | Ga0496112_0009054_1397_1702 | 101 |
| 1266 | 3300048915 | Ga0496112_0574714 | Ga0496112_0574714_551_856 | 101 |
| 1267 | 3300048915 | Ga0496112_0588092 | Ga0496112_0588092_488_793 | 101 |
| 1268 | 3300048915 | Ga0496112_1343895 | Ga0496112_1343895_307_612 | 101 |
| 1269 | 3300048916 | Ga0496113_0106557 | Ga0496113_0106557_993_1298 | 101 |
| 1270 | 3300048916 | Ga0496113_0536021 | Ga0496113_0536021_205_510 | 101 |
| 1271 | 3300048917 | Ga0496114_0002220 | Ga0496114_0002220_6970_7275 | 101 |
| 1272 | 3300048917 | Ga0496114_0009046 | Ga0496114_0009046_5975_6280 | 101 |
| 1273 | 3300048917 | Ga0496114_0017246 | Ga0496114_0017246_4681_4986 | 101 |
| 1274 | 3300048917 | Ga0496114_1184832 | Ga0496114_1184832_224_529 | 101 |
| 1275 | 3300048918 | Ga0496115_0005471 | Ga0496115_0005471_1449_1754 | 101 |
| 1276 | 3300048918 | Ga0496115_0137279 | Ga0496115_0137279_1272_1577 | 101 |
| 1277 | 3300048918 | Ga0496115_0201742 | Ga0496115_0201742_719_1024 | 101 |
| 1278 | 3300048918 | Ga0496115_0259538 | Ga0496115_0259538_564_869 | 101 |
| 1279 | 3300048918 | Ga0496115_0355670 | Ga0496115_0355670_630_935 | 101 |
| 1280 | 3300048918 | Ga0496115_0884241 | Ga0496115_0884241_65_370 | 101 |
| 1281 | 3300048919 | Ga0496116_0276692 | Ga0496116_0276692_188_493 | 101 |
| 1282 | 3300048920 | Ga0496117_0548477 | Ga0496117_0548477_129_434 | 101 |
| 1283 | 3300048921 | Ga0496118_0013267 | Ga0496118_0013267_943_1248 | 101 |
| 1284 | 3300048921 | Ga0496118_0609783 | Ga0496118_0609783_36_341 | 101 |
| 1285 | 3300048922 | Ga0496119_0281602 | Ga0496119_0281602_45_350 | 101 |
| 1286 | 3300048922 | Ga0496119_0530017 | Ga0496119_0530017_101_406 | 101 |
| 1287 | 3300048923 | Ga0496120_0269452 | Ga0496120_0269452_442_747 | 101 |
| 1288 | 3300048923 | Ga0496120_0413403 | Ga0496120_0413403_187_492 | 101 |
| 1289 | 3300048924 | Ga0496121_0000704 | Ga0496121_0000704_60153_60458 | 101 |
| 1290 | 3300048927 | Ga0496124_0370756 | Ga0496124_0370756_201_506 | 101 |
| 1291 | 3300048928 | Ga0496125_0005100 | Ga0496125_0005100_14045_14350 | 101 |
| 1292 | 3300048928 | Ga0496125_0050036 | Ga0496125_0050036_185_490 | 101 |
| 1293 | 3300048928 | Ga0496125_0124580 | Ga0496125_0124580_1119_1424 | 101 |
| 1294 | 3300048928 | Ga0496125_0419979 | Ga0496125_0419979_59_364 | 101 |
| 1295 | 3300048929 | Ga0496126_0004928 | Ga0496126_0004928_8219_8524 | 101 |
| 1296 | 3300048929 | Ga0496126_0098679 | Ga0496126_0098679_1147_1452 | 101 |
| 1297 | 3300049460 | Ga0495682_0049136 | Ga0495682_0049136_476_781 | 101 |
| 1298 | 3300049568 | Ga0501031_0579094 | Ga0501031_0579094_135_440 | 101 |
| 1299 | 3300049569 | Ga0501032_0186687 | Ga0501032_0186687_925_1230 | 101 |
| 1300 | 3300049569 | Ga0501032_0911698 | Ga0501032_0911698_111_416 | 101 |
