F494251

General Info

Members Datasets Scaffolds Average Seq Length
1477 526 1477 101

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_2276575|Ga0453684_2276575_65_370
Length 101
Sequence MAKKSVLERQKKREILVARRWKQREELRKKGVDASLTEEERQQARVALNKMPRDTSIIRLRTRCQCTGRARGVYKKFKLSRLCFRELALTGMIPGITKASW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
214 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
219 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
220 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
227 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
232 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
235 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
236 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
240 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
246 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
247 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
267 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
268 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
295 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
296 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
297 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
298 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
299 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
300 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
301 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
302 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
303 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
304 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
305 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
306 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
307 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
308 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
309 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
310 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
311 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
312 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
313 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
314 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
315 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
316 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
317 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
318 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
319 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
320 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
321 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
322 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
323 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
324 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
325 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
326 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
327 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
328 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
329 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
330 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
334 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
335 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
340 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
356 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
357 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
364 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
365 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
366 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
369 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
370 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
371 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
379 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
380 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
381 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
382 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
394 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
395 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
396 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
399 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
400 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
401 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
402 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
403 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
419 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
420 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
421 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
422 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
425 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
456 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
457 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
458 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
459 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
460 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
461 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
466 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
467 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
468 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
469 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
470 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
471 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
472 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
480 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
481 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
482 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
483 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
484 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
485 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
486 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
487 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
488 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
489 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
490 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
491 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
492 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
493 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
494 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
495 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
496 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
497 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
498 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
499 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
500 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
501 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
502 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
503 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
525 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
526 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 2.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 4.6
Rhizosphere 86.8
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2458830 2162886007 Bacteria 2754
2 SwRhRL2b_contig_305464 2162886007 Bacteria 3378
3 LJNas_1009780 3300000546 Unclassified 1024
4 rootL2_10298515 3300003322 Bacteria 1414
5 Ga0065707_10083802 3300005295 Bacteria 8210
6 Ga0070658_10257996 3300005327 Bacteria 1480
7 Ga0070658_10295114 3300005327 Bacteria 1382
8 Ga0070676_10073677 3300005328 Bacteria 2055
9 Ga0070676_10479439 3300005328 Bacteria 879
10 Ga0070676_11028069 3300005328 Bacteria 620
11 Ga0070683_100880746 3300005329 Bacteria 859
12 Ga0070683_100929438 3300005329 Bacteria 835
13 Ga0070690_100185153 3300005330 Bacteria 1440
14 Ga0070690_100818035 3300005330 Bacteria 724
15 Ga0070670_100000015 3300005331 Bacteria 228819
16 Ga0070670_100042316 3300005331 Bacteria 3915
17 Ga0070670_100199450 3300005331 Bacteria 1738
18 Ga0070670_100265999 3300005331 Bacteria 1495
19 Ga0070670_100873049 3300005331 Bacteria 815
20 Ga0070677_10072009 3300005333 Bacteria 1456
21 Ga0070677_10097789 3300005333 Bacteria 1288
22 Ga0068869_100157158 3300005334 Bacteria 1767
23 Ga0068869_100185294 3300005334 Bacteria 1633
24 Ga0068869_100227172 3300005334 Bacteria 1482
25 Ga0068869_100263074 3300005334 Bacteria 1381
26 Ga0068869_100263844 3300005334 Bacteria 1379
27 Ga0068869_100272095 3300005334 Bacteria 1359
28 Ga0068869_100482335 3300005334 Bacteria 1032
29 Ga0068869_100800604 3300005334 Bacteria 810
30 Ga0070666_10001446 3300005335 Bacteria 14396
31 Ga0070666_10005025 3300005335 Bacteria 8088
32 Ga0070666_10007123 3300005335 Bacteria 6896
33 Ga0070666_10128706 3300005335 Bacteria 1758
34 Ga0070666_10520393 3300005335 Bacteria 863
35 Ga0070680_100040283 3300005336 Bacteria 3782
36 Ga0070680_100105088 3300005336 Bacteria 2347
37 Ga0070680_100262924 3300005336 Bacteria 1460
38 Ga0070680_100391830 3300005336 Bacteria 1183
39 Ga0070682_100093827 3300005337 Bacteria 1968
40 Ga0070682_100196386 3300005337 Bacteria 1420
41 Ga0070682_100295777 3300005337 Bacteria 1186
42 Ga0070682_100522069 3300005337 Bacteria 924
43 Ga0070682_101875204 3300005337 Bacteria 524
44 Ga0070682_101957885 3300005337 Bacteria 514
45 Ga0068868_100008294 3300005338 Bacteria 7438
46 Ga0068868_100155721 3300005338 Bacteria 1884
47 Ga0068868_100297572 3300005338 Bacteria 1370
48 Ga0068868_100945844 3300005338 Bacteria 785
49 Ga0070660_100218304 3300005339 Bacteria 1549
50 Ga0070660_100822022 3300005339 Bacteria 782
51 Ga0070660_101314308 3300005339 Bacteria 614
52 Ga0070689_100015417 3300005340 Bacteria 5572
53 Ga0070689_100194297 3300005340 Bacteria 1653
54 Ga0070689_100639427 3300005340 Bacteria 924
55 Ga0070689_100729449 3300005340 Bacteria 867
56 Ga0070689_101539914 3300005340 Bacteria 603
57 Ga0070687_100398813 3300005343 Bacteria 901
58 Ga0070661_100043750 3300005344 Bacteria 3271
59 Ga0070661_100405968 3300005344 Bacteria 1078
60 Ga0070661_100476134 3300005344 Bacteria 996
61 Ga0070692_10637538 3300005345 Bacteria 710
62 Ga0070668_100015678 3300005347 Bacteria 5667
63 Ga0070668_100304484 3300005347 Bacteria 1337
64 Ga0070668_100553556 3300005347 Bacteria 1001
65 Ga0070668_100701114 3300005347 Bacteria 893
66 Ga0070668_101105513 3300005347 Bacteria 715
67 Ga0070669_100004607 3300005353 Bacteria 9957
68 Ga0070669_100068175 3300005353 Bacteria 2626
69 Ga0070669_101167194 3300005353 Bacteria 664
70 Ga0070675_100604755 3300005354 Bacteria 994
71 Ga0070675_101450340 3300005354 Bacteria 633
72 Ga0070675_101542601 3300005354 Bacteria 613
73 Ga0070675_101975770 3300005354 Bacteria 538
74 Ga0070671_100000013 3300005355 Bacteria 173287
75 Ga0070671_100003161 3300005355 Bacteria 12839
76 Ga0070671_100005400 3300005355 Bacteria 10190
77 Ga0070671_100024367 3300005355 Bacteria 4953
78 Ga0070671_100043910 3300005355 Bacteria 3714
79 Ga0070671_100194729 3300005355 Bacteria 1718
80 Ga0070671_100289073 3300005355 Bacteria 1395
81 Ga0070671_100968024 3300005355 Bacteria 745
82 Ga0070671_101230034 3300005355 Bacteria 659
83 Ga0070674_100459821 3300005356 Bacteria 1052
84 Ga0070674_100875519 3300005356 Bacteria 781
85 Ga0070674_101181444 3300005356 Bacteria 678
86 Ga0070673_100069532 3300005364 Bacteria 2822
87 Ga0070673_100126122 3300005364 Bacteria 2142
88 Ga0070673_101085747 3300005364 Bacteria 747
89 Ga0070688_100001170 3300005365 Bacteria 13058
90 Ga0070688_100100587 3300005365 Bacteria 1905
91 Ga0070688_100224119 3300005365 Bacteria 1326
92 Ga0070688_101429513 3300005365 Bacteria 561
93 Ga0070659_100912333 3300005366 Bacteria 768
94 Ga0070659_101332672 3300005366 Bacteria 637
95 Ga0070667_100000015 3300005367 Bacteria 238203
96 Ga0070667_100012347 3300005367 Bacteria 7064
97 Ga0070667_100052533 3300005367 Bacteria 3439
98 Ga0070667_100055472 3300005367 Bacteria 3346
99 Ga0070667_100129962 3300005367 Bacteria 2197
100 Ga0070667_100246143 3300005367 Bacteria 1597
101 Ga0070667_100332046 3300005367 Bacteria 1374
102 Ga0070667_100361652 3300005367 Bacteria 1315
103 Ga0070667_100496374 3300005367 Bacteria 1119
104 Ga0070667_100907096 3300005367 Bacteria 820
105 Ga0070667_101053655 3300005367 Bacteria 759
106 Ga0070667_101650388 3300005367 Bacteria 603
107 Ga0070709_10009928 3300005434 Bacteria 5262
108 Ga0070709_10015515 3300005434 Bacteria 4337
109 Ga0070709_10540170 3300005434 Bacteria 891
110 Ga0070709_11246486 3300005434 Bacteria 599
111 Ga0070714_100009500 3300005435 Bacteria 7649
112 Ga0070714_100039089 3300005435 Bacteria 3993
113 Ga0070714_100118523 3300005435 Bacteria 2352
114 Ga0070713_100001795 3300005436 Bacteria 13831
115 Ga0070713_100006105 3300005436 Bacteria 8311
116 Ga0070713_100143194 3300005436 Bacteria 2119
117 Ga0070713_102210715 3300005436 Bacteria 533
118 Ga0070710_10218779 3300005437 Bacteria 1211
119 Ga0070710_10282913 3300005437 Bacteria 1077
120 Ga0070710_10284586 3300005437 Bacteria 1074
121 Ga0070710_10297749 3300005437 Bacteria 1052
122 Ga0070710_10439812 3300005437 Bacteria 882
123 Ga0070710_10509940 3300005437 Bacteria 825
124 Ga0070701_10012276 3300005438 Bacteria 3858
125 Ga0070701_10936903 3300005438 Bacteria 600
126 Ga0070701_11077180 3300005438 Bacteria 564
127 Ga0070711_100001465 3300005439 Bacteria 12963
128 Ga0070711_100025752 3300005439 Bacteria 3851
129 Ga0070711_100102588 3300005439 Bacteria 2083
130 Ga0070711_101116594 3300005439 Bacteria 680
131 Ga0070705_100026638 3300005440 Bacteria 3148
132 Ga0070705_100959165 3300005440 Bacteria 692
133 Ga0070705_101410545 3300005440 Bacteria 581
134 Ga0070700_100108314 3300005441 Bacteria 1842
135 Ga0070700_100111081 3300005441 Bacteria 1822
136 Ga0070694_100203816 3300005444 Bacteria 1476
137 Ga0070694_100266569 3300005444 Bacteria 1301
138 Ga0070694_101631334 3300005444 Bacteria 548
139 Ga0070663_100261291 3300005455 Bacteria 1373
140 Ga0070663_100460622 3300005455 Bacteria 1050
141 Ga0070663_100887224 3300005455 Bacteria 769
142 Ga0070663_100961791 3300005455 Bacteria 741
143 Ga0070678_100002594 3300005456 Bacteria 9934
144 Ga0070678_100003045 3300005456 Bacteria 9285
145 Ga0070662_100193386 3300005457 Bacteria 1610
146 Ga0070662_100324196 3300005457 Bacteria 1257
147 Ga0070662_100566273 3300005457 Bacteria 953
148 Ga0070662_101037380 3300005457 Bacteria 703
149 Ga0070681_10008976 3300005458 Bacteria 9830
150 Ga0070681_10035786 3300005458 Bacteria 4988
151 Ga0070681_10048581 3300005458 Bacteria 4239
152 Ga0070681_10124955 3300005458 Bacteria 2505
153 Ga0070681_10226323 3300005458 Bacteria 1785
154 Ga0070681_10447630 3300005458 Bacteria 1203
155 Ga0070681_10857361 3300005458 Unclassified 826
156 Ga0068867_100034823 3300005459 Bacteria 3651
157 Ga0068867_100284808 3300005459 Bacteria 1356
158 Ga0068867_100308681 3300005459 Bacteria 1306
159 Ga0068867_100582762 3300005459 Bacteria 973
160 Ga0068867_102247104 3300005459 Bacteria 518
161 Ga0070685_10000104 3300005466 Bacteria 53528
162 Ga0070685_10075272 3300005466 Bacteria 2010
163 Ga0070685_10359631 3300005466 Bacteria 997
164 Ga0070685_10379550 3300005466 Bacteria 973
165 Ga0070685_10694073 3300005466 Bacteria 741
166 Ga0070706_100618727 3300005467 Bacteria 1006
167 Ga0070698_100403358 3300005471 Bacteria 1301
168 Ga0070699_100038586 3300005518 Bacteria 4136
169 Ga0070699_101982475 3300005518 Bacteria 532
170 Ga0070679_100017288 3300005530 Bacteria 6978
171 Ga0070679_100103898 3300005530 Bacteria 2827
172 Ga0070679_100392779 3300005530 Bacteria 1333
173 Ga0070679_100461063 3300005530 Bacteria 1215
174 Ga0070679_100979079 3300005530 Bacteria 790
175 Ga0070684_100247020 3300005535 Bacteria 1631
176 Ga0070684_100338267 3300005535 Bacteria 1384
177 Ga0068853_100093611 3300005539 Bacteria 2646
178 Ga0068853_100411250 3300005539 Bacteria 1267
179 Ga0068853_100832908 3300005539 Bacteria 884
180 Ga0068853_102131749 3300005539 Bacteria 543
181 Ga0070672_100029396 3300005543 Bacteria 4120
182 Ga0070672_100123866 3300005543 Bacteria 2119
183 Ga0070672_101584022 3300005543 Bacteria 587
184 Ga0070686_100033543 3300005544 Bacteria 3155
185 Ga0070686_100067091 3300005544 Bacteria 2336
186 Ga0070686_100304762 3300005544 Bacteria 1182
187 Ga0070686_100328730 3300005544 Bacteria 1142
188 Ga0070686_100331701 3300005544 Bacteria 1137
189 Ga0070686_100427149 3300005544 Bacteria 1013
190 Ga0070686_101294030 3300005544 Bacteria 609
191 Ga0070695_100002554 3300005545 Bacteria 10512
192 Ga0070695_100315217 3300005545 Bacteria 1161
193 Ga0070696_100001443 3300005546 Bacteria 15552
194 Ga0070696_100094917 3300005546 Bacteria 2129
195 Ga0070696_100302416 3300005546 Bacteria 1226
196 Ga0070696_100456680 3300005546 Bacteria 1009
197 Ga0070693_100005307 3300005547 Bacteria 6176
198 Ga0070693_100297442 3300005547 Bacteria 1087
199 Ga0070693_100486805 3300005547 Bacteria 872
200 Ga0070693_100898563 3300005547 Bacteria 664
201 Ga0070665_100000175 3300005548 Bacteria 113874
202 Ga0070665_100003465 3300005548 Bacteria 16812
203 Ga0070665_100005442 3300005548 Bacteria 13132
204 Ga0070665_100007665 3300005548 Bacteria 10970
205 Ga0070665_100008007 3300005548 Bacteria 10704
206 Ga0070665_100008860 3300005548 Bacteria 10186
207 Ga0070665_100014481 3300005548 Bacteria 7909
208 Ga0070665_100041345 3300005548 Bacteria 4633
209 Ga0070665_100045273 3300005548 Bacteria 4419
210 Ga0070665_100088333 3300005548 Bacteria 3105
211 Ga0070665_100373744 3300005548 Bacteria 1432
212 Ga0070665_101260584 3300005548 Bacteria 749
213 Ga0070665_101569949 3300005548 Bacteria 666
214 Ga0070665_101617870 3300005548 Bacteria 655
215 Ga0070704_100096958 3300005549 Bacteria 2212
216 Ga0070704_101225118 3300005549 Bacteria 685
217 Ga0070704_101291132 3300005549 Bacteria 668
218 Ga0068855_100008308 3300005563 Bacteria 12546
219 Ga0068855_100032357 3300005563 Bacteria 6245
220 Ga0068855_100065515 3300005563 Bacteria 4235
221 Ga0068855_100114994 3300005563 Bacteria 3084
222 Ga0068855_100271336 3300005563 Bacteria 1886
223 Ga0068855_100285468 3300005563 Bacteria 1831
224 Ga0068855_100428146 3300005563 Bacteria 1447
225 Ga0068855_100586554 3300005563 Bacteria 1203
226 Ga0068855_100685966 3300005563 Bacteria 1097
227 Ga0070664_100047403 3300005564 Bacteria 3630
228 Ga0070664_100155787 3300005564 Bacteria 2018
229 Ga0070664_100380435 3300005564 Bacteria 1288
230 Ga0070664_101172709 3300005564 Bacteria 724
231 Ga0070664_101232379 3300005564 Bacteria 706
232 Ga0070664_101274042 3300005564 Bacteria 694
233 Ga0070664_101451379 3300005564 Bacteria 649
234 Ga0070664_101766471 3300005564 Bacteria 586
235 Ga0068857_100399905 3300005577 Bacteria 1278
236 Ga0068857_100466980 3300005577 Bacteria 1181
237 Ga0068857_101793026 3300005577 Bacteria 601
238 Ga0068854_100120736 3300005578 Bacteria 1989
239 Ga0068854_100126961 3300005578 Bacteria 1943
240 Ga0068854_100585414 3300005578 Bacteria 951
241 Ga0068854_100961944 3300005578 Bacteria 754
242 Ga0068854_101178647 3300005578 Bacteria 685
243 Ga0068854_101347674 3300005578 Bacteria 644
244 Ga0068856_100006458 3300005614 Bacteria 11500
245 Ga0068856_100042931 3300005614 Bacteria 4449
246 Ga0068856_100047430 3300005614 Bacteria 4231
247 Ga0068856_100065387 3300005614 Bacteria 3594
248 Ga0068856_101019825 3300005614 Bacteria 846
249 Ga0068856_101760333 3300005614 Bacteria 632
250 Ga0070702_100447241 3300005615 Bacteria 936
251 Ga0070702_100490995 3300005615 Bacteria 899
252 Ga0070702_101506072 3300005615 Bacteria 554
253 Ga0068852_100172880 3300005616 Bacteria 2026
254 Ga0068852_100275903 3300005616 Bacteria 1619
255 Ga0068852_100907747 3300005616 Bacteria 898
256 Ga0068852_102181017 3300005616 Bacteria 575
257 Ga0068859_100000641 3300005617 Bacteria 34946
258 Ga0068859_100005854 3300005617 Bacteria 12474
259 Ga0068859_100047020 3300005617 Bacteria 4334
260 Ga0068859_100056515 3300005617 Bacteria 3950
261 Ga0068859_100077312 3300005617 Bacteria 3369
262 Ga0068859_100291710 3300005617 Bacteria 1724
263 Ga0068859_100313859 3300005617 Bacteria 1661
264 Ga0068859_101283777 3300005617 Bacteria 807
265 Ga0068859_103057760 3300005617 Bacteria 510
266 Ga0068864_100000056 3300005618 Bacteria 127891
267 Ga0068864_100043033 3300005618 Bacteria 3866
268 Ga0068864_100839782 3300005618 Bacteria 904
269 Ga0068864_100858896 3300005618 Bacteria 894
270 Ga0068864_101536866 3300005618 Bacteria 669
271 Ga0068864_101545628 3300005618 Bacteria 667
272 Ga0068866_10002031 3300005718 Bacteria 8429
273 Ga0068866_10091532 3300005718 Bacteria 1657
274 Ga0068866_10633009 3300005718 Bacteria 726
275 Ga0068866_10784860 3300005718 Bacteria 661
276 Ga0068861_100066380 3300005719 Bacteria 2781
277 Ga0068861_100097092 3300005719 Bacteria 2336
278 Ga0068861_100167386 3300005719 Bacteria 1819
279 Ga0068861_100388924 3300005719 Bacteria 1234
280 Ga0068861_101079416 3300005719 Bacteria 770
281 Ga0068861_101116219 3300005719 Bacteria 758
282 Ga0068861_101691155 3300005719 Bacteria 625
283 Ga0068861_102259291 3300005719 Bacteria 545
284 Ga0068851_10032527 3300005834 Bacteria 2595
285 Ga0068851_10351588 3300005834 Bacteria 857
286 Ga0068870_10001674 3300005840 Bacteria 9068
287 Ga0068870_10164633 3300005840 Bacteria 1318