| 1301 | 3300049569 | Ga0501032_1037062 | Ga0501032_1037062_171_476 | 101 |
| 1302 | 3300049570 | Ga0501033_0049659 | Ga0501033_0049659_1113_1418 | 101 |
| 1303 | 3300049570 | Ga0501033_0290223 | Ga0501033_0290223_417_722 | 101 |
| 1304 | 3300049572 | Ga0501036_0023621 | Ga0501036_0023621_1115_1420 | 101 |
| 1305 | 3300049572 | Ga0501036_0048255 | Ga0501036_0048255_2853_3158 | 101 |
| 1306 | 3300049573 | Ga0501037_0024581 | Ga0501037_0024581_3692_3997 | 101 |
| 1307 | 3300049573 | Ga0501037_0071416 | Ga0501037_0071416_45_350 | 101 |
| 1308 | 3300049574 | Ga0501038_0015092 | Ga0501038_0015092_2701_3006 | 101 |
| 1309 | 3300049574 | Ga0501038_0090870 | Ga0501038_0090870_360_665 | 101 |
| 1310 | 3300049574 | Ga0501038_0189643 | Ga0501038_0189643_1231_1536 | 101 |
| 1311 | 3300049575 | Ga0501039_0021546 | Ga0501039_0021546_4205_4510 | 101 |
| 1312 | 3300049575 | Ga0501039_0115981 | Ga0501039_0115981_880_1185 | 101 |
| 1313 | 3300049575 | Ga0501039_0451889 | Ga0501039_0451889_420_725 | 101 |
| 1314 | 3300049575 | Ga0501039_0702981 | Ga0501039_0702981_17_322 | 101 |
| 1315 | 3300049576 | Ga0501040_0008066 | Ga0501040_0008066_5581_5886 | 101 |
| 1316 | 3300049576 | Ga0501040_0044091 | Ga0501040_0044091_203_508 | 101 |
| 1317 | 3300049577 | Ga0501041_0001598 | Ga0501041_0001598_2340_2645 | 101 |
| 1318 | 3300049577 | Ga0501041_0119305 | Ga0501041_0119305_387_692 | 101 |
| 1319 | 3300049578 | Ga0501042_0001373 | Ga0501042_0001373_6763_7068 | 101 |
| 1320 | 3300049578 | Ga0501042_0158721 | Ga0501042_0158721_165_470 | 101 |
| 1321 | 3300049579 | Ga0501043_0418507 | Ga0501043_0418507_468_773 | 101 |
| 1322 | 3300049580 | Ga0501046_0015243 | Ga0501046_0015243_3020_3325 | 101 |
| 1323 | 3300049580 | Ga0501046_0105554 | Ga0501046_0105554_822_1127 | 101 |
| 1324 | 3300049581 | Ga0501047_0148132 | Ga0501047_0148132_1124_1429 | 101 |
| 1325 | 3300049581 | Ga0501047_0364875 | Ga0501047_0364875_490_795 | 101 |
| 1326 | 3300049582 | Ga0501048_0009558 | Ga0501048_0009558_1225_1530 | 101 |
| 1327 | 3300049582 | Ga0501048_0067468 | Ga0501048_0067468_790_1095 | 101 |
| 1328 | 3300049582 | Ga0501048_0309943 | Ga0501048_0309943_37_342 | 101 |
| 1329 | 3300049583 | Ga0501067_0031483 | Ga0501067_0031483_2492_2797 | 101 |
| 1330 | 3300049583 | Ga0501067_0138286 | Ga0501067_0138286_634_939 | 101 |
| 1331 | 3300049583 | Ga0501067_0163247 | Ga0501067_0163247_563_868 | 101 |
| 1332 | 3300049584 | Ga0501068_0001465 | Ga0501068_0001465_5865_6170 | 101 |
| 1333 | 3300049584 | Ga0501068_0041518 | Ga0501068_0041518_2222_2527 | 101 |
| 1334 | 3300049584 | Ga0501068_0404347 | Ga0501068_0404347_133_438 | 101 |
| 1335 | 3300049585 | Ga0501069_0392696 | Ga0501069_0392696_276_581 | 101 |
| 1336 | 3300049586 | Ga0501070_0044235 | Ga0501070_0044235_1702_2007 | 101 |
| 1337 | 3300049587 | Ga0501071_0003527 | Ga0501071_0003527_8826_9131 | 101 |
| 1338 | 3300049587 | Ga0501071_0024289 | Ga0501071_0024289_1218_1523 | 101 |
| 1339 | 3300049587 | Ga0501071_0144858 | Ga0501071_0144858_235_540 | 101 |
| 1340 | 3300049588 | Ga0501072_0025385 | Ga0501072_0025385_4014_4319 | 101 |
| 1341 | 3300049588 | Ga0501072_0063312 | Ga0501072_0063312_554_859 | 101 |
| 1342 | 3300049589 | Ga0501073_0000525 | Ga0501073_0000525_8382_8687 | 101 |
| 1343 | 3300049589 | Ga0501073_0122379 | Ga0501073_0122379_1323_1628 | 101 |
| 1344 | 3300049590 | Ga0501074_0001124 | Ga0501074_0001124_13648_13953 | 101 |
| 1345 | 3300049590 | Ga0501074_0089815 | Ga0501074_0089815_732_1037 | 101 |
| 1346 | 3300049590 | Ga0501074_0222352 | Ga0501074_0222352_887_1192 | 101 |
| 1347 | 3300049591 | Ga0501075_0015597 | Ga0501075_0015597_2958_3263 | 101 |
| 1348 | 3300049591 | Ga0501075_0055471 | Ga0501075_0055471_1509_1814 | 101 |
| 1349 | 3300049591 | Ga0501075_0231797 | Ga0501075_0231797_506_811 | 101 |
| 1350 | 3300049592 | Ga0501076_0004639 | Ga0501076_0004639_5859_6164 | 101 |
| 1351 | 3300049592 | Ga0501076_0022764 | Ga0501076_0022764_437_742 | 101 |
| 1352 | 3300049592 | Ga0501076_0028505 | Ga0501076_0028505_3373_3678 | 101 |
| 1353 | 3300049593 | Ga0501077_0002875 | Ga0501077_0002875_2182_2487 | 101 |
| 1354 | 3300049593 | Ga0501077_0007629 | Ga0501077_0007629_2741_3046 | 101 |
| 1355 | 3300049593 | Ga0501077_0029086 | Ga0501077_0029086_387_692 | 101 |
| 1356 | 3300049704 | Ga0501221_202380 | Ga0501221_202380_144_449 | 101 |
| 1357 | 3300049706 | Ga0501229_020387 | Ga0501229_020387_174_479 | 101 |
| 1358 | 3300049741 | Ga0501079_0004772 | Ga0501079_0004772_2006_2311 | 101 |
| 1359 | 3300049741 | Ga0501079_0006996 | Ga0501079_0006996_764_1069 | 101 |
| 1360 | 3300049741 | Ga0501079_0179169 | Ga0501079_0179169_899_1204 | 101 |
| 1361 | 3300049742 | Ga0501080_0001373 | Ga0501080_0001373_7677_7982 | 101 |
| 1362 | 3300049742 | Ga0501080_0011395 | Ga0501080_0011395_925_1230 | 101 |
| 1363 | 3300049742 | Ga0501080_0037660 | Ga0501080_0037660_3780_4085 | 101 |
| 1364 | 3300049742 | Ga0501080_0794587 | Ga0501080_0794587_484_789 | 101 |
| 1365 | 3300049742 | Ga0501080_0865037 | Ga0501080_0865037_100_405 | 101 |
| 1366 | 3300049742 | Ga0501080_1063857 | Ga0501080_1063857_142_447 | 101 |
| 1367 | 3300049743 | Ga0501081_0006719 | Ga0501081_0006719_4747_5052 | 101 |
| 1368 | 3300049743 | Ga0501081_0018126 | Ga0501081_0018126_387_692 | 101 |
| 1369 | 3300049744 | Ga0501083_0004501 | Ga0501083_0004501_2951_3256 | 101 |
| 1370 | 3300049744 | Ga0501083_0032077 | Ga0501083_0032077_1223_1528 | 101 |
| 1371 | 3300049744 | Ga0501083_0067453 | Ga0501083_0067453_447_752 | 101 |
| 1372 | 3300049744 | Ga0501083_0079781 | Ga0501083_0079781_137_442 | 101 |