288 Ga0068870_10629134 3300005840 Bacteria 732
289 Ga0068870_10837143 3300005840 Bacteria 645
290 Ga0068863_100008761 3300005841 Bacteria 9878
291 Ga0068863_100069769 3300005841 Bacteria 3323
292 Ga0068863_100075635 3300005841 Bacteria 3186
293 Ga0068863_100154561 3300005841 Bacteria 2196
294 Ga0068863_100156589 3300005841 Bacteria 2181
295 Ga0068863_100181690 3300005841 Bacteria 2019
296 Ga0068863_100368482 3300005841 Bacteria 1401
297 Ga0068863_100649716 3300005841 Bacteria 1046
298 Ga0068863_100731629 3300005841 Bacteria 984
299 Ga0068863_100936433 3300005841 Bacteria 867
300 Ga0068863_101486838 3300005841 Bacteria 686
301 Ga0068863_102334353 3300005841 Bacteria 545
302 Ga0068858_100000125 3300005842 Bacteria 79795
303 Ga0068858_100004270 3300005842 Bacteria 14053
304 Ga0068858_100031324 3300005842 Bacteria 4939
305 Ga0068858_100054829 3300005842 Bacteria 3686
306 Ga0068858_100130358 3300005842 Bacteria 2357
307 Ga0068858_100143953 3300005842 Bacteria 2238
308 Ga0068858_100458094 3300005842 Bacteria 1230
309 Ga0068858_101216752 3300005842 Bacteria 741
310 Ga0068858_102467426 3300005842 Bacteria 514
311 Ga0068860_100002410 3300005843 Bacteria 19616
312 Ga0068860_100006244 3300005843 Bacteria 11972
313 Ga0068860_100009263 3300005843 Bacteria 9789
314 Ga0068860_100010872 3300005843 Bacteria 8977
315 Ga0068860_100074726 3300005843 Bacteria 3223
316 Ga0068860_100125358 3300005843 Bacteria 2461
317 Ga0068860_100987493 3300005843 Bacteria 860
318 Ga0068860_101441857 3300005843 Bacteria 710
319 Ga0068860_102036230 3300005843 Bacteria 596
320 Ga0068860_102307423 3300005843 Bacteria 559
321 Ga0068862_100008335 3300005844 Bacteria 8578
322 Ga0068862_100065242 3300005844 Bacteria 3136
323 Ga0068862_100098243 3300005844 Bacteria 2557
324 Ga0068862_100145559 3300005844 Bacteria 2106
325 Ga0068862_100198509 3300005844 Bacteria 1808
326 Ga0068862_100344838 3300005844 Bacteria 1380
327 Ga0068862_101189284 3300005844 Bacteria 760
328 Ga0081455_10008699 3300005937 Bacteria 10513
329 Ga0081540_1179590 3300005983 Bacteria 794
330 Ga0070717_10062172 3300006028 Bacteria 3096
331 Ga0075368_10226039 3300006042 Bacteria 796
332 Ga0070715_10000668 3300006163 Bacteria 9167
333 Ga0070715_10111151 3300006163 Bacteria 1293
334 Ga0070716_100004769 3300006173 Bacteria 6507
335 Ga0070716_101570414 3300006173 Bacteria 540
336 Ga0070712_100001456 3300006175 Bacteria 14428
337 Ga0070712_100044366 3300006175 Bacteria 3065
338 Ga0070712_100057768 3300006175 Bacteria 2727
339 Ga0070712_100156187 3300006175 Bacteria 1757
340 Ga0070712_100311663 3300006175 Bacteria 1277
341 Ga0070712_100371053 3300006175 Bacteria 1176
342 Ga0075362_10545825 3300006177 Bacteria 596
343 Ga0075367_10328708 3300006178 Bacteria 964
344 Ga0075367_10857991 3300006178 Bacteria 579
345 Ga0075366_10043507 3300006195 Bacteria 2660
346 Ga0075366_10096819 3300006195 Bacteria 1770
347 Ga0075366_10184479 3300006195 Bacteria 1268
348 Ga0075366_10344993 3300006195 Bacteria 913
349 Ga0097621_100003525 3300006237 Bacteria 10812
350 Ga0097621_100078362 3300006237 Bacteria 2745
351 Ga0097621_100122525 3300006237 Bacteria 2207
352 Ga0097621_100139427 3300006237 Bacteria 2071
353 Ga0097621_100201163 3300006237 Bacteria 1729
354 Ga0097621_100213968 3300006237 Bacteria 1677
355 Ga0097621_100244548 3300006237 Bacteria 1569
356 Ga0097621_100379215 3300006237 Bacteria 1263
357 Ga0097621_100480099 3300006237 Bacteria 1123
358 Ga0097621_100485288 3300006237 Bacteria 1117
359 Ga0097621_100882874 3300006237 Bacteria 832
360 Ga0075370_10203587 3300006353 Bacteria 1168
361 Ga0075370_10434802 3300006353 Bacteria 789
362 Ga0068871_100044280 3300006358 Bacteria 3578
363 Ga0068871_100188243 3300006358 Bacteria 1777
364 Ga0068871_100226252 3300006358 Bacteria 1622
365 Ga0068871_100413993 3300006358 Bacteria 1202
366 Ga0068871_100453812 3300006358 Bacteria 1149
367 Ga0068871_100778809 3300006358 Bacteria 881
368 Ga0068871_100810447 3300006358 Bacteria 863
369 Ga0068871_100851851 3300006358 Bacteria 843
370 Ga0068871_101325124 3300006358 Bacteria 677
371 Ga0068871_101620222 3300006358 Bacteria 613
372 Ga0075428_100802261 3300006844 Bacteria 1001
373 Ga0075430_100218759 3300006846 Bacteria 1580
374 Ga0075430_101708589 3300006846 Bacteria 516
375 Ga0075433_10827216 3300006852 Bacteria 809
376 Ga0075429_100593330 3300006880 Bacteria 971
377 Ga0068865_100001214 3300006881 Bacteria 15025
378 Ga0068865_100010514 3300006881 Bacteria 5763
379 Ga0068865_100021451 3300006881 Bacteria 4200
380 Ga0068865_100037315 3300006881 Bacteria 3281
381 Ga0068865_100074556 3300006881 Bacteria 2417
382 Ga0068865_100902572 3300006881 Bacteria 768
383 Ga0068865_101185461 3300006881 Bacteria 675
384 Ga0068865_101269991 3300006881 Bacteria 654
385 Ga0097620_100000641 3300006931 Bacteria 34946
386 Ga0097620_100005854 3300006931 Bacteria 12474
387 Ga0097620_100047018 3300006931 Bacteria 4334
388 Ga0097620_100056514 3300006931 Bacteria 3950
389 Ga0097620_100077315 3300006931 Bacteria 3369
390 Ga0097620_100291721 3300006931 Bacteria 1724
391 Ga0097620_100313863 3300006931 Bacteria 1661
392 Ga0097620_101283982 3300006931 Bacteria 807
393 Ga0097620_103057767 3300006931 Bacteria 510
394 Ga0075435_100074393 3300007076 Bacteria 2779
395 Ga0099794_10074634 3300007265 Bacteria 1666
396 Ga0099794_10524708 3300007265 Bacteria 624
397 Ga0099795_10003084 3300007788 Bacteria 4070
398 Ga0105240_10010598 3300009093 Bacteria 12954
399 Ga0105240_10029309 3300009093 Bacteria 7174
400 Ga0105240_10086135 3300009093 Bacteria 3848
401 Ga0105240_10112936 3300009093 Bacteria 3283
402 Ga0105240_10242587 3300009093 Bacteria 2088
403 Ga0105240_10281671 3300009093 Bacteria 1909
404 Ga0105240_10582231 3300009093 Bacteria 1234
405 Ga0105240_10626335 3300009093 Bacteria 1182
406 Ga0111539_10799285 3300009094 Bacteria 1098
407 Ga0111539_11140813 3300009094 Bacteria 906
408 Ga0111539_12212886 3300009094 Bacteria 638
409 Ga0111539_12365742 3300009094 Bacteria 616
410 Ga0105245_10087460 3300009098 Bacteria 2860
411 Ga0105245_10099675 3300009098 Bacteria 2686
412 Ga0105245_11037789 3300009098 Bacteria 865
413 Ga0105247_10002466 3300009101 Bacteria 12578
414 Ga0105247_10015909 3300009101 Bacteria 4504
415 Ga0105247_10176946 3300009101 Bacteria 1422
416 Ga0105247_10229055 3300009101 Bacteria 1261
417 Ga0114129_12003029 3300009147 Bacteria 700
418 Ga0105243_10194189 3300009148 Bacteria 1775
419 Ga0105241_10011879 3300009174 Bacteria 6399
420 Ga0105241_10113915 3300009174 Bacteria 2168
421 Ga0105242_10003026 3300009176 Bacteria 13137
422 Ga0105242_10003628 3300009176 Bacteria 12013
423 Ga0105242_10206784 3300009176 Bacteria 1746
424 Ga0105242_10313692 3300009176 Bacteria 1436
425 Ga0105242_13064695 3300009176 Bacteria 518
426 Ga0105248_10003146 3300009177 Bacteria 18265
427 Ga0105248_10005842 3300009177 Bacteria 13527
428 Ga0105248_10023564 3300009177 Bacteria 6838
429 Ga0105248_11602520 3300009177 Bacteria 737
430 Ga0105237_10044034 3300009545 Bacteria 4495
431 Ga0105237_10096005 3300009545 Bacteria 2955
432 Ga0105237_10099219 3300009545 Bacteria 2904
433 Ga0105237_11401620 3300009545 Bacteria 705
434 Ga0105237_12217420 3300009545 Bacteria 559
435 Ga0105238_10022279 3300009551 Bacteria 6457
436 Ga0105238_10406256 3300009551 Bacteria 1355
437 Ga0105238_11488562 3300009551 Bacteria 705
438 Ga0105238_11852273 3300009551 Bacteria 636
439 Ga0105238_11939221 3300009551 Bacteria 622
440 Ga0105238_11982085 3300009551 Bacteria 616
441 Ga0105238_12008678 3300009551 Bacteria 612
442 Ga0105249_10014582 3300009553 Bacteria 6947
443 Ga0105249_12013929 3300009553 Bacteria 650
444 Ga0105249_13085298 3300009553 Bacteria 535
445 Ga0099796_10000013 3300010159 Bacteria 54630
446 Ga0099796_10006593 3300010159 Bacteria 2983
447 Ga0099796_10145978 3300010159 Bacteria 928
448 Ga0099796_10174031 3300010159 Bacteria 860
449 Ga0105239_10103797 3300010375 Bacteria 3147
450 Ga0105239_10500212 3300010375 Bacteria 1382
451 Ga0105239_10564741 3300010375 Bacteria 1296
452 Ga0105239_11021932 3300010375 Bacteria 951
453 Ga0105239_11149118 3300010375 Bacteria 894
454 Ga0105246_10472133 3300011119 Bacteria 1059
455 Ga0105246_10796721 3300011119 Bacteria 838
456 Ga0105246_11577531 3300011119 Bacteria 619
457 Ga0105246_12155952 3300011119 Bacteria 541
458 Ga0157373_10162009 3300013100 Bacteria 1574
459 Ga0157373_11037167 3300013100 Bacteria 613
460 Ga0157371_11264455 3300013102 Bacteria 570
461 Ga0157370_10262850 3300013104 Bacteria 1595
462 Ga0157370_10299273 3300013104 Bacteria 1485
463 Ga0157370_11797859 3300013104 Bacteria 550
464 Ga0157369_10015323 3300013105 Bacteria 8645
465 Ga0157369_10051835 3300013105 Bacteria 4441
466 Ga0157369_10213528 3300013105 Bacteria 2022
467 Ga0157369_10293856 3300013105 Bacteria 1691
468 Ga0157369_10535674 3300013105 Bacteria 1211
469 Ga0157369_10746078 3300013105 Bacteria 1007
470 Ga0157374_10002813 3300013296 Bacteria 14598
471 Ga0157374_10039033 3300013296 Bacteria 4368
472 Ga0157374_10310346 3300013296 Bacteria 1561
473 Ga0157374_10414545 3300013296 Bacteria 1345
474 Ga0157378_10006374 3300013297 Bacteria 10319
475 Ga0157378_10013575 3300013297 Bacteria 7124
476 Ga0163162_10006236 3300013306 Bacteria 11558
477 Ga0163162_10008705 3300013306 Bacteria 9877
478 Ga0163162_10026596 3300013306 Bacteria 5720
479 Ga0163162_10646134 3300013306 Bacteria 1182
480 Ga0163162_10655282 3300013306 Bacteria 1173
481 Ga0163162_11551272 3300013306 Bacteria 755
482 Ga0163162_11693985 3300013306 Bacteria 722
483 Ga0163162_12420139 3300013306 Bacteria 604
484 Ga0163162_12778846 3300013306 Bacteria 563
485 Ga0157372_10081320 3300013307 Bacteria 3667
486 Ga0157372_10897157 3300013307 Bacteria 1029
487 Ga0157372_11041560 3300013307 Bacteria 947
488 Ga0157372_11995561 3300013307 Bacteria 667
489 Ga0157375_10000319 3300013308 Bacteria 43172
490 Ga0157375_10006856 3300013308 Bacteria 9930
491 Ga0157375_10493225 3300013308 Bacteria 1389
492 Ga0157375_10545902 3300013308 Bacteria 1321
493 Ga0157375_11014123 3300013308 Bacteria 969
494 Ga0157375_11627865 3300013308 Bacteria 764
495 Ga0163163_10000199 3300014325 Bacteria 62045
496 Ga0163163_10007457 3300014325 Bacteria 9652
497 Ga0163163_10176222 3300014325 Bacteria 2185
498 Ga0163163_10404151 3300014325 Bacteria 1424
499 Ga0163163_10733157 3300014325 Bacteria 1052
500 Ga0163163_11985108 3300014325 Bacteria 642
501 Ga0157380_11708957 3300014326 Bacteria 687
502 Ga0157380_12923379 3300014326 Bacteria 544
503 Ga0157377_10941315 3300014745 Bacteria 649
504 Ga0157379_10006918 3300014968 Bacteria 9807
505 Ga0157379_10037733 3300014968 Bacteria 4309
506 Ga0157379_10055138 3300014968 Bacteria 3552
507 Ga0157379_10082681 3300014968 Bacteria 2877
508 Ga0157379_10187423 3300014968 Bacteria 1870
509 Ga0157379_10447257 3300014968 Bacteria 1192
510 Ga0157379_10949746 3300014968 Bacteria 818
511 Ga0157379_11261575 3300014968 Bacteria 712
512 Ga0157379_12059406 3300014968 Bacteria 565
513 Ga0157376_10131141 3300014969 Bacteria 2236
514 Ga0157376_10278682 3300014969 Bacteria 1574
515 Ga0157376_10280609 3300014969 Bacteria 1569
516 Ga0157376_10447997 3300014969 Bacteria 1259
517 Ga0157376_11563247 3300014969 Bacteria 693
518 Ga0182007_10211695 3300015262 Bacteria 682
519 Ga0163161_10205021 3300017792 Bacteria 1521
520 Ga0163161_10501275 3300017792 Bacteria 989
521 Ga0197907_10294975 3300020069 Unclassified 521
522 Ga0206356_11568175 3300020070 Bacteria 1269
523 Ga0206356_11640133 3300020070 Bacteria 2223
524 Ga0206351_10700694 3300020077 Bacteria 1521
525 Ga0206352_10349565 3300020078 Bacteria 725
526 Ga0206354_11036454 3300020081 Bacteria 1025
527 Ga0206353_10222205 3300020082 Bacteria 879
528 Ga0213873_10261514 3300021358 Bacteria 550
529 Ga0213874_10149716 3300021377 Bacteria 813
530 Ga0213876_10032683 3300021384 Bacteria 2744
531 Ga0213876_10099155 3300021384 Bacteria 1544
532 Ga0213876_10222335 3300021384 Bacteria 1004
533 Ga0213876_10564005 3300021384 Bacteria 606
534 Ga0213875_10435923 3300021388 Bacteria 627
535 Ga0213871_10014920 3300021441 Bacteria 1850
536 Ga0213871_10270734 3300021441 Bacteria 543
537 Ga0224712_10358615 3300022467 Bacteria 690
538 Ga0224572_1011889 3300024225 Bacteria 1649
539 Ga0224572_1076459 3300024225 Bacteria 618
540 Ga0209233_1001951 3300025261 Bacteria 7860
541 Ga0207666_1019476 3300025271 Bacteria 991
542 Ga0207697_10027047 3300025315 Bacteria 2346
543 Ga0207656_10044300 3300025321 Bacteria 1899
544 Ga0207656_10182284 3300025321 Bacteria 1008
545 Ga0207653_10133826 3300025885 Bacteria 902
546 Ga0207692_10132931 3300025898 Bacteria 1407
547 Ga0207692_10246844 3300025898 Bacteria 1068
548 Ga0207692_10464853 3300025898 Bacteria 798
549 Ga0207692_10698704 3300025898 Bacteria 658
550 Ga0207692_11194148 3300025898 Bacteria 505
551 Ga0207642_10016853 3300025899 Bacteria 2764
552 Ga0207642_11013530 3300025899 Bacteria 535
553 Ga0207710_10000332 3300025900 Bacteria 35424
554 Ga0207710_10009562 3300025900 Bacteria 4077
555 Ga0207710_10010376 3300025900 Bacteria 3923
556 Ga0207710_10012607 3300025900 Bacteria 3557
557 Ga0207710_10056714 3300025900 Bacteria 1768
558 Ga0207710_10112208 3300025900 Bacteria 1295
559 Ga0207688_10144333 3300025901 Bacteria 1402
560 Ga0207680_10009301 3300025903 Bacteria 4869
561 Ga0207680_10047575 3300025903 Bacteria 2542
562 Ga0207680_10136511 3300025903 Bacteria 1622
563 Ga0207680_10235304 3300025903 Bacteria 1260
564 Ga0207680_10257091 3300025903 Bacteria 1208
565 Ga0207647_10046204 3300025904 Bacteria 2714
566 Ga0207647_10097771 3300025904 Bacteria 1745
567 Ga0207685_10000121 3300025905 Bacteria 11820
568 Ga0207685_10032092 3300025905 Bacteria 1887
569 Ga0207685_10158287 3300025905 Bacteria 1032
570 Ga0207699_10024184 3300025906 Bacteria 3318
571 Ga0207699_10043471 3300025906 Bacteria 2610
572 Ga0207699_10281638 3300025906 Bacteria 1155
573 Ga0207699_10941374 3300025906 Bacteria 638
574 Ga0207645_10015789 3300025907 Bacteria 5006
575 Ga0207645_10027678 3300025907 Bacteria 3659
576 Ga0207645_10186335 3300025907 Bacteria 1363
577 Ga0207645_10620537 3300025907 Bacteria 734
578 Ga0207643_10002762 3300025908 Bacteria 9490
579 Ga0207643_10070432 3300025908 Bacteria 2011
580 Ga0207643_10583790 3300025908 Bacteria 718
581 Ga0207705_10385827 3300025909 Bacteria 1082
582 Ga0207705_11159612 3300025909 Bacteria 594
583 Ga0207684_10575909 3300025910 Bacteria 962
584 Ga0207654_10034349 3300025911 Bacteria 2817
585 Ga0207654_10062727 3300025911 Bacteria 2179
586 Ga0207654_10327449 3300025911 Bacteria 1049
587 Ga0207654_10644101 3300025911 Bacteria 758
588 Ga0207707_10000276 3300025912 Bacteria 55321
589 Ga0207707_10000410 3300025912 Bacteria 44977
590 Ga0207707_10017188 3300025912 Bacteria 6305
591 Ga0207707_10025066 3300025912 Bacteria 5218
592 Ga0207707_10059190 3300025912 Bacteria 3333
593 Ga0207707_10075513 3300025912 Bacteria 2941
594 Ga0207707_10181062 3300025912 Bacteria 1840
595 Ga0207707_10790462 3300025912 Unclassified 791
596 Ga0207695_10003442 3300025913 Bacteria 22318
597 Ga0207695_10042133 3300025913 Bacteria 4880
598 Ga0207695_10049612 3300025913 Bacteria 4423
599 Ga0207695_10052562 3300025913 Bacteria 4267
600 Ga0207695_10072121 3300025913 Bacteria 3525
601 Ga0207695_10083172 3300025913 Bacteria 3234
602 Ga0207695_10097549 3300025913 Bacteria 2940
603 Ga0207695_10234878 3300025913 Bacteria 1736
604 Ga0207695_10317282 3300025913 Bacteria 1448
605 Ga0207695_10339792 3300025913 Bacteria 1389
606 Ga0207671_10010563 3300025914 Bacteria 7600
607 Ga0207671_10073947 3300025914 Bacteria 2546
608 Ga0207671_10157809 3300025914 Bacteria 1756
609 Ga0207671_10168779 3300025914 Bacteria 1698
610 Ga0207671_10190336 3300025914 Bacteria 1600
611 Ga0207671_11074785 3300025914 Bacteria 633
612 Ga0207693_10000448 3300025915 Bacteria 37696
613 Ga0207693_10126708 3300025915 Bacteria 2007
614 Ga0207693_10360999 3300025915 Bacteria 1137
615 Ga0207693_10481430 3300025915 Bacteria 969
616 Ga0207663_10030730 3300025916 Bacteria 3171
617 Ga0207663_10045973 3300025916 Bacteria 2688
618 Ga0207663_10112779 3300025916 Bacteria 1847
619 Ga0207663_10369763 3300025916 Bacteria 1090
620 Ga0207663_11285009 3300025916 Bacteria 589
621 Ga0207663_11458397 3300025916 Unclassified 551
622 Ga0207660_10002217 3300025917 Bacteria 12862
623 Ga0207660_10415405 3300025917 Bacteria 1085
624 Ga0207660_10441396 3300025917 Bacteria 1052
625 Ga0207662_10036401 3300025918 Bacteria 2876
626 Ga0207662_10201054 3300025918 Bacteria 1290
627 Ga0207657_10063277 3300025919 Bacteria 3164
628 Ga0207657_10218405 3300025919 Bacteria 1528
629 Ga0207649_10183146 3300025920 Bacteria 1467
630 Ga0207649_10584605 3300025920 Unclassified 857
631 Ga0207649_11147799 3300025920 Bacteria 613
632 Ga0207652_10003383 3300025921 Bacteria 13178
633 Ga0207652_10088779 3300025921 Bacteria 2713
634 Ga0207652_10266859 3300025921 Bacteria 1544
635 Ga0207646_10580829 3300025922 Bacteria 1006
636 Ga0207646_10803463 3300025922 Bacteria 838
637 Ga0207681_10003213 3300025923 Bacteria 10254
638 Ga0207681_10019048 3300025923 Bacteria 4332
639 Ga0207681_10071603 3300025923 Bacteria 2418
640 Ga0207681_11460364 3300025923 Bacteria 574
641 Ga0207694_10003326 3300025924 Bacteria 12785
642 Ga0207694_10850433 3300025924 Bacteria 771
643 Ga0207694_10855851 3300025924 Bacteria 768
644 Ga0207650_10000013 3300025925 Bacteria 409471
645 Ga0207650_10018767 3300025925 Bacteria 4857
646 Ga0207650_10054455 3300025925 Bacteria 2967
647 Ga0207650_10221148 3300025925 Bacteria 1524
648 Ga0207650_10653968 3300025925 Bacteria 886
649 Ga0207650_11325316 3300025925 Bacteria 613
650 Ga0207650_11625876 3300025925 Bacteria 548
651 Ga0207659_10061691 3300025926 Bacteria 2703
652 Ga0207687_10076669 3300025927 Bacteria 2402
653 Ga0207687_11273253 3300025927 Bacteria 632
654 Ga0207700_10003609 3300025928 Bacteria 9016
655 Ga0207700_10647428 3300025928 Bacteria 942
656 Ga0207700_10836972 3300025928 Bacteria 823
657 Ga0207700_10862520 3300025928 Bacteria 810
658 Ga0207700_11545406 3300025928 Bacteria 588
659 Ga0207664_10007010 3300025929 Bacteria 7803
660 Ga0207664_10051619 3300025929 Bacteria 3248
661 Ga0207664_10350438 3300025929 Bacteria 1307
662 Ga0207644_10000407 3300025931 Bacteria 28083
663 Ga0207644_10000428 3300025931 Bacteria 27319
664 Ga0207644_10004012 3300025931 Bacteria 9557
665 Ga0207644_10093201 3300025931 Bacteria 2248
666 Ga0207644_10179249 3300025931 Bacteria 1659
667 Ga0207644_10573836 3300025931 Bacteria 935
668 Ga0207644_11450954 3300025931 Bacteria 576
669 Ga0207690_10156897 3300025932 Bacteria 1693
670 Ga0207706_10375437 3300025933 Bacteria 1234
671 Ga0207706_10498430 3300025933 Bacteria 1051
672 Ga0207706_10597721 3300025933 Bacteria 948
673 Ga0207706_11133911 3300025933 Bacteria 652
674 Ga0207706_11570495 3300025933 Bacteria 534
675 Ga0207686_10005014 3300025934 Bacteria 7128
676 Ga0207686_10007583 3300025934 Bacteria 5844
677 Ga0207686_10072816 3300025934 Bacteria 2215
678 Ga0207686_10255208 3300025934 Bacteria 1283
679 Ga0207686_11085111 3300025934 Unclassified 652
680 Ga0207709_10431056 3300025935 Bacteria 1015
681 Ga0207670_10126684 3300025936 Bacteria 1864
682 Ga0207670_10684398 3300025936 Bacteria 848
683 Ga0207670_10703399 3300025936 Bacteria 837
684 Ga0207670_11102066 3300025936 Bacteria 670
685 Ga0207670_11875155 3300025936 Unclassified 510
686 Ga0207669_10068174 3300025937 Bacteria 2220
687 Ga0207669_10419872 3300025937 Bacteria 1052
688 Ga0207704_10002424 3300025938 Bacteria 8388
689 Ga0207704_10014528 3300025938 Bacteria 3978
690 Ga0207704_10040967 3300025938 Bacteria 2712
691 Ga0207704_10188426 3300025938 Bacteria 1498
692 Ga0207704_11518336 3300025938 Bacteria 575
693 Ga0207665_10035902 3300025939 Bacteria 3293
694 Ga0207665_10088305 3300025939 Bacteria 2145
695 Ga0207691_10049133 3300025940 Bacteria 3865
696 Ga0207691_10104939 3300025940 Bacteria 2518
697 Ga0207691_10242604 3300025940 Bacteria 1557
698 Ga0207691_10308562 3300025940 Bacteria 1358
699 Ga0207691_10726901 3300025940 Bacteria 836
700 Ga0207691_11290328 3300025940 Bacteria 603
701 Ga0207711_10000194 3300025941 Bacteria 65127
702 Ga0207711_10004185 3300025941 Bacteria 12357
703 Ga0207711_10116126 3300025941 Bacteria 2385
704 Ga0207711_10159847 3300025941 Bacteria 2038
705 Ga0207711_11059250 3300025941 Bacteria 751
706 Ga0207689_10127570 3300025942 Bacteria 2092
707 Ga0207689_10224281 3300025942 Bacteria 1553
708 Ga0207689_10232116 3300025942 Bacteria 1525
709 Ga0207689_10460341 3300025942 Bacteria 1063
710 Ga0207689_11099186 3300025942 Bacteria 670
711 Ga0207661_10649510 3300025944 Bacteria 969
712 Ga0207679_10093035 3300025945 Bacteria 2337
713 Ga0207679_10127063 3300025945 Bacteria 2039
714 Ga0207679_10268843 3300025945 Bacteria 1457
715 Ga0207679_10564397 3300025945 Bacteria 1022
716 Ga0207679_10948619 3300025945 Bacteria 788
717 Ga0207679_11280853 3300025945 Bacteria 673
718 Ga0207679_11886660 3300025945 Bacteria 545
719 Ga0207667_10008242 3300025949 Bacteria 12403
720 Ga0207667_10014175 3300025949 Bacteria 9098
721 Ga0207667_10048865 3300025949 Bacteria 4472
722 Ga0207667_10617984 3300025949 Bacteria 1091
723 Ga0207667_10914561 3300025949 Unclassified 869
724 Ga0207667_11023502 3300025949 Bacteria 812
725 Ga0207667_12244332 3300025949 Bacteria 502