| 1373 | 3300049822 | Ga0501035_0416594 | Ga0501035_0416594_445_750 | 101 |
| 1374 | 3300049822 | Ga0501035_0532215 | Ga0501035_0532215_584_889 | 101 |
| 1375 | 3300049822 | Ga0501035_0950616 | Ga0501035_0950616_17_322 | 101 |
| 1376 | 3300049823 | Ga0501044_0413807 | Ga0501044_0413807_156_461 | 101 |
| 1377 | 3300049823 | Ga0501044_1078751 | Ga0501044_1078751_20_325 | 101 |
| 1378 | 3300049824 | Ga0501045_0008747 | Ga0501045_0008747_4094_4399 | 101 |
| 1379 | 3300049824 | Ga0501045_0084307 | Ga0501045_0084307_573_878 | 101 |
| 1380 | 3300050491 | nmdc:mga00v17_416636_c1 | nmdc:mga00v17_416636_c1_371_676 | 101 |
| 1381 | 3300050493 | nmdc:mga0k408_129650_c1 | nmdc:mga0k408_129650_c1_1164_1469 | 101 |
| 1382 | 3300050493 | nmdc:mga0k408_210024_c1 | nmdc:mga0k408_210024_c1_315_620 | 101 |
| 1383 | 3300050493 | nmdc:mga0k408_403038_c1 | nmdc:mga0k408_403038_c1_304_609 | 101 |
| 1384 | 3300050493 | nmdc:mga0k408_620355_c1 | nmdc:mga0k408_620355_c1_296_601 | 101 |
| 1385 | 3300050493 | nmdc:mga0k408_65172_c1 | nmdc:mga0k408_65172_c1_404_709 | 101 |
| 1386 | 3300050494 | nmdc:mga06z11_249605_c1 | nmdc:mga06z11_249605_c1_544_849 | 101 |
| 1387 | 3300050494 | nmdc:mga06z11_526216_c1 | nmdc:mga06z11_526216_c1_134_439 | 101 |
| 1388 | 3300050495 | nmdc:mga04h51_191481_c1 | nmdc:mga04h51_191481_c1_182_487 | 101 |
| 1389 | 3300050496 | nmdc:mga07m45_427265_c1 | nmdc:mga07m45_427265_c1_181_486 | 101 |
| 1390 | 3300050496 | nmdc:mga07m45_463706_c1 | nmdc:mga07m45_463706_c1_118_423 | 101 |
| 1391 | 3300050496 | nmdc:mga07m45_490894_c1 | nmdc:mga07m45_490894_c1_39_344 | 101 |
| 1392 | 3300050496 | nmdc:mga07m45_826988_c1 | nmdc:mga07m45_826988_c1_136_441 | 101 |
| 1393 | 3300050508 | nmdc:mga09592_404099_c1 | nmdc:mga09592_404099_c1_376_681 | 101 |
| 1394 | 3300050509 | nmdc:mga0qj67_1159723_c1 | nmdc:mga0qj67_1159723_c1_53_358 | 101 |
| 1395 | 3300050509 | nmdc:mga0qj67_1182304_c1 | nmdc:mga0qj67_1182304_c1_71_376 | 101 |
| 1396 | 3300050511 | nmdc:mga08y16_397291_c1 | nmdc:mga08y16_397291_c1_1061_1366 | 101 |
| 1397 | 3300050513 | nmdc:mga0rr50_62474_c1 | nmdc:mga0rr50_62474_c1_2342_2647 | 101 |
| 1398 | 3300050515 | nmdc:mga0a205_803976_c1 | nmdc:mga0a205_803976_c1_164_469 | 101 |
| 1399 | 3300053077 | Ga0495601_0301989 | Ga0495601_0301989_230_535 | 101 |
| 1400 | 3300053077 | Ga0495601_0375658 | Ga0495601_0375658_426_731 | 101 |
| 1401 | 3300053078 | Ga0495612_0422317 | Ga0495612_0422317_238_543 | 101 |
| 1402 | 3300053083 | Ga0495655_0027539 | Ga0495655_0027539_979_1284 | 101 |
| 1403 | 3300053085 | Ga0495619_0091313 | Ga0495619_0091313_659_964 | 101 |
| 1404 | 3300053088 | Ga0500644_0024450 | Ga0500644_0024450_1088_1393 | 101 |
| 1405 | 3300053088 | Ga0500644_0061778 | Ga0500644_0061778_301_606 | 101 |
| 1406 | 3300053088 | Ga0500644_0093414 | Ga0500644_0093414_592_897 | 101 |
| 1407 | 3300053090 | Ga0500646_0034024 | Ga0500646_0034024_265_570 | 101 |
| 1408 | 3300053092 | Ga0500583_0002507 | Ga0500583_0002507_973_1278 | 101 |
| 1409 | 3300053092 | Ga0500583_0041097 | Ga0500583_0041097_1380_1685 | 101 |
| 1410 | 3300053096 | Ga0500641_0069032 | Ga0500641_0069032_755_1060 | 101 |
| 1411 | 3300053096 | Ga0500641_0105565 | Ga0500641_0105565_384_689 | 101 |
| 1412 | 3300053096 | Ga0500641_0180809 | Ga0500641_0180809_46_351 | 101 |
| 1413 | 3300053097 | Ga0500648_185932 | Ga0500648_185932_520_825 | 101 |
| 1414 | 3300053109 | Ga0500569_074574 | Ga0500569_074574_520_825 | 101 |
| 1415 | 3300053118 | Ga0500594_0090275 | Ga0500594_0090275_316_621 | 101 |
| 1416 | 3300053120 | Ga0500597_287311 | Ga0500597_287311_244_549 | 101 |
| 1417 | 3300053126 | Ga0500621_165278 | Ga0500621_165278_444_749 | 101 |
| 1418 | 3300053126 | Ga0500621_239922 | Ga0500621_239922_169_474 | 101 |
| 1419 | 3300053127 | Ga0500623_241004 | Ga0500623_241004_283_588 | 101 |
| 1420 | 3300053130 | Ga0500642_0084229 | Ga0500642_0084229_34_339 | 101 |
| 1421 | 3300053130 | Ga0500642_0147518 | Ga0500642_0147518_385_690 | 101 |
| 1422 | 3300053131 | Ga0500652_095300 | Ga0500652_095300_177_482 | 101 |
| 1423 | 3300053139 | Ga0500568_0017821 | Ga0500568_0017821_2613_2918 | 101 |
| 1424 | 3300053147 | Ga0500589_240462 | Ga0500589_240462_313_618 | 101 |
| 1425 | 3300053153 | Ga0500616_0000499 | Ga0500616_0000499_43295_43600 | 101 |
| 1426 | 3300053153 | Ga0500616_0007626 | Ga0500616_0007626_2922_3227 | 101 |
| 1427 | 3300053156 | Ga0500622_0003284 | Ga0500622_0003284_7319_7624 | 101 |
| 1428 | 3300053158 | Ga0500627_0283306 | Ga0500627_0283306_307_612 | 101 |
| 1429 | 3300053159 | Ga0500630_113114 | Ga0500630_113114_268_573 | 101 |
| 1430 | 3300053163 | Ga0500639_292615 | Ga0500639_292615_53_358 | 101 |
| 1431 | 3300053177 | Ga0500636_0329121 | Ga0500636_0329121_314_619 | 101 |
| 1432 | 3300053178 | Ga0500637_0239922 | Ga0500637_0239922_320_625 | 101 |
| 1433 | 3300053727 | Ga0500611_066042 | Ga0500611_066042_111_416 | 101 |
| 1434 | 3300054114 | Ga0501084_0008704 | Ga0501084_0008704_1325_1630 | 101 |
| 1435 | 3300054114 | Ga0501084_0022568 | Ga0501084_0022568_2920_3225 | 101 |
| 1436 | 3300054114 | Ga0501084_0144399 | Ga0501084_0144399_460_765 | 101 |
| 1437 | 3300054114 | Ga0501084_1367973 | Ga0501084_1367973_97_402 | 101 |
| 1438 | 3300059424 | Ga0590075_024840 | Ga0590075_024840_438_743 | 101 |
| 1439 | 3300059424 | Ga0590075_092399 | Ga0590075_092399_260_565 | 101 |
| 1440 | 3300059426 | Ga0590077_032183 | Ga0590077_032183_196_501 | 101 |
| 1441 | 3300059426 | Ga0590077_115504 | Ga0590077_115504_205_510 | 101 |