726 Ga0207651_10007788 3300025960 Bacteria 5729
727 Ga0207651_10025701 3300025960 Bacteria 3665
728 Ga0207651_10049602 3300025960 Bacteria 2845
729 Ga0207651_10056314 3300025960 Bacteria 2705
730 Ga0207651_10312895 3300025960 Bacteria 1310
731 Ga0207651_11776303 3300025960 Bacteria 555
732 Ga0207712_10274654 3300025961 Bacteria 1373
733 Ga0207712_11349038 3300025961 Bacteria 638
734 Ga0207668_10008346 3300025972 Bacteria 6168
735 Ga0207668_10264120 3300025972 Bacteria 1404
736 Ga0207668_10498202 3300025972 Bacteria 1047
737 Ga0207668_10544631 3300025972 Bacteria 1004
738 Ga0207640_10264980 3300025981 Bacteria 1341
739 Ga0207640_10361518 3300025981 Bacteria 1170
740 Ga0207640_10419821 3300025981 Bacteria 1094
741 Ga0207640_10785089 3300025981 Bacteria 824
742 Ga0207640_11145885 3300025981 Bacteria 689
743 Ga0207658_10000005 3300025986 Bacteria 408341
744 Ga0207658_10004751 3300025986 Bacteria 9405
745 Ga0207658_10108411 3300025986 Bacteria 2190
746 Ga0207658_10175447 3300025986 Bacteria 1769
747 Ga0207658_10437648 3300025986 Bacteria 1156
748 Ga0207658_10625449 3300025986 Bacteria 969
749 Ga0207658_10793713 3300025986 Bacteria 859
750 Ga0207658_11262300 3300025986 Bacteria 675
751 Ga0207677_10017062 3300026023 Bacteria 4318
752 Ga0207677_10020677 3300026023 Bacteria 4002
753 Ga0207677_10703153 3300026023 Bacteria 897
754 Ga0207677_11066414 3300026023 Bacteria 735
755 Ga0207703_10001524 3300026035 Bacteria 21042
756 Ga0207703_10019203 3300026035 Bacteria 5338
757 Ga0207703_10024678 3300026035 Bacteria 4730
758 Ga0207703_10050143 3300026035 Bacteria 3377
759 Ga0207703_10235714 3300026035 Bacteria 1643
760 Ga0207703_10347890 3300026035 Bacteria 1364
761 Ga0207639_10699382 3300026041 Bacteria 940
762 Ga0207639_11770732 3300026041 Bacteria 578
763 Ga0207639_11950144 3300026041 Bacteria 548
764 Ga0207678_10005556 3300026067 Bacteria 11267
765 Ga0207678_10267753 3300026067 Bacteria 1465
766 Ga0207678_10276992 3300026067 Bacteria 1439
767 Ga0207678_10372903 3300026067 Bacteria 1233
768 Ga0207678_11429764 3300026067 Bacteria 611
769 Ga0207708_10036414 3300026075 Bacteria 3746
770 Ga0207708_10047577 3300026075 Bacteria 3265
771 Ga0207708_10405882 3300026075 Bacteria 1128
772 Ga0207702_10043700 3300026078 Bacteria 3764
773 Ga0207702_10086751 3300026078 Bacteria 2730
774 Ga0207702_10128657 3300026078 Bacteria 2276
775 Ga0207702_11220565 3300026078 Bacteria 746
776 Ga0207702_11309893 3300026078 Bacteria 718
777 Ga0207641_10002325 3300026088 Bacteria 17632
778 Ga0207641_10003553 3300026088 Bacteria 13779
779 Ga0207641_10009230 3300026088 Bacteria 8134
780 Ga0207641_10010988 3300026088 Bacteria 7422
781 Ga0207641_10029923 3300026088 Bacteria 4505
782 Ga0207641_10106203 3300026088 Bacteria 2481
783 Ga0207641_10235301 3300026088 Bacteria 1704
784 Ga0207641_10623681 3300026088 Bacteria 1057
785 Ga0207641_11812483 3300026088 Bacteria 612
786 Ga0207648_10052141 3300026089 Bacteria 3577
787 Ga0207648_10052679 3300026089 Bacteria 3558
788 Ga0207648_10307642 3300026089 Bacteria 1422
789 Ga0207648_10388734 3300026089 Bacteria 1262
790 Ga0207648_10407117 3300026089 Bacteria 1233
791 Ga0207648_12189707 3300026089 Bacteria 514
792 Ga0207676_10000010 3300026095 Bacteria 519402
793 Ga0207676_10038749 3300026095 Bacteria 3640
794 Ga0207676_10363333 3300026095 Bacteria 1342
795 Ga0207676_11224328 3300026095 Bacteria 744
796 Ga0207676_11780453 3300026095 Bacteria 614
797 Ga0207674_10272624 3300026116 Bacteria 1640
798 Ga0207674_10326743 3300026116 Bacteria 1483
799 Ga0207674_10663830 3300026116 Bacteria 1007
800 Ga0207674_10856467 3300026116 Bacteria 876
801 Ga0207675_100080055 3300026118 Bacteria 3062
802 Ga0207675_100132610 3300026118 Bacteria 2362
803 Ga0207675_100142749 3300026118 Bacteria 2275
804 Ga0207675_100375270 3300026118 Bacteria 1398
805 Ga0207675_100632434 3300026118 Bacteria 1075
806 Ga0207675_101701120 3300026118 Bacteria 651
807 Ga0207675_102258542 3300026118 Bacteria 558
808 Ga0207683_10002499 3300026121 Bacteria 16042
809 Ga0207683_10022992 3300026121 Bacteria 5358
810 Ga0207683_10141534 3300026121 Bacteria 2168
811 Ga0207698_10091691 3300026142 Bacteria 2488
812 Ga0207698_10257621 3300026142 Bacteria 1601
813 Ga0207698_10433276 3300026142 Bacteria 1265
814 Ga0207698_10610020 3300026142 Bacteria 1077
815 Ga0207698_11385002 3300026142 Bacteria 718
816 Ga0207698_11670797 3300026142 Bacteria 652
817 Ga0209179_1000094 3300027512 Bacteria 12638
818 Ga0209179_1000174 3300027512 Bacteria 6081
819 Ga0209588_1045050 3300027671 Bacteria 1427
820 Ga0209813_10164941 3300027866 Bacteria 801
821 Ga0265356_1000652 3300028017 Bacteria 6018
822 Ga0265357_1035170 3300028023 Bacteria 579
823 Ga0268266_10000943 3300028379 Bacteria 37110
824 Ga0268266_10002538 3300028379 Bacteria 19391
825 Ga0268266_10005009 3300028379 Bacteria 12515
826 Ga0268266_10010307 3300028379 Bacteria 8174
827 Ga0268266_10013518 3300028379 Bacteria 7028
828 Ga0268266_10018044 3300028379 Bacteria 6013
829 Ga0268266_10019459 3300028379 Bacteria 5783
830 Ga0268266_10078059 3300028379 Bacteria 2880
831 Ga0268266_10082273 3300028379 Bacteria 2808
832 Ga0268266_10165713 3300028379 Bacteria 2002
833 Ga0268266_10421058 3300028379 Bacteria 1265
834 Ga0268266_10925547 3300028379 Bacteria 843
835 Ga0268266_11493521 3300028379 Bacteria 651
836 Ga0268266_11521321 3300028379 Bacteria 645
837 Ga0268265_10000383 3300028380 Bacteria 47354
838 Ga0268265_10056316 3300028380 Bacteria 2990
839 Ga0268265_10144177 3300028380 Bacteria 1998
840 Ga0268265_10246003 3300028380 Bacteria 1581
841 Ga0268265_10499903 3300028380 Bacteria 1145
842 Ga0268265_10653004 3300028380 Bacteria 1011
843 Ga0268264_10000036 3300028381 Bacteria 392994
844 Ga0268264_10000102 3300028381 Bacteria 222526
845 Ga0268264_10011424 3300028381 Bacteria 7332
846 Ga0268264_10013393 3300028381 Bacteria 6749
847 Ga0268264_10085143 3300028381 Bacteria 2713
848 Ga0268264_10200275 3300028381 Bacteria 1826
849 Ga0268264_10256879 3300028381 Bacteria 1626
850 Ga0268264_10909714 3300028381 Bacteria 883
851 Ga0268264_11527368 3300028381 Bacteria 678
852 Ga0268264_12206416 3300028381 Bacteria 558
853 Ga0268264_12206752 3300028381 Bacteria 558
854 Ga0265326_10147255 3300028558 Bacteria 672
855 Ga0265319_1002761 3300028563 Bacteria 9412
856 Ga0265334_10000272 3300028573 Bacteria 29197
857 Ga0265334_10001026 3300028573 Bacteria 13760
858 Ga0265334_10104489 3300028573 Bacteria 1022
859 Ga0265318_10000228 3300028577 Bacteria 48687
860 Ga0265336_10019649 3300028666 Bacteria 2178
861 Ga0307517_10266356 3300028786 Bacteria 990
862 Ga0307515_10034640 3300028794 Bacteria 8252
863 Ga0307515_10711569 3300028794 Bacteria 621
864 Ga0307515_10840440 3300028794 Bacteria 544
865 Ga0265338_10005919 3300028800 Bacteria 15752
866 Ga0265338_10016309 3300028800 Bacteria 8091
867 Ga0265338_10124432 3300028800 Bacteria 2049
868 Ga0265338_10145015 3300028800 Bacteria 1853
869 Ga0265338_10320714 3300028800 Bacteria 1122
870 Ga0307511_10000235 3300030521 Bacteria 56564
871 Ga0307511_10056308 3300030521 Bacteria 3076
872 Ga0307511_10182269 3300030521 Bacteria 1129
873 Ga0265770_1000452 3300030878 Bacteria 5652
874 Ga0265771_1003521 3300031010 Bacteria 906
875 Ga0265773_1003029 3300031018 Bacteria 1072
876 Ga0265760_10001436 3300031090 Bacteria 7017
877 Ga0265760_10016486 3300031090 Bacteria 2120
878 Ga0265330_10004229 3300031235 Bacteria 7321
879 Ga0265330_10027214 3300031235 Bacteria 2584
880 Ga0265332_10001037 3300031238 Bacteria 16333
881 Ga0265332_10086955 3300031238 Bacteria 1324
882 Ga0265332_10356677 3300031238 Bacteria 603
883 Ga0265328_10002988 3300031239 Bacteria 7548
884 Ga0265328_10003225 3300031239 Bacteria 7230
885 Ga0265328_10029110 3300031239 Bacteria 2065
886 Ga0265328_10122277 3300031239 Bacteria 971
887 Ga0265328_10197442 3300031239 Bacteria 763
888 Ga0265320_10004080 3300031240 Bacteria 9592
889 Ga0265320_10083511 3300031240 Bacteria 1488
890 Ga0265320_10367736 3300031240 Bacteria 635
891 Ga0265320_10430262 3300031240 Bacteria 583
892 Ga0265325_10005189 3300031241 Bacteria 8094
893 Ga0265329_10001451 3300031242 Bacteria 11427
894 Ga0265340_10013162 3300031247 Bacteria 4354
895 Ga0265340_10020617 3300031247 Bacteria 3384
896 Ga0265340_10040021 3300031247 Bacteria 2310
897 Ga0265340_10180734 3300031247 Bacteria 953
898 Ga0265340_10233383 3300031247 Bacteria 822
899 Ga0265340_10533645 3300031247 Bacteria 516
900 Ga0265339_10014355 3300031249 Bacteria 4775
901 Ga0265331_10004429 3300031250 Bacteria 8774
902 Ga0265331_10018795 3300031250 Bacteria 3575
903 Ga0265331_10149262 3300031250 Bacteria 1062
904 Ga0265327_10000005 3300031251 Bacteria 790146
905 Ga0265316_10013033 3300031344 Bacteria 7415
906 Ga0265316_10277063 3300031344 Bacteria 1226
907 Ga0265316_10800381 3300031344 Bacteria 661
908 Ga0307513_10007825 3300031456 Bacteria 13780
909 Ga0307513_10044257 3300031456 Bacteria 4878
910 Ga0307513_10058418 3300031456 Bacteria 4100
911 Ga0307513_10847699 3300031456 Bacteria 620
912 Ga0307509_10565722 3300031507 Bacteria 813
913 Ga0307408_100021417 3300031548 Bacteria 4375
914 Ga0307408_100293830 3300031548 Bacteria 1358
915 Ga0307408_100469453 3300031548 Bacteria 1095
916 Ga0307408_100595029 3300031548 Bacteria 982
917 Ga0265313_10001786 3300031595 Bacteria 19657
918 Ga0265313_10438966 3300031595 Bacteria 508
919 Ga0307508_10111635 3300031616 Bacteria 2334
920 Ga0307514_10104256 3300031649 Bacteria 2029
921 Ga0265314_10005233 3300031711 Bacteria 11760
922 Ga0265314_10174330 3300031711 Bacteria 1295
923 Ga0265314_10481917 3300031711 Bacteria 656
924 Ga0265342_10002379 3300031712 Bacteria 16291
925 Ga0307516_10398880 3300031730 Bacteria 1035
926 Ga0307516_10507748 3300031730 Bacteria 860
927 Ga0307516_10511254 3300031730 Bacteria 855
928 Ga0307405_10286534 3300031731 Bacteria 1243
929 Ga0307405_10640466 3300031731 Bacteria 873
930 Ga0307405_10783047 3300031731 Bacteria 797
931 Ga0307413_10001429 3300031824 Bacteria 9034
932 Ga0307413_10035769 3300031824 Bacteria 2852
933 Ga0307413_10180497 3300031824 Bacteria 1504
934 Ga0307413_10206648 3300031824 Bacteria 1422
935 Ga0307410_10002645 3300031852 Bacteria 8733
936 Ga0307410_10718460 3300031852 Bacteria 843
937 Ga0307410_10762095 3300031852 Bacteria 820
938 Ga0307406_10214883 3300031901 Bacteria 1425
939 Ga0307406_10862465 3300031901 Bacteria 768
940 Ga0307406_11779662 3300031901 Bacteria 547
941 Ga0307407_10007323 3300031903 Bacteria 4990
942 Ga0307407_10367805 3300031903 Bacteria 1023
943 Ga0307407_10401641 3300031903 Bacteria 983
944 Ga0307412_10275217 3300031911 Bacteria 1319
945 Ga0307412_10300299 3300031911 Bacteria 1269
946 Ga0307409_100008471 3300031995 Bacteria 6245
947 Ga0307409_100018987 3300031995 Bacteria 4642
948 Ga0307409_100067110 3300031995 Bacteria 2831
949 Ga0307409_100072562 3300031995 Bacteria 2742
950 Ga0307409_100623909 3300031995 Bacteria 1068
951 Ga0307416_100218253 3300032002 Bacteria 1826
952 Ga0307416_100553375 3300032002 Bacteria 1224
953 Ga0307416_100764931 3300032002 Bacteria 1059
954 Ga0307416_101433336 3300032002 Bacteria 796
955 Ga0307416_103094738 3300032002 Bacteria 556
956 Ga0307416_103768426 3300032002 Bacteria 507
957 Ga0307414_10283564 3300032004 Bacteria 1393
958 Ga0307411_10001998 3300032005 Bacteria 8755
959 Ga0307411_10034772 3300032005 Bacteria 3139
960 Ga0307411_10354795 3300032005 Bacteria 1197
961 Ga0307411_10535613 3300032005 Bacteria 996
962 Ga0307411_11420539 3300032005 Bacteria 636
963 Ga0307415_100068825 3300032126 Bacteria 2479
964 Ga0307415_100098172 3300032126 Bacteria 2140
965 Ga0307415_100210379 3300032126 Bacteria 1551
966 Ga0307415_100843478 3300032126 Bacteria 840
967 Ga0307415_102202861 3300032126 Bacteria 539
968 Ga0307507_10414909 3300033179 Bacteria 759
969 Ga0307510_10000006 3300033180 Bacteria 566474
970 Ga0307510_10029950 3300033180 Bacteria 6180
971 Ga0307510_10083840 3300033180 Bacteria 3074
972 Ga0373928_0116950 3300035084 Bacteria 711
973 Ga0373934_0198021 3300035086 Bacteria 827
974 Ga0373944_0040350 3300035089 Bacteria 1440
975 Ga0373952_0094250 3300035092 Bacteria 782
976 Ga0373923_0030963 3300035111 Bacteria 2154
977 Ga0373923_0093456 3300035111 Bacteria 1319
978 Ga0373936_0035525 3300035113 Bacteria 1984
979 Ga0373936_0036445 3300035113 Bacteria 1962
980 Ga0373936_0068071 3300035113 Bacteria 1464
981 Ga0373936_0384330 3300035113 Bacteria 643
982 Ga0373936_0431473 3300035113 Bacteria 608
983 Ga0373936_0582413 3300035113 Bacteria 525
984 Ga0373939_0195557 3300035114 Bacteria 762
985 Ga0373945_0139007 3300035116 Bacteria 978
986 Ga0373945_0229516 3300035116 Bacteria 779
987 Ga0373953_0270691 3300035117 Bacteria 740
988 Ga0373953_0288935 3300035117 Bacteria 715
989 Ga0373954_0124223 3300035118 Bacteria 1254
990 Ga0373956_0132597 3300035119 Bacteria 1167
991 Ga0373957_0044948 3300035120 Bacteria 1672
992 Ga0373957_0057320 3300035120 Bacteria 1502
993 Ga0373960_0227138 3300035121 Bacteria 670
994 Ga0373943_0114904 3300035170 Bacteria 1424
995 Ga0373943_0404474 3300035170 Bacteria 788
996 Ga0373946_0057466 3300035171 Bacteria 1646
997 Ga0373946_0323051 3300035171 Bacteria 767
998 Ga0373955_0018160 3300035172 Bacteria 3494
999 Ga0373955_0018691 3300035172 Bacteria 3452
1000 Ga0373955_0046500 3300035172 Bacteria 2346
1001 Ga0373955_0714756 3300035172 Bacteria 615
1002 Ga0373955_0835562 3300035172 Bacteria 566
1003 Ga0373942_0133951 3300035207 Bacteria 784
1004 Ga0373961_0201024 3300035241 Bacteria 703
1005 Ga0373931_0677189 3300035691 Bacteria 680
1006 Ga0373935_0338218 3300035692 Bacteria 1071
1007 Ga0373935_0930979 3300035692 Bacteria 644
1008 Ga0373927_0009161 3300035695 Bacteria 6644
1009 Ga0373933_0134605 3300035724 Bacteria 1556
1010 Ga0373933_0663875 3300035724 Bacteria 685
1011 Ga0373933_0815132 3300035724 Bacteria 614
1012 Ga0373933_0985631 3300035724 Bacteria 555
1013 Ga0373947_0254326 3300035725 Bacteria 1162
1014 Ga0373947_0716259 3300035725 Bacteria 683
1015 Ga0373937_0065988 3300036401 Bacteria 3332
1016 Ga0373937_0086972 3300036401 Bacteria 2892
1017 Ga0373937_0107062 3300036401 Bacteria 2599
1018 Ga0373937_0120811 3300036401 Bacteria 2441
1019 Ga0373937_0241467 3300036401 Bacteria 1702
1020 Ga0373937_1298504 3300036401 Bacteria 676
1021 Ga0373925_0026649 3300037068 Bacteria 4230
1022 Ga0373925_0747219 3300037068 Bacteria 806
1023 Ga0395899_0377597 3300037312 Bacteria 943
1024 Ga0395900_0328446 3300037418 Bacteria 1508
1025 Ga0395898_0014841 3300037466 Bacteria 7998
1026 Ga0395898_0039994 3300037466 Bacteria 4639
1027 Ga0395898_0742163 3300037466 Bacteria 923
1028 Ga0436364_0966198 3300037853 Bacteria 1000
1029 Ga0436364_1119394 3300037853 Bacteria 1000
1030 Ga0436365_0032067 3300039437 Bacteria 3787
1031 Ga0436365_0123496 3300039437 Bacteria 3393
1032 Ga0436365_0309009 3300039437 Bacteria 1091
1033 Ga0436365_0574996 3300039437 Bacteria 738
1034 Ga0436365_0588607 3300039437 Bacteria 729
1035 Ga0436365_1106216 3300039437 Bacteria 1073
1036 Ga0436365_1107339 3300039437 Bacteria 1102
1037 Ga0436365_1277090 3300039437 Bacteria 882
1038 Ga0436360_0226775 3300039438 Bacteria 2277
1039 Ga0436360_0397350 3300039438 Bacteria 1255
1040 Ga0436360_0552698 3300039438 Bacteria 830
1041 Ga0436360_0749057 3300039438 Bacteria 2001
1042 Ga0436360_0999940 3300039438 Unclassified 513
1043 Ga0436360_1375355 3300039438 Bacteria 1443
1044 Ga0436361_0031697 3300039447 Bacteria 733
1045 Ga0436361_0734175 3300039447 Bacteria 887
1046 Ga0436363_0052657 3300039450 Unclassified 617
1047 Ga0436363_0193457 3300039450 Bacteria 1244
1048 Ga0436363_0498253 3300039450 Bacteria 9613
1049 Ga0436363_0603378 3300039450 Bacteria 1047
1050 Ga0436363_0620486 3300039450 Bacteria 2806
1051 Ga0436363_0854207 3300039450 Bacteria 3337
1052 Ga0436363_1530821 3300039450 Bacteria 2990
1053 Ga0436362_0241992 3300039453 Bacteria 639
1054 Ga0436362_0610762 3300039453 Bacteria 787
1055 Ga0436362_0693496 3300039453 Bacteria 3146
1056 Ga0436362_0820035 3300039453 Bacteria 1513
1057 Ga0436362_1267612 3300039453 Bacteria 746
1058 Ga0439439_0151535 3300041406 Bacteria 659
1059 Ga0451787_619150 3300041441 Bacteria 592
1060 Ga0451789_0038452 3300041443 Bacteria 539
1061 Ga0451789_0348250 3300041443 Bacteria 671
1062 Ga0451791_0414676 3300041451 Bacteria 730
1063 Ga0451791_0421855 3300041451 Bacteria 872
1064 Ga0451791_1468289 3300041451 Bacteria 823
1065 Ga0451793_1713978 3300041452 Bacteria 861
1066 Ga0451797_0463910 3300041453 Bacteria 961
1067 Ga0451797_1066747 3300041453 Bacteria 895
1068 Ga0451797_1136816 3300041453 Bacteria 908
1069 Ga0451798_0614515 3300041458 Bacteria 758
1070 Ga0451800_0475520 3300041459 Bacteria 1521
1071 Ga0451802_1195489 3300041460 Bacteria 1135
1072 Ga0451807_0772385 3300041486 Bacteria 988
1073 Ga0451807_2713173 3300041486 Bacteria 852
1074 Ga0451835_0527541 3300041492 Bacteria 1016
1075 Ga0451837_0095635 3300041494 Bacteria 523
1076 Ga0451837_0361166 3300041494 Bacteria 856
1077 Ga0451839_0596168 3300041496 Bacteria 509
1078 Ga0451847_0947723 3300041503 Bacteria 767
1079 Ga0451849_1081235 3300041505 Bacteria 870
1080 Ga0451851_0606114 3300041507 Bacteria 632
1081 Ga0451843_0028636 3300041509 Bacteria 1011
1082 Ga0451853_0730695 3300041512 Bacteria 683
1083 Ga0451853_1933935 3300041512 Bacteria 706
1084 Ga0451853_2732029 3300041512 Bacteria 632
1085 Ga0439445_0180438 3300042004 Bacteria 620
1086 Ga0450890_010652 3300042127 Bacteria 1184
1087 Ga0450894_029561 3300042131 Bacteria 761
1088 Ga0450896_096353 3300042133 Bacteria 509
1089 Ga0450898_051332 3300042134 Bacteria 797
1090 Ga0439446_0167783 3300042156 Bacteria 729
1091 Ga0439446_0249342 3300042156 Bacteria 612
1092 Ga0439458_0102221 3300042157 Bacteria 745
1093 Ga0439434_0308825 3300042435 Bacteria 548
1094 Ga0439435_0010142 3300042436 Bacteria 2228
1095 Ga0439459_0133243 3300042438 Bacteria 636
1096 Ga0450916_025576 3300042530 Bacteria 834
1097 Ga0451577_0008727 3300042876 Bacteria 9827
1098 Ga0451577_0145274 3300042876 Bacteria 2132
1099 Ga0466969_0003941 3300044656 Bacteria 7881
1100 Ga0466969_0195423 3300044656 Bacteria 924
1101 Ga0466972_0472510 3300044658 Bacteria 589
1102 Ga0453683_0375398 3300044673 Bacteria 915
1103 Ga0466966_0002570 3300044684 Bacteria 11886
1104 Ga0466966_0015541 3300044684 Bacteria 5032
1105 Ga0466966_0484215 3300044684 Bacteria 744
1106 Ga0466961_0021828 3300044693 Bacteria 4118
1107 Ga0466964_0000625 3300044706 Bacteria 11251
1108 Ga0453684_0052092 3300044712 Bacteria 5356
1109 Ga0453684_0195515 3300044712 Bacteria 2362
1110 Ga0453684_0332911 3300044712 Bacteria 1716
1111 Ga0453684_0340103 3300044712 Bacteria 1695
1112 Ga0453684_2276575 3300044712 Unclassified 539
1113 Ga0466971_0001102 3300044719 Bacteria 11213
1114 Ga0466968_0018375 3300044735 Bacteria 2804
1115 Ga0466970_0283586 3300044765 Unclassified 932
1116 Ga0466957_0014712 3300044842 Bacteria 4559
1117 Ga0466959_0002822 3300045049 Bacteria 11197
1118 Ga0466959_0027151 3300045049 Bacteria 4246
1119 Ga0466959_0103445 3300045049 Bacteria 2037
1120 Ga0466959_0257685 3300045049 Bacteria 1201
1121 Ga0451576_0079035 3300045051 Bacteria 3422
1122 Ga0451576_0231550 3300045051 Bacteria 1930
1123 Ga0451576_0488431 3300045051 Bacteria 1293
1124 Ga0451576_0879117 3300045051 Bacteria 940
1125 Ga0451576_1507074 3300045051 Bacteria 699
1126 Ga0466967_0269226 3300045976 Bacteria 1632
1127 Ga0495617_066779 3300046452 Bacteria 1185
1128 Ga0495592_0259242 3300046454 Bacteria 1146
1129 Ga0495603_0163745 3300046455 Bacteria 1290
1130 Ga0495590_0063883 3300046457 Bacteria 1288
1131 Ga0495629_0159354 3300046459 Bacteria 1568
1132 Ga0495629_0235336 3300046459 Bacteria 1262
1133 Ga0495638_0020600 3300046460 Bacteria 4356
1134 Ga0495638_0023580 3300046460 Bacteria 4022
1135 Ga0495638_0074489 3300046460 Bacteria 2071
1136 Ga0495638_0116034 3300046460 Bacteria 1586
1137 Ga0495641_0101699 3300046461 Bacteria 1282
1138 Ga0495651_0986344 3300046462 Bacteria 512
1139 Ga0495650_0256828 3300046471 Bacteria 593
1140 Ga0495580_0992791 3300046472 Bacteria 535
1141 Ga0495582_0021138 3300046473 Bacteria 3564
1142 Ga0495582_0218917 3300046473 Bacteria 1089
1143 Ga0495639_0023140 3300046475 Bacteria 2729
1144 Ga0495664_0661920 3300046477 Bacteria 618
1145 Ga0495585_0124260 3300046492 Bacteria 1363
1146 Ga0495583_0022468 3300046506 Bacteria 3218
1147 Ga0495583_0142270 3300046506 Bacteria 998
1148 Ga0495583_0207707 3300046506 Bacteria 794
1149 Ga0495610_0096636 3300046512 Bacteria 1330
1150 Ga0495616_0006494 3300046513 Bacteria 7072
1151 Ga0495616_0093680 3300046513 Bacteria 1418
1152 Ga0495616_0338126 3300046513 Bacteria 629
1153 Ga0495618_0091215 3300046514 Bacteria 1948
1154 Ga0495618_0263098 3300046514 Bacteria 1080
1155 Ga0495620_0086369 3300046515 Bacteria 1263
1156 Ga0495628_0530413 3300046516 Bacteria 847
1157 Ga0495630_0140489 3300046517 Bacteria 1836
1158 Ga0495630_0656731 3300046517 Bacteria 803
1159 Ga0495630_0913251 3300046517 Bacteria 669
1160 Ga0495632_0093981 3300046519 Bacteria 1418
1161 Ga0495632_0113435 3300046519 Bacteria 1271
1162 Ga0495632_0123602 3300046519 Bacteria 1208
1163 Ga0495632_0489639 3300046519 Unclassified 531
1164 Ga0495637_0119817 3300046520 Bacteria 1014
1165 Ga0495663_0091107 3300046525 Bacteria 994
1166 Ga0495652_0220478 3300046529 Bacteria 1426
1167 Ga0495640_0102492 3300046533 Bacteria 1878
1168 Ga0495586_0869142 3300046535 Bacteria 520
1169 Ga0495587_0105962 3300046536 Bacteria 1617
1170 Ga0495598_0186638 3300046537 Bacteria 742
1171 Ga0495609_0186064 3300046538 Bacteria 873
1172 Ga0495597_0317500 3300046542 Bacteria 602
1173 Ga0495645_0354218 3300046543 Bacteria 945
1174 Ga0495645_0522972 3300046543 Bacteria 739
1175 Ga0495622_0117795 3300046557 Bacteria 1214
1176 Ga0495668_0164067 3300046616 Bacteria 1217
1177 Ga0495634_0149361 3300046642 Bacteria 1479
1178 Ga0495634_0227438 3300046642 Bacteria 1149
1179 Ga0495625_0020303 3300046660 Bacteria 5131
1180 Ga0495625_0102533 3300046660 Bacteria 1964
1181 Ga0495625_0138933 3300046660 Bacteria 1640
1182 Ga0495625_0220280 3300046660 Bacteria 1244
1183 Ga0495625_0377859 3300046660 Bacteria 890
1184 Ga0495625_0441025 3300046660 Bacteria 806
1185 Ga0495625_0595743 3300046660 Bacteria 664
1186 Ga0495659_0077302 3300046664 Bacteria 1257
1187 Ga0495599_0086546 3300046678 Bacteria 1957
1188 Ga0495599_0385745 3300046678 Bacteria 836
1189 Ga0495623_0376314 3300046679 Bacteria 769
1190 Ga0495647_0090860 3300046681 Bacteria 1252
1191 Ga0495647_0179329 3300046681 Bacteria 921
1192 Ga0495647_0180487 3300046681 Bacteria 918
1193 Ga0495658_0011888 3300046683 Bacteria 4392
1194 Ga0495658_0027894 3300046683 Bacteria 3043
1195 Ga0495658_0166619 3300046683 Bacteria 1362
1196 Ga0495613_0215026 3300046689 Bacteria 1351
1197 Ga0495613_0724512 3300046689 Bacteria 653
1198 Ga0495624_0670704 3300046690 Bacteria 616
1199 Ga0495670_0042455 3300046691 Bacteria 2269
1200 Ga0495670_0564651 3300046691 Bacteria 619
1201 Ga0495671_0253568 3300046692 Bacteria 849
1202 Ga0495671_0295587 3300046692 Bacteria 779
1203 Ga0495649_0509840 3300046694 Bacteria 598
1204 Ga0495589_0119441 3300046794 Bacteria 1270
1205 Ga0495589_0389293 3300046794 Bacteria 640
1206 Ga0495600_0123643 3300046809 Bacteria 1683
1207 Ga0495660_0528220 3300046810 Bacteria 502
1208 Ga0495604_0208301 3300047317 Bacteria 1352
1209 Ga0495604_0502222 3300047317 Bacteria 787
1210 Ga0495674_0250348 3300047319 Bacteria 1458
1211 Ga0495672_0312795 3300047320 Bacteria 740
1212 Ga0495672_0437206 3300047320 Bacteria 592
1213 Ga0495672_0555305 3300047320 Bacteria 503
1214 Ga0495680_0062566 3300047322 Bacteria 2861
1215 Ga0495680_0383518 3300047322 Bacteria 973
1216 Ga0495683_0243794 3300047323 Bacteria 792
1217 Ga0495683_0288146 3300047323 Bacteria 709
1218 Ga0495687_032507 3300047443 Bacteria 2380
1219 Ga0495675_0613493 3300047444 Bacteria 616
1220 Ga0495677_0276222 3300047445 Bacteria 659
1221 Ga0495673_0204943 3300047469 Bacteria 736
1222 Ga0495673_0242607 3300047469 Bacteria 660
1223 Ga0495684_0193885 3300047471 Bacteria 1501
1224 Ga0495686_0177695 3300047472 Bacteria 1235
1225 Ga0495602_0721799 3300048088 Bacteria 675
1226 Ga0495602_0984899 3300048088 Bacteria 557
1227 Ga0495626_0105620 3300048091 Bacteria 1224
1228 Ga0496100_0003550 3300048903 Bacteria 8145
1229 Ga0496100_0774048 3300048903 Bacteria 751
1230 Ga0496100_0965158 3300048903 Bacteria 670
1231 Ga0496100_1206157 3300048903 Bacteria 597
1232 Ga0496101_0018936 3300048904 Bacteria 4690
1233 Ga0496101_0777477 3300048904 Bacteria 755
1234 Ga0496101_1211394 3300048904 Bacteria 591
1235 Ga0496102_0006276 3300048905 Bacteria 10133
1236 Ga0496102_0162163 3300048905 Bacteria 2103
1237 Ga0496102_0199613 3300048905 Bacteria 1885
1238 Ga0496102_0397339 3300048905 Bacteria 1296
1239 Ga0496103_0004906 3300048906 Bacteria 8077
1240 Ga0496103_0425100 3300048906 Bacteria 853
1241 Ga0496103_0714653 3300048906 Bacteria 635
1242 Ga0496104_0000099 3300048907 Bacteria 84201
1243 Ga0496104_0043605 3300048907 Bacteria 4212
1244 Ga0496104_0054136 3300048907 Bacteria 3792
1245 Ga0496104_0327787 3300048907 Bacteria 1444
1246 Ga0496105_0000021 3300048908 Bacteria 164255
1247 Ga0496105_0003469 3300048908 Bacteria 11665
1248 Ga0496105_0010900 3300048908 Bacteria 7160
1249 Ga0496105_0686706 3300048908 Bacteria 787
1250 Ga0496106_0004678 3300048909 Bacteria 10148
1251 Ga0496106_0066543 3300048909 Bacteria 2745
1252 Ga0496106_0183397 3300048909 Bacteria 1662
1253 Ga0496106_0915163 3300048909 Bacteria 692
1254 Ga0496107_0001576 3300048910 Bacteria 14181
1255 Ga0496107_0039998 3300048910 Bacteria 3365
1256 Ga0496108_0002086 3300048911 Bacteria 15999
1257 Ga0496108_0140105 3300048911 Bacteria 2084
1258 Ga0496108_0168503 3300048911 Bacteria 1894
1259 Ga0496108_0397727 3300048911 Bacteria 1203
1260 Ga0496109_0006030 3300048912 Bacteria 10183
1261 Ga0496109_0618045 3300048912 Bacteria 1020
1262 Ga0496109_0653774 3300048912 Bacteria 988
1263 Ga0496110_0005639 3300048913 Bacteria 9824
1264 Ga0496111_0003878 3300048914 Bacteria 9354
1265 Ga0496112_0009054 3300048915 Bacteria 8943
1266 Ga0496112_0574714 3300048915 Bacteria 1060
1267 Ga0496112_0588092 3300048915 Bacteria 1045
1268 Ga0496112_1343895 3300048915 Bacteria 630
1269 Ga0496113_0106557 3300048916 Bacteria 2177
1270 Ga0496113_0536021 3300048916 Bacteria 939
1271 Ga0496114_0002220 3300048917 Bacteria 14800
1272 Ga0496114_0009046 3300048917 Bacteria 7897
1273 Ga0496114_0017246 3300048917 Bacteria 5825
1274 Ga0496114_1184832 3300048917 Bacteria 650
1275 Ga0496115_0005471 3300048918 Bacteria 9241
1276 Ga0496115_0137279 3300048918 Bacteria 2016
1277 Ga0496115_0201742 3300048918 Bacteria 1643
1278 Ga0496115_0259538 3300048918 Bacteria 1429
1279 Ga0496115_0355670 3300048918 Bacteria 1194
1280 Ga0496115_0884241 3300048918 Bacteria 690
1281 Ga0496116_0276692 3300048919 Bacteria 816
1282 Ga0496117_0548477 3300048920 Bacteria 551
1283 Ga0496118_0013267 3300048921 Bacteria 7811
1284 Ga0496118_0609783 3300048921 Bacteria 520
1285 Ga0496119_0281602 3300048922 Bacteria 826
1286 Ga0496119_0530017 3300048922 Bacteria 544
1287 Ga0496120_0269452 3300048923 Bacteria 791
1288 Ga0496120_0413403 3300048923 Bacteria 594
1289 Ga0496121_0000704 3300048924 Bacteria 62218
1290 Ga0496124_0370756 3300048927 Bacteria 1005
1291 Ga0496125_0005100 3300048928 Bacteria 14779
1292 Ga0496125_0050036 3300048928 Bacteria 3465
1293 Ga0496125_0124580 3300048928 Bacteria 1829
1294 Ga0496125_0419979 3300048928 Bacteria 775
1295 Ga0496126_0004928 3300048929 Bacteria 15582
1296 Ga0496126_0098679 3300048929 Bacteria 2559
1297 Ga0495682_0049136 3300049460 Bacteria 1537
1298 Ga0501031_0579094 3300049568 Bacteria 722
1299 Ga0501032_0186687 3300049569 Bacteria 1356
1300 Ga0501032_0911698 3300049569 Bacteria 553
1301 Ga0501032_1037062 3300049569 Bacteria 515
1302 Ga0501033_0049659 3300049570 Bacteria 3114
1303 Ga0501033_0290223 3300049570 Bacteria 1153
1304 Ga0501036_0023621 3300049572 Bacteria 5181
1305 Ga0501036_0048255 3300049572 Bacteria 3605
1306 Ga0501037_0024581 3300049573 Bacteria 4455
1307 Ga0501037_0071416 3300049573 Bacteria 2525
1308 Ga0501038_0015092 3300049574 Bacteria 7031
1309 Ga0501038_0090870 3300049574 Bacteria 2558
1310 Ga0501038_0189643 3300049574 Bacteria 1655
1311 Ga0501039_0021546 3300049575 Bacteria 4943
1312 Ga0501039_0115981 3300049575 Bacteria 2096
1313 Ga0501039_0451889 3300049575 Bacteria 1009
1314 Ga0501039_0702981 3300049575 Bacteria 790
1315 Ga0501040_0008066 3300049576 Bacteria 6839
1316 Ga0501040_0044091 3300049576 Bacteria 3040
1317 Ga0501041_0001598 3300049577 Bacteria 12636
1318 Ga0501041_0119305 3300049577 Bacteria 1638
1319 Ga0501042_0001373 3300049578 Bacteria 14288
1320 Ga0501042_0158721 3300049578 Bacteria 1631
1321 Ga0501043_0418507 3300049579 Bacteria 1010
1322 Ga0501046_0015243 3300049580 Bacteria 6464
1323 Ga0501046_0105554 3300049580 Bacteria 2157
1324 Ga0501047_0148132 3300049581 Bacteria 2224
1325 Ga0501047_0364875 3300049581 Bacteria 1280
1326 Ga0501048_0009558 3300049582 Bacteria 7281
1327 Ga0501048_0067468 3300049582 Bacteria 2528
1328 Ga0501048_0309943 3300049582 Bacteria 1124
1329 Ga0501067_0031483 3300049583 Bacteria 2943
1330 Ga0501067_0138286 3300049583 Bacteria 1356
1331 Ga0501067_0163247 3300049583 Bacteria 1241
1332 Ga0501068_0001465 3300049584 Bacteria 12558
1333 Ga0501068_0041518 3300049584 Bacteria 2764
1334 Ga0501068_0404347 3300049584 Bacteria 880
1335 Ga0501069_0392696 3300049585 Bacteria 820
1336 Ga0501070_0044235 3300049586 Bacteria 3706
1337 Ga0501071_0003527 3300049587 Bacteria 9786
1338 Ga0501071_0024289 3300049587 Bacteria 4238
1339 Ga0501071_0144858 3300049587 Bacteria 1770
1340 Ga0501072_0025385 3300049588 Bacteria 4617
1341 Ga0501072_0063312 3300049588 Bacteria 2917
1342 Ga0501073_0000525 3300049589 Bacteria 26880
1343 Ga0501073_0122379 3300049589 Bacteria 1803
1344 Ga0501074_0001124 3300049590 Bacteria 17502
1345 Ga0501074_0089815 3300049590 Bacteria 2200
1346 Ga0501074_0222352 3300049590 Bacteria 1344
1347 Ga0501075_0015597 3300049591 Bacteria 5453
1348 Ga0501075_0055471 3300049591 Bacteria 2981
1349 Ga0501075_0231797 3300049591 Bacteria 1408
1350 Ga0501076_0004639 3300049592 Bacteria 9791
1351 Ga0501076_0022764 3300049592 Bacteria 4818
1352 Ga0501076_0028505 3300049592 Bacteria 4336
1353 Ga0501077_0002875 3300049593 Bacteria 10325
1354 Ga0501077_0007629 3300049593 Bacteria 6677
1355 Ga0501077_0029086 3300049593 Bacteria 3512
1356 Ga0501221_202380 3300049704 Bacteria 552
1357 Ga0501229_020387 3300049706 Bacteria 877
1358 Ga0501079_0004772 3300049741 Bacteria 10039
1359 Ga0501079_0006996 3300049741 Bacteria 8503
1360 Ga0501079_0179169 3300049741 Bacteria 1653
1361 Ga0501080_0001373 3300049742 Bacteria 20360
1362 Ga0501080_0011395 3300049742 Bacteria 8144
1363 Ga0501080_0037660 3300049742 Bacteria 4517
1364 Ga0501080_0794587 3300049742 Bacteria 830
1365 Ga0501080_0865037 3300049742 Bacteria 790
1366 Ga0501080_1063857 3300049742 Bacteria 700
1367 Ga0501081_0006719 3300049743 Bacteria 7480
1368 Ga0501081_0018126 3300049743 Bacteria 4672
1369 Ga0501083_0004501 3300049744 Bacteria 9845
1370 Ga0501083_0032077 3300049744 Bacteria 3604
1371 Ga0501083_0067453 3300049744 Bacteria 2382
1372 Ga0501083_0079781 3300049744 Bacteria 2170
1373 Ga0501035_0416594 3300049822 Bacteria 1115
1374 Ga0501035_0532215 3300049822 Bacteria 964
1375 Ga0501035_0950616 3300049822 Bacteria 678
1376 Ga0501044_0413807 3300049823 Bacteria 1259
1377 Ga0501044_1078751 3300049823 Bacteria 673
1378 Ga0501045_0008747 3300049824 Bacteria 7062
1379 Ga0501045_0084307 3300049824 Bacteria 2344
1380 nmdc:mga00v17_416636_c1 3300050491 Bacteria 872
1381 nmdc:mga0k408_129650_c1 3300050493 Bacteria 1497
1382 nmdc:mga0k408_210024_c1 3300050493 Bacteria 1162
1383 nmdc:mga0k408_403038_c1 3300050493 Bacteria 814
1384 nmdc:mga0k408_620355_c1 3300050493 Bacteria 637
1385 nmdc:mga0k408_65172_c1 3300050493 Bacteria 2120
1386 nmdc:mga06z11_249605_c1 3300050494 Bacteria 1044
1387 nmdc:mga06z11_526216_c1 3300050494 Bacteria 717
1388 nmdc:mga04h51_191481_c1 3300050495 Bacteria 800
1389 nmdc:mga07m45_427265_c1 3300050496 Bacteria 768
1390 nmdc:mga07m45_463706_c1 3300050496 Bacteria 734
1391 nmdc:mga07m45_490894_c1 3300050496 Bacteria 711
1392 nmdc:mga07m45_826988_c1 3300050496 Bacteria 530
1393 nmdc:mga09592_404099_c1 3300050508 Bacteria 1180
1394 nmdc:mga0qj67_1159723_c1 3300050509 Bacteria 602
1395 nmdc:mga0qj67_1182304_c1 3300050509 Bacteria 595
1396 nmdc:mga08y16_397291_c1 3300050511 Bacteria 1411
1397 nmdc:mga0rr50_62474_c1 3300050513 Bacteria 2810
1398 nmdc:mga0a205_803976_c1 3300050515 Bacteria 788
1399 Ga0495601_0301989 3300053077 Bacteria 1043
1400 Ga0495601_0375658 3300053077 Bacteria 923
1401 Ga0495612_0422317 3300053078 Bacteria 607
1402 Ga0495655_0027539 3300053083 Bacteria 1349
1403 Ga0495619_0091313 3300053085 Bacteria 2062
1404 Ga0500644_0024450 3300053088 Bacteria 1847
1405 Ga0500644_0061778 3300053088 Bacteria 1322
1406 Ga0500644_0093414 3300053088 Bacteria 1130
1407 Ga0500646_0034024 3300053090 Bacteria 1412
1408 Ga0500583_0002507 3300053092 Bacteria 5535
1409 Ga0500583_0041097 3300053092 Bacteria 2098
1410 Ga0500641_0069032 3300053096 Bacteria 1484
1411 Ga0500641_0105565 3300053096 Bacteria 1210
1412 Ga0500641_0180809 3300053096 Bacteria 905
1413 Ga0500648_185932 3300053097 Bacteria 1063
1414 Ga0500569_074574 3300053109 Bacteria 1074
1415 Ga0500594_0090275 3300053118 Bacteria 929
1416 Ga0500597_287311 3300053120 Bacteria 661
1417 Ga0500621_165278 3300053126 Bacteria 817
1418 Ga0500621_239922 3300053126 Bacteria 616
1419 Ga0500623_241004 3300053127 Unclassified 616
1420 Ga0500642_0084229 3300053130 Bacteria 1464
1421 Ga0500642_0147518 3300053130 Bacteria 1104
1422 Ga0500652_095300 3300053131 Bacteria 1243
1423 Ga0500568_0017821 3300053139 Bacteria 3124
1424 Ga0500589_240462 3300053147 Bacteria 670
1425 Ga0500616_0000499 3300053153 Bacteria 50346
1426 Ga0500616_0007626 3300053153 Bacteria 6839
1427 Ga0500622_0003284 3300053156 Bacteria 10962
1428 Ga0500627_0283306 3300053158 Bacteria 727
1429 Ga0500630_113114 3300053159 Bacteria 1216
1430 Ga0500639_292615 3300053163 Bacteria 618
1431 Ga0500636_0329121 3300053177 Bacteria 739
1432 Ga0500637_0239922 3300053178 Bacteria 1016
1433 Ga0500611_066042 3300053727 Bacteria 869
1434 Ga0501084_0008704 3300054114 Bacteria 8394
1435 Ga0501084_0022568 3300054114 Bacteria 5252
1436 Ga0501084_0144399 3300054114 Bacteria 2004
1437 Ga0501084_1367973 3300054114 Bacteria 593
1438 Ga0590075_024840 3300059424 Bacteria 1505
1439 Ga0590075_092399 3300059424 Bacteria 785
1440 Ga0590077_032183 3300059426 Bacteria 1148
1441 Ga0590077_115504 3300059426 Bacteria 633
1442 Ga0587066_011018 3300059490 Bacteria 1318
1443 Ga0587070_211754 3300059491 Bacteria 521
1444 Ga0587073_0063602 3300059492 Bacteria 872
1445 Ga0587073_0206325 3300059492 Bacteria 592
1446 Ga0587077_005133 3300059493 Bacteria 1771
1447 Ga0587077_020561 3300059493 Bacteria 1162
1448 Ga0587080_004278 3300059503 Bacteria 1842
1449 Ga0587083_0015822 3300059505 Bacteria 1323
1450 Ga0587083_0029935 3300059505 Bacteria 1076
1451 Ga0587088_005875 3300059508 Bacteria 1633
1452 Ga0587090_007160 3300059510 Bacteria 1457
1453 Ga0587094_013915 3300059513 Bacteria 1093
1454 Ga0587106_017423 3300059605 Bacteria 1027
1455 Ga0587109_008544 3300059624 Bacteria 1584
1456 Ga0587128_094305 3300059630 Bacteria 618
1457 Ga0587130_039456 3300059631 Unclassified 567
1458 Ga0587062_011923 3300059639 Bacteria 1106
1459 Ga0587067_014519 3300059640 Bacteria 1264
1460 Ga0587067_021127 3300059640 Bacteria 1120
1461 Ga0587068_042614 3300059641 Bacteria 826
1462 Ga0587068_045700 3300059641 Bacteria 805
1463 Ga0587075_018539 3300059644 Bacteria 1011
1464 Ga0587076_014586 3300059645 Bacteria 1212
1465 Ga0587076_038507 3300059645 Bacteria 883
1466 Ga0587076_157098 3300059645 Bacteria 556
1467 Ga0587110_028294 3300059654 Bacteria 672
1468 Ga0587071_070132 3300060344 Bacteria 762
1469 Ga0587111_0035975 3300060346 Bacteria 1035
1470 Ga0587111_0190869 3300060346 Bacteria 575
1471 Ga0501082_0004231 3300060353 Bacteria 12537
1472 Ga0501082_0043889 3300060353 Bacteria 3857
1473 Ga0501082_0087089 3300060353 Bacteria 2694
1474 Ga0466962_0001207 3300061719 Bacteria 11873
1475 Ga0530510_0007174 3300061734 Bacteria 7756
1476 Ga0530510_0170978 3300061734 Bacteria 1609
1477 Ga0530510_0398438 3300061734 Bacteria 1037

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 2162886007 SwRhRL2b_contig_2458830 SwRhRL2b_0662.00000660 101
2 2162886007 SwRhRL2b_contig_305464 SwRhRL2b_0013.00005770 101
3 3300000546 LJNas_1009780 LJNas_10097802 101
4 3300003322 rootL2_10298515 rootL2_102985152 101
5 3300005295 Ga0065707_10083802 Ga0065707_1008380211 101
6 3300005327 Ga0070658_10257996 Ga0070658_102579962 101
7 3300005327 Ga0070658_10295114 Ga0070658_102951143 101
8 3300005328 Ga0070676_10073677 Ga0070676_100736773 101
9 3300005328 Ga0070676_10479439 Ga0070676_104794392 101
10 3300005328 Ga0070676_11028069 Ga0070676_110280691 101
11 3300005329 Ga0070683_100880746 Ga0070683_1008807462 101
12 3300005329 Ga0070683_100929438 Ga0070683_1009294382 101
13 3300005330 Ga0070690_100185153 Ga0070690_1001851532 101
14 3300005330 Ga0070690_100818035 Ga0070690_1008180351 101
15 3300005331 Ga0070670_100000015 Ga0070670_10000001516 101
16 3300005331 Ga0070670_100042316 Ga0070670_1000423168 101
17 3300005331 Ga0070670_100199450 Ga0070670_1001994502 101
18 3300005331 Ga0070670_100265999 Ga0070670_1002659993 101
19 3300005331 Ga0070670_100873049 Ga0070670_1008730492 101
20 3300005333 Ga0070677_10072009 Ga0070677_100720093 101
21 3300005333 Ga0070677_10097789 Ga0070677_100977893 101
22 3300005334 Ga0068869_100157158 Ga0068869_1001571584 101
23 3300005334 Ga0068869_100185294 Ga0068869_1001852944 101
24 3300005334 Ga0068869_100227172 Ga0068869_1002271722 101
25 3300005334 Ga0068869_100263074 Ga0068869_1002630742 101
26 3300005334 Ga0068869_100263844 Ga0068869_1002638442 101
27 3300005334 Ga0068869_100272095 Ga0068869_1002720951 101
28 3300005334 Ga0068869_100482335 Ga0068869_1004823351 101
29 3300005334 Ga0068869_100800604 Ga0068869_1008006042 101
30 3300005335 Ga0070666_10001446 Ga0070666_1000144616 101
31 3300005335 Ga0070666_10005025 Ga0070666_100050258 101
32 3300005335 Ga0070666_10007123 Ga0070666_100071239 101
33 3300005335 Ga0070666_10128706 Ga0070666_101287064 101
34 3300005335 Ga0070666_10520393 Ga0070666_105203931 101
35 3300005336 Ga0070680_100040283 Ga0070680_1000402839 101
36 3300005336 Ga0070680_100105088 Ga0070680_1001050881 101
37 3300005336 Ga0070680_100262924 Ga0070680_1002629244 101
38 3300005336 Ga0070680_100391830 Ga0070680_1003918303 101
39 3300005337 Ga0070682_100093827 Ga0070682_1000938275 101
40 3300005337 Ga0070682_100196386 Ga0070682_1001963864 101
41 3300005337 Ga0070682_100295777 Ga0070682_1002957773 101
42 3300005337 Ga0070682_100522069 Ga0070682_1005220691 101
43 3300005337 Ga0070682_101875204 Ga0070682_1018752041 101
44 3300005337 Ga0070682_101957885 Ga0070682_1019578852 101
45 3300005338 Ga0068868_100008294 Ga0068868_1000082945 101
46 3300005338 Ga0068868_100155721 Ga0068868_1001557213 101
47 3300005338 Ga0068868_100297572 Ga0068868_1002975723 101
48 3300005338 Ga0068868_100945844 Ga0068868_1009458441 101
49 3300005339 Ga0070660_100218304 Ga0070660_1002183043 101
50 3300005339 Ga0070660_100822022 Ga0070660_1008220222 101
51 3300005339 Ga0070660_101314308 Ga0070660_1013143081 101
52 3300005340 Ga0070689_100015417 Ga0070689_10001541710 101
53 3300005340 Ga0070689_100194297 Ga0070689_1001942974 101
54 3300005340 Ga0070689_100639427 Ga0070689_1006394272 101
55 3300005340 Ga0070689_100729449 Ga0070689_1007294492 101
56 3300005340 Ga0070689_101539914 Ga0070689_1015399141 101
57 3300005343 Ga0070687_100398813 Ga0070687_1003988132 101
58 3300005344 Ga0070661_100043750 Ga0070661_1000437504 101
59 3300005344 Ga0070661_100405968 Ga0070661_1004059682 101
60 3300005344 Ga0070661_100476134 Ga0070661_1004761343 101
61 3300005345 Ga0070692_10637538 Ga0070692_106375381 101
62 3300005347 Ga0070668_100015678 Ga0070668_10001567811 101
63 3300005347 Ga0070668_100304484 Ga0070668_1003044842 101
64 3300005347 Ga0070668_100553556 Ga0070668_1005535562 101
65 3300005347 Ga0070668_100701114 Ga0070668_1007011142 101
66 3300005347 Ga0070668_101105513 Ga0070668_1011055132 101
67 3300005353 Ga0070669_100004607 Ga0070669_10000460716 101
68 3300005353 Ga0070669_100068175 Ga0070669_1000681754 101
69 3300005353 Ga0070669_101167194 Ga0070669_1011671941 101
70 3300005354 Ga0070675_100604755 Ga0070675_1006047552 101
71 3300005354 Ga0070675_101450340 Ga0070675_1014503401 101
72 3300005354 Ga0070675_101542601 Ga0070675_1015426011 101
73 3300005354 Ga0070675_101975770 Ga0070675_1019757701 101
74 3300005355 Ga0070671_100000013 Ga0070671_10000001316 101
75 3300005355 Ga0070671_100003161 Ga0070671_10000316111 101
76 3300005355 Ga0070671_100005400 Ga0070671_10000540015 101
77 3300005355 Ga0070671_100024367 Ga0070671_1000243678 101
78 3300005355 Ga0070671_100043910 Ga0070671_1000439108 101
79 3300005355 Ga0070671_100194729 Ga0070671_1001947293 101
80 3300005355 Ga0070671_100289073 Ga0070671_1002890732 101
81 3300005355 Ga0070671_100968024 Ga0070671_1009680242 101
82 3300005355 Ga0070671_101230034 Ga0070671_1012300341 101
83 3300005356 Ga0070674_100459821 Ga0070674_1004598212 101
84 3300005356 Ga0070674_100875519 Ga0070674_1008755191 101
85 3300005356 Ga0070674_101181444 Ga0070674_1011814441 101
86 3300005364 Ga0070673_100069532 Ga0070673_1000695321 101
87 3300005364 Ga0070673_100126122 Ga0070673_1001261224 101
88 3300005364 Ga0070673_101085747 Ga0070673_1010857472 101
89 3300005365 Ga0070688_100001170 Ga0070688_1000011707 101
90 3300005365 Ga0070688_100100587 Ga0070688_1001005872 101
91 3300005365 Ga0070688_100224119 Ga0070688_1002241191 101
92 3300005365 Ga0070688_101429513 Ga0070688_1014295131 101
93 3300005366 Ga0070659_100912333 Ga0070659_1009123332 101
94 3300005366 Ga0070659_101332672 Ga0070659_1013326722 101
95 3300005367 Ga0070667_100000015 Ga0070667_100000015199 101
96 3300005367 Ga0070667_100012347 Ga0070667_10001234711 101
97 3300005367 Ga0070667_100052533 Ga0070667_1000525333 101
98 3300005367 Ga0070667_100055472 Ga0070667_1000554722 101
99 3300005367 Ga0070667_100129962 Ga0070667_1001299625 101
100 3300005367 Ga0070667_100246143 Ga0070667_1002461433 101
101 3300005367 Ga0070667_100332046 Ga0070667_1003320463 101
102 3300005367 Ga0070667_100361652 Ga0070667_1003616522 101
103 3300005367 Ga0070667_100496374 Ga0070667_1004963742 101
104 3300005367 Ga0070667_100907096 Ga0070667_1009070961 101
105 3300005367 Ga0070667_101053655 Ga0070667_1010536551 101
106 3300005367 Ga0070667_101650388 Ga0070667_1016503882 101
107 3300005434 Ga0070709_10009928 Ga0070709_100099287 101
108 3300005434 Ga0070709_10015515 Ga0070709_100155155 101
109 3300005434 Ga0070709_10540170 Ga0070709_105401702 101
110 3300005434 Ga0070709_11246486 Ga0070709_112464862 101
111 3300005435 Ga0070714_100009500 Ga0070714_1000095009 101
112 3300005435 Ga0070714_100039089 Ga0070714_1000390894 101
113 3300005435 Ga0070714_100118523 Ga0070714_1001185233 101
114 3300005436 Ga0070713_100001795 Ga0070713_10000179517 101
115 3300005436 Ga0070713_100006105 Ga0070713_10000610516 101
116 3300005436 Ga0070713_100143194 Ga0070713_1001431944 101
117 3300005436 Ga0070713_102210715 Ga0070713_1022107151 101
118 3300005437 Ga0070710_10218779 Ga0070710_102187792 101
119 3300005437 Ga0070710_10282913 Ga0070710_102829133 101
120 3300005437 Ga0070710_10284586 Ga0070710_102845863 101
121 3300005437 Ga0070710_10297749 Ga0070710_102977493 101
122 3300005437 Ga0070710_10439812 Ga0070710_104398122 101
123 3300005437 Ga0070710_10509940 Ga0070710_105099402 101
124 3300005438 Ga0070701_10012276 Ga0070701_100122763 101
125 3300005438 Ga0070701_10936903 Ga0070701_109369032 101
126 3300005438 Ga0070701_11077180 Ga0070701_110771802 101
127 3300005439 Ga0070711_100001465 Ga0070711_10000146514 101
128 3300005439 Ga0070711_100025752 Ga0070711_1000257525 101
129 3300005439 Ga0070711_100102588 Ga0070711_1001025882 101
130 3300005439 Ga0070711_101116594 Ga0070711_1011165942 101
131 3300005440 Ga0070705_100026638 Ga0070705_1000266382 101
132 3300005440 Ga0070705_100959165 Ga0070705_1009591651 101
133 3300005440 Ga0070705_101410545 Ga0070705_1014105451 101
134 3300005441 Ga0070700_100108314 Ga0070700_1001083143 101
135 3300005441 Ga0070700_100111081 Ga0070700_1001110813 101
136 3300005444 Ga0070694_100203816 Ga0070694_1002038162 101
137 3300005444 Ga0070694_100266569 Ga0070694_1002665693 101
138 3300005444 Ga0070694_101631334 Ga0070694_1016313341 101
139 3300005455 Ga0070663_100261291 Ga0070663_1002612913 101
140 3300005455 Ga0070663_100460622 Ga0070663_1004606222 101
141 3300005455 Ga0070663_100887224 Ga0070663_1008872242 101
142 3300005455 Ga0070663_100961791 Ga0070663_1009617911 101
143 3300005456 Ga0070678_100002594 Ga0070678_1000025948 101
144 3300005456 Ga0070678_100003045 Ga0070678_1000030454 101
145 3300005457 Ga0070662_100193386 Ga0070662_1001933863 101
146 3300005457 Ga0070662_100324196 Ga0070662_1003241963 101
147 3300005457 Ga0070662_100566273 Ga0070662_1005662732 101
148 3300005457 Ga0070662_101037380 Ga0070662_1010373802 101
149 3300005458 Ga0070681_10008976 Ga0070681_1000897612 101
150 3300005458 Ga0070681_10035786 Ga0070681_100357867 101
151 3300005458 Ga0070681_10048581 Ga0070681_100485818 101
152 3300005458 Ga0070681_10124955 Ga0070681_101249556 101
153 3300005458 Ga0070681_10226323 Ga0070681_102263234 101
154 3300005458 Ga0070681_10447630 Ga0070681_104476301 101
155 3300005458 Ga0070681_10857361 Ga0070681_108573612 101
156 3300005459 Ga0068867_100034823 Ga0068867_1000348237 101
157 3300005459 Ga0068867_100284808 Ga0068867_1002848082 101
158 3300005459 Ga0068867_100308681 Ga0068867_1003086813 101
159 3300005459 Ga0068867_100582762 Ga0068867_1005827622 101
160 3300005459 Ga0068867_102247104 Ga0068867_1022471041 101
161 3300005466 Ga0070685_10000104 Ga0070685_1000010415 101
162 3300005466 Ga0070685_10075272 Ga0070685_100752722 101
163 3300005466 Ga0070685_10359631 Ga0070685_103596311 101
164 3300005466 Ga0070685_10379550 Ga0070685_103795502 101
165 3300005466 Ga0070685_10694073 Ga0070685_106940731 101
166 3300005467 Ga0070706_100618727 Ga0070706_1006187272 101
167 3300005471 Ga0070698_100403358 Ga0070698_1004033582 101
168 3300005518 Ga0070699_100038586 Ga0070699_1000385864 101
169 3300005518 Ga0070699_101982475 Ga0070699_1019824751 101
170 3300005530 Ga0070679_100017288 Ga0070679_1000172882 101
171 3300005530 Ga0070679_100103898 Ga0070679_1001038981 101
172 3300005530 Ga0070679_100392779 Ga0070679_1003927791 101
173 3300005530 Ga0070679_100461063 Ga0070679_1004610631 101
174 3300005530 Ga0070679_100979079 Ga0070679_1009790792 101
175 3300005535 Ga0070684_100247020 Ga0070684_1002470202 101
176 3300005535 Ga0070684_100338267 Ga0070684_1003382673 101
177 3300005539 Ga0068853_100093611 Ga0068853_1000936117 101
178 3300005539 Ga0068853_100411250 Ga0068853_1004112503 101
179 3300005539 Ga0068853_100832908 Ga0068853_1008329082 101
180 3300005539 Ga0068853_102131749 Ga0068853_1021317492 101
181 3300005543 Ga0070672_100029396 Ga0070672_1000293968 101
182 3300005543 Ga0070672_100123866 Ga0070672_1001238664 101
183 3300005543 Ga0070672_101584022 Ga0070672_1015840222 101
184 3300005544 Ga0070686_100033543 Ga0070686_1000335438 101
185 3300005544 Ga0070686_100067091 Ga0070686_1000670912 101
186 3300005544 Ga0070686_100304762 Ga0070686_1003047621 101
187 3300005544 Ga0070686_100328730 Ga0070686_1003287302 101
188 3300005544 Ga0070686_100331701 Ga0070686_1003317011 101
189 3300005544 Ga0070686_100427149 Ga0070686_1004271491 101
190 3300005544 Ga0070686_101294030 Ga0070686_1012940301 101
191 3300005545 Ga0070695_100002554 Ga0070695_1000025545 101
192 3300005545 Ga0070695_100315217 Ga0070695_1003152171 101
193 3300005546 Ga0070696_100001443 Ga0070696_10000144316 101
194 3300005546 Ga0070696_100094917 Ga0070696_1000949173 101
195 3300005546 Ga0070696_100302416 Ga0070696_1003024163 101
196 3300005546 Ga0070696_100456680 Ga0070696_1004566802 101
197 3300005547 Ga0070693_100005307 Ga0070693_1000053074 101
198 3300005547 Ga0070693_100297442 Ga0070693_1002974423 101
199 3300005547 Ga0070693_100486805 Ga0070693_1004868052 101
200 3300005547 Ga0070693_100898563 Ga0070693_1008985632 101
201 3300005548 Ga0070665_100000175 Ga0070665_10000017599 101
202 3300005548 Ga0070665_100003465 Ga0070665_10000346512 101
203 3300005548 Ga0070665_100005442 Ga0070665_10000544213 101
204 3300005548 Ga0070665_100007665 Ga0070665_1000076657 101
205 3300005548 Ga0070665_100008007 Ga0070665_1000080072 101
206 3300005548 Ga0070665_100008860 Ga0070665_1000088608 101
207 3300005548 Ga0070665_100014481 Ga0070665_10001448111 101
208 3300005548 Ga0070665_100041345 Ga0070665_1000413451 101
209 3300005548 Ga0070665_100045273 Ga0070665_1000452738 101
210 3300005548 Ga0070665_100088333 Ga0070665_1000883335 101
211 3300005548 Ga0070665_100373744 Ga0070665_1003737444 101
212 3300005548 Ga0070665_101260584 Ga0070665_1012605842 101
213 3300005548 Ga0070665_101569949 Ga0070665_1015699492 101
214 3300005548 Ga0070665_101617870 Ga0070665_1016178701 101
215 3300005549 Ga0070704_100096958 Ga0070704_1000969582 101
216 3300005549 Ga0070704_101225118 Ga0070704_1012251182 101
217 3300005549 Ga0070704_101291132 Ga0070704_1012911321 101
218 3300005563 Ga0068855_100008308 Ga0068855_10000830813 101
219 3300005563 Ga0068855_100032357 Ga0068855_1000323572 101
220 3300005563 Ga0068855_100065515 Ga0068855_1000655153 101
221 3300005563 Ga0068855_100114994 Ga0068855_1001149945 101
222 3300005563 Ga0068855_100271336 Ga0068855_1002713365 101
223 3300005563 Ga0068855_100285468 Ga0068855_1002854681 101
224 3300005563 Ga0068855_100428146 Ga0068855_1004281461 101
225 3300005563 Ga0068855_100586554 Ga0068855_1005865541 101
226 3300005563 Ga0068855_100685966 Ga0068855_1006859663 101
227 3300005564 Ga0070664_100047403 Ga0070664_1000474036 101
228 3300005564 Ga0070664_100155787 Ga0070664_1001557874 101
229 3300005564 Ga0070664_100380435 Ga0070664_1003804352 101
230 3300005564 Ga0070664_101172709 Ga0070664_1011727092 101
231 3300005564 Ga0070664_101232379 Ga0070664_1012323792 101
232 3300005564 Ga0070664_101274042 Ga0070664_1012740422 101
233 3300005564 Ga0070664_101451379 Ga0070664_1014513792 101
234 3300005564 Ga0070664_101766471 Ga0070664_1017664712 101
235 3300005577 Ga0068857_100399905 Ga0068857_1003999053 101
236 3300005577 Ga0068857_100466980 Ga0068857_1004669803 101
237 3300005577 Ga0068857_101793026 Ga0068857_1017930262 101
238 3300005578 Ga0068854_100120736 Ga0068854_1001207364 101
239 3300005578 Ga0068854_100126961 Ga0068854_1001269614 101
240 3300005578 Ga0068854_100585414 Ga0068854_1005854142 101
241 3300005578 Ga0068854_100961944 Ga0068854_1009619442 101
242 3300005578 Ga0068854_101178647 Ga0068854_1011786471 101
243 3300005578 Ga0068854_101347674 Ga0068854_1013476742 101
244 3300005614 Ga0068856_100006458 Ga0068856_10000645819 101
245 3300005614 Ga0068856_100042931 Ga0068856_1000429314 101
246 3300005614 Ga0068856_100047430 Ga0068856_1000474305 101
247 3300005614 Ga0068856_100065387 Ga0068856_1000653875 101
248 3300005614 Ga0068856_101019825 Ga0068856_1010198252 101
249 3300005614 Ga0068856_101760333 Ga0068856_1017603332 101
250 3300005615 Ga0070702_100447241 Ga0070702_1004472412 101
251 3300005615 Ga0070702_100490995 Ga0070702_1004909951 101
252 3300005615 Ga0070702_101506072 Ga0070702_1015060721 101
253 3300005616 Ga0068852_100172880 Ga0068852_1001728805 101
254 3300005616 Ga0068852_100275903 Ga0068852_1002759031 101
255 3300005616 Ga0068852_100907747 Ga0068852_1009077472 101
256 3300005616 Ga0068852_102181017 Ga0068852_1021810171 101
257 3300005617 Ga0068859_100000641 Ga0068859_10000064116 101
258 3300005617 Ga0068859_100005854 Ga0068859_10000585413 101
259 3300005617 Ga0068859_100047020 Ga0068859_1000470205 101
260 3300005617 Ga0068859_100056515 Ga0068859_1000565155 101
261 3300005617 Ga0068859_100077312 Ga0068859_1000773125 101
262 3300005617 Ga0068859_100291710 Ga0068859_1002917101 101
263 3300005617 Ga0068859_100313859 Ga0068859_1003138593 101
264 3300005617 Ga0068859_101283777 Ga0068859_1012837772 101
265 3300005617 Ga0068859_103057760 Ga0068859_1030577602 101
266 3300005618 Ga0068864_100000056 Ga0068864_100000056100 101
267 3300005618 Ga0068864_100043033 Ga0068864_1000430338 101
268 3300005618 Ga0068864_100839782 Ga0068864_1008397822 101
269 3300005618 Ga0068864_100858896 Ga0068864_1008588962 101
270 3300005618 Ga0068864_101536866 Ga0068864_1015368662 101
271 3300005618 Ga0068864_101545628 Ga0068864_1015456282 101
272 3300005718 Ga0068866_10002031 Ga0068866_100020317 101
273 3300005718 Ga0068866_10091532 Ga0068866_100915322 101
274 3300005718 Ga0068866_10633009 Ga0068866_106330092 101
275 3300005718 Ga0068866_10784860 Ga0068866_107848602 101
276 3300005719 Ga0068861_100066380 Ga0068861_1000663801 101
277 3300005719 Ga0068861_100097092 Ga0068861_1000970924 101
278 3300005719 Ga0068861_100167386 Ga0068861_1001673863 101
279 3300005719 Ga0068861_100388924 Ga0068861_1003889242 101
280 3300005719 Ga0068861_101079416 Ga0068861_1010794162 101
281 3300005719 Ga0068861_101116219 Ga0068861_1011162192 101
282 3300005719 Ga0068861_101691155 Ga0068861_1016911552 101
283 3300005719 Ga0068861_102259291 Ga0068861_1022592912 101
284 3300005834 Ga0068851_10032527 Ga0068851_100325275 101
285 3300005834 Ga0068851_10351588 Ga0068851_103515882 101
286 3300005840 Ga0068870_10001674 Ga0068870_1000167414 101
287 3300005840 Ga0068870_10164633 Ga0068870_101646333 101
288 3300005840 Ga0068870_10629134 Ga0068870_106291341 101
289 3300005840 Ga0068870_10837143 Ga0068870_108371431 101
290 3300005841 Ga0068863_100008761 Ga0068863_10000876111 101
291 3300005841 Ga0068863_100069769 Ga0068863_1000697697 101
292 3300005841 Ga0068863_100075635 Ga0068863_1000756354 101
293 3300005841 Ga0068863_100154561 Ga0068863_1001545614 101
294 3300005841 Ga0068863_100156589 Ga0068863_1001565895 101
295 3300005841 Ga0068863_100181690 Ga0068863_1001816902 101
296 3300005841 Ga0068863_100368482 Ga0068863_1003684823 101
297 3300005841 Ga0068863_100649716 Ga0068863_1006497162 101
298 3300005841 Ga0068863_100731629 Ga0068863_1007316292 101
299 3300005841 Ga0068863_100936433 Ga0068863_1009364332 101
300 3300005841 Ga0068863_101486838 Ga0068863_1014868381 101
301 3300005841 Ga0068863_102334353 Ga0068863_1023343532 101
302 3300005842 Ga0068858_100000125 Ga0068858_10000012548 101
303 3300005842 Ga0068858_100004270 Ga0068858_10000427014 101
304 3300005842 Ga0068858_100031324 Ga0068858_1000313247 101
305 3300005842 Ga0068858_100054829 Ga0068858_1000548297 101
306 3300005842 Ga0068858_100130358 Ga0068858_1001303581 101
307 3300005842 Ga0068858_100143953 Ga0068858_1001439535 101
308 3300005842 Ga0068858_100458094 Ga0068858_1004580941 101
309 3300005842 Ga0068858_101216752 Ga0068858_1012167521 101
310 3300005842 Ga0068858_102467426 Ga0068858_1024674261 101
311 3300005843 Ga0068860_100002410 Ga0068860_10000241027 101
312 3300005843 Ga0068860_100006244 Ga0068860_1000062448 101
313 3300005843 Ga0068860_100009263 Ga0068860_10000926317 101
314 3300005843 Ga0068860_100010872 Ga0068860_10001087213 101
315 3300005843 Ga0068860_100074726 Ga0068860_1000747265 101
316 3300005843 Ga0068860_100125358 Ga0068860_1001253584 101
317 3300005843 Ga0068860_100987493 Ga0068860_1009874932 101
318 3300005843 Ga0068860_101441857 Ga0068860_1014418572 101
319 3300005843 Ga0068860_102036230 Ga0068860_1020362302 101
320 3300005843 Ga0068860_102307423 Ga0068860_1023074232 101
321 3300005844 Ga0068862_100008335 Ga0068862_1000083354 101
322 3300005844 Ga0068862_100065242 Ga0068862_1000652422 101
323 3300005844 Ga0068862_100098243 Ga0068862_1000982433 101
324 3300005844 Ga0068862_100145559 Ga0068862_1001455593 101
325 3300005844 Ga0068862_100198509 Ga0068862_1001985092 101
326 3300005844 Ga0068862_100344838 Ga0068862_1003448382 101
327 3300005844 Ga0068862_101189284 Ga0068862_1011892841 101
328 3300005937 Ga0081455_10008699 Ga0081455_1000869911 101
329 3300005983 Ga0081540_1179590 Ga0081540_11795902 101
330 3300006028 Ga0070717_10062172 Ga0070717_100621722 101
331 3300006042 Ga0075368_10226039 Ga0075368_102260392 101
332 3300006163 Ga0070715_10000668 Ga0070715_1000066815 101
333 3300006163 Ga0070715_10111151 Ga0070715_101111512 101
334 3300006173 Ga0070716_100004769 Ga0070716_1000047693 101
335 3300006173 Ga0070716_101570414 Ga0070716_1015704141 101
336 3300006175 Ga0070712_100001456 Ga0070712_10000145614 101
337 3300006175 Ga0070712_100044366 Ga0070712_1000443663 101
338 3300006175 Ga0070712_100057768 Ga0070712_1000577682 101
339 3300006175 Ga0070712_100156187 Ga0070712_1001561874 101
340 3300006175 Ga0070712_100311663 Ga0070712_1003116632 101
341 3300006175 Ga0070712_100371053 Ga0070712_1003710532 101
342 3300006177 Ga0075362_10545825 Ga0075362_105458252 101
343 3300006178 Ga0075367_10328708 Ga0075367_103287082 101
344 3300006178 Ga0075367_10857991 Ga0075367_108579912 101
345 3300006195 Ga0075366_10043507 Ga0075366_100435072 101
346 3300006195 Ga0075366_10096819 Ga0075366_100968193 101
347 3300006195 Ga0075366_10184479 Ga0075366_101844793 101
348 3300006195 Ga0075366_10344993 Ga0075366_103449931 101
349 3300006237 Ga0097621_100003525 Ga0097621_10000352513 101
350 3300006237 Ga0097621_100078362 Ga0097621_1000783623 101
351 3300006237 Ga0097621_100122525 Ga0097621_1001225253 101
352 3300006237 Ga0097621_100139427 Ga0097621_1001394273 101
353 3300006237 Ga0097621_100201163 Ga0097621_1002011634 101
354 3300006237 Ga0097621_100213968 Ga0097621_1002139682 101
355 3300006237 Ga0097621_100244548 Ga0097621_1002445481 101
356 3300006237 Ga0097621_100379215 Ga0097621_1003792153 101
357 3300006237 Ga0097621_100480099 Ga0097621_1004800993 101
358 3300006237 Ga0097621_100485288 Ga0097621_1004852882 101
359 3300006237 Ga0097621_100882874 Ga0097621_1008828742 101
360 3300006353 Ga0075370_10203587 Ga0075370_102035873 101
361 3300006353 Ga0075370_10434802 Ga0075370_104348022 101
362 3300006358 Ga0068871_100044280 Ga0068871_1000442804 101
363 3300006358 Ga0068871_100188243 Ga0068871_1001882433 101
364 3300006358 Ga0068871_100226252 Ga0068871_1002262523 101
365 3300006358 Ga0068871_100413993 Ga0068871_1004139932 101
366 3300006358 Ga0068871_100453812 Ga0068871_1004538122 101
367 3300006358 Ga0068871_100778809 Ga0068871_1007788092 101
368 3300006358 Ga0068871_100810447 Ga0068871_1008104472 101
369 3300006358 Ga0068871_100851851 Ga0068871_1008518512 101
370 3300006358 Ga0068871_101325124 Ga0068871_1013251242 101
371 3300006358 Ga0068871_101620222 Ga0068871_1016202222 101
372 3300006844 Ga0075428_100802261 Ga0075428_1008022611 101
373 3300006846 Ga0075430_100218759 Ga0075430_1002187593 101
374 3300006846 Ga0075430_101708589 Ga0075430_1017085892 101
375 3300006852 Ga0075433_10827216 Ga0075433_108272162 101
376 3300006880 Ga0075429_100593330 Ga0075429_1005933302 101
377 3300006881 Ga0068865_100001214 Ga0068865_10000121416 101
378 3300006881 Ga0068865_100010514 Ga0068865_1000105148 101
379 3300006881 Ga0068865_100021451 Ga0068865_1000214517 101
380 3300006881 Ga0068865_100037315 Ga0068865_1000373156 101
381 3300006881 Ga0068865_100074556 Ga0068865_1000745567 101
382 3300006881 Ga0068865_100902572 Ga0068865_1009025722 101
383 3300006881 Ga0068865_101185461 Ga0068865_1011854612 101
384 3300006881 Ga0068865_101269991 Ga0068865_1012699912 101
385 3300006931 Ga0097620_100000641 Ga0097620_10000064116 101
386 3300006931 Ga0097620_100005854 Ga0097620_10000585413 101
387 3300006931 Ga0097620_100047018 Ga0097620_1000470187 101
388 3300006931 Ga0097620_100056514 Ga0097620_1000565147 101
389 3300006931 Ga0097620_100077315 Ga0097620_1000773155 101
390 3300006931 Ga0097620_100291721 Ga0097620_1002917211 101
391 3300006931 Ga0097620_100313863 Ga0097620_1003138632 101
392 3300006931 Ga0097620_101283982 Ga0097620_1012839822 101
393 3300006931 Ga0097620_103057767 Ga0097620_1030577671 101
394 3300007076 Ga0075435_100074393 Ga0075435_1000743932 101
395 3300007265 Ga0099794_10074634 Ga0099794_100746343 101
396 3300007265 Ga0099794_10524708 Ga0099794_105247081 101
397 3300007788 Ga0099795_10003084 Ga0099795_100030849 101
398 3300009093 Ga0105240_10010598 Ga0105240_1001059816 101
399 3300009093 Ga0105240_10029309 Ga0105240_1002930911 101
400 3300009093 Ga0105240_10086135 Ga0105240_100861358 101
401 3300009093 Ga0105240_10112936 Ga0105240_101129368 101
402 3300009093 Ga0105240_10242587 Ga0105240_102425872 101
403 3300009093 Ga0105240_10281671 Ga0105240_102816713 101
404 3300009093 Ga0105240_10582231 Ga0105240_105822311 101
405 3300009093 Ga0105240_10626335 Ga0105240_106263353 101
406 3300009094 Ga0111539_10799285 Ga0111539_107992852 101
407 3300009094 Ga0111539_11140813 Ga0111539_111408131 101
408 3300009094 Ga0111539_12212886 Ga0111539_122128862 101
409 3300009094 Ga0111539_12365742 Ga0111539_123657421 101
410 3300009098 Ga0105245_10087460 Ga0105245_100874603 101
411 3300009098 Ga0105245_10099675 Ga0105245_100996755 101
412 3300009098 Ga0105245_11037789 Ga0105245_110377892 101
413 3300009101 Ga0105247_10002466 Ga0105247_1000246616 101
414 3300009101 Ga0105247_10015909 Ga0105247_100159097 101
415 3300009101 Ga0105247_10176946 Ga0105247_101769462 101
416 3300009101 Ga0105247_10229055 Ga0105247_102290551 101
417 3300009147 Ga0114129_12003029 Ga0114129_120030292 101
418 3300009148 Ga0105243_10194189 Ga0105243_101941894 101
419 3300009174 Ga0105241_10011879 Ga0105241_1001187910 101
420 3300009174 Ga0105241_10113915 Ga0105241_101139152 101
421 3300009176 Ga0105242_10003026 Ga0105242_1000302616 101
422 3300009176 Ga0105242_10003628 Ga0105242_1000362817 101
423 3300009176 Ga0105242_10206784 Ga0105242_102067842 101
424 3300009176 Ga0105242_10313692 Ga0105242_103136921 101
425 3300009176 Ga0105242_13064695 Ga0105242_130646951 101
426 3300009177 Ga0105248_10003146 Ga0105248_1000314616 101
427 3300009177 Ga0105248_10005842 Ga0105248_1000584214 101
428 3300009177 Ga0105248_10023564 Ga0105248_1002356413 101
429 3300009177 Ga0105248_11602520 Ga0105248_116025202 101
430 3300009545 Ga0105237_10044034 Ga0105237_100440347 101
431 3300009545 Ga0105237_10096005 Ga0105237_100960055 101
432 3300009545 Ga0105237_10099219 Ga0105237_100992197 101
433 3300009545 Ga0105237_11401620 Ga0105237_114016202 101
434 3300009545 Ga0105237_12217420 Ga0105237_122174202 101
435 3300009551 Ga0105238_10022279 Ga0105238_100222793 101
436 3300009551 Ga0105238_10406256 Ga0105238_104062563 101
437 3300009551 Ga0105238_11488562 Ga0105238_114885622 101
438 3300009551 Ga0105238_11852273 Ga0105238_118522731 101
439 3300009551 Ga0105238_11939221 Ga0105238_119392212 101
440 3300009551 Ga0105238_11982085 Ga0105238_119820852 101
441 3300009551 Ga0105238_12008678 Ga0105238_120086782 101
442 3300009553 Ga0105249_10014582 Ga0105249_1001458211 101
443 3300009553 Ga0105249_12013929 Ga0105249_120139292 101
444 3300009553 Ga0105249_13085298 Ga0105249_130852981 101
445 3300010159 Ga0099796_10000013 Ga0099796_100000137 101
446 3300010159 Ga0099796_10006593 Ga0099796_100065932 101
447 3300010159 Ga0099796_10145978 Ga0099796_101459782 101
448 3300010159 Ga0099796_10174031 Ga0099796_101740312 101
449 3300010375 Ga0105239_10103797 Ga0105239_101037973 101
450 3300010375 Ga0105239_10500212 Ga0105239_105002124 101
451 3300010375 Ga0105239_10564741 Ga0105239_105647411 101
452 3300010375 Ga0105239_11021932 Ga0105239_110219322 101
453 3300010375 Ga0105239_11149118 Ga0105239_111491181 101
454 3300011119 Ga0105246_10472133 Ga0105246_104721332 101
455 3300011119 Ga0105246_10796721 Ga0105246_107967212 101
456 3300011119 Ga0105246_11577531 Ga0105246_115775311 101
457 3300011119 Ga0105246_12155952 Ga0105246_121559521 101
458 3300013100 Ga0157373_10162009 Ga0157373_101620092 101
459 3300013100 Ga0157373_11037167 Ga0157373_110371671 101
460 3300013102 Ga0157371_11264455 Ga0157371_112644552 101
461 3300013104 Ga0157370_10262850 Ga0157370_102628502 101
462 3300013104 Ga0157370_10299273 Ga0157370_102992732 101
463 3300013104 Ga0157370_11797859 Ga0157370_117978592 101
464 3300013105 Ga0157369_10015323 Ga0157369_100153235 101
465 3300013105 Ga0157369_10051835 Ga0157369_100518358 101
466 3300013105 Ga0157369_10213528 Ga0157369_102135284 101
467 3300013105 Ga0157369_10293856 Ga0157369_102938564 101
468 3300013105 Ga0157369_10535674 Ga0157369_105356741 101
469 3300013105 Ga0157369_10746078 Ga0157369_107460782 101
470 3300013296 Ga0157374_10002813 Ga0157374_1000281318 101
471 3300013296 Ga0157374_10039033 Ga0157374_100390339 101
472 3300013296 Ga0157374_10310346 Ga0157374_103103463 101
473 3300013296 Ga0157374_10414545 Ga0157374_104145454 101
474 3300013297 Ga0157378_10006374 Ga0157378_100063748 101
475 3300013297 Ga0157378_10013575 Ga0157378_1001357515 101
476 3300013306 Ga0163162_10006236 Ga0163162_1000623616 101
477 3300013306 Ga0163162_10008705 Ga0163162_100087058 101
478 3300013306 Ga0163162_10026596 Ga0163162_100265968 101
479 3300013306 Ga0163162_10646134 Ga0163162_106461343 101
480 3300013306 Ga0163162_10655282 Ga0163162_106552822 101
481 3300013306 Ga0163162_11551272 Ga0163162_115512722 101
482 3300013306 Ga0163162_11693985 Ga0163162_116939851 101
483 3300013306 Ga0163162_12420139 Ga0163162_124201391 101
484 3300013306 Ga0163162_12778846 Ga0163162_127788462 101
485 3300013307 Ga0157372_10081320 Ga0157372_100813202 101
486 3300013307 Ga0157372_10897157 Ga0157372_108971572 101
487 3300013307 Ga0157372_11041560 Ga0157372_110415602 101
488 3300013307 Ga0157372_11995561 Ga0157372_119955612 101
489 3300013308 Ga0157375_10000319 Ga0157375_1000031915 101
490 3300013308 Ga0157375_10006856 Ga0157375_100068567 101
491 3300013308 Ga0157375_10493225 Ga0157375_104932252 101
492 3300013308 Ga0157375_10545902 Ga0157375_105459022 101
493 3300013308 Ga0157375_11014123 Ga0157375_110141232 101
494 3300013308 Ga0157375_11627865 Ga0157375_116278652 101
495 3300014325 Ga0163163_10000199 Ga0163163_1000019941 101
496 3300014325 Ga0163163_10007457 Ga0163163_1000745711 101
497 3300014325 Ga0163163_10176222 Ga0163163_101762223 101
498 3300014325 Ga0163163_10404151 Ga0163163_104041513 101
499 3300014325 Ga0163163_10733157 Ga0163163_107331572 101
500 3300014325 Ga0163163_11985108 Ga0163163_119851082 101
501 3300014326 Ga0157380_11708957 Ga0157380_117089571 101
502 3300014326 Ga0157380_12923379 Ga0157380_129233791 101
503 3300014745 Ga0157377_10941315 Ga0157377_109413151 101
504 3300014968 Ga0157379_10006918 Ga0157379_1000691813 101
505 3300014968 Ga0157379_10037733 Ga0157379_100377333 101
506 3300014968 Ga0157379_10055138 Ga0157379_100551386 101
507 3300014968 Ga0157379_10082681 Ga0157379_100826814 101
508 3300014968 Ga0157379_10187423 Ga0157379_101874232 101
509 3300014968 Ga0157379_10447257 Ga0157379_104472572 101
510 3300014968 Ga0157379_10949746 Ga0157379_109497462 101
511 3300014968 Ga0157379_11261575 Ga0157379_112615752 101
512 3300014968 Ga0157379_12059406 Ga0157379_120594061 101
513 3300014969 Ga0157376_10131141 Ga0157376_101311414 101
514 3300014969 Ga0157376_10278682 Ga0157376_102786821 101
515 3300014969 Ga0157376_10280609 Ga0157376_102806092 101
516 3300014969 Ga0157376_10447997 Ga0157376_104479972 101
517 3300014969 Ga0157376_11563247 Ga0157376_115632472 101
518 3300015262 Ga0182007_10211695 Ga0182007_102116951 101
519 3300017792 Ga0163161_10205021 Ga0163161_102050213 101
520 3300017792 Ga0163161_10501275 Ga0163161_105012752 101
521 3300020069 Ga0197907_10294975 Ga0197907_102949752 101
522 3300020070 Ga0206356_11568175 Ga0206356_115681753 101
523 3300020070 Ga0206356_11640133 Ga0206356_116401335 101
524 3300020077 Ga0206351_10700694 Ga0206351_107006942 101
525 3300020078 Ga0206352_10349565 Ga0206352_103495652 101
526 3300020081 Ga0206354_11036454 Ga0206354_110364542 101
527 3300020082 Ga0206353_10222205 Ga0206353_102222052 101
528 3300021358 Ga0213873_10261514 Ga0213873_102615142 101
529 3300021377 Ga0213874_10149716 Ga0213874_101497162 101
530 3300021384 Ga0213876_10032683 Ga0213876_100326837 101
531 3300021384 Ga0213876_10099155 Ga0213876_100991552 101
532 3300021384 Ga0213876_10222335 Ga0213876_102223353 101
533 3300021384 Ga0213876_10564005 Ga0213876_105640052 101
534 3300021388 Ga0213875_10435923 Ga0213875_104359232 101
535 3300021441 Ga0213871_10014920 Ga0213871_100149202 101
536 3300021441 Ga0213871_10270734 Ga0213871_102707342 101
537 3300022467 Ga0224712_10358615 Ga0224712_103586152 101
538 3300024225 Ga0224572_1011889 Ga0224572_10118894 101
539 3300024225 Ga0224572_1076459 Ga0224572_10764591 101
540 3300025261 Ga0209233_1001951 Ga0209233_100195111 101
541 3300025271 Ga0207666_1019476 Ga0207666_10194762 101
542 3300025315 Ga0207697_10027047 Ga0207697_100270473 101
543 3300025321 Ga0207656_10044300 Ga0207656_100443004 101
544 3300025321 Ga0207656_10182284 Ga0207656_101822842 101
545 3300025885 Ga0207653_10133826 Ga0207653_101338262 101
546 3300025898 Ga0207692_10132931 Ga0207692_101329312 101
547 3300025898 Ga0207692_10246844 Ga0207692_102468442 101
548 3300025898 Ga0207692_10464853 Ga0207692_104648532 101
549 3300025898 Ga0207692_10698704 Ga0207692_106987041 101
550 3300025898 Ga0207692_11194148 Ga0207692_111941482 101
551 3300025899 Ga0207642_10016853 Ga0207642_100168532 101
552 3300025899 Ga0207642_11013530 Ga0207642_110135301 101
553 3300025900 Ga0207710_10000332 Ga0207710_1000033239 101
554 3300025900 Ga0207710_10009562 Ga0207710_100095628 101
555 3300025900 Ga0207710_10010376 Ga0207710_100103766 101
556 3300025900 Ga0207710_10012607 Ga0207710_100126077 101
557 3300025900 Ga0207710_10056714 Ga0207710_100567144 101
558 3300025900 Ga0207710_10112208 Ga0207710_101122082 101
559 3300025901 Ga0207688_10144333 Ga0207688_101443332 101
560 3300025903 Ga0207680_10009301 Ga0207680_100093017 101
561 3300025903 Ga0207680_10047575 Ga0207680_100475752 101
562 3300025903 Ga0207680_10136511 Ga0207680_101365112 101
563 3300025903 Ga0207680_10235304 Ga0207680_102353042 101
564 3300025903 Ga0207680_10257091 Ga0207680_102570912 101
565 3300025904 Ga0207647_10046204 Ga0207647_100462047 101
566 3300025904 Ga0207647_10097771 Ga0207647_100977712 101
567 3300025905 Ga0207685_10000121 Ga0207685_1000012114 101
568 3300025905 Ga0207685_10032092 Ga0207685_100320923 101
569 3300025905 Ga0207685_10158287 Ga0207685_101582873 101
570 3300025906 Ga0207699_10024184 Ga0207699_100241847 101
571 3300025906 Ga0207699_10043471 Ga0207699_100434717 101
572 3300025906 Ga0207699_10281638 Ga0207699_102816382 101
573 3300025906 Ga0207699_10941374 Ga0207699_109413742 101
574 3300025907 Ga0207645_10015789 Ga0207645_100157897 101
575 3300025907 Ga0207645_10027678 Ga0207645_100276784 101
576 3300025907 Ga0207645_10186335 Ga0207645_101863353 101
577 3300025907 Ga0207645_10620537 Ga0207645_106205372 101
578 3300025908 Ga0207643_10002762 Ga0207643_1000276214 101
579 3300025908 Ga0207643_10070432 Ga0207643_100704323 101
580 3300025908 Ga0207643_10583790 Ga0207643_105837902 101
581 3300025909 Ga0207705_10385827 Ga0207705_103858272 101
582 3300025909 Ga0207705_11159612 Ga0207705_111596122 101
583 3300025910 Ga0207684_10575909 Ga0207684_105759092 101
584 3300025911 Ga0207654_10034349 Ga0207654_100343494 101
585 3300025911 Ga0207654_10062727 Ga0207654_100627273 101
586 3300025911 Ga0207654_10327449 Ga0207654_103274492 101
587 3300025911 Ga0207654_10644101 Ga0207654_106441012 101
588 3300025912 Ga0207707_10000276 Ga0207707_1000027628 101
589 3300025912 Ga0207707_10000410 Ga0207707_1000041035 101
590 3300025912 Ga0207707_10017188 Ga0207707_100171881 101
591 3300025912 Ga0207707_10025066 Ga0207707_100250667 101
592 3300025912 Ga0207707_10059190 Ga0207707_100591907 101
593 3300025912 Ga0207707_10075513 Ga0207707_100755137 101
594 3300025912 Ga0207707_10181062 Ga0207707_101810624 101
595 3300025912 Ga0207707_10790462 Ga0207707_107904622 101
596 3300025913 Ga0207695_10003442 Ga0207695_100034424 101
597 3300025913 Ga0207695_10042133 Ga0207695_100421337 101
598 3300025913 Ga0207695_10049612 Ga0207695_100496123 101
599 3300025913 Ga0207695_10052562 Ga0207695_100525629 101
600 3300025913 Ga0207695_10072121 Ga0207695_100721216 101
601 3300025913 Ga0207695_10083172 Ga0207695_100831728 101
602 3300025913 Ga0207695_10097549 Ga0207695_100975496 101
603 3300025913 Ga0207695_10234878 Ga0207695_102348784 101
604 3300025913 Ga0207695_10317282 Ga0207695_103172822 101
605 3300025913 Ga0207695_10339792 Ga0207695_103397923 101
606 3300025914 Ga0207671_10010563 Ga0207671_1001056311 101
607 3300025914 Ga0207671_10073947 Ga0207671_100739473 101
608 3300025914 Ga0207671_10157809 Ga0207671_101578095 101
609 3300025914 Ga0207671_10168779 Ga0207671_101687792 101
610 3300025914 Ga0207671_10190336 Ga0207671_101903362 101
611 3300025914 Ga0207671_11074785 Ga0207671_110747852 101
612 3300025915 Ga0207693_10000448 Ga0207693_1000044816 101
613 3300025915 Ga0207693_10126708 Ga0207693_101267084 101
614 3300025915 Ga0207693_10360999 Ga0207693_103609992 101
615 3300025915 Ga0207693_10481430 Ga0207693_104814302 101
616 3300025916 Ga0207663_10030730 Ga0207663_100307303 101
617 3300025916 Ga0207663_10045973 Ga0207663_100459734 101
618 3300025916 Ga0207663_10112779 Ga0207663_101127793 101
619 3300025916 Ga0207663_10369763 Ga0207663_103697632 101
620 3300025916 Ga0207663_11285009 Ga0207663_112850091 101
621 3300025916 Ga0207663_11458397 Ga0207663_114583971 101
622 3300025917 Ga0207660_10002217 Ga0207660_100022172 101
623 3300025917 Ga0207660_10415405 Ga0207660_104154053 101
624 3300025917 Ga0207660_10441396 Ga0207660_104413962 101
625 3300025918 Ga0207662_10036401 Ga0207662_100364015 101
626 3300025918 Ga0207662_10201054 Ga0207662_102010543 101
627 3300025919 Ga0207657_10063277 Ga0207657_100632772 101
628 3300025919 Ga0207657_10218405 Ga0207657_102184054 101
629 3300025920 Ga0207649_10183146 Ga0207649_101831461 101
630 3300025920 Ga0207649_10584605 Ga0207649_105846052 101
631 3300025920 Ga0207649_11147799 Ga0207649_111477992 101
632 3300025921 Ga0207652_10003383 Ga0207652_1000338314 101
633 3300025921 Ga0207652_10088779 Ga0207652_100887796 101
634 3300025921 Ga0207652_10266859 Ga0207652_102668594 101
635 3300025922 Ga0207646_10580829 Ga0207646_105808292 101
636 3300025922 Ga0207646_10803463 Ga0207646_108034632 101
637 3300025923 Ga0207681_10003213 Ga0207681_1000321313 101
638 3300025923 Ga0207681_10019048 Ga0207681_100190485 101
639 3300025923 Ga0207681_10071603 Ga0207681_100716035 101
640 3300025923 Ga0207681_11460364 Ga0207681_114603642 101
641 3300025924 Ga0207694_10003326 Ga0207694_1000332612 101
642 3300025924 Ga0207694_10850433 Ga0207694_108504332 101
643 3300025924 Ga0207694_10855851 Ga0207694_108558512 101
644 3300025925 Ga0207650_10000013 Ga0207650_10000013186 101
645 3300025925 Ga0207650_10018767 Ga0207650_100187672 101
646 3300025925 Ga0207650_10054455 Ga0207650_100544555 101
647 3300025925 Ga0207650_10221148 Ga0207650_102211483 101
648 3300025925 Ga0207650_10653968 Ga0207650_106539682 101
649 3300025925 Ga0207650_11325316 Ga0207650_113253162 101
650 3300025925 Ga0207650_11625876 Ga0207650_116258762 101
651 3300025926 Ga0207659_10061691 Ga0207659_100616917 101
652 3300025927 Ga0207687_10076669 Ga0207687_100766693 101
653 3300025927 Ga0207687_11273253 Ga0207687_112732532 101
654 3300025928 Ga0207700_10003609 Ga0207700_1000360913 101
655 3300025928 Ga0207700_10647428 Ga0207700_106474282 101
656 3300025928 Ga0207700_10836972 Ga0207700_108369722 101
657 3300025928 Ga0207700_10862520 Ga0207700_108625201 101
658 3300025928 Ga0207700_11545406 Ga0207700_115454062 101
659 3300025929 Ga0207664_10007010 Ga0207664_100070108 101
660 3300025929 Ga0207664_10051619 Ga0207664_100516193 101
661 3300025929 Ga0207664_10350438 Ga0207664_103504382 101
662 3300025931 Ga0207644_10000407 Ga0207644_1000040716 101
663 3300025931 Ga0207644_10000428 Ga0207644_1000042818 101
664 3300025931 Ga0207644_10004012 Ga0207644_1000401214 101
665 3300025931 Ga0207644_10093201 Ga0207644_100932012 101
666 3300025931 Ga0207644_10179249 Ga0207644_101792494 101
667 3300025931 Ga0207644_10573836 Ga0207644_105738362 101
668 3300025931 Ga0207644_11450954 Ga0207644_114509541 101
669 3300025932 Ga0207690_10156897 Ga0207690_101568974 101
670 3300025933 Ga0207706_10375437 Ga0207706_103754373 101
671 3300025933 Ga0207706_10498430 Ga0207706_104984302 101
672 3300025933 Ga0207706_10597721 Ga0207706_105977211 101
673 3300025933 Ga0207706_11133911 Ga0207706_111339112 101
674 3300025933 Ga0207706_11570495 Ga0207706_115704951 101
675 3300025934 Ga0207686_10005014 Ga0207686_1000501415 101
676 3300025934 Ga0207686_10007583 Ga0207686_100075838 101
677 3300025934 Ga0207686_10072816 Ga0207686_100728164 101
678 3300025934 Ga0207686_10255208 Ga0207686_102552082 101
679 3300025934 Ga0207686_11085111 Ga0207686_110851112 101
680 3300025935 Ga0207709_10431056 Ga0207709_104310562 101
681 3300025936 Ga0207670_10126684 Ga0207670_101266844 101
682 3300025936 Ga0207670_10684398 Ga0207670_106843982 101
683 3300025936 Ga0207670_10703399 Ga0207670_107033992 101
684 3300025936 Ga0207670_11102066 Ga0207670_111020662 101
685 3300025936 Ga0207670_11875155 Ga0207670_118751552 101
686 3300025937 Ga0207669_10068174 Ga0207669_100681743 101
687 3300025937 Ga0207669_10419872 Ga0207669_104198722 101
688 3300025938 Ga0207704_10002424 Ga0207704_100024243 101
689 3300025938 Ga0207704_10014528 Ga0207704_100145288 101
690 3300025938 Ga0207704_10040967 Ga0207704_100409672 101
691 3300025938 Ga0207704_10188426 Ga0207704_101884262 101
692 3300025938 Ga0207704_11518336 Ga0207704_115183362 101
693 3300025939 Ga0207665_10035902 Ga0207665_100359023 101
694 3300025939 Ga0207665_10088305 Ga0207665_100883053 101
695 3300025940 Ga0207691_10049133 Ga0207691_100491331 101
696 3300025940 Ga0207691_10104939 Ga0207691_101049393 101
697 3300025940 Ga0207691_10242604 Ga0207691_102426043 101
698 3300025940 Ga0207691_10308562 Ga0207691_103085622 101
699 3300025940 Ga0207691_10726901 Ga0207691_107269012 101
700 3300025940 Ga0207691_11290328 Ga0207691_112903282 101
701 3300025941 Ga0207711_10000194 Ga0207711_1000019421 101
702 3300025941 Ga0207711_10004185 Ga0207711_1000418514 101
703 3300025941 Ga0207711_10116126 Ga0207711_101161262 101
704 3300025941 Ga0207711_10159847 Ga0207711_101598472 101
705 3300025941 Ga0207711_11059250 Ga0207711_110592502 101
706 3300025942 Ga0207689_10127570 Ga0207689_101275703 101
707 3300025942 Ga0207689_10224281 Ga0207689_102242813 101
708 3300025942 Ga0207689_10232116 Ga0207689_102321163 101
709 3300025942 Ga0207689_10460341 Ga0207689_104603412 101
710 3300025942 Ga0207689_11099186 Ga0207689_110991862 101
711 3300025944 Ga0207661_10649510 Ga0207661_106495102 101
712 3300025945 Ga0207679_10093035 Ga0207679_100930355 101
713 3300025945 Ga0207679_10127063 Ga0207679_101270633 101
714 3300025945 Ga0207679_10268843 Ga0207679_102688433 101
715 3300025945 Ga0207679_10564397 Ga0207679_105643972 101
716 3300025945 Ga0207679_10948619 Ga0207679_109486192 101
717 3300025945 Ga0207679_11280853 Ga0207679_112808532 101
718 3300025945 Ga0207679_11886660 Ga0207679_118866601 101
719 3300025949 Ga0207667_10008242 Ga0207667_1000824216 101
720 3300025949 Ga0207667_10014175 Ga0207667_100141756 101
721 3300025949 Ga0207667_10048865 Ga0207667_100488659 101
722 3300025949 Ga0207667_10617984 Ga0207667_106179842 101
723 3300025949 Ga0207667_10914561 Ga0207667_109145612 101
724 3300025949 Ga0207667_11023502 Ga0207667_110235021 101
725 3300025949 Ga0207667_12244332 Ga0207667_122443322 101
726 3300025960 Ga0207651_10007788 Ga0207651_100077883 101
727 3300025960 Ga0207651_10025701 Ga0207651_100257018 101
728 3300025960 Ga0207651_10049602 Ga0207651_100496026 101
729 3300025960 Ga0207651_10056314 Ga0207651_100563145 101
730 3300025960 Ga0207651_10312895 Ga0207651_103128951 101
731 3300025960 Ga0207651_11776303 Ga0207651_117763032 101
732 3300025961 Ga0207712_10274654 Ga0207712_102746542 101
733 3300025961 Ga0207712_11349038 Ga0207712_113490382 101
734 3300025972 Ga0207668_10008346 Ga0207668_1000834611 101
735 3300025972 Ga0207668_10264120 Ga0207668_102641202 101
736 3300025972 Ga0207668_10498202 Ga0207668_104982022 101
737 3300025972 Ga0207668_10544631 Ga0207668_105446312 101
738 3300025981 Ga0207640_10264980 Ga0207640_102649802 101
739 3300025981 Ga0207640_10361518 Ga0207640_103615183 101
740 3300025981 Ga0207640_10419821 Ga0207640_104198212 101
741 3300025981 Ga0207640_10785089 Ga0207640_107850892 101
742 3300025981 Ga0207640_11145885 Ga0207640_111458852 101
743 3300025986 Ga0207658_10000005 Ga0207658_10000005187 101
744 3300025986 Ga0207658_10004751 Ga0207658_100047517 101
745 3300025986 Ga0207658_10108411 Ga0207658_101084115 101
746 3300025986 Ga0207658_10175447 Ga0207658_101754473 101
747 3300025986 Ga0207658_10437648 Ga0207658_104376481 101
748 3300025986 Ga0207658_10625449 Ga0207658_106254491 101
749 3300025986 Ga0207658_10793713 Ga0207658_107937132 101
750 3300025986 Ga0207658_11262300 Ga0207658_112623002 101
751 3300026023 Ga0207677_10017062 Ga0207677_100170627 101
752 3300026023 Ga0207677_10020677 Ga0207677_100206773 101
753 3300026023 Ga0207677_10703153 Ga0207677_107031532 101
754 3300026023 Ga0207677_11066414 Ga0207677_110664141 101
755 3300026035 Ga0207703_10001524 Ga0207703_1000152419 101
756 3300026035 Ga0207703_10019203 Ga0207703_100192038 101
757 3300026035 Ga0207703_10024678 Ga0207703_100246787 101
758 3300026035 Ga0207703_10050143 Ga0207703_100501433 101
759 3300026035 Ga0207703_10235714 Ga0207703_102357144 101
760 3300026035 Ga0207703_10347890 Ga0207703_103478901 101
761 3300026041 Ga0207639_10699382 Ga0207639_106993822 101
762 3300026041 Ga0207639_11770732 Ga0207639_117707322 101
763 3300026041 Ga0207639_11950144 Ga0207639_119501442 101
764 3300026067 Ga0207678_10005556 Ga0207678_100055567 101
765 3300026067 Ga0207678_10267753 Ga0207678_102677531 101
766 3300026067 Ga0207678_10276992 Ga0207678_102769922 101
767 3300026067 Ga0207678_10372903 Ga0207678_103729032 101
768 3300026067 Ga0207678_11429764 Ga0207678_114297642 101
769 3300026075 Ga0207708_10036414 Ga0207708_100364144 101
770 3300026075 Ga0207708_10047577 Ga0207708_100475773 101
771 3300026075 Ga0207708_10405882 Ga0207708_104058822 101
772 3300026078 Ga0207702_10043700 Ga0207702_100437007 101
773 3300026078 Ga0207702_10086751 Ga0207702_100867517 101
774 3300026078 Ga0207702_10128657 Ga0207702_101286577 101
775 3300026078 Ga0207702_11220565 Ga0207702_112205652 101
776 3300026078 Ga0207702_11309893 Ga0207702_113098932 101
777 3300026088 Ga0207641_10002325 Ga0207641_1000232516 101
778 3300026088 Ga0207641_10003553 Ga0207641_1000355316 101
779 3300026088 Ga0207641_10009230 Ga0207641_100092305 101
780 3300026088 Ga0207641_10010988 Ga0207641_100109887 101
781 3300026088 Ga0207641_10029923 Ga0207641_100299239 101
782 3300026088 Ga0207641_10106203 Ga0207641_101062036 101
783 3300026088 Ga0207641_10235301 Ga0207641_102353014 101
784 3300026088 Ga0207641_10623681 Ga0207641_106236812 101
785 3300026088 Ga0207641_11812483 Ga0207641_118124832 101
786 3300026089 Ga0207648_10052141 Ga0207648_100521415 101
787 3300026089 Ga0207648_10052679 Ga0207648_100526792 101
788 3300026089 Ga0207648_10307642 Ga0207648_103076422 101
789 3300026089 Ga0207648_10388734 Ga0207648_103887341 101
790 3300026089 Ga0207648_10407117 Ga0207648_104071172 101
791 3300026089 Ga0207648_12189707 Ga0207648_121897071 101
792 3300026095 Ga0207676_10000010 Ga0207676_10000010284 101
793 3300026095 Ga0207676_10038749 Ga0207676_100387498 101
794 3300026095 Ga0207676_10363333 Ga0207676_103633331 101
795 3300026095 Ga0207676_11224328 Ga0207676_112243282 101
796 3300026095 Ga0207676_11780453 Ga0207676_117804531 101
797 3300026116 Ga0207674_10272624 Ga0207674_102726242 101
798 3300026116 Ga0207674_10326743 Ga0207674_103267433 101
799 3300026116 Ga0207674_10663830 Ga0207674_106638302 101
800 3300026116 Ga0207674_10856467 Ga0207674_108564672 101
801 3300026118 Ga0207675_100080055 Ga0207675_1000800558 101
802 3300026118 Ga0207675_100132610 Ga0207675_1001326103 101
803 3300026118 Ga0207675_100142749 Ga0207675_1001427493 101
804 3300026118 Ga0207675_100375270 Ga0207675_1003752701 101
805 3300026118 Ga0207675_100632434 Ga0207675_1006324343 101
806 3300026118 Ga0207675_101701120 Ga0207675_1017011202 101
807 3300026118 Ga0207675_102258542 Ga0207675_1022585421 101
808 3300026121 Ga0207683_10002499 Ga0207683_1000249915 101
809 3300026121 Ga0207683_10022992 Ga0207683_100229928 101
810 3300026121 Ga0207683_10141534 Ga0207683_101415345 101
811 3300026142 Ga0207698_10091691 Ga0207698_100916912 101
812 3300026142 Ga0207698_10257621 Ga0207698_102576214 101
813 3300026142 Ga0207698_10433276 Ga0207698_104332761 101
814 3300026142 Ga0207698_10610020 Ga0207698_106100202 101
815 3300026142 Ga0207698_11385002 Ga0207698_113850022 101
816 3300026142 Ga0207698_11670797 Ga0207698_116707971 101
817 3300027512 Ga0209179_1000094 Ga0209179_100009410 101
818 3300027512 Ga0209179_1000174 Ga0209179_10001742 101
819 3300027671 Ga0209588_1045050 Ga0209588_10450502 101
820 3300027866 Ga0209813_10164941 Ga0209813_101649412 101
821 3300028017 Ga0265356_1000652 Ga0265356_100065212 101
822 3300028023 Ga0265357_1035170 Ga0265357_10351701 101
823 3300028379 Ga0268266_10000943 Ga0268266_1000094315 101
824 3300028379 Ga0268266_10002538 Ga0268266_1000253816 101
825 3300028379 Ga0268266_10005009 Ga0268266_100050094 101
826 3300028379 Ga0268266_10010307 Ga0268266_100103074 101
827 3300028379 Ga0268266_10013518 Ga0268266_1001351811 101
828 3300028379 Ga0268266_10018044 Ga0268266_100180447 101
829 3300028379 Ga0268266_10019459 Ga0268266_1001945911 101
830 3300028379 Ga0268266_10078059 Ga0268266_100780592 101
831 3300028379 Ga0268266_10082273 Ga0268266_100822734 101
832 3300028379 Ga0268266_10165713 Ga0268266_101657133 101
833 3300028379 Ga0268266_10421058 Ga0268266_104210582 101
834 3300028379 Ga0268266_10925547 Ga0268266_109255472 101
835 3300028379 Ga0268266_11493521 Ga0268266_114935211 101
836 3300028379 Ga0268266_11521321 Ga0268266_115213212 101
837 3300028380 Ga0268265_10000383 Ga0268265_1000038342 101
838 3300028380 Ga0268265_10056316 Ga0268265_100563168 101
839 3300028380 Ga0268265_10144177 Ga0268265_101441775 101
840 3300028380 Ga0268265_10246003 Ga0268265_102460033 101
841 3300028380 Ga0268265_10499903 Ga0268265_104999033 101
842 3300028380 Ga0268265_10653004 Ga0268265_106530043 101
843 3300028381 Ga0268264_10000036 Ga0268264_10000036334 101
844 3300028381 Ga0268264_10000102 Ga0268264_1000010216 101
845 3300028381 Ga0268264_10011424 Ga0268264_100114244 101
846 3300028381 Ga0268264_10013393 Ga0268264_100133938 101
847 3300028381 Ga0268264_10085143 Ga0268264_100851437 101
848 3300028381 Ga0268264_10200275 Ga0268264_102002752 101
849 3300028381 Ga0268264_10256879 Ga0268264_102568794 101
850 3300028381 Ga0268264_10909714 Ga0268264_109097142 101
851 3300028381 Ga0268264_11527368 Ga0268264_115273682 101
852 3300028381 Ga0268264_12206416 Ga0268264_122064161 101
853 3300028381 Ga0268264_12206752 Ga0268264_122067522 101
854 3300028558 Ga0265326_10147255 Ga0265326_101472552 101
855 3300028563 Ga0265319_1002761 Ga0265319_10027618 101
856 3300028573 Ga0265334_10000272 Ga0265334_1000027227 101
857 3300028573 Ga0265334_10001026 Ga0265334_1000102616 101
858 3300028573 Ga0265334_10104489 Ga0265334_101044892 101
859 3300028577 Ga0265318_10000228 Ga0265318_1000022828 101
860 3300028666 Ga0265336_10019649 Ga0265336_100196493 101
861 3300028786 Ga0307517_10266356 Ga0307517_102663562 101
862 3300028794 Ga0307515_10034640 Ga0307515_100346403 101
863 3300028794 Ga0307515_10711569 Ga0307515_107115692 101
864 3300028794 Ga0307515_10840440 Ga0307515_108404402 101
865 3300028800 Ga0265338_10005919 Ga0265338_1000591911 101
866 3300028800 Ga0265338_10016309 Ga0265338_1001630914 101
867 3300028800 Ga0265338_10124432 Ga0265338_101244322 101
868 3300028800 Ga0265338_10145015 Ga0265338_101450155 101
869 3300028800 Ga0265338_10320714 Ga0265338_103207142 101
870 3300030521 Ga0307511_10000235 Ga0307511_1000023549 101
871 3300030521 Ga0307511_10056308 Ga0307511_100563087 101
872 3300030521 Ga0307511_10182269 Ga0307511_101822693 101
873 3300030878 Ga0265770_1000452 Ga0265770_10004527 101
874 3300031010 Ga0265771_1003521 Ga0265771_10035212 101
875 3300031018 Ga0265773_1003029 Ga0265773_10030292 101
876 3300031090 Ga0265760_10001436 Ga0265760_1000143610 101
877 3300031090 Ga0265760_10016486 Ga0265760_100164863 101
878 3300031235 Ga0265330_10004229 Ga0265330_1000422910 101
879 3300031235 Ga0265330_10027214 Ga0265330_100272143 101
880 3300031238 Ga0265332_10001037 Ga0265332_1000103716 101
881 3300031238 Ga0265332_10086955 Ga0265332_100869553 101
882 3300031238 Ga0265332_10356677 Ga0265332_103566772 101
883 3300031239 Ga0265328_10002988 Ga0265328_100029889 101
884 3300031239 Ga0265328_10003225 Ga0265328_100032257 101
885 3300031239 Ga0265328_10029110 Ga0265328_100291103 101
886 3300031239 Ga0265328_10122277 Ga0265328_101222772 101
887 3300031239 Ga0265328_10197442 Ga0265328_101974421 101
888 3300031240 Ga0265320_10004080 Ga0265320_1000408012 101
889 3300031240 Ga0265320_10083511 Ga0265320_100835112 101
890 3300031240 Ga0265320_10367736 Ga0265320_103677362 101
891 3300031240 Ga0265320_10430262 Ga0265320_104302621 101
892 3300031241 Ga0265325_10005189 Ga0265325_1000518911 101
893 3300031242 Ga0265329_10001451 Ga0265329_100014518 101
894 3300031247 Ga0265340_10013162 Ga0265340_100131623 101
895 3300031247 Ga0265340_10020617 Ga0265340_100206174 101
896 3300031247 Ga0265340_10040021 Ga0265340_100400215 101
897 3300031247 Ga0265340_10180734 Ga0265340_101807342 101
898 3300031247 Ga0265340_10233383 Ga0265340_102333832 101
899 3300031247 Ga0265340_10533645 Ga0265340_105336452 101
900 3300031249 Ga0265339_10014355 Ga0265339_100143552 101
901 3300031250 Ga0265331_10004429 Ga0265331_100044299 101
902 3300031250 Ga0265331_10018795 Ga0265331_100187957 101
903 3300031250 Ga0265331_10149262 Ga0265331_101492622 101
904 3300031251 Ga0265327_10000005 Ga0265327_10000005191 101
905 3300031344 Ga0265316_10013033 Ga0265316_1001303314 101
906 3300031344 Ga0265316_10277063 Ga0265316_102770633 101
907 3300031344 Ga0265316_10800381 Ga0265316_108003812 101
908 3300031456 Ga0307513_10007825 Ga0307513_100078258 101
909 3300031456 Ga0307513_10044257 Ga0307513_100442579 101
910 3300031456 Ga0307513_10058418 Ga0307513_100584188 101
911 3300031456 Ga0307513_10847699 Ga0307513_108476992 101
912 3300031507 Ga0307509_10565722 Ga0307509_105657222 101
913 3300031548 Ga0307408_100021417 Ga0307408_1000214171 101
914 3300031548 Ga0307408_100293830 Ga0307408_1002938302 101
915 3300031548 Ga0307408_100469453 Ga0307408_1004694531 101
916 3300031548 Ga0307408_100595029 Ga0307408_1005950292 101
917 3300031595 Ga0265313_10001786 Ga0265313_1000178614 101
918 3300031595 Ga0265313_10438966 Ga0265313_104389661 101
919 3300031616 Ga0307508_10111635 Ga0307508_101116352 101
920 3300031649 Ga0307514_10104256 Ga0307514_101042565 101
921 3300031711 Ga0265314_10005233 Ga0265314_1000523310 101
922 3300031711 Ga0265314_10174330 Ga0265314_101743302 101
923 3300031711 Ga0265314_10481917 Ga0265314_104819172 101
924 3300031712 Ga0265342_10002379 Ga0265342_1000237915 101
925 3300031730 Ga0307516_10398880 Ga0307516_103988803 101
926 3300031730 Ga0307516_10507748 Ga0307516_105077482 101
927 3300031730 Ga0307516_10511254 Ga0307516_105112541 101
928 3300031731 Ga0307405_10286534 Ga0307405_102865343 101
929 3300031731 Ga0307405_10640466 Ga0307405_106404662 101
930 3300031731 Ga0307405_10783047 Ga0307405_107830472 101
931 3300031824 Ga0307413_10001429 Ga0307413_1000142914 101
932 3300031824 Ga0307413_10035769 Ga0307413_100357694 101
933 3300031824 Ga0307413_10180497 Ga0307413_101804972 101
934 3300031824 Ga0307413_10206648 Ga0307413_102066482 101
935 3300031852 Ga0307410_10002645 Ga0307410_1000264515 101
936 3300031852 Ga0307410_10718460 Ga0307410_107184602 101
937 3300031852 Ga0307410_10762095 Ga0307410_107620952 101
938 3300031901 Ga0307406_10214883 Ga0307406_102148833 101
939 3300031901 Ga0307406_10862465 Ga0307406_108624652 101
940 3300031901 Ga0307406_11779662 Ga0307406_117796622 101
941 3300031903 Ga0307407_10007323 Ga0307407_100073233 101
942 3300031903 Ga0307407_10367805 Ga0307407_103678053 101
943 3300031903 Ga0307407_10401641 Ga0307407_104016412 101
944 3300031911 Ga0307412_10275217 Ga0307412_102752171 101
945 3300031911 Ga0307412_10300299 Ga0307412_103002992 101
946 3300031995 Ga0307409_100008471 Ga0307409_10000847114 101
947 3300031995 Ga0307409_100018987 Ga0307409_1000189874 101
948 3300031995 Ga0307409_100067110 Ga0307409_1000671108 101
949 3300031995 Ga0307409_100072562 Ga0307409_1000725623 101
950 3300031995 Ga0307409_100623909 Ga0307409_1006239093 101
951 3300032002 Ga0307416_100218253 Ga0307416_1002182532 101
952 3300032002 Ga0307416_100553375 Ga0307416_1005533752 101
953 3300032002 Ga0307416_100764931 Ga0307416_1007649313 101
954 3300032002 Ga0307416_101433336 Ga0307416_1014333362 101
955 3300032002 Ga0307416_103094738 Ga0307416_1030947382 101
956 3300032002 Ga0307416_103768426 Ga0307416_1037684261 101
957 3300032004 Ga0307414_10283564 Ga0307414_102835643 101
958 3300032005 Ga0307411_10001998 Ga0307411_1000199815 101
959 3300032005 Ga0307411_10034772 Ga0307411_100347727 101
960 3300032005 Ga0307411_10354795 Ga0307411_103547953 101
961 3300032005 Ga0307411_10535613 Ga0307411_105356132 101
962 3300032005 Ga0307411_11420539 Ga0307411_114205392 101
963 3300032126 Ga0307415_100068825 Ga0307415_1000688257 101
964 3300032126 Ga0307415_100098172 Ga0307415_1000981726 101
965 3300032126 Ga0307415_100210379 Ga0307415_1002103794 101
966 3300032126 Ga0307415_100843478 Ga0307415_1008434782 101
967 3300032126 Ga0307415_102202861 Ga0307415_1022028612 101
968 3300033179 Ga0307507_10414909 Ga0307507_104149092 101
969 3300033180 Ga0307510_10000006 Ga0307510_10000006347 101
970 3300033180 Ga0307510_10029950 Ga0307510_100299508 101
971 3300033180 Ga0307510_10083840 Ga0307510_100838403 101
972 3300035084 Ga0373928_0116950 Ga0373928_0116950_322_627 101
973 3300035086 Ga0373934_0198021 Ga0373934_0198021_420_725 101
974 3300035089 Ga0373944_0040350 Ga0373944_0040350_245_550 101
975 3300035092 Ga0373952_0094250 Ga0373952_0094250_71_376 101
976 3300035111 Ga0373923_0030963 Ga0373923_0030963_567_872 101
977 3300035111 Ga0373923_0093456 Ga0373923_0093456_795_1100 101
978 3300035113 Ga0373936_0035525 Ga0373936_0035525_880_1185 101
979 3300035113 Ga0373936_0036445 Ga0373936_0036445_413_718 101
980 3300035113 Ga0373936_0068071 Ga0373936_0068071_779_1084 101
981 3300035113 Ga0373936_0384330 Ga0373936_0384330_61_366 101
982 3300035113 Ga0373936_0431473 Ga0373936_0431473_54_359 101
983 3300035113 Ga0373936_0582413 Ga0373936_0582413_93_398 101
984 3300035114 Ga0373939_0195557 Ga0373939_0195557_271_576 101
985 3300035116 Ga0373945_0139007 Ga0373945_0139007_567_872 101
986 3300035116 Ga0373945_0229516 Ga0373945_0229516_269_574 101
987 3300035117 Ga0373953_0270691 Ga0373953_0270691_412_717 101
988 3300035117 Ga0373953_0288935 Ga0373953_0288935_289_594 101
989 3300035118 Ga0373954_0124223 Ga0373954_0124223_549_854 101
990 3300035119 Ga0373956_0132597 Ga0373956_0132597_69_374 101
991 3300035120 Ga0373957_0044948 Ga0373957_0044948_1195_1500 101
992 3300035120 Ga0373957_0057320 Ga0373957_0057320_1094_1399 101
993 3300035121 Ga0373960_0227138 Ga0373960_0227138_220_525 101
994 3300035170 Ga0373943_0114904 Ga0373943_0114904_135_440 101
995 3300035170 Ga0373943_0404474 Ga0373943_0404474_410_715 101
996 3300035171 Ga0373946_0057466 Ga0373946_0057466_1265_1570 101
997 3300035171 Ga0373946_0323051 Ga0373946_0323051_239_544 101
998 3300035172 Ga0373955_0018160 Ga0373955_0018160_2158_2463 101
999 3300035172 Ga0373955_0018691 Ga0373955_0018691_1059_1364 101
1000 3300035172 Ga0373955_0046500 Ga0373955_0046500_1347_1652 101
1001 3300035172 Ga0373955_0714756 Ga0373955_0714756_216_590 101
1002 3300035172 Ga0373955_0835562 Ga0373955_0835562_71_376 101
1003 3300035207 Ga0373942_0133951 Ga0373942_0133951_436_741 101
1004 3300035241 Ga0373961_0201024 Ga0373961_0201024_47_352 101
1005 3300035691 Ga0373931_0677189 Ga0373931_0677189_48_353 101
1006 3300035692 Ga0373935_0338218 Ga0373935_0338218_384_689 101
1007 3300035692 Ga0373935_0930979 Ga0373935_0930979_188_493 101
1008 3300035695 Ga0373927_0009161 Ga0373927_0009161_2940_3245 101
1009 3300035724 Ga0373933_0134605 Ga0373933_0134605_978_1283 101
1010 3300035724 Ga0373933_0663875 Ga0373933_0663875_207_512 101
1011 3300035724 Ga0373933_0815132 Ga0373933_0815132_277_582 101
1012 3300035724 Ga0373933_0985631 Ga0373933_0985631_61_366 101
1013 3300035725 Ga0373947_0254326 Ga0373947_0254326_784_1089 101
1014 3300035725 Ga0373947_0716259 Ga0373947_0716259_153_458 101
1015 3300036401 Ga0373937_0065988 Ga0373937_0065988_1648_1953 101
1016 3300036401 Ga0373937_0086972 Ga0373937_0086972_722_1027 101
1017 3300036401 Ga0373937_0107062 Ga0373937_0107062_431_736 101
1018 3300036401 Ga0373937_0120811 Ga0373937_0120811_1699_2004 101
1019 3300036401 Ga0373937_0241467 Ga0373937_0241467_1124_1429 101
1020 3300036401 Ga0373937_1298504 Ga0373937_1298504_250_555 101
1021 3300037068 Ga0373925_0026649 Ga0373925_0026649_896_1201 101
1022 3300037068 Ga0373925_0747219 Ga0373925_0747219_424_729 101
1023 3300037312 Ga0395899_0377597 Ga0395899_0377597_132_437 101
1024 3300037418 Ga0395900_0328446 Ga0395900_0328446_1148_1453 101
1025 3300037466 Ga0395898_0014841 Ga0395898_0014841_2935_3240 101
1026 3300037466 Ga0395898_0039994 Ga0395898_0039994_4043_4348 101
1027 3300037466 Ga0395898_0742163 Ga0395898_0742163_50_355 101
1028 3300037853 Ga0436364_0966198 Ga0436364_0966198_18_323 101
1029 3300037853 Ga0436364_1119394 Ga0436364_1119394_629_934 101
1030 3300039437 Ga0436365_0032067 Ga0436365_0032067_1988_2293 101
1031 3300039437 Ga0436365_0123496 Ga0436365_0123496_2625_2930 101
1032 3300039437 Ga0436365_0309009 Ga0436365_0309009_110_415 101
1033 3300039437 Ga0436365_0574996 Ga0436365_0574996_262_567 101
1034 3300039437 Ga0436365_0588607 Ga0436365_0588607_137_442 101
1035 3300039437 Ga0436365_1106216 Ga0436365_1106216_225_530 101
1036 3300039437 Ga0436365_1107339 Ga0436365_1107339_407_712 101
1037 3300039437 Ga0436365_1277090 Ga0436365_1277090_32_337 101
1038 3300039438 Ga0436360_0226775 Ga0436360_0226775_1413_1718 101
1039 3300039438 Ga0436360_0397350 Ga0436360_0397350_253_558 101
1040 3300039438 Ga0436360_0552698 Ga0436360_0552698_216_521 101
1041 3300039438 Ga0436360_0749057 Ga0436360_0749057_1336_1641 101
1042 3300039438 Ga0436360_0999940 Ga0436360_0999940_157_462 101
1043 3300039438 Ga0436360_1375355 Ga0436360_1375355_775_1080 101
1044 3300039447 Ga0436361_0031697 Ga0436361_0031697_418_723 101
1045 3300039447 Ga0436361_0734175 Ga0436361_0734175_82_387 101
1046 3300039450 Ga0436363_0052657 Ga0436363_0052657_152_457 101
1047 3300039450 Ga0436363_0193457 Ga0436363_0193457_726_1031 101
1048 3300039450 Ga0436363_0498253 Ga0436363_0498253_6504_6809 101
1049 3300039450 Ga0436363_0603378 Ga0436363_0603378_726_1031 101
1050 3300039450 Ga0436363_0620486 Ga0436363_0620486_2076_2381 101
1051 3300039450 Ga0436363_0854207 Ga0436363_0854207_2943_3248 101
1052 3300039450 Ga0436363_1530821 Ga0436363_1530821_2674_2979 101
1053 3300039453 Ga0436362_0241992 Ga0436362_0241992_173_478 101
1054 3300039453 Ga0436362_0610762 Ga0436362_0610762_319_624 101
1055 3300039453 Ga0436362_0693496 Ga0436362_0693496_924_1229 101
1056 3300039453 Ga0436362_0820035 Ga0436362_0820035_832_1137 101
1057 3300039453 Ga0436362_1267612 Ga0436362_1267612_225_530 101
1058 3300041406 Ga0439439_0151535 Ga0439439_0151535_109_414 101
1059 3300041441 Ga0451787_619150 Ga0451787_619150_14_319 101
1060 3300041443 Ga0451789_0038452 Ga0451789_0038452_169_474 101
1061 3300041443 Ga0451789_0348250 Ga0451789_0348250_312_617 101
1062 3300041451 Ga0451791_0414676 Ga0451791_0414676_95_400 101
1063 3300041451 Ga0451791_0421855 Ga0451791_0421855_546_851 101
1064 3300041451 Ga0451791_1468289 Ga0451791_1468289_420_725 101
1065 3300041452 Ga0451793_1713978 Ga0451793_1713978_189_494 101
1066 3300041453 Ga0451797_0463910 Ga0451797_0463910_106_411 101
1067 3300041453 Ga0451797_1066747 Ga0451797_1066747_398_703 101
1068 3300041453 Ga0451797_1136816 Ga0451797_1136816_390_695 101
1069 3300041458 Ga0451798_0614515 Ga0451798_0614515_419_724 101
1070 3300041459 Ga0451800_0475520 Ga0451800_0475520_387_692 101
1071 3300041460 Ga0451802_1195489 Ga0451802_1195489_161_466 101
1072 3300041486 Ga0451807_0772385 Ga0451807_0772385_408_713 101
1073 3300041486 Ga0451807_2713173 Ga0451807_2713173_128_433 101
1074 3300041492 Ga0451835_0527541 Ga0451835_0527541_202_507 101
1075 3300041494 Ga0451837_0095635 Ga0451837_0095635_186_491 101
1076 3300041494 Ga0451837_0361166 Ga0451837_0361166_409_714 101
1077 3300041496 Ga0451839_0596168 Ga0451839_0596168_172_477 101
1078 3300041503 Ga0451847_0947723 Ga0451847_0947723_441_746 101
1079 3300041505 Ga0451849_1081235 Ga0451849_1081235_293_598 101
1080 3300041507 Ga0451851_0606114 Ga0451851_0606114_155_460 101
1081 3300041509 Ga0451843_0028636 Ga0451843_0028636_525_830 101
1082 3300041512 Ga0451853_0730695 Ga0451853_0730695_272_577 101
1083 3300041512 Ga0451853_1933935 Ga0451853_1933935_321_626 101
1084 3300041512 Ga0451853_2732029 Ga0451853_2732029_106_411 101
1085 3300042004 Ga0439445_0180438 Ga0439445_0180438_203_508 101
1086 3300042127 Ga0450890_010652 Ga0450890_010652_700_1005 101
1087 3300042131 Ga0450894_029561 Ga0450894_029561_125_430 101
1088 3300042133 Ga0450896_096353 Ga0450896_096353_71_376 101
1089 3300042134 Ga0450898_051332 Ga0450898_051332_382_687 101
1090 3300042156 Ga0439446_0167783 Ga0439446_0167783_126_431 101
1091 3300042156 Ga0439446_0249342 Ga0439446_0249342_284_589 101
1092 3300042157 Ga0439458_0102221 Ga0439458_0102221_210_515 101
1093 3300042435 Ga0439434_0308825 Ga0439434_0308825_52_357 101
1094 3300042436 Ga0439435_0010142 Ga0439435_0010142_824_1129 101
1095 3300042438 Ga0439459_0133243 Ga0439459_0133243_81_386 101
1096 3300042530 Ga0450916_025576 Ga0450916_025576_481_786 101
1097 3300042876 Ga0451577_0008727 Ga0451577_0008727_3771_4076 101
1098 3300042876 Ga0451577_0145274 Ga0451577_0145274_1362_1667 101
1099 3300044656 Ga0466969_0003941 Ga0466969_0003941_4300_4605 101
1100 3300044656 Ga0466969_0195423 Ga0466969_0195423_79_384 101
1101 3300044658 Ga0466972_0472510 Ga0466972_0472510_38_343 101
1102 3300044673 Ga0453683_0375398 Ga0453683_0375398_226_531 101
1103 3300044684 Ga0466966_0002570 Ga0466966_0002570_7770_8075 101
1104 3300044684 Ga0466966_0015541 Ga0466966_0015541_189_494 101
1105 3300044684 Ga0466966_0484215 Ga0466966_0484215_200_505 101
1106 3300044693 Ga0466961_0021828 Ga0466961_0021828_3182_3487 101
1107 3300044706 Ga0466964_0000625 Ga0466964_0000625_4656_4961 101
1108 3300044712 Ga0453684_0052092 Ga0453684_0052092_2453_2758 101
1109 3300044712 Ga0453684_0195515 Ga0453684_0195515_929_1234 101
1110 3300044712 Ga0453684_0332911 Ga0453684_0332911_459_764 101
1111 3300044712 Ga0453684_0340103 Ga0453684_0340103_960_1265 101
1112 3300044712 Ga0453684_2276575 Ga0453684_2276575_65_370 101
1113 3300044719 Ga0466971_0001102 Ga0466971_0001102_5866_6171 101
1114 3300044735 Ga0466968_0018375 Ga0466968_0018375_113_418 101
1115 3300044765 Ga0466970_0283586 Ga0466970_0283586_516_821 101
1116 3300044842 Ga0466957_0014712 Ga0466957_0014712_3756_4061 101
1117 3300045049 Ga0466959_0002822 Ga0466959_0002822_6939_7244 101
1118 3300045049 Ga0466959_0027151 Ga0466959_0027151_3182_3487 101
1119 3300045049 Ga0466959_0103445 Ga0466959_0103445_680_985 101
1120 3300045049 Ga0466959_0257685 Ga0466959_0257685_175_480 101
1121 3300045051 Ga0451576_0079035 Ga0451576_0079035_2652_2957 101
1122 3300045051 Ga0451576_0231550 Ga0451576_0231550_1161_1466 101
1123 3300045051 Ga0451576_0488431 Ga0451576_0488431_921_1226 101
1124 3300045051 Ga0451576_0879117 Ga0451576_0879117_477_782 101
1125 3300045051 Ga0451576_1507074 Ga0451576_1507074_125_430 101
1126 3300045976 Ga0466967_0269226 Ga0466967_0269226_609_914 101
1127 3300046452 Ga0495617_066779 Ga0495617_066779_478_783 101
1128 3300046454 Ga0495592_0259242 Ga0495592_0259242_389_694 101
1129 3300046455 Ga0495603_0163745 Ga0495603_0163745_791_1096 101
1130 3300046457 Ga0495590_0063883 Ga0495590_0063883_351_656 101
1131 3300046459 Ga0495629_0159354 Ga0495629_0159354_794_1099 101
1132 3300046459 Ga0495629_0235336 Ga0495629_0235336_639_944 101
1133 3300046460 Ga0495638_0020600 Ga0495638_0020600_3657_3962 101
1134 3300046460 Ga0495638_0023580 Ga0495638_0023580_79_384 101
1135 3300046460 Ga0495638_0074489 Ga0495638_0074489_737_1042 101
1136 3300046460 Ga0495638_0116034 Ga0495638_0116034_1250_1555 101
1137 3300046461 Ga0495641_0101699 Ga0495641_0101699_760_1065 101
1138 3300046462 Ga0495651_0986344 Ga0495651_0986344_66_371 101
1139 3300046471 Ga0495650_0256828 Ga0495650_0256828_69_374 101
1140 3300046472 Ga0495580_0992791 Ga0495580_0992791_75_380 101
1141 3300046473 Ga0495582_0021138 Ga0495582_0021138_1260_1565 101
1142 3300046473 Ga0495582_0218917 Ga0495582_0218917_733_1038 101
1143 3300046475 Ga0495639_0023140 Ga0495639_0023140_1282_1587 101
1144 3300046477 Ga0495664_0661920 Ga0495664_0661920_268_573 101
1145 3300046492 Ga0495585_0124260 Ga0495585_0124260_622_927 101
1146 3300046506 Ga0495583_0022468 Ga0495583_0022468_1592_1897 101
1147 3300046506 Ga0495583_0142270 Ga0495583_0142270_236_541 101
1148 3300046506 Ga0495583_0207707 Ga0495583_0207707_170_475 101
1149 3300046512 Ga0495610_0096636 Ga0495610_0096636_529_834 101
1150 3300046513 Ga0495616_0006494 Ga0495616_0006494_2625_2930 101
1151 3300046513 Ga0495616_0093680 Ga0495616_0093680_981_1286 101
1152 3300046513 Ga0495616_0338126 Ga0495616_0338126_21_326 101
1153 3300046514 Ga0495618_0091215 Ga0495618_0091215_89_394 101
1154 3300046514 Ga0495618_0263098 Ga0495618_0263098_659_964 101
1155 3300046515 Ga0495620_0086369 Ga0495620_0086369_425_730 101
1156 3300046516 Ga0495628_0530413 Ga0495628_0530413_486_791 101
1157 3300046517 Ga0495630_0140489 Ga0495630_0140489_1092_1397 101
1158 3300046517 Ga0495630_0656731 Ga0495630_0656731_47_352 101
1159 3300046517 Ga0495630_0913251 Ga0495630_0913251_304_609 101
1160 3300046519 Ga0495632_0093981 Ga0495632_0093981_334_639 101
1161 3300046519 Ga0495632_0113435 Ga0495632_0113435_867_1172 101
1162 3300046519 Ga0495632_0123602 Ga0495632_0123602_259_564 101
1163 3300046519 Ga0495632_0489639 Ga0495632_0489639_169_474 101
1164 3300046520 Ga0495637_0119817 Ga0495637_0119817_406_711 101
1165 3300046525 Ga0495663_0091107 Ga0495663_0091107_56_361 101
1166 3300046529 Ga0495652_0220478 Ga0495652_0220478_950_1255 101
1167 3300046533 Ga0495640_0102492 Ga0495640_0102492_1184_1489 101
1168 3300046535 Ga0495586_0869142 Ga0495586_0869142_37_342 101
1169 3300046536 Ga0495587_0105962 Ga0495587_0105962_659_964 101
1170 3300046537 Ga0495598_0186638 Ga0495598_0186638_191_496 101
1171 3300046538 Ga0495609_0186064 Ga0495609_0186064_268_573 101
1172 3300046542 Ga0495597_0317500 Ga0495597_0317500_283_588 101
1173 3300046543 Ga0495645_0354218 Ga0495645_0354218_441_746 101
1174 3300046543 Ga0495645_0522972 Ga0495645_0522972_228_533 101
1175 3300046557 Ga0495622_0117795 Ga0495622_0117795_210_515 101
1176 3300046616 Ga0495668_0164067 Ga0495668_0164067_18_323 101
1177 3300046642 Ga0495634_0149361 Ga0495634_0149361_497_802 101
1178 3300046642 Ga0495634_0227438 Ga0495634_0227438_183_488 101
1179 3300046660 Ga0495625_0020303 Ga0495625_0020303_1101_1406 101
1180 3300046660 Ga0495625_0102533 Ga0495625_0102533_874_1179 101
1181 3300046660 Ga0495625_0138933 Ga0495625_0138933_241_546 101
1182 3300046660 Ga0495625_0220280 Ga0495625_0220280_170_475 101
1183 3300046660 Ga0495625_0377859 Ga0495625_0377859_166_471 101
1184 3300046660 Ga0495625_0441025 Ga0495625_0441025_153_458 101
1185 3300046660 Ga0495625_0595743 Ga0495625_0595743_108_413 101
1186 3300046664 Ga0495659_0077302 Ga0495659_0077302_521_826 101
1187 3300046678 Ga0495599_0086546 Ga0495599_0086546_706_1011 101
1188 3300046678 Ga0495599_0385745 Ga0495599_0385745_81_386 101
1189 3300046679 Ga0495623_0376314 Ga0495623_0376314_37_342 101
1190 3300046681 Ga0495647_0090860 Ga0495647_0090860_209_514 101
1191 3300046681 Ga0495647_0179329 Ga0495647_0179329_172_477 101
1192 3300046681 Ga0495647_0180487 Ga0495647_0180487_567_872 101
1193 3300046683 Ga0495658_0011888 Ga0495658_0011888_3608_3913 101
1194 3300046683 Ga0495658_0027894 Ga0495658_0027894_459_764 101
1195 3300046683 Ga0495658_0166619 Ga0495658_0166619_302_607 101
1196 3300046689 Ga0495613_0215026 Ga0495613_0215026_743_1048 101
1197 3300046689 Ga0495613_0724512 Ga0495613_0724512_183_488 101
1198 3300046690 Ga0495624_0670704 Ga0495624_0670704_254_559 101
1199 3300046691 Ga0495670_0042455 Ga0495670_0042455_332_637 101
1200 3300046691 Ga0495670_0564651 Ga0495670_0564651_199_504 101
1201 3300046692 Ga0495671_0253568 Ga0495671_0253568_264_569 101
1202 3300046692 Ga0495671_0295587 Ga0495671_0295587_51_356 101
1203 3300046694 Ga0495649_0509840 Ga0495649_0509840_43_348 101
1204 3300046794 Ga0495589_0119441 Ga0495589_0119441_841_1146 101
1205 3300046794 Ga0495589_0389293 Ga0495589_0389293_196_501 101
1206 3300046809 Ga0495600_0123643 Ga0495600_0123643_305_610 101
1207 3300046810 Ga0495660_0528220 Ga0495660_0528220_133_438 101
1208 3300047317 Ga0495604_0208301 Ga0495604_0208301_1024_1329 101
1209 3300047317 Ga0495604_0502222 Ga0495604_0502222_337_642 101
1210 3300047319 Ga0495674_0250348 Ga0495674_0250348_519_824 101
1211 3300047320 Ga0495672_0312795 Ga0495672_0312795_93_398 101
1212 3300047320 Ga0495672_0437206 Ga0495672_0437206_188_493 101
1213 3300047320 Ga0495672_0555305 Ga0495672_0555305_56_361 101
1214 3300047322 Ga0495680_0062566 Ga0495680_0062566_1050_1355 101
1215 3300047322 Ga0495680_0383518 Ga0495680_0383518_242_547 101
1216 3300047323 Ga0495683_0243794 Ga0495683_0243794_157_462 101
1217 3300047323 Ga0495683_0288146 Ga0495683_0288146_96_401 101
1218 3300047443 Ga0495687_032507 Ga0495687_032507_860_1165 101
1219 3300047444 Ga0495675_0613493 Ga0495675_0613493_168_473 101
1220 3300047445 Ga0495677_0276222 Ga0495677_0276222_133_438 101
1221 3300047469 Ga0495673_0204943 Ga0495673_0204943_247_552 101
1222 3300047469 Ga0495673_0242607 Ga0495673_0242607_129_434 101
1223 3300047471 Ga0495684_0193885 Ga0495684_0193885_90_395 101
1224 3300047472 Ga0495686_0177695 Ga0495686_0177695_242_547 101
1225 3300048088 Ga0495602_0721799 Ga0495602_0721799_108_413 101
1226 3300048088 Ga0495602_0984899 Ga0495602_0984899_23_328 101
1227 3300048091 Ga0495626_0105620 Ga0495626_0105620_566_871 101
1228 3300048903 Ga0496100_0003550 Ga0496100_0003550_5661_5966 101
1229 3300048903 Ga0496100_0774048 Ga0496100_0774048_116_421 101
1230 3300048903 Ga0496100_0965158 Ga0496100_0965158_242_547 101
1231 3300048903 Ga0496100_1206157 Ga0496100_1206157_177_482 101
1232 3300048904 Ga0496101_0018936 Ga0496101_0018936_2305_2610 101
1233 3300048904 Ga0496101_0777477 Ga0496101_0777477_187_492 101
1234 3300048904 Ga0496101_1211394 Ga0496101_1211394_112_417 101
1235 3300048905 Ga0496102_0006276 Ga0496102_0006276_9129_9434 101
1236 3300048905 Ga0496102_0162163 Ga0496102_0162163_528_833 101
1237 3300048905 Ga0496102_0199613 Ga0496102_0199613_1189_1494 101
1238 3300048905 Ga0496102_0397339 Ga0496102_0397339_451_756 101
1239 3300048906 Ga0496103_0004906 Ga0496103_0004906_3803_4108 101
1240 3300048906 Ga0496103_0425100 Ga0496103_0425100_15_320 101
1241 3300048906 Ga0496103_0714653 Ga0496103_0714653_285_590 101
1242 3300048907 Ga0496104_0000099 Ga0496104_0000099_6904_7209 101
1243 3300048907 Ga0496104_0043605 Ga0496104_0043605_1969_2274 101
1244 3300048907 Ga0496104_0054136 Ga0496104_0054136_459_764 101
1245 3300048907 Ga0496104_0327787 Ga0496104_0327787_760_1065 101
1246 3300048908 Ga0496105_0000021 Ga0496105_0000021_86933_87238 101
1247 3300048908 Ga0496105_0003469 Ga0496105_0003469_4455_4760 101
1248 3300048908 Ga0496105_0010900 Ga0496105_0010900_1089_1394 101
1249 3300048908 Ga0496105_0686706 Ga0496105_0686706_306_611 101
1250 3300048909 Ga0496106_0004678 Ga0496106_0004678_2211_2516 101
1251 3300048909 Ga0496106_0066543 Ga0496106_0066543_1689_1994 101
1252 3300048909 Ga0496106_0183397 Ga0496106_0183397_796_1101 101
1253 3300048909 Ga0496106_0915163 Ga0496106_0915163_43_348 101
1254 3300048910 Ga0496107_0001576 Ga0496107_0001576_10758_11063 101
1255 3300048910 Ga0496107_0039998 Ga0496107_0039998_701_1006 101
1256 3300048911 Ga0496108_0002086 Ga0496108_0002086_3318_3623 101
1257 3300048911 Ga0496108_0140105 Ga0496108_0140105_167_472 101
1258 3300048911 Ga0496108_0168503 Ga0496108_0168503_1199_1504 101
1259 3300048911 Ga0496108_0397727 Ga0496108_0397727_327_632 101
1260 3300048912 Ga0496109_0006030 Ga0496109_0006030_7458_7763 101
1261 3300048912 Ga0496109_0618045 Ga0496109_0618045_445_750 101
1262 3300048912 Ga0496109_0653774 Ga0496109_0653774_251_556 101
1263 3300048913 Ga0496110_0005639 Ga0496110_0005639_2091_2396 101
1264 3300048914 Ga0496111_0003878 Ga0496111_0003878_4844_5149 101
1265 3300048915 Ga0496112_0009054 Ga0496112_0009054_1397_1702 101
1266 3300048915 Ga0496112_0574714 Ga0496112_0574714_551_856 101
1267 3300048915 Ga0496112_0588092 Ga0496112_0588092_488_793 101
1268 3300048915 Ga0496112_1343895 Ga0496112_1343895_307_612 101
1269 3300048916 Ga0496113_0106557 Ga0496113_0106557_993_1298 101
1270 3300048916 Ga0496113_0536021 Ga0496113_0536021_205_510 101
1271 3300048917 Ga0496114_0002220 Ga0496114_0002220_6970_7275 101
1272 3300048917 Ga0496114_0009046 Ga0496114_0009046_5975_6280 101
1273 3300048917 Ga0496114_0017246 Ga0496114_0017246_4681_4986 101
1274 3300048917 Ga0496114_1184832 Ga0496114_1184832_224_529 101
1275 3300048918 Ga0496115_0005471 Ga0496115_0005471_1449_1754 101
1276 3300048918 Ga0496115_0137279 Ga0496115_0137279_1272_1577 101
1277 3300048918 Ga0496115_0201742 Ga0496115_0201742_719_1024 101
1278 3300048918 Ga0496115_0259538 Ga0496115_0259538_564_869 101
1279 3300048918 Ga0496115_0355670 Ga0496115_0355670_630_935 101
1280 3300048918 Ga0496115_0884241 Ga0496115_0884241_65_370 101
1281 3300048919 Ga0496116_0276692 Ga0496116_0276692_188_493 101
1282 3300048920 Ga0496117_0548477 Ga0496117_0548477_129_434 101
1283 3300048921 Ga0496118_0013267 Ga0496118_0013267_943_1248 101
1284 3300048921 Ga0496118_0609783 Ga0496118_0609783_36_341 101
1285 3300048922 Ga0496119_0281602 Ga0496119_0281602_45_350 101
1286 3300048922 Ga0496119_0530017 Ga0496119_0530017_101_406 101
1287 3300048923 Ga0496120_0269452 Ga0496120_0269452_442_747 101
1288 3300048923 Ga0496120_0413403 Ga0496120_0413403_187_492 101
1289 3300048924 Ga0496121_0000704 Ga0496121_0000704_60153_60458 101
1290 3300048927 Ga0496124_0370756 Ga0496124_0370756_201_506 101
1291 3300048928 Ga0496125_0005100 Ga0496125_0005100_14045_14350 101
1292 3300048928 Ga0496125_0050036 Ga0496125_0050036_185_490 101
1293 3300048928 Ga0496125_0124580 Ga0496125_0124580_1119_1424 101
1294 3300048928 Ga0496125_0419979 Ga0496125_0419979_59_364 101
1295 3300048929 Ga0496126_0004928 Ga0496126_0004928_8219_8524 101
1296 3300048929 Ga0496126_0098679 Ga0496126_0098679_1147_1452 101
1297 3300049460 Ga0495682_0049136 Ga0495682_0049136_476_781 101
1298 3300049568 Ga0501031_0579094 Ga0501031_0579094_135_440 101
1299 3300049569 Ga0501032_0186687 Ga0501032_0186687_925_1230 101
1300 3300049569 Ga0501032_0911698 Ga0501032_0911698_111_416 101
1301 3300049569 Ga0501032_1037062 Ga0501032_1037062_171_476 101
1302 3300049570 Ga0501033_0049659 Ga0501033_0049659_1113_1418 101
1303 3300049570 Ga0501033_0290223 Ga0501033_0290223_417_722 101
1304 3300049572 Ga0501036_0023621 Ga0501036_0023621_1115_1420 101
1305 3300049572 Ga0501036_0048255 Ga0501036_0048255_2853_3158 101
1306 3300049573 Ga0501037_0024581 Ga0501037_0024581_3692_3997 101
1307 3300049573 Ga0501037_0071416 Ga0501037_0071416_45_350 101
1308 3300049574 Ga0501038_0015092 Ga0501038_0015092_2701_3006 101
1309 3300049574 Ga0501038_0090870 Ga0501038_0090870_360_665 101
1310 3300049574 Ga0501038_0189643 Ga0501038_0189643_1231_1536 101
1311 3300049575 Ga0501039_0021546 Ga0501039_0021546_4205_4510 101
1312 3300049575 Ga0501039_0115981 Ga0501039_0115981_880_1185 101
1313 3300049575 Ga0501039_0451889 Ga0501039_0451889_420_725 101
1314 3300049575 Ga0501039_0702981 Ga0501039_0702981_17_322 101
1315 3300049576 Ga0501040_0008066 Ga0501040_0008066_5581_5886 101
1316 3300049576 Ga0501040_0044091 Ga0501040_0044091_203_508 101
1317 3300049577 Ga0501041_0001598 Ga0501041_0001598_2340_2645 101
1318 3300049577 Ga0501041_0119305 Ga0501041_0119305_387_692 101
1319 3300049578 Ga0501042_0001373 Ga0501042_0001373_6763_7068 101
1320 3300049578 Ga0501042_0158721 Ga0501042_0158721_165_470 101
1321 3300049579 Ga0501043_0418507 Ga0501043_0418507_468_773 101
1322 3300049580 Ga0501046_0015243 Ga0501046_0015243_3020_3325 101
1323 3300049580 Ga0501046_0105554 Ga0501046_0105554_822_1127 101
1324 3300049581 Ga0501047_0148132 Ga0501047_0148132_1124_1429 101
1325 3300049581 Ga0501047_0364875 Ga0501047_0364875_490_795 101
1326 3300049582 Ga0501048_0009558 Ga0501048_0009558_1225_1530 101
1327 3300049582 Ga0501048_0067468 Ga0501048_0067468_790_1095 101
1328 3300049582 Ga0501048_0309943 Ga0501048_0309943_37_342 101
1329 3300049583 Ga0501067_0031483 Ga0501067_0031483_2492_2797 101
1330 3300049583 Ga0501067_0138286 Ga0501067_0138286_634_939 101
1331 3300049583 Ga0501067_0163247 Ga0501067_0163247_563_868 101
1332 3300049584 Ga0501068_0001465 Ga0501068_0001465_5865_6170 101
1333 3300049584 Ga0501068_0041518 Ga0501068_0041518_2222_2527 101
1334 3300049584 Ga0501068_0404347 Ga0501068_0404347_133_438 101
1335 3300049585 Ga0501069_0392696 Ga0501069_0392696_276_581 101
1336 3300049586 Ga0501070_0044235 Ga0501070_0044235_1702_2007 101
1337 3300049587 Ga0501071_0003527 Ga0501071_0003527_8826_9131 101
1338 3300049587 Ga0501071_0024289 Ga0501071_0024289_1218_1523 101
1339 3300049587 Ga0501071_0144858 Ga0501071_0144858_235_540 101
1340 3300049588 Ga0501072_0025385 Ga0501072_0025385_4014_4319 101
1341 3300049588 Ga0501072_0063312 Ga0501072_0063312_554_859 101
1342 3300049589 Ga0501073_0000525 Ga0501073_0000525_8382_8687 101
1343 3300049589 Ga0501073_0122379 Ga0501073_0122379_1323_1628 101
1344 3300049590 Ga0501074_0001124 Ga0501074_0001124_13648_13953 101
1345 3300049590 Ga0501074_0089815 Ga0501074_0089815_732_1037 101
1346 3300049590 Ga0501074_0222352 Ga0501074_0222352_887_1192 101
1347 3300049591 Ga0501075_0015597 Ga0501075_0015597_2958_3263 101
1348 3300049591 Ga0501075_0055471 Ga0501075_0055471_1509_1814 101
1349 3300049591 Ga0501075_0231797 Ga0501075_0231797_506_811 101
1350 3300049592 Ga0501076_0004639 Ga0501076_0004639_5859_6164 101
1351 3300049592 Ga0501076_0022764 Ga0501076_0022764_437_742 101
1352 3300049592 Ga0501076_0028505 Ga0501076_0028505_3373_3678 101
1353 3300049593 Ga0501077_0002875 Ga0501077_0002875_2182_2487 101
1354 3300049593 Ga0501077_0007629 Ga0501077_0007629_2741_3046 101
1355 3300049593 Ga0501077_0029086 Ga0501077_0029086_387_692 101
1356 3300049704 Ga0501221_202380 Ga0501221_202380_144_449 101
1357 3300049706 Ga0501229_020387 Ga0501229_020387_174_479 101
1358 3300049741 Ga0501079_0004772 Ga0501079_0004772_2006_2311 101
1359 3300049741 Ga0501079_0006996 Ga0501079_0006996_764_1069 101
1360 3300049741 Ga0501079_0179169 Ga0501079_0179169_899_1204 101
1361 3300049742 Ga0501080_0001373 Ga0501080_0001373_7677_7982 101
1362 3300049742 Ga0501080_0011395 Ga0501080_0011395_925_1230 101
1363 3300049742 Ga0501080_0037660 Ga0501080_0037660_3780_4085 101
1364 3300049742 Ga0501080_0794587 Ga0501080_0794587_484_789 101
1365 3300049742 Ga0501080_0865037 Ga0501080_0865037_100_405 101
1366 3300049742 Ga0501080_1063857 Ga0501080_1063857_142_447 101
1367 3300049743 Ga0501081_0006719 Ga0501081_0006719_4747_5052 101
1368 3300049743 Ga0501081_0018126 Ga0501081_0018126_387_692 101
1369 3300049744 Ga0501083_0004501 Ga0501083_0004501_2951_3256 101
1370 3300049744 Ga0501083_0032077 Ga0501083_0032077_1223_1528 101
1371 3300049744 Ga0501083_0067453 Ga0501083_0067453_447_752 101
1372 3300049744 Ga0501083_0079781 Ga0501083_0079781_137_442 101
1373 3300049822 Ga0501035_0416594 Ga0501035_0416594_445_750 101
1374 3300049822 Ga0501035_0532215 Ga0501035_0532215_584_889 101
1375 3300049822 Ga0501035_0950616 Ga0501035_0950616_17_322 101
1376 3300049823 Ga0501044_0413807 Ga0501044_0413807_156_461 101
1377 3300049823 Ga0501044_1078751 Ga0501044_1078751_20_325 101
1378 3300049824 Ga0501045_0008747 Ga0501045_0008747_4094_4399 101
1379 3300049824 Ga0501045_0084307 Ga0501045_0084307_573_878 101
1380 3300050491 nmdc:mga00v17_416636_c1 nmdc:mga00v17_416636_c1_371_676 101
1381 3300050493 nmdc:mga0k408_129650_c1 nmdc:mga0k408_129650_c1_1164_1469 101
1382 3300050493 nmdc:mga0k408_210024_c1 nmdc:mga0k408_210024_c1_315_620 101
1383 3300050493 nmdc:mga0k408_403038_c1 nmdc:mga0k408_403038_c1_304_609 101
1384 3300050493 nmdc:mga0k408_620355_c1 nmdc:mga0k408_620355_c1_296_601 101
1385 3300050493 nmdc:mga0k408_65172_c1 nmdc:mga0k408_65172_c1_404_709 101
1386 3300050494 nmdc:mga06z11_249605_c1 nmdc:mga06z11_249605_c1_544_849 101
1387 3300050494 nmdc:mga06z11_526216_c1 nmdc:mga06z11_526216_c1_134_439 101
1388 3300050495 nmdc:mga04h51_191481_c1 nmdc:mga04h51_191481_c1_182_487 101
1389 3300050496 nmdc:mga07m45_427265_c1 nmdc:mga07m45_427265_c1_181_486 101
1390 3300050496 nmdc:mga07m45_463706_c1 nmdc:mga07m45_463706_c1_118_423 101
1391 3300050496 nmdc:mga07m45_490894_c1 nmdc:mga07m45_490894_c1_39_344 101
1392 3300050496 nmdc:mga07m45_826988_c1 nmdc:mga07m45_826988_c1_136_441 101
1393 3300050508 nmdc:mga09592_404099_c1 nmdc:mga09592_404099_c1_376_681 101
1394 3300050509 nmdc:mga0qj67_1159723_c1 nmdc:mga0qj67_1159723_c1_53_358 101
1395 3300050509 nmdc:mga0qj67_1182304_c1 nmdc:mga0qj67_1182304_c1_71_376 101
1396 3300050511 nmdc:mga08y16_397291_c1 nmdc:mga08y16_397291_c1_1061_1366 101
1397 3300050513 nmdc:mga0rr50_62474_c1 nmdc:mga0rr50_62474_c1_2342_2647 101
1398 3300050515 nmdc:mga0a205_803976_c1 nmdc:mga0a205_803976_c1_164_469 101
1399 3300053077 Ga0495601_0301989 Ga0495601_0301989_230_535 101
1400 3300053077 Ga0495601_0375658 Ga0495601_0375658_426_731 101
1401 3300053078 Ga0495612_0422317 Ga0495612_0422317_238_543 101
1402 3300053083 Ga0495655_0027539 Ga0495655_0027539_979_1284 101
1403 3300053085 Ga0495619_0091313 Ga0495619_0091313_659_964 101
1404 3300053088 Ga0500644_0024450 Ga0500644_0024450_1088_1393 101
1405 3300053088 Ga0500644_0061778 Ga0500644_0061778_301_606 101
1406 3300053088 Ga0500644_0093414 Ga0500644_0093414_592_897 101
1407 3300053090 Ga0500646_0034024 Ga0500646_0034024_265_570 101
1408 3300053092 Ga0500583_0002507 Ga0500583_0002507_973_1278 101
1409 3300053092 Ga0500583_0041097 Ga0500583_0041097_1380_1685 101
1410 3300053096 Ga0500641_0069032 Ga0500641_0069032_755_1060 101
1411 3300053096 Ga0500641_0105565 Ga0500641_0105565_384_689 101
1412 3300053096 Ga0500641_0180809 Ga0500641_0180809_46_351 101
1413 3300053097 Ga0500648_185932 Ga0500648_185932_520_825 101
1414 3300053109 Ga0500569_074574 Ga0500569_074574_520_825 101
1415 3300053118 Ga0500594_0090275 Ga0500594_0090275_316_621 101
1416 3300053120 Ga0500597_287311 Ga0500597_287311_244_549 101
1417 3300053126 Ga0500621_165278 Ga0500621_165278_444_749 101
1418 3300053126 Ga0500621_239922 Ga0500621_239922_169_474 101
1419 3300053127 Ga0500623_241004 Ga0500623_241004_283_588 101
1420 3300053130 Ga0500642_0084229 Ga0500642_0084229_34_339 101
1421 3300053130 Ga0500642_0147518 Ga0500642_0147518_385_690 101
1422 3300053131 Ga0500652_095300 Ga0500652_095300_177_482 101
1423 3300053139 Ga0500568_0017821 Ga0500568_0017821_2613_2918 101
1424 3300053147 Ga0500589_240462 Ga0500589_240462_313_618 101
1425 3300053153 Ga0500616_0000499 Ga0500616_0000499_43295_43600 101
1426 3300053153 Ga0500616_0007626 Ga0500616_0007626_2922_3227 101
1427 3300053156 Ga0500622_0003284 Ga0500622_0003284_7319_7624 101
1428 3300053158 Ga0500627_0283306 Ga0500627_0283306_307_612 101
1429 3300053159 Ga0500630_113114 Ga0500630_113114_268_573 101
1430 3300053163 Ga0500639_292615 Ga0500639_292615_53_358 101
1431 3300053177 Ga0500636_0329121 Ga0500636_0329121_314_619 101
1432 3300053178 Ga0500637_0239922 Ga0500637_0239922_320_625 101
1433 3300053727 Ga0500611_066042 Ga0500611_066042_111_416 101
1434 3300054114 Ga0501084_0008704 Ga0501084_0008704_1325_1630 101
1435 3300054114 Ga0501084_0022568 Ga0501084_0022568_2920_3225 101
1436 3300054114 Ga0501084_0144399 Ga0501084_0144399_460_765 101
1437 3300054114 Ga0501084_1367973 Ga0501084_1367973_97_402 101
1438 3300059424 Ga0590075_024840 Ga0590075_024840_438_743 101
1439 3300059424 Ga0590075_092399 Ga0590075_092399_260_565 101
1440 3300059426 Ga0590077_032183 Ga0590077_032183_196_501 101
1441 3300059426 Ga0590077_115504 Ga0590077_115504_205_510 101
1442 3300059490 Ga0587066_011018 Ga0587066_011018_886_1191 101
1443 3300059491 Ga0587070_211754 Ga0587070_211754_56_361 101
1444 3300059492 Ga0587073_0063602 Ga0587073_0063602_292_597 101
1445 3300059492 Ga0587073_0206325 Ga0587073_0206325_99_404 101
1446 3300059493 Ga0587077_005133 Ga0587077_005133_817_1122 101
1447 3300059493 Ga0587077_020561 Ga0587077_020561_408_713 101
1448 3300059503 Ga0587080_004278 Ga0587080_004278_1337_1642 101
1449 3300059505 Ga0587083_0015822 Ga0587083_0015822_274_579 101
1450 3300059505 Ga0587083_0029935 Ga0587083_0029935_419_724 101
1451 3300059508 Ga0587088_005875 Ga0587088_005875_560_865 101
1452 3300059510 Ga0587090_007160 Ga0587090_007160_770_1075 101
1453 3300059513 Ga0587094_013915 Ga0587094_013915_665_970 101
1454 3300059605 Ga0587106_017423 Ga0587106_017423_525_830 101
1455 3300059624 Ga0587109_008544 Ga0587109_008544_199_504 101
1456 3300059630 Ga0587128_094305 Ga0587128_094305_228_533 101
1457 3300059631 Ga0587130_039456 Ga0587130_039456_64_369 101
1458 3300059639 Ga0587062_011923 Ga0587062_011923_555_860 101
1459 3300059640 Ga0587067_014519 Ga0587067_014519_893_1198 101
1460 3300059640 Ga0587067_021127 Ga0587067_021127_375_680 101
1461 3300059641 Ga0587068_042614 Ga0587068_042614_466_771 101
1462 3300059641 Ga0587068_045700 Ga0587068_045700_247_552 101
1463 3300059644 Ga0587075_018539 Ga0587075_018539_474_779 101
1464 3300059645 Ga0587076_014586 Ga0587076_014586_654_959 101
1465 3300059645 Ga0587076_038507 Ga0587076_038507_506_811 101
1466 3300059645 Ga0587076_157098 Ga0587076_157098_43_348 101
1467 3300059654 Ga0587110_028294 Ga0587110_028294_46_351 101
1468 3300060344 Ga0587071_070132 Ga0587071_070132_414_719 101
1469 3300060346 Ga0587111_0035975 Ga0587111_0035975_71_376 101
1470 3300060346 Ga0587111_0190869 Ga0587111_0190869_71_376 101
1471 3300060353 Ga0501082_0004231 Ga0501082_0004231_10182_10487 101
1472 3300060353 Ga0501082_0043889 Ga0501082_0043889_2650_2955 101
1473 3300060353 Ga0501082_0087089 Ga0501082_0087089_798_1103 101
1474 3300061719 Ga0466962_0001207 Ga0466962_0001207_3827_4132 101
1475 3300061734 Ga0530510_0007174 Ga0530510_0007174_4391_4696 101
1476 3300061734 Ga0530510_0170978 Ga0530510_0170978_316_621 101
1477 3300061734 Ga0530510_0398438 Ga0530510_0398438_326_631 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

47

100

0.98

Feature Viewer

pLDDT pTM Quality
73.52 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map