| 1442 | 3300059490 | Ga0587066_011018 | Ga0587066_011018_886_1191 | 101 |
| 1443 | 3300059491 | Ga0587070_211754 | Ga0587070_211754_56_361 | 101 |
| 1444 | 3300059492 | Ga0587073_0063602 | Ga0587073_0063602_292_597 | 101 |
| 1445 | 3300059492 | Ga0587073_0206325 | Ga0587073_0206325_99_404 | 101 |
| 1446 | 3300059493 | Ga0587077_005133 | Ga0587077_005133_817_1122 | 101 |
| 1447 | 3300059493 | Ga0587077_020561 | Ga0587077_020561_408_713 | 101 |
| 1448 | 3300059503 | Ga0587080_004278 | Ga0587080_004278_1337_1642 | 101 |
| 1449 | 3300059505 | Ga0587083_0015822 | Ga0587083_0015822_274_579 | 101 |
| 1450 | 3300059505 | Ga0587083_0029935 | Ga0587083_0029935_419_724 | 101 |
| 1451 | 3300059508 | Ga0587088_005875 | Ga0587088_005875_560_865 | 101 |
| 1452 | 3300059510 | Ga0587090_007160 | Ga0587090_007160_770_1075 | 101 |
| 1453 | 3300059513 | Ga0587094_013915 | Ga0587094_013915_665_970 | 101 |
| 1454 | 3300059605 | Ga0587106_017423 | Ga0587106_017423_525_830 | 101 |
| 1455 | 3300059624 | Ga0587109_008544 | Ga0587109_008544_199_504 | 101 |
| 1456 | 3300059630 | Ga0587128_094305 | Ga0587128_094305_228_533 | 101 |
| 1457 | 3300059631 | Ga0587130_039456 | Ga0587130_039456_64_369 | 101 |
| 1458 | 3300059639 | Ga0587062_011923 | Ga0587062_011923_555_860 | 101 |
| 1459 | 3300059640 | Ga0587067_014519 | Ga0587067_014519_893_1198 | 101 |
| 1460 | 3300059640 | Ga0587067_021127 | Ga0587067_021127_375_680 | 101 |
| 1461 | 3300059641 | Ga0587068_042614 | Ga0587068_042614_466_771 | 101 |
| 1462 | 3300059641 | Ga0587068_045700 | Ga0587068_045700_247_552 | 101 |
| 1463 | 3300059644 | Ga0587075_018539 | Ga0587075_018539_474_779 | 101 |
| 1464 | 3300059645 | Ga0587076_014586 | Ga0587076_014586_654_959 | 101 |
| 1465 | 3300059645 | Ga0587076_038507 | Ga0587076_038507_506_811 | 101 |
| 1466 | 3300059645 | Ga0587076_157098 | Ga0587076_157098_43_348 | 101 |
| 1467 | 3300059654 | Ga0587110_028294 | Ga0587110_028294_46_351 | 101 |
| 1468 | 3300060344 | Ga0587071_070132 | Ga0587071_070132_414_719 | 101 |
| 1469 | 3300060346 | Ga0587111_0035975 | Ga0587111_0035975_71_376 | 101 |
| 1470 | 3300060346 | Ga0587111_0190869 | Ga0587111_0190869_71_376 | 101 |
| 1471 | 3300060353 | Ga0501082_0004231 | Ga0501082_0004231_10182_10487 | 101 |
| 1472 | 3300060353 | Ga0501082_0043889 | Ga0501082_0043889_2650_2955 | 101 |
| 1473 | 3300060353 | Ga0501082_0087089 | Ga0501082_0087089_798_1103 | 101 |
| 1474 | 3300061719 | Ga0466962_0001207 | Ga0466962_0001207_3827_4132 | 101 |
| 1475 | 3300061734 | Ga0530510_0007174 | Ga0530510_0007174_4391_4696 | 101 |
| 1476 | 3300061734 | Ga0530510_0170978 | Ga0530510_0170978_316_621 | 101 |
| 1477 | 3300061734 | Ga0530510_0398438 | Ga0530510_0398438_326_631 | 101 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar