F494153

General Info

Members Datasets Scaffolds Average Seq Length
1464 508 1448 415

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10013627|Ga0105250_100136273
Length 486
Sequence MTRKPLDLGGIDAGHAGFSGDHADDLIIWVSAVVAARRPHRYVYAPFQAGARGFRAGRLLAPFGAHGNVMARLVMKFGGTSVADLDRIRNVARHVKREVDAGYDVVVVVSAMAGVTNQLVEWCRQAAMLHDAREYDAVVATGEQVTAGLLALVLEGMGVNARSWQGWQLPILTDNAHASARILNVNGTELIKRFKEHGQVAVIAGFQGMHGDTGRVTTLGRGGSDTSAVAIASAIGAERCDIYTDVDGVYTTDPRVVPQAHRMDKIAYEEMLEFASLGAKVMQVRSVELGMVHNVRIFVRSSFDKPEDIDPKKPPSGTLICDEGDIVEQQVVTGIAFSKDEAQISIRRVQDKPGVAAAIFGPLADNNVNVDMIVQNVSADGATTDLTFTVPSADYERARMTLDKAKGAIGYERLDGATDVAKVSVIGIGMRSHAGVAAKAFKALSGQKINILAITTSEIKFSVLIKAAQTDLAVRTLHTLYGLDRP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
5 2643221651 Afipia sp. Root123D2 Isolate Unclassified
6 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
7 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
8 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
9 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
13 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
14 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
15 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
16 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
17 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
18 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
19 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
20 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
29 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
30 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
31 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
32 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
33 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
34 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
35 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
36 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
37 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
116 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
117 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
122 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
123 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
124 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
125 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
126 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
127 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
128 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
129 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
135 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
136 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
142 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
170 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
175 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
176 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
177 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
247 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
260 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
261 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
262 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
263 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
267 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
268 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
269 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
270 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
271 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
272 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
273 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
274 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
278 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
281 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
282 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
283 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
284 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
288 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
289 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
290 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
291 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
292 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
293 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
295 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
297 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
298 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
299 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
300 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
301 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
302 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
303 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
304 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
305 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
306 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
307 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
308 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
311 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
319 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
320 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
321 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
322 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
325 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
326 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
327 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
328 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
329 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
330 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
331 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
332 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
333 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
334 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
335 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
336 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
337 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
338 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
339 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
340 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
341 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
342 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
343 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
349 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
350 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
351 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
355 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
356 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
357 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
358 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
359 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
360 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
363 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
364 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
365 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
366 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
369 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
370 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
371 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
372 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
373 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
374 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
375 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
376 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
377 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
378 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
379 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
380 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
381 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
382 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
383 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
384 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
385 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
388 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
389 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
390 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
391 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
392 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
393 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
394 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
395 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
396 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
397 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
398 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
399 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
400 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
401 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
402 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
403 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
404 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
405 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
406 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
407 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
408 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
409 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
410 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
411 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
412 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
413 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
414 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
415 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
416 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
417 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
418 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
419 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
420 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
421 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
422 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
423 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
424 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
425 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
426 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
427 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
428 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
429 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
430 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
431 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
432 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
433 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
434 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
435 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
438 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
439 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
440 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
441 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
442 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
443 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
444 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
457 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
458 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
461 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
462 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
463 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
464 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
465 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
466 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
467 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
468 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
469 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
470 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
473 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
479 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
480 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
481 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
482 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
483 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
484 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
485 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
486 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
487 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
488 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
489 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
490 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
491 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
492 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
493 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
494 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
495 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
496 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
497 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
498 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
499 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
500 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
503 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
504 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
505 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
506 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
507 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
508 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.07
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0.2
Rhizoplane 6.35
Rhizosphere 88.46
Stem 0
Stem Tuber 0.07
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745200 2209111006 Bacteria 16385
2 ARcpr5oldR_c000003 3300000041 Bacteria 66110
3 ARSoilYngRDRAFT_c00037 3300000042 Bacteria 21051
4 ARcpr5yngRDRAFT_c000010 3300000043 Bacteria 36497
5 ARSoilOldRDRAFT_c000045 3300000044 Bacteria 25938
6 ARCol0yngRDRAFT_1000086 3300000652 Bacteria 17270
7 JGI24741J21665_1005824 3300001915 Bacteria 2530
8 JGI24741J21665_1006916 3300001915 Bacteria 2238
9 JGI24746J21847_1000225 3300001977 Bacteria 7752
10 JGI24740J21852_10018132 3300001979 Bacteria 2505
11 JGI24740J21852_10032414 3300001979 Bacteria 1671
12 JGI24739J22299_10000887 3300001989 Bacteria 11064
13 JGI24739J22299_10002234 3300001989 Bacteria 7439
14 JGI24739J22299_10007003 3300001989 Bacteria 4246
15 JGI24737J22298_10000286 3300001990 Bacteria 16793
16 JGI24737J22298_10018510 3300001990 Bacteria 2235
17 JGI24737J22298_10023419 3300001990 Bacteria 1959
18 JGI24743J22301_10001925 3300001991 Bacteria 3016
19 JGI24743J22301_10004783 3300001991 Bacteria 2225
20 JGI24735J21928_10001811 3300002067 Bacteria 7508
21 JGI24735J21928_10002726 3300002067 Bacteria 6093
22 JGI24750J21931_1000044 3300002070 Bacteria 16702
23 JGI24750J21931_1001976 3300002070 Bacteria 2504
24 JGI24748J21848_1003070 3300002074 Bacteria 1903
25 JGI24738J21930_10000666 3300002075 Bacteria 9974
26 JGI24738J21930_10003659 3300002075 Bacteria 3851
27 JGI24749J21850_1002556 3300002076 Bacteria 2555
28 JGI24744J21845_10001499 3300002077 Bacteria 4642
29 JGI24744J21845_10008784 3300002077 Bacteria 2076
30 JGI24035J26624_1000205 3300002126 Bacteria 5357
31 JGI24034J26672_10000348 3300002239 Bacteria 6015
32 JGI24742J22300_10000091 3300002244 Bacteria 13233
33 JGI24751J29686_10009779 3300002459 Bacteria 1975
34 JGI25406J46586_10033627 3300003203 Bacteria 1891
35 JGI25404J52841_10005123 3300003659 Bacteria 2699
36 Ga0055530_10006443 3300003791 Bacteria 5242
37 Ga0065716_1001671 3300005277 Bacteria 4329
38 Ga0065712_10001083 3300005290 Bacteria 9078
39 Ga0065712_10016249 3300005290 Bacteria 1799
40 Ga0065712_10081197 3300005290 Bacteria 3029
41 Ga0065715_10089726 3300005293 Bacteria 8711
42 Ga0070658_10000264 3300005327 Bacteria 46199
43 Ga0070658_10002220 3300005327 Bacteria 16299
44 Ga0070658_10008993 3300005327 Bacteria 8030
45 Ga0070658_10010453 3300005327 Bacteria 7444
46 Ga0070658_10022506 3300005327 Bacteria 5058
47 Ga0070658_10049510 3300005327 Bacteria 3404
48 Ga0070658_10124174 3300005327 Bacteria 2147
49 Ga0070658_10126593 3300005327 Bacteria 2127
50 Ga0070676_10000186 3300005328 Bacteria 25797
51 Ga0070676_10025905 3300005328 Bacteria 3318
52 Ga0070676_10102088 3300005328 Bacteria 1773
53 Ga0070683_100000064 3300005329 Bacteria 76343
54 Ga0070683_100037722 3300005329 Bacteria 4424
55 Ga0070683_100096585 3300005329 Bacteria 2779
56 Ga0070683_100231247 3300005329 Bacteria 1758
57 Ga0070690_100055973 3300005330 Bacteria 2527
58 Ga0070690_100078858 3300005330 Bacteria 2152
59 Ga0070670_100002541 3300005331 Bacteria 15048
60 Ga0070670_100006533 3300005331 Bacteria 9875
61 Ga0070670_100007186 3300005331 Bacteria 9432
62 Ga0070670_100011611 3300005331 Bacteria 7529
63 Ga0070670_100024387 3300005331 Bacteria 5201
64 Ga0070670_100036861 3300005331 Bacteria 4207
65 Ga0070670_100062640 3300005331 Bacteria 3193
66 Ga0070670_100187930 3300005331 Bacteria 1794
67 Ga0070677_10000050 3300005333 Bacteria 37198
68 Ga0070677_10027622 3300005333 Bacteria 2138
69 Ga0068869_100000191 3300005334 Bacteria 31688
70 Ga0068869_100027748 3300005334 Bacteria 3950
71 Ga0068869_100149583 3300005334 Bacteria 1810
72 Ga0070666_10022428 3300005335 Bacteria 4099
73 Ga0070666_10056441 3300005335 Bacteria 2652
74 Ga0070666_10059573 3300005335 Bacteria 2582
75 Ga0070680_100007728 3300005336 Bacteria 8193
76 Ga0070680_100066516 3300005336 Bacteria 2955
77 Ga0070680_100142711 3300005336 Bacteria 2008
78 Ga0070680_100196106 3300005336 Bacteria 1702
79 Ga0070682_100001714 3300005337 Bacteria 12197
80 Ga0070682_100035477 3300005337 Bacteria 3045
81 Ga0070682_100069856 3300005337 Bacteria 2243
82 Ga0070682_100096978 3300005337 Bacteria 1939
83 Ga0068868_100000233 3300005338 Bacteria 37955
84 Ga0068868_100032246 3300005338 Bacteria 4029
85 Ga0070660_100000091 3300005339 Bacteria 54397
86 Ga0070660_100004304 3300005339 Bacteria 9834
87 Ga0070660_100005461 3300005339 Bacteria 8800
88 Ga0070660_100064748 3300005339 Bacteria 2844
89 Ga0070660_100117995 3300005339 Bacteria 2116
90 Ga0070660_100119041 3300005339 Bacteria 2106
91 Ga0070660_100165159 3300005339 Bacteria 1786
92 Ga0070689_100006518 3300005340 Bacteria 8093
93 Ga0070689_100113223 3300005340 Bacteria 2160
94 Ga0070691_10006662 3300005341 Bacteria 5287
95 Ga0070691_10022854 3300005341 Bacteria 2903
96 Ga0070691_10037130 3300005341 Bacteria 2298
97 Ga0070687_100000337 3300005343 Bacteria 15983
98 Ga0070687_100010015 3300005343 Bacteria 4080
99 Ga0070687_100050606 3300005343 Bacteria 2146
100 Ga0070687_100134806 3300005343 Bacteria 1430
101 Ga0070661_100000188 3300005344 Bacteria 51025
102 Ga0070661_100006306 3300005344 Bacteria 8181
103 Ga0070661_100018063 3300005344 Bacteria 5011
104 Ga0070661_100057653 3300005344 Bacteria 2846
105 Ga0070661_100085828 3300005344 Bacteria 2326
106 Ga0070661_100087437 3300005344 Bacteria 2305
107 Ga0070661_100160492 3300005344 Bacteria 1702
108 Ga0070692_10050483 3300005345 Bacteria 2160
109 Ga0070692_10056796 3300005345 Bacteria 2050
110 Ga0070692_10069571 3300005345 Bacteria 1872
111 Ga0070668_100000409 3300005347 Bacteria 28506
112 Ga0070669_100000523 3300005353 Bacteria 28564
113 Ga0070669_100062266 3300005353 Bacteria 2743
114 Ga0070675_100000034 3300005354 Bacteria 87135
115 Ga0070675_100002418 3300005354 Bacteria 13921
116 Ga0070675_100016370 3300005354 Bacteria 5885
117 Ga0070675_100092638 3300005354 Bacteria 2533
118 Ga0070671_100000111 3300005355 Bacteria 52298
119 Ga0070671_100001584 3300005355 Bacteria 17103
120 Ga0070671_100010789 3300005355 Bacteria 7331
121 Ga0070671_100011792 3300005355 Bacteria 7031
122 Ga0070671_100018174 3300005355 Bacteria 5708
123 Ga0070671_100019157 3300005355 Bacteria 5567
124 Ga0070671_100045533 3300005355 Bacteria 3647
125 Ga0070671_100083737 3300005355 Bacteria 2667
126 Ga0070671_100116863 3300005355 Bacteria 2243
127 Ga0070674_100003026 3300005356 Bacteria 9349
128 Ga0070674_100035850 3300005356 Bacteria 3325
129 Ga0070674_100063764 3300005356 Bacteria 2580
130 Ga0070673_100001357 3300005364 Bacteria 14305
131 Ga0070673_100008515 3300005364 Bacteria 6823
132 Ga0070673_100153387 3300005364 Bacteria 1953
133 Ga0070673_100169148 3300005364 Bacteria 1864
134 Ga0070688_100000401 3300005365 Bacteria 21994
135 Ga0070688_100052107 3300005365 Bacteria 2555
136 Ga0070688_100054570 3300005365 Bacteria 2503
137 Ga0070688_100071567 3300005365 Bacteria 2220
138 Ga0070659_100002194 3300005366 Bacteria 13899
139 Ga0070659_100005493 3300005366 Bacteria 9108
140 Ga0070659_100114249 3300005366 Bacteria 2181
141 Ga0070659_100117346 3300005366 Bacteria 2152
142 Ga0070659_100132646 3300005366 Bacteria 2024
143 Ga0070659_100139737 3300005366 Bacteria 1972
144 Ga0070659_100187150 3300005366 Bacteria 1701
145 Ga0070659_100192052 3300005366 Bacteria 1679
146 Ga0070659_100263079 3300005366 Bacteria 1431
147 Ga0070667_100005633 3300005367 Bacteria 10458
148 Ga0070667_100010235 3300005367 Bacteria 7748
149 Ga0070667_100015164 3300005367 Bacteria 6365
150 Ga0070667_100016010 3300005367 Bacteria 6204
151 Ga0070667_100058925 3300005367 Bacteria 3247
152 Ga0070667_100186025 3300005367 Bacteria 1838
153 Ga0070667_100253537 3300005367 Bacteria 1574
154 Ga0070709_10028699 3300005434 Bacteria 3321
155 Ga0070709_10035379 3300005434 Bacteria 3035
156 Ga0070714_100011938 3300005435 Bacteria 6910
157 Ga0070714_100022892 3300005435 Bacteria 5127
158 Ga0070714_100050119 3300005435 Bacteria 3555
159 Ga0070714_100087174 3300005435 Bacteria 2730
160 Ga0070714_100238776 3300005435 Bacteria 1677
161 Ga0070713_100007751 3300005436 Bacteria 7560
162 Ga0070713_100010936 3300005436 Bacteria 6581
163 Ga0070713_100063116 3300005436 Bacteria 3104
164 Ga0070713_100067951 3300005436 Bacteria 3002
165 Ga0070710_10008568 3300005437 Bacteria 4978
166 Ga0070710_10010806 3300005437 Bacteria 4490
167 Ga0070710_10021500 3300005437 Bacteria 3364
168 Ga0070710_10022840 3300005437 Bacteria 3279
169 Ga0070701_10000524 3300005438 Bacteria 13233
170 Ga0070701_10019632 3300005438 Bacteria 3195
171 Ga0070711_100011116 3300005439 Bacteria 5585
172 Ga0070711_100015201 3300005439 Bacteria 4868
173 Ga0070711_100023573 3300005439 Bacteria 4005
174 Ga0070705_100000252 3300005440 Bacteria 31840
175 Ga0070700_100000657 3300005441 Bacteria 17071
176 Ga0070700_100006474 3300005441 Bacteria 6269
177 Ga0070694_100021318 3300005444 Bacteria 4139
178 Ga0070694_100089908 3300005444 Bacteria 2152
179 Ga0070708_100112727 3300005445 Bacteria 2501
180 Ga0070663_100004855 3300005455 Bacteria 7931
181 Ga0070663_100015911 3300005455 Bacteria 4870
182 Ga0070663_100028662 3300005455 Bacteria 3794
183 Ga0070663_100085590 3300005455 Bacteria 2326
184 Ga0070663_100121253 3300005455 Bacteria 1975
185 Ga0070663_100131583 3300005455 Bacteria 1900
186 Ga0070663_100191807 3300005455 Bacteria 1590
187 Ga0070678_100001414 3300005456 Bacteria 12797
188 Ga0070678_100010734 3300005456 Bacteria 5611
189 Ga0070678_100011766 3300005456 Bacteria 5411
190 Ga0070662_100001002 3300005457 Bacteria 17247
191 Ga0070662_100017420 3300005457 Bacteria 4844
192 Ga0070662_100064810 3300005457 Bacteria 2676
193 Ga0070662_100069580 3300005457 Bacteria 2591
194 Ga0070662_100076669 3300005457 Bacteria 2479
195 Ga0070681_10047969 3300005458 Bacteria 4268
196 Ga0070681_10052703 3300005458 Bacteria 4058
197 Ga0070681_10071322 3300005458 Bacteria 3438
198 Ga0070681_10072311 3300005458 Bacteria 3411
199 Ga0070681_10082351 3300005458 Bacteria 3173
200 Ga0070681_10123273 3300005458 Bacteria 2524
201 Ga0068867_100001011 3300005459 Bacteria 19191
202 Ga0068867_100083074 3300005459 Bacteria 2417
203 Ga0070685_10002699 3300005466 Bacteria 9088
204 Ga0070685_10065248 3300005466 Bacteria 2142
205 Ga0070707_100043599 3300005468 Bacteria 4293
206 Ga0070699_100014320 3300005518 Bacteria 6819
207 Ga0070679_100004731 3300005530 Bacteria 12558
208 Ga0070679_100016615 3300005530 Bacteria 7107
209 Ga0070679_100034565 3300005530 Bacteria 5010
210 Ga0070679_100036926 3300005530 Bacteria 4850
211 Ga0070679_100150520 3300005530 Bacteria 2304
212 Ga0070679_100261883 3300005530 Bacteria 1684
213 Ga0070684_100000275 3300005535 Bacteria 35701
214 Ga0070684_100031635 3300005535 Bacteria 4506
215 Ga0070684_100061891 3300005535 Bacteria 3277
216 Ga0070684_100123682 3300005535 Bacteria 2328
217 Ga0070684_100134572 3300005535 Bacteria 2232
218 Ga0070697_100137122 3300005536 Bacteria 2055
219 Ga0068853_100002273 3300005539 Bacteria 14352
220 Ga0068853_100017670 3300005539 Bacteria 5886
221 Ga0068853_100083372 3300005539 Bacteria 2801
222 Ga0068853_100160014 3300005539 Bacteria 2031
223 Ga0068853_100251885 3300005539 Bacteria 1620
224 Ga0070672_100000008 3300005543 Bacteria 91782
225 Ga0070672_100013010 3300005543 Bacteria 5865
226 Ga0070672_100027974 3300005543 Bacteria 4212
227 Ga0070672_100028466 3300005543 Bacteria 4180
228 Ga0070672_100094811 3300005543 Bacteria 2413
229 Ga0070686_100062116 3300005544 Bacteria 2416
230 Ga0070686_100080097 3300005544 Bacteria 2160
231 Ga0070695_100063612 3300005545 Bacteria 2398
232 Ga0070696_100017449 3300005546 Bacteria 4844
233 Ga0070696_100056926 3300005546 Bacteria 2728
234 Ga0070696_100070532 3300005546 Bacteria 2458
235 Ga0070696_100250150 3300005546 Bacteria 1340
236 Ga0070693_100007754 3300005547 Bacteria 5264
237 Ga0070693_100008375 3300005547 Bacteria 5095
238 Ga0070665_100043426 3300005548 Bacteria 4518
239 Ga0070704_100001016 3300005549 Bacteria 14398
240 Ga0070704_100091417 3300005549 Bacteria 2269
241 Ga0068855_100000129 3300005563 Bacteria 96519
242 Ga0068855_100007455 3300005563 Bacteria 13251
243 Ga0068855_100033428 3300005563 Bacteria 6137
244 Ga0068855_100034657 3300005563 Bacteria 6016
245 Ga0068855_100055594 3300005563 Bacteria 4648
246 Ga0068855_100058535 3300005563 Bacteria 4512
247 Ga0068855_100187219 3300005563 Bacteria 2337
248 Ga0068855_100217650 3300005563 Bacteria 2143
249 Ga0070664_100000419 3300005564 Bacteria 31758
250 Ga0070664_100005421 3300005564 Bacteria 10239
251 Ga0070664_100017741 3300005564 Bacteria 5847
252 Ga0070664_100036462 3300005564 Bacteria 4131
253 Ga0070664_100048170 3300005564 Bacteria 3601
254 Ga0070664_100232242 3300005564 Bacteria 1654
255 Ga0068857_100002666 3300005577 Bacteria 14652
256 Ga0068857_100009744 3300005577 Bacteria 8343
257 Ga0068857_100012690 3300005577 Bacteria 7343
258 Ga0068857_100244218 3300005577 Bacteria 1644
259 Ga0068854_100001824 3300005578 Bacteria 12963
260 Ga0068854_100037514 3300005578 Bacteria 3402
261 Ga0068856_100000963 3300005614 Bacteria 30708
262 Ga0070702_100003016 3300005615 Bacteria 7444
263 Ga0070702_100008357 3300005615 Bacteria 5009
264 Ga0068852_100001994 3300005616 Bacteria 13910
265 Ga0068852_100015664 3300005616 Bacteria 5889
266 Ga0068852_100039158 3300005616 Bacteria 3989
267 Ga0068852_100044588 3300005616 Bacteria 3767
268 Ga0068852_100090988 3300005616 Bacteria 2730
269 Ga0068852_100179374 3300005616 Bacteria 1991
270 Ga0068859_100000088 3300005617 Bacteria 84390
271 Ga0068859_100107572 3300005617 Bacteria 2849
272 Ga0068859_100132405 3300005617 Bacteria 2565
273 Ga0068859_100209476 3300005617 Bacteria 2035
274 Ga0068859_100311275 3300005617 Bacteria 1668
275 Ga0068859_100397254 3300005617 Bacteria 1474
276 Ga0068864_100000136 3300005618 Bacteria 70797
277 Ga0068864_100001346 3300005618 Bacteria 20428
278 Ga0068864_100003805 3300005618 Bacteria 12441
279 Ga0068864_100019015 3300005618 Bacteria 5742
280 Ga0068866_10000291 3300005718 Bacteria 23901
281 Ga0068861_100001924 3300005719 Bacteria 13364
282 Ga0068861_100116771 3300005719 Bacteria 2146
283 Ga0068851_10049564 3300005834 Bacteria 2130
284 Ga0068870_10000005 3300005840 Bacteria 79445
285 Ga0068863_100000384 3300005841 Bacteria 44825
286 Ga0068863_100000608 3300005841 Bacteria 36316
287 Ga0068863_100024134 3300005841 Bacteria 5802
288 Ga0068863_100074646 3300005841 Bacteria 3208
289 Ga0068863_100107829 3300005841 Bacteria 2650
290 Ga0068863_100271166 3300005841 Bacteria 1643
291 Ga0068858_100000063 3300005842 Bacteria 111811
292 Ga0068858_100011061 3300005842 Bacteria 8532
293 Ga0068858_100021963 3300005842 Bacteria 5960
294 Ga0068858_100026552 3300005842 Bacteria 5379
295 Ga0068858_100149146 3300005842 Bacteria 2198
296 Ga0068858_100244735 3300005842 Bacteria 1702
297 Ga0068860_100001183 3300005843 Bacteria 28556
298 Ga0068860_100022772 3300005843 Bacteria 6058
299 Ga0068860_100034044 3300005843 Bacteria 4886
300 Ga0068860_100067885 3300005843 Bacteria 3387
301 Ga0068860_100079433 3300005843 Bacteria 3119
302 Ga0068860_100080163 3300005843 Bacteria 3105
303 Ga0068860_100113496 3300005843 Bacteria 2591
304 Ga0068860_100198147 3300005843 Bacteria 1945
305 Ga0068860_100237878 3300005843 Bacteria 1771
306 Ga0068862_100007190 3300005844 Bacteria 9245
307 Ga0068862_100010432 3300005844 Bacteria 7672
308 Ga0068862_100011427 3300005844 Bacteria 7328
309 Ga0068862_100017057 3300005844 Bacteria 6042
310 Ga0068862_100024857 3300005844 Bacteria 5026
311 Ga0068862_100079551 3300005844 Bacteria 2841
312 Ga0081455_10000002 3300005937 Bacteria 460472
313 Ga0081455_10000329 3300005937 Bacteria 62107
314 Ga0081455_10015834 3300005937 Bacteria 7303
315 Ga0081538_10002523 3300005981 Bacteria 17830
316 Ga0081538_10021900 3300005981 Bacteria 4647
317 Ga0081540_1001201 3300005983 Bacteria 22688
318 Ga0081540_1009095 3300005983 Bacteria 6860
319 Ga0081540_1010246 3300005983 Bacteria 6365
320 Ga0081539_10000522 3300005985 Bacteria 79973
321 Ga0070717_10001785 3300006028 Bacteria 14994
322 Ga0075365_10013799 3300006038 Bacteria 4847
323 Ga0075365_10024810 3300006038 Bacteria 3789
324 Ga0075368_10000129 3300006042 Bacteria 20027
325 Ga0075363_100002771 3300006048 Bacteria 7269
326 Ga0075363_100004616 3300006048 Bacteria 6051
327 Ga0075432_10013821 3300006058 Bacteria 2746
328 Ga0070715_10005920 3300006163 Bacteria 4120
329 Ga0070715_10009052 3300006163 Bacteria 3495
330 Ga0070715_10025330 3300006163 Bacteria 2348
331 Ga0070716_100000730 3300006173 Bacteria 14019
332 Ga0070716_100012351 3300006173 Bacteria 4327
333 Ga0070716_100044410 3300006173 Bacteria 2489
334 Ga0070712_100000963 3300006175 Bacteria 17331
335 Ga0070712_100041974 3300006175 Bacteria 3144
336 Ga0070712_100048764 3300006175 Bacteria 2937
337 Ga0070712_100153292 3300006175 Bacteria 1771
338 Ga0075362_10013349 3300006177 Bacteria 3288
339 Ga0075367_10002669 3300006178 Bacteria 8224
340 Ga0075367_10014764 3300006178 Bacteria 4230
341 Ga0075427_10000026 3300006194 Bacteria 9852
342 Ga0075366_10089288 3300006195 Bacteria 1846
343 Ga0097621_100000006 3300006237 Bacteria 134536
344 Ga0097621_100008279 3300006237 Bacteria 7484
345 Ga0097621_100182116 3300006237 Bacteria 1815
346 Ga0068871_100000022 3300006358 Bacteria 82775
347 Ga0068871_100030110 3300006358 Bacteria 4271
348 Ga0068871_100200826 3300006358 Bacteria 1721
349 Ga0075428_100003527 3300006844 Bacteria 17133
350 Ga0075428_100009313 3300006844 Bacteria 10891
351 Ga0075428_100055661 3300006844 Bacteria 4334
352 Ga0075430_100001061 3300006846 Bacteria 21766
353 Ga0075430_100005415 3300006846 Bacteria 10781
354 Ga0075430_100034066 3300006846 Bacteria 4322
355 Ga0075430_100069113 3300006846 Bacteria 2963
356 Ga0075431_100000856 3300006847 Bacteria 26728
357 Ga0075431_100035384 3300006847 Bacteria 5142
358 Ga0075433_10003278 3300006852 Bacteria 12496
359 Ga0075433_10028588 3300006852 Bacteria 4741
360 Ga0075434_100000346 3300006871 Bacteria 33425
361 Ga0075434_100017393 3300006871 Bacteria 6926
362 Ga0075434_100035969 3300006871 Bacteria 4897
363 Ga0075434_100171152 3300006871 Bacteria 2192
364 Ga0075429_100001137 3300006880 Bacteria 21442
365 Ga0075429_100007463 3300006880 Bacteria 9488
366 Ga0075429_100022293 3300006880 Bacteria 5493
367 Ga0068865_100000196 3300006881 Bacteria 33650
368 Ga0068865_100133796 3300006881 Bacteria 1860
369 Ga0097620_100000088 3300006931 Bacteria 84390
370 Ga0097620_100107561 3300006931 Bacteria 2849
371 Ga0097620_100132405 3300006931 Bacteria 2565
372 Ga0097620_100209474 3300006931 Bacteria 2035
373 Ga0097620_100311247 3300006931 Bacteria 1668
374 Ga0097620_100397247 3300006931 Bacteria 1474
375 Ga0075435_100003799 3300007076 Bacteria 10296
376 Ga0075435_100019065 3300007076 Bacteria 5230
377 Ga0075435_100038442 3300007076 Bacteria 3815
378 Ga0099795_10033014 3300007788 Bacteria 1794
379 Ga0099795_10048007 3300007788 Bacteria 1544
380 Ga0105251_10034057 3300009011 Bacteria 2524
381 Ga0105250_10013627 3300009092 Bacteria 3349
382 Ga0105240_10021899 3300009093 Bacteria 8490
383 Ga0105240_10068944 3300009093 Bacteria 4379
384 Ga0105240_10190806 3300009093 Bacteria 2410
385 Ga0105240_10380728 3300009093 Bacteria 1594
386 Ga0111539_10000817 3300009094 Bacteria 40427
387 Ga0111539_10001765 3300009094 Bacteria 28723
388 Ga0111539_10001792 3300009094 Bacteria 28559
389 Ga0111539_10016539 3300009094 Bacteria 9143
390 Ga0111539_10289486 3300009094 Bacteria 1906
391 Ga0105245_10006255 3300009098 Bacteria 10475
392 Ga0105245_10051976 3300009098 Bacteria 3674
393 Ga0105245_10053755 3300009098 Bacteria 3615
394 Ga0105245_10160885 3300009098 Bacteria 2130
395 Ga0105247_10004177 3300009101 Bacteria 9267
396 Ga0105247_10014764 3300009101 Bacteria 4682
397 Ga0105247_10113196 3300009101 Bacteria 1749
398 Ga0114129_10001060 3300009147 Bacteria 36097
399 Ga0114129_10003956 3300009147 Bacteria 20922
400 Ga0114129_10021909 3300009147 Bacteria 9069
401 Ga0114129_10024577 3300009147 Bacteria 8536
402 Ga0105243_10003212 3300009148 Bacteria 13374
403 Ga0105241_10002185 3300009174 Bacteria 14733
404 Ga0105241_10022254 3300009174 Bacteria 4693
405 Ga0105241_10044485 3300009174 Bacteria 3365
406 Ga0105242_10002746 3300009176 Bacteria 13773
407 Ga0105242_10023628 3300009176 Bacteria 4845
408 Ga0105248_10000169 3300009177 Bacteria 75948
409 Ga0105248_10005067 3300009177 Bacteria 14550
410 Ga0105248_10006401 3300009177 Bacteria 12919
411 Ga0105248_10020884 3300009177 Bacteria 7257
412 Ga0105248_10021626 3300009177 Bacteria 7124
413 Ga0105248_10214425 3300009177 Bacteria 2169
414 Ga0105237_10085695 3300009545 Bacteria 3140
415 Ga0105237_10096569 3300009545 Bacteria 2945
416 Ga0105238_10004728 3300009551 Bacteria 13465
417 Ga0105238_10038260 3300009551 Bacteria 4871
418 Ga0105249_10003096 3300009553 Bacteria 14360
419 Ga0105249_10039603 3300009553 Bacteria 4279
420 Ga0105249_10139808 3300009553 Bacteria 2321
421 Ga0105239_10001436 3300010375 Bacteria 31755
422 Ga0105239_10021456 3300010375 Bacteria 7121
423 Ga0105239_10025721 3300010375 Bacteria 6482
424 Ga0105239_10079131 3300010375 Bacteria 3617
425 Ga0105246_10001322 3300011119 Bacteria 14587
426 Ga0105246_10056113 3300011119 Bacteria 2721
427 Ga0105246_10122645 3300011119 Bacteria 1928
428 Ga0157373_10014713 3300013100 Bacteria 5732
429 Ga0157373_10062685 3300013100 Bacteria 2633
430 Ga0157371_10005808 3300013102 Bacteria 10326
431 Ga0157371_10011416 3300013102 Bacteria 6846
432 Ga0157371_10031596 3300013102 Bacteria 3815
433 Ga0157371_10035537 3300013102 Bacteria 3570
434 Ga0157371_10036397 3300013102 Bacteria 3525
435 Ga0157371_10123912 3300013102 Bacteria 1838
436 Ga0157371_10202790 3300013102 Bacteria 1422
437 Ga0157371_10211537 3300013102 Bacteria 1392
438 Ga0157370_10021346 3300013104 Bacteria 6452
439 Ga0157370_10040486 3300013104 Bacteria 4499
440 Ga0157369_10042326 3300013105 Bacteria 4969
441 Ga0157369_10088883 3300013105 Bacteria 3298
442 Ga0157374_10023096 3300013296 Bacteria 5557
443 Ga0157374_10059192 3300013296 Bacteria 3581
444 Ga0157378_10004038 3300013297 Bacteria 12960
445 Ga0157378_10050000 3300013297 Bacteria 3720
446 Ga0163162_10002546 3300013306 Bacteria 17252
447 Ga0163162_10039471 3300013306 Bacteria 4718
448 Ga0163162_10041821 3300013306 Bacteria 4585
449 Ga0163162_10370488 3300013306 Bacteria 1565
450 Ga0157372_10029143 3300013307 Bacteria 6025
451 Ga0157372_10066996 3300013307 Bacteria 4034
452 Ga0157372_10068034 3300013307 Bacteria 4004
453 Ga0157372_10243052 3300013307 Bacteria 2089
454 Ga0157372_10336092 3300013307 Bacteria 1759
455 Ga0157375_10056614 3300013308 Bacteria 3872
456 Ga0157375_10161948 3300013308 Bacteria 2380
457 Ga0163163_10000170 3300014325 Bacteria 68377
458 Ga0163163_10001683 3300014325 Bacteria 18663
459 Ga0163163_10066801 3300014325 Bacteria 3573
460 Ga0163163_10122875 3300014325 Bacteria 2631
461 Ga0163163_10188748 3300014325 Bacteria 2109
462 Ga0157380_10067347 3300014326 Bacteria 2883
463 Ga0157377_10000127 3300014745 Bacteria 49198
464 Ga0157379_10008840 3300014968 Bacteria 8784
465 Ga0157379_10008961 3300014968 Bacteria 8721
466 Ga0157379_10013169 3300014968 Bacteria 7241
467 Ga0157379_10054179 3300014968 Bacteria 3584
468 Ga0157376_10000126 3300014969 Bacteria 52844
469 Ga0157376_10011024 3300014969 Bacteria 6643
470 Ga0163161_10000562 3300017792 Bacteria 29937
471 Ga0163161_10049148 3300017792 Bacteria 3047
472 Ga0213874_10001300 3300021377 Bacteria 5163
473 Ga0213876_10054320 3300021384 Bacteria 2115
474 Ga0228598_1000321 3300024227 Bacteria 9375
475 Ga0207666_1002396 3300025271 Bacteria 2260
476 Ga0207673_1000208 3300025290 Bacteria 5916
477 Ga0209050_1000262 3300025298 Bacteria 112798
478 Ga0207697_10029097 3300025315 Bacteria 2260
479 Ga0207653_10009245 3300025885 Bacteria 3070
480 Ga0207682_10000001 3300025893 Bacteria 152713
481 Ga0207682_10001899 3300025893 Bacteria 9485
482 Ga0207692_10034318 3300025898 Bacteria 2455
483 Ga0207692_10041374 3300025898 Bacteria 2281
484 Ga0207642_10001429 3300025899 Bacteria 7409
485 Ga0207710_10000895 3300025900 Bacteria 15956
486 Ga0207710_10005202 3300025900 Bacteria 5624
487 Ga0207688_10001997 3300025901 Bacteria 10941
488 Ga0207688_10008183 3300025901 Bacteria 5683
489 Ga0207688_10053713 3300025901 Bacteria 2260
490 Ga0207680_10007725 3300025903 Bacteria 5257
491 Ga0207647_10000627 3300025904 Bacteria 27507
492 Ga0207647_10002335 3300025904 Bacteria 14419
493 Ga0207647_10004040 3300025904 Bacteria 10933
494 Ga0207647_10006288 3300025904 Bacteria 8647
495 Ga0207647_10097072 3300025904 Bacteria 1753
496 Ga0207647_10120962 3300025904 Bacteria 1544
497 Ga0207699_10044303 3300025906 Bacteria 2590
498 Ga0207699_10045606 3300025906 Bacteria 2560
499 Ga0207645_10000276 3300025907 Bacteria 42632
500 Ga0207645_10005447 3300025907 Bacteria 9222
501 Ga0207645_10020893 3300025907 Bacteria 4277
502 Ga0207643_10000041 3300025908 Bacteria 85133
503 Ga0207643_10000613 3300025908 Bacteria 22494
504 Ga0207643_10117178 3300025908 Bacteria 1574
505 Ga0207705_10000091 3300025909 Bacteria 110768
506 Ga0207705_10009087 3300025909 Bacteria 7244
507 Ga0207705_10018644 3300025909 Bacteria 4962
508 Ga0207705_10029024 3300025909 Bacteria 3945
509 Ga0207705_10035312 3300025909 Bacteria 3576
510 Ga0207705_10037339 3300025909 Bacteria 3476
511 Ga0207705_10044392 3300025909 Bacteria 3194
512 Ga0207705_10049030 3300025909 Bacteria 3039
513 Ga0207705_10069088 3300025909 Bacteria 2558
514 Ga0207654_10003566 3300025911 Bacteria 7872
515 Ga0207654_10028711 3300025911 Bacteria 3035
516 Ga0207707_10005534 3300025912 Bacteria 11046
517 Ga0207707_10017298 3300025912 Bacteria 6284
518 Ga0207707_10041404 3300025912 Bacteria 4023
519 Ga0207707_10059659 3300025912 Bacteria 3319
520 Ga0207707_10185051 3300025912 Bacteria 1818
521 Ga0207707_10205317 3300025912 Bacteria 1717
522 Ga0207695_10043579 3300025913 Bacteria 4782
523 Ga0207671_10013164 3300025914 Bacteria 6606
524 Ga0207671_10054159 3300025914 Bacteria 2973
525 Ga0207693_10004802 3300025915 Bacteria 11369
526 Ga0207693_10005773 3300025915 Bacteria 10265
527 Ga0207693_10012871 3300025915 Bacteria 6750
528 Ga0207693_10052850 3300025915 Bacteria 3187
529 Ga0207693_10054500 3300025915 Bacteria 3136
530 Ga0207693_10093817 3300025915 Bacteria 2352
531 Ga0207663_10004685 3300025916 Bacteria 6826
532 Ga0207663_10018835 3300025916 Bacteria 3877
533 Ga0207663_10036004 3300025916 Bacteria 2974
534 Ga0207660_10000006 3300025917 Bacteria 106298
535 Ga0207660_10000864 3300025917 Bacteria 20005
536 Ga0207660_10006249 3300025917 Bacteria 7734
537 Ga0207660_10043755 3300025917 Bacteria 3147
538 Ga0207660_10237190 3300025917 Bacteria 1436
539 Ga0207662_10000207 3300025918 Bacteria 27378
540 Ga0207662_10003504 3300025918 Bacteria 8083
541 Ga0207662_10011850 3300025918 Bacteria 4847
542 Ga0207662_10024769 3300025918 Bacteria 3454
543 Ga0207662_10110690 3300025918 Bacteria 1712
544 Ga0207657_10000092 3300025919 Bacteria 85665
545 Ga0207657_10000252 3300025919 Bacteria 57036
546 Ga0207657_10001742 3300025919 Bacteria 23458
547 Ga0207657_10002395 3300025919 Bacteria 20270
548 Ga0207657_10004547 3300025919 Bacteria 14659
549 Ga0207657_10004799 3300025919 Bacteria 14261
550 Ga0207657_10015568 3300025919 Bacteria 7362
551 Ga0207657_10018720 3300025919 Bacteria 6600
552 Ga0207657_10019350 3300025919 Bacteria 6469
553 Ga0207657_10019526 3300025919 Bacteria 6433
554 Ga0207657_10019679 3300025919 Bacteria 6401
555 Ga0207657_10024115 3300025919 Bacteria 5648
556 Ga0207657_10040408 3300025919 Bacteria 4133
557 Ga0207657_10054523 3300025919 Bacteria 3457
558 Ga0207657_10164423 3300025919 Bacteria 1801
559 Ga0207649_10000049 3300025920 Bacteria 109723
560 Ga0207649_10114529 3300025920 Bacteria 1807
561 Ga0207652_10000300 3300025921 Bacteria 51095
562 Ga0207652_10015009 3300025921 Bacteria 6284
563 Ga0207652_10017153 3300025921 Bacteria 5922
564 Ga0207652_10070600 3300025921 Bacteria 3033
565 Ga0207652_10085936 3300025921 Bacteria 2757
566 Ga0207652_10114203 3300025921 Bacteria 2398
567 Ga0207681_10000024 3300025923 Bacteria 206607
568 Ga0207681_10018745 3300025923 Bacteria 4364
569 Ga0207694_10001718 3300025924 Bacteria 18345
570 Ga0207694_10007596 3300025924 Bacteria 8220
571 Ga0207650_10000990 3300025925 Bacteria 21364
572 Ga0207650_10005202 3300025925 Bacteria 8873
573 Ga0207650_10007269 3300025925 Bacteria 7540
574 Ga0207650_10019900 3300025925 Bacteria 4724
575 Ga0207650_10044215 3300025925 Bacteria 3272
576 Ga0207659_10000042 3300025926 Bacteria 90881
577 Ga0207659_10000885 3300025926 Bacteria 17789
578 Ga0207659_10024411 3300025926 Bacteria 4050
579 Ga0207659_10033789 3300025926 Bacteria 3523
580 Ga0207659_10245158 3300025926 Bacteria 1451
581 Ga0207687_10003253 3300025927 Bacteria 11003
582 Ga0207687_10124486 3300025927 Bacteria 1933
583 Ga0207700_10001840 3300025928 Bacteria 12027
584 Ga0207700_10142645 3300025928 Bacteria 1970
585 Ga0207664_10035347 3300025929 Bacteria 3855
586 Ga0207664_10042440 3300025929 Bacteria 3550
587 Ga0207664_10051499 3300025929 Bacteria 3251
588 Ga0207664_10171022 3300025929 Bacteria 1860
589 Ga0207644_10000041 3300025931 Bacteria 114951
590 Ga0207644_10001327 3300025931 Bacteria 15896
591 Ga0207644_10005264 3300025931 Bacteria 8445
592 Ga0207644_10015084 3300025931 Bacteria 5184
593 Ga0207644_10048211 3300025931 Bacteria 3044
594 Ga0207644_10057501 3300025931 Bacteria 2808
595 Ga0207644_10120300 3300025931 Bacteria 1998
596 Ga0207690_10000137 3300025932 Bacteria 59768
597 Ga0207690_10000709 3300025932 Bacteria 21444
598 Ga0207690_10002665 3300025932 Bacteria 10761
599 Ga0207690_10015489 3300025932 Bacteria 4622
600 Ga0207690_10031479 3300025932 Bacteria 3395
601 Ga0207690_10042617 3300025932 Bacteria 2982
602 Ga0207690_10054048 3300025932 Bacteria 2698
603 Ga0207690_10136594 3300025932 Bacteria 1801
604 Ga0207690_10148699 3300025932 Bacteria 1734
605 Ga0207706_10000568 3300025933 Bacteria 39206
606 Ga0207706_10000746 3300025933 Bacteria 33880
607 Ga0207706_10004407 3300025933 Bacteria 13227
608 Ga0207706_10010385 3300025933 Bacteria 8503
609 Ga0207706_10011126 3300025933 Bacteria 8200
610 Ga0207706_10015457 3300025933 Bacteria 6895
611 Ga0207706_10024460 3300025933 Bacteria 5415
612 Ga0207706_10027262 3300025933 Bacteria 5109
613 Ga0207706_10065107 3300025933 Bacteria 3209
614 Ga0207706_10131449 3300025933 Bacteria 2202
615 Ga0207706_10281828 3300025933 Bacteria 1449
616 Ga0207686_10000571 3300025934 Bacteria 23350
617 Ga0207686_10056004 3300025934 Bacteria 2476
618 Ga0207709_10000220 3300025935 Bacteria 72291
619 Ga0207709_10010336 3300025935 Bacteria 5140
620 Ga0207709_10089212 3300025935 Bacteria 2010
621 Ga0207709_10201888 3300025935 Bacteria 1421
622 Ga0207670_10000323 3300025936 Bacteria 28564
623 Ga0207669_10000005 3300025937 Bacteria 185218
624 Ga0207669_10004706 3300025937 Bacteria 6039
625 Ga0207669_10007517 3300025937 Bacteria 5045
626 Ga0207669_10008276 3300025937 Bacteria 4873
627 Ga0207704_10000060 3300025938 Bacteria 76535
628 Ga0207665_10000117 3300025939 Bacteria 52204
629 Ga0207665_10000210 3300025939 Bacteria 39483
630 Ga0207691_10005532 3300025940 Bacteria 12201
631 Ga0207691_10006907 3300025940 Bacteria 10948
632 Ga0207691_10017079 3300025940 Bacteria 6884
633 Ga0207691_10037116 3300025940 Bacteria 4513
634 Ga0207691_10077281 3300025940 Bacteria 2999
635 Ga0207691_10129432 3300025940 Bacteria 2231
636 Ga0207691_10129978 3300025940 Bacteria 2225
637 Ga0207711_10000039 3300025941 Bacteria 162974
638 Ga0207711_10001557 3300025941 Bacteria 21221
639 Ga0207711_10014181 3300025941 Bacteria 6620
640 Ga0207711_10015227 3300025941 Bacteria 6384
641 Ga0207711_10022126 3300025941 Bacteria 5314
642 Ga0207711_10031874 3300025941 Bacteria 4453
643 Ga0207711_10063794 3300025941 Bacteria 3181
644 Ga0207711_10070811 3300025941 Bacteria 3025
645 Ga0207689_10000053 3300025942 Bacteria 88245
646 Ga0207689_10007517 3300025942 Bacteria 9554
647 Ga0207689_10009414 3300025942 Bacteria 8439
648 Ga0207689_10027153 3300025942 Bacteria 4793
649 Ga0207689_10052697 3300025942 Bacteria 3352
650 Ga0207661_10000036 3300025944 Bacteria 149720
651 Ga0207661_10019697 3300025944 Bacteria 5036
652 Ga0207679_10000060 3300025945 Bacteria 100711
653 Ga0207679_10002925 3300025945 Bacteria 10572
654 Ga0207679_10010577 3300025945 Bacteria 5946
655 Ga0207679_10026824 3300025945 Bacteria 3976
656 Ga0207679_10081322 3300025945 Bacteria 2477
657 Ga0207679_10106286 3300025945 Bacteria 2206
658 Ga0207679_10139096 3300025945 Bacteria 1960
659 Ga0207667_10000303 3300025949 Bacteria 68209
660 Ga0207667_10197000 3300025949 Bacteria 2067
661 Ga0207667_10198839 3300025949 Bacteria 2056
662 Ga0207651_10000014 3300025960 Bacteria 166931
663 Ga0207651_10224986 3300025960 Bacteria 1519
664 Ga0207712_10000134 3300025961 Bacteria 78054
665 Ga0207712_10000195 3300025961 Bacteria 62560
666 Ga0207712_10116473 3300025961 Bacteria 2014
667 Ga0207668_10000350 3300025972 Bacteria 29956
668 Ga0207668_10075099 3300025972 Bacteria 2429
669 Ga0207668_10114395 3300025972 Bacteria 2031
670 Ga0207668_10132031 3300025972 Bacteria 1908
671 Ga0207668_10137641 3300025972 Bacteria 1873
672 Ga0207640_10001960 3300025981 Bacteria 11088
673 Ga0207640_10026231 3300025981 Bacteria 3535
674 Ga0207658_10001042 3300025986 Bacteria 22510
675 Ga0207658_10001227 3300025986 Bacteria 20271
676 Ga0207658_10003771 3300025986 Bacteria 10675
677 Ga0207658_10017582 3300025986 Bacteria 4930
678 Ga0207658_10071331 3300025986 Bacteria 2630
679 Ga0207658_10072259 3300025986 Bacteria 2615
680 Ga0207658_10257038 3300025986 Bacteria 1487
681 Ga0207658_10268364 3300025986 Bacteria 1457
682 Ga0207677_10003136 3300026023 Bacteria 8720
683 Ga0207677_10003572 3300026023 Bacteria 8236
684 Ga0207703_10000327 3300026035 Bacteria 51797
685 Ga0207703_10032671 3300026035 Bacteria 4119
686 Ga0207703_10250734 3300026035 Bacteria 1595
687 Ga0207703_10302439 3300026035 Bacteria 1459
688 Ga0207639_10000835 3300026041 Bacteria 20893
689 Ga0207639_10001105 3300026041 Bacteria 18312
690 Ga0207639_10048488 3300026041 Bacteria 3215
691 Ga0207639_10093241 3300026041 Bacteria 2414
692 Ga0207678_10000892 3300026067 Bacteria 27377
693 Ga0207678_10001535 3300026067 Bacteria 21206
694 Ga0207678_10001718 3300026067 Bacteria 20053
695 Ga0207678_10003104 3300026067 Bacteria 15046
696 Ga0207678_10011286 3300026067 Bacteria 7843
697 Ga0207678_10026959 3300026067 Bacteria 5011
698 Ga0207678_10034704 3300026067 Bacteria 4393
699 Ga0207678_10041314 3300026067 Bacteria 3998
700 Ga0207678_10047163 3300026067 Bacteria 3727
701 Ga0207678_10099602 3300026067 Bacteria 2482
702 Ga0207678_10160785 3300026067 Bacteria 1918
703 Ga0207678_10161923 3300026067 Bacteria 1911
704 Ga0207708_10001777 3300026075 Bacteria 15902
705 Ga0207708_10101112 3300026075 Bacteria 2231
706 Ga0207708_10101648 3300026075 Bacteria 2225
707 Ga0207702_10011181 3300026078 Bacteria 7486
708 Ga0207702_10091065 3300026078 Bacteria 2669
709 Ga0207641_10000138 3300026088 Bacteria 106531
710 Ga0207641_10000664 3300026088 Bacteria 37481
711 Ga0207641_10009374 3300026088 Bacteria 8069
712 Ga0207641_10054912 3300026088 Bacteria 3382
713 Ga0207641_10142163 3300026088 Bacteria 2166
714 Ga0207648_10004308 3300026089 Bacteria 14655
715 Ga0207648_10017594 3300026089 Bacteria 6493
716 Ga0207648_10063136 3300026089 Bacteria 3229
717 Ga0207676_10000358 3300026095 Bacteria 38949
718 Ga0207676_10000983 3300026095 Bacteria 21929
719 Ga0207676_10005202 3300026095 Bacteria 9209
720 Ga0207676_10016480 3300026095 Bacteria 5351
721 Ga0207674_10000185 3300026116 Bacteria 76519
722 Ga0207674_10000314 3300026116 Bacteria 61753
723 Ga0207674_10002181 3300026116 Bacteria 24762
724 Ga0207674_10002696 3300026116 Bacteria 22163
725 Ga0207674_10024950 3300026116 Bacteria 6381
726 Ga0207674_10044244 3300026116 Bacteria 4585
727 Ga0207675_100002850 3300026118 Bacteria 17017
728 Ga0207675_100018253 3300026118 Bacteria 6540
729 Ga0207675_100154693 3300026118 Bacteria 2185
730 Ga0207675_100162829 3300026118 Bacteria 2129
731 Ga0207683_10000001 3300026121 Bacteria 352047
732 Ga0207683_10027328 3300026121 Bacteria 4930
733 Ga0207683_10038667 3300026121 Bacteria 4161
734 Ga0207683_10127233 3300026121 Bacteria 2290
735 Ga0207698_10000857 3300026142 Bacteria 17683
736 Ga0207698_10044221 3300026142 Bacteria 3344
737 Ga0207698_10084683 3300026142 Bacteria 2571
738 Ga0207698_10162661 3300026142 Bacteria 1954
739 Ga0207698_10220339 3300026142 Bacteria 1714
740 Ga0209179_1005986 3300027512 Bacteria 1934
741 Ga0209966_1000701 3300027695 Bacteria 7232
742 Ga0209813_10000184 3300027866 Bacteria 19954
743 Ga0209974_10006072 3300027876 Bacteria 4228
744 Ga0207428_10000316 3300027907 Bacteria 63363
745 Ga0207428_10000897 3300027907 Bacteria 33272
746 Ga0207428_10000923 3300027907 Bacteria 32854
747 Ga0268266_10016735 3300028379 Bacteria 6270
748 Ga0268266_10019041 3300028379 Bacteria 5847
749 Ga0268266_10028106 3300028379 Bacteria 4782
750 Ga0268266_10028711 3300028379 Bacteria 4728
751 Ga0268265_10002015 3300028380 Bacteria 15954
752 Ga0268265_10006389 3300028380 Bacteria 7988
753 Ga0268265_10007116 3300028380 Bacteria 7552
754 Ga0268265_10010473 3300028380 Bacteria 6263
755 Ga0268265_10019093 3300028380 Bacteria 4758
756 Ga0268265_10036082 3300028380 Bacteria 3619
757 Ga0268265_10073525 3300028380 Bacteria 2670
758 Ga0268265_10108458 3300028380 Bacteria 2260
759 Ga0268265_10115467 3300028380 Bacteria 2200
760 Ga0268264_10000976 3300028381 Bacteria 29278
761 Ga0268264_10002587 3300028381 Bacteria 15829
762 Ga0268264_10003561 3300028381 Bacteria 13410
763 Ga0268264_10010537 3300028381 Bacteria 7644
764 Ga0268264_10048516 3300028381 Bacteria 3532
765 Ga0268264_10118751 3300028381 Bacteria 2327
766 Ga0268264_10123474 3300028381 Bacteria 2285
767 Ga0268264_10184721 3300028381 Bacteria 1896
768 Ga0265318_10022180 3300028577 Bacteria 2541
769 Ga0265338_10014430 3300028800 Bacteria 8794
770 Ga0265760_10023408 3300031090 Bacteria 1795
771 Ga0265330_10021930 3300031235 Bacteria 2910
772 Ga0265332_10035887 3300031238 Bacteria 2153
773 Ga0265332_10066004 3300031238 Bacteria 1545
774 Ga0265328_10011073 3300031239 Bacteria 3613
775 Ga0265325_10000097 3300031241 Bacteria 61606
776 Ga0265325_10003705 3300031241 Bacteria 9887
777 Ga0265325_10009260 3300031241 Bacteria 5757
778 Ga0265325_10009896 3300031241 Bacteria 5548
779 Ga0265325_10050320 3300031241 Bacteria 2146
780 Ga0265340_10010971 3300031247 Bacteria 4832
781 Ga0265339_10000091 3300031249 Bacteria 75937
782 Ga0265339_10007468 3300031249 Bacteria 7064
783 Ga0265339_10013800 3300031249 Bacteria 4889
784 Ga0265331_10023779 3300031250 Bacteria 3108
785 Ga0265316_10008071 3300031344 Bacteria 9820
786 Ga0265316_10023549 3300031344 Bacteria 5171
787 Ga0307513_10200910 3300031456 Bacteria 1834
788 Ga0307408_100020885 3300031548 Bacteria 4425
789 Ga0307408_100036610 3300031548 Bacteria 3451
790 Ga0307408_100038872 3300031548 Bacteria 3359
791 Ga0307408_100175266 3300031548 Bacteria 1715
792 Ga0265313_10000260 3300031595 Bacteria 57581
793 Ga0265313_10004440 3300031595 Bacteria 10791
794 Ga0265313_10006139 3300031595 Bacteria 8626
795 Ga0265313_10009745 3300031595 Bacteria 6191
796 Ga0265313_10017993 3300031595 Bacteria 3987
797 Ga0265313_10026282 3300031595 Bacteria 3069
798 Ga0265313_10063235 3300031595 Bacteria 1726
799 Ga0316579_10007010 3300031691 Bacteria 4633
800 Ga0265314_10001493 3300031711 Bacteria 25971
801 Ga0265314_10029986 3300031711 Bacteria 4032
802 Ga0265314_10034505 3300031711 Bacteria 3698
803 Ga0265342_10035680 3300031712 Bacteria 3042
804 Ga0265342_10065731 3300031712 Bacteria 2125
805 Ga0265342_10075153 3300031712 Bacteria 1961
806 Ga0307405_10019312 3300031731 Bacteria 3782
807 Ga0307405_10099604 3300031731 Bacteria 1945
808 Ga0307413_10004947 3300031824 Bacteria 5873
809 Ga0307413_10005807 3300031824 Bacteria 5558
810 Ga0307413_10041306 3300031824 Bacteria 2699
811 Ga0307410_10000196 3300031852 Bacteria 22538
812 Ga0307410_10006424 3300031852 Bacteria 6340
813 Ga0307410_10008268 3300031852 Bacteria 5760
814 Ga0307410_10067718 3300031852 Bacteria 2463
815 Ga0307410_10078392 3300031852 Bacteria 2312
816 Ga0307410_10107900 3300031852 Bacteria 2009
817 Ga0307406_10006125 3300031901 Bacteria 6610
818 Ga0307406_10082294 3300031901 Bacteria 2143
819 Ga0307407_10002297 3300031903 Bacteria 7419
820 Ga0307407_10005484 3300031903 Bacteria 5510
821 Ga0307407_10027269 3300031903 Bacteria 3036
822 Ga0307412_10018182 3300031911 Bacteria 4224
823 Ga0307412_10082897 3300031911 Bacteria 2221
824 Ga0307412_10095467 3300031911 Bacteria 2090
825 Ga0307412_10117210 3300031911 Bacteria 1911
826 Ga0307412_10178438 3300031911 Bacteria 1595
827 Ga0307409_100000135 3300031995 Bacteria 27853
828 Ga0307409_100003671 3300031995 Bacteria 8404
829 Ga0307409_100023312 3300031995 Bacteria 4286
830 Ga0307409_100031858 3300031995 Bacteria 3813
831 Ga0307409_100122463 3300031995 Bacteria 2205
832 Ga0307416_100004600 3300032002 Bacteria 8347
833 Ga0307416_100030220 3300032002 Bacteria 4062
834 Ga0307416_100036347 3300032002 Bacteria 3776
835 Ga0307416_100063662 3300032002 Bacteria 3021
836 Ga0307416_100167519 3300032002 Bacteria 2040
837 Ga0307414_10008740 3300032004 Bacteria 5772
838 Ga0307414_10031793 3300032004 Bacteria 3466
839 Ga0307414_10044294 3300032004 Bacteria 3037
840 Ga0307414_10080811 3300032004 Bacteria 2378
841 Ga0307414_10091118 3300032004 Bacteria 2265
842 Ga0307414_10116781 3300032004 Bacteria 2043
843 Ga0307414_10219992 3300032004 Bacteria 1558
844 Ga0307414_10230655 3300032004 Bacteria 1526
845 Ga0307411_10001690 3300032005 Bacteria 9252
846 Ga0307411_10002367 3300032005 Bacteria 8292
847 Ga0307411_10008891 3300032005 Bacteria 5239
848 Ga0307411_10022155 3300032005 Bacteria 3734
849 Ga0307411_10042276 3300032005 Bacteria 2906
850 Ga0307411_10046202 3300032005 Bacteria 2805
851 Ga0307411_10047788 3300032005 Bacteria 2768
852 Ga0307411_10068032 3300032005 Bacteria 2399
853 Ga0307411_10104022 3300032005 Bacteria 2015
854 Ga0307415_100031263 3300032126 Bacteria 3427
855 Ga0307415_100059518 3300032126 Bacteria 2635
856 Ga0307415_100148538 3300032126 Bacteria 1800
857 Ga0307415_100226374 3300032126 Bacteria 1503
858 Ga0316583_10000081 3300032133 Bacteria 20405
859 Ga0373930_0000006 3300034816 Bacteria 23914
860 Ga0373958_0000694 3300034819 Bacteria 4267
861 Ga0373958_0001103 3300034819 Bacteria 3564
862 Ga0373959_0005640 3300034820 Bacteria 2056
863 Ga0373938_0000479 3300034957 Bacteria 6462
864 Ga0373938_0001513 3300034957 Bacteria 3730
865 Ga0373926_0007041 3300035083 Bacteria 3740
866 Ga0373928_0003420 3300035084 Bacteria 3021
867 Ga0373928_0004315 3300035084 Bacteria 2713
868 Ga0373929_0000474 3300035085 Bacteria 7702
869 Ga0373934_0003474 3300035086 Bacteria 5783
870 Ga0373934_0047832 3300035086 Bacteria 1693
871 Ga0373940_0000343 3300035088 Bacteria 6919
872 Ga0373940_0008788 3300035088 Bacteria 2329
873 Ga0373944_0002019 3300035089 Bacteria 5143
874 Ga0373944_0002875 3300035089 Bacteria 4412
875 Ga0373944_0003428 3300035089 Bacteria 4090
876 Ga0373944_0024959 3300035089 Bacteria 1756
877 Ga0373951_0000313 3300035091 Bacteria 15313
878 Ga0373952_0000218 3300035092 Bacteria 9116
879 Ga0373952_0000939 3300035092 Bacteria 5291
880 Ga0373923_0018708 3300035111 Bacteria 2671
881 Ga0373932_0002670 3300035112 Bacteria 4437
882 Ga0373932_0003226 3300035112 Bacteria 3956
883 Ga0373932_0017848 3300035112 Bacteria 1828
884 Ga0373936_0045373 3300035113 Bacteria 1770
885 Ga0373939_0000569 3300035114 Bacteria 9219
886 Ga0373939_0005627 3300035114 Bacteria 2986
887 Ga0373941_0001350 3300035115 Bacteria 5161
888 Ga0373941_0025498 3300035115 Bacteria 1708
889 Ga0373941_0031985 3300035115 Bacteria 1572
890 Ga0373945_0004285 3300035116 Bacteria 4527
891 Ga0373945_0012804 3300035116 Bacteria 2791
892 Ga0373953_0006282 3300035117 Bacteria 3906
893 Ga0373954_0013421 3300035118 Bacteria 3651
894 Ga0373954_0016582 3300035118 Bacteria 3300
895 Ga0373954_0036014 3300035118 Bacteria 2296
896 Ga0373956_0006720 3300035119 Bacteria 4612
897 Ga0373956_0037549 3300035119 Bacteria 2141
898 Ga0373956_0040827 3300035119 Bacteria 2059
899 Ga0373957_0013818 3300035120 Bacteria 2748
900 Ga0373960_0000093 3300035121 Bacteria 13747
901 Ga0373943_0000567 3300035170 Bacteria 16034
902 Ga0373943_0012619 3300035170 Bacteria 3808
903 Ga0373946_0002942 3300035171 Bacteria 6038
904 Ga0373946_0008443 3300035171 Bacteria 3778
905 Ga0373946_0023518 3300035171 Bacteria 2408
906 Ga0373946_0063818 3300035171 Bacteria 1574
907 Ga0373955_0000962 3300035172 Bacteria 12266
908 Ga0373955_0001391 3300035172 Bacteria 10289
909 Ga0373955_0025552 3300035172 Bacteria 3034
910 Ga0373955_0043621 3300035172 Bacteria 2413
911 Ga0373942_0000292 3300035207 Bacteria 13607
912 Ga0373942_0010958 3300035207 Bacteria 2141
913 Ga0373961_0001147 3300035241 Bacteria 8298
914 Ga0373961_0010379 3300035241 Bacteria 2294
915 Ga0373962_0000301 3300035242 Bacteria 10672
916 Ga0373962_0001628 3300035242 Bacteria 5333
917 Ga0373962_0011123 3300035242 Bacteria 2252
918 Ga0373931_0000086 3300035691 Bacteria 43093
919 Ga0373931_0003593 3300035691 Bacteria 6996
920 Ga0373935_0031599 3300035692 Bacteria 3287
921 Ga0373935_0057184 3300035692 Bacteria 2488
922 Ga0373935_0065204 3300035692 Bacteria 2336
923 Ga0373935_0067547 3300035692 Bacteria 2298
924 Ga0373927_0005131 3300035695 Bacteria 9063
925 Ga0373927_0034920 3300035695 Bacteria 3270
926 Ga0373927_0059331 3300035695 Bacteria 2474
927 Ga0373927_0071753 3300035695 Bacteria 2241
928 Ga0373927_0114791 3300035695 Bacteria 1755
929 Ga0373933_0009812 3300035724 Bacteria 5238
930 Ga0373933_0017845 3300035724 Bacteria 3984
931 Ga0373933_0028060 3300035724 Bacteria 3245
932 Ga0373947_0009204 3300035725 Bacteria 5675
933 Ga0373947_0014769 3300035725 Bacteria 4480
934 Ga0373947_0021695 3300035725 Bacteria 3719
935 Ga0373937_0004313 3300036401 Bacteria 12059
936 Ga0373937_0004822 3300036401 Bacteria 11465
937 Ga0373937_0013053 3300036401 Bacteria 7316
938 Ga0373937_0023035 3300036401 Bacteria 5602
939 Ga0373937_0031048 3300036401 Bacteria 4838
940 Ga0373937_0117379 3300036401 Bacteria 2478
941 Ga0316582_0080845 3300036647 Bacteria 2122
942 Ga0373925_0003922 3300037068 Bacteria 11355
943 Ga0373925_0015075 3300037068 Bacteria 5586
944 Ga0373925_0023858 3300037068 Bacteria 4462
945 Ga0395899_0000132 3300037312 Bacteria 115455
946 Ga0395899_0025245 3300037312 Bacteria 4486
947 Ga0395900_0000477 3300037418 Bacteria 56791
948 Ga0395900_0000997 3300037418 Bacteria 36770
949 Ga0395900_0001169 3300037418 Bacteria 32753
950 Ga0395900_0003479 3300037418 Bacteria 16993
951 Ga0395900_0016968 3300037418 Bacteria 7431
952 Ga0395900_0078138 3300037418 Bacteria 3400
953 Ga0395900_0085220 3300037418 Bacteria 3247
954 Ga0395900_0091734 3300037418 Bacteria 3121
955 Ga0395898_0015973 3300037466 Bacteria 7691
956 Ga0395898_0017326 3300037466 Bacteria 7360
957 Ga0395898_0028510 3300037466 Bacteria 5594
958 Ga0395898_0061634 3300037466 Bacteria 3644
959 Ga0395898_0067555 3300037466 Bacteria 3461
960 Ga0395898_0117554 3300037466 Bacteria 2547
961 Ga0395898_0121892 3300037466 Bacteria 2498
962 Ga0395905_0000818 3300037471 Bacteria 40874
963 Ga0395905_0001164 3300037471 Bacteria 32823
964 Ga0395905_0002761 3300037471 Bacteria 19234
965 Ga0395905_0010864 3300037471 Bacteria 8818
966 Ga0395905_0021647 3300037471 Bacteria 6082
967 Ga0395905_0043421 3300037471 Bacteria 4218
968 Ga0395905_0053027 3300037471 Bacteria 3797
969 Ga0395905_0068826 3300037471 Bacteria 3315
970 Ga0436364_0319726 3300037853 Bacteria 1794
971 Ga0395901_0000208 3300038443 Bacteria 73874
972 Ga0395901_0000589 3300038443 Bacteria 42319
973 Ga0395901_0002866 3300038443 Bacteria 17413
974 Ga0395901_0007227 3300038443 Bacteria 11200
975 Ga0395901_0087854 3300038443 Bacteria 3250
976 Ga0395901_0114738 3300038443 Bacteria 2829
977 Ga0395901_0197617 3300038443 Bacteria 2108
978 Ga0395901_0295086 3300038443 Bacteria 1681
979 Ga0395901_0368745 3300038443 Bacteria 1479
980 Ga0436365_0414414 3300039437 Bacteria 44510
981 Ga0436365_0458815 3300039437 Bacteria 12358
982 Ga0436360_0251329 3300039438 Bacteria 2226
983 Ga0436361_0896735 3300039447 Bacteria 20111
984 Ga0439445_0002205 3300042004 Bacteria 4320
985 Ga0439448_0020086 3300042005 Bacteria 2064
986 Ga0439432_008816 3300042006 Bacteria 3528
987 Ga0439432_023841 3300042006 Bacteria 2013
988 Ga0439452_023708 3300042010 Bacteria 1577
989 Ga0439455_0025551 3300042012 Bacteria 1436
990 Ga0439462_0031594 3300042015 Bacteria 1403
991 Ga0450905_003094 3300042142 Bacteria 2173
992 Ga0450889_000019 3300042144 Bacteria 13862
993 Ga0439435_0000116 3300042436 Bacteria 10320
994 Ga0451577_0012529 3300042876 Bacteria 7962
995 Ga0466972_0068169 3300044658 Bacteria 1699
996 Ga0466966_0167740 3300044684 Bacteria 1335
997 Ga0466963_0003406 3300044694 Bacteria 9099
998 Ga0466963_0015451 3300044694 Bacteria 4728
999 Ga0466963_0042944 3300044694 Bacteria 2970
1000 Ga0466963_0155714 3300044694 Bacteria 1588
1001 Ga0453684_0082525 3300044712 Bacteria 4004
1002 Ga0466959_0059587 3300045049 Bacteria 2780
1003 Ga0451576_0027924 3300045051 Bacteria 6053
1004 Ga0466958_0035584 3300045836 Bacteria 2975
1005 Ga0466967_0002255 3300045976 Bacteria 11880
1006 Ga0466967_0007911 3300045976 Bacteria 7730
1007 Ga0466967_0053981 3300045976 Bacteria 3534
1008 Ga0466967_0066726 3300045976 Bacteria 3207
1009 Ga0466967_0081609 3300045976 Bacteria 2921
1010 Ga0466967_0172865 3300045976 Bacteria 2034
1011 Ga0466967_0178004 3300045976 Bacteria 2004
1012 Ga0466967_0191450 3300045976 Bacteria 1933
1013 Ga0495592_0008217 3300046454 Bacteria 7838
1014 Ga0495592_0027775 3300046454 Bacteria 4286
1015 Ga0495592_0101871 3300046454 Bacteria 2045
1016 Ga0495603_0087900 3300046455 Bacteria 1818
1017 Ga0495629_0000668 3300046459 Bacteria 27756
1018 Ga0495629_0135648 3300046459 Bacteria 1713
1019 Ga0495638_0000204 3300046460 Bacteria 84182
1020 Ga0495638_0017966 3300046460 Bacteria 4706
1021 Ga0495638_0021126 3300046460 Bacteria 4294
1022 Ga0495641_0034802 3300046461 Bacteria 2378
1023 Ga0495641_0068827 3300046461 Bacteria 1591
1024 Ga0495651_0000237 3300046462 Bacteria 42533
1025 Ga0495651_0009743 3300046462 Bacteria 7388
1026 Ga0495651_0014732 3300046462 Bacteria 6046
1027 Ga0495651_0064792 3300046462 Bacteria 2792
1028 Ga0495653_0009351 3300046463 Bacteria 8019
1029 Ga0495653_0020295 3300046463 Bacteria 5388
1030 Ga0495653_0047643 3300046463 Bacteria 3314
1031 Ga0495580_0024260 3300046472 Bacteria 4444
1032 Ga0495580_0044157 3300046472 Bacteria 3171
1033 Ga0495582_0035811 3300046473 Bacteria 2730
1034 Ga0495639_0020552 3300046475 Bacteria 2885
1035 Ga0495662_0000280 3300046476 Bacteria 21964
1036 Ga0495662_0007973 3300046476 Bacteria 5216
1037 Ga0495662_0015169 3300046476 Bacteria 3743
1038 Ga0495664_0000112 3300046477 Bacteria 40522
1039 Ga0495664_0006025 3300046477 Bacteria 6683
1040 Ga0495664_0092353 3300046477 Bacteria 1820
1041 Ga0495584_0011269 3300046491 Bacteria 4579
1042 Ga0495584_0055204 3300046491 Bacteria 1999
1043 Ga0495584_0074316 3300046491 Bacteria 1708
1044 Ga0495585_0000734 3300046492 Bacteria 29222
1045 Ga0495585_0006706 3300046492 Bacteria 7107
1046 Ga0495596_0008510 3300046500 Bacteria 4563
1047 Ga0495607_0011035 3300046501 Bacteria 6034
1048 Ga0495608_0005221 3300046511 Bacteria 9279
1049 Ga0495608_0067866 3300046511 Bacteria 2332
1050 Ga0495610_0002641 3300046512 Bacteria 14823
1051 Ga0495618_0001016 3300046514 Bacteria 19217
1052 Ga0495618_0007304 3300046514 Bacteria 6686
1053 Ga0495618_0066673 3300046514 Bacteria 2288
1054 Ga0495618_0134541 3300046514 Bacteria 1581
1055 Ga0495628_0004625 3300046516 Bacteria 12159
1056 Ga0495628_0018442 3300046516 Bacteria 5780
1057 Ga0495628_0211069 3300046516 Bacteria 1460
1058 Ga0495630_0024126 3300046517 Bacteria 4497
1059 Ga0495630_0034111 3300046517 Bacteria 3797
1060 Ga0495631_0016466 3300046518 Bacteria 3523
1061 Ga0495632_0000075 3300046519 Bacteria 102051
1062 Ga0495632_0046880 3300046519 Bacteria 2146
1063 Ga0495637_0000123 3300046520 Bacteria 57717
1064 Ga0495637_0034787 3300046520 Bacteria 2204
1065 Ga0495643_0000009 3300046522 Bacteria 344767
1066 Ga0495644_0000306 3300046523 Bacteria 22634
1067 Ga0495648_0037541 3300046524 Bacteria 3111
1068 Ga0495663_0000003 3300046525 Bacteria 362694
1069 Ga0495663_0017730 3300046525 Bacteria 2023
1070 Ga0495666_0023948 3300046526 Bacteria 3019
1071 Ga0495666_0034834 3300046526 Bacteria 2455
1072 Ga0495652_0019482 3300046529 Bacteria 6042
1073 Ga0495652_0105926 3300046529 Bacteria 2271
1074 Ga0495665_0007482 3300046531 Bacteria 5909
1075 Ga0495665_0012616 3300046531 Bacteria 4575
1076 Ga0495665_0030802 3300046531 Bacteria 2870
1077 Ga0495640_0000871 3300046533 Bacteria 23106
1078 Ga0495640_0084501 3300046533 Bacteria 2105
1079 Ga0495586_0014023 3300046535 Bacteria 4255
1080 Ga0495586_0041668 3300046535 Bacteria 2473
1081 Ga0495586_0111993 3300046535 Bacteria 1519
1082 Ga0495587_0006533 3300046536 Bacteria 7598
1083 Ga0495587_0072252 3300046536 Bacteria 2006
1084 Ga0495587_0118441 3300046536 Bacteria 1517
1085 Ga0495598_0003015 3300046537 Bacteria 3534
1086 Ga0495621_0000652 3300046539 Bacteria 8756
1087 Ga0495621_0011175 3300046539 Bacteria 2769
1088 Ga0495621_0019245 3300046539 Bacteria 2228
1089 Ga0495645_0003375 3300046543 Bacteria 10820
1090 Ga0495645_0004586 3300046543 Bacteria 9430
1091 Ga0495645_0076719 3300046543 Bacteria 2403
1092 Ga0495622_0034756 3300046557 Bacteria 2351
1093 Ga0495622_0054674 3300046557 Bacteria 1852
1094 Ga0495633_0000173 3300046558 Bacteria 84576
1095 Ga0495633_0001183 3300046558 Bacteria 20947
1096 Ga0495633_0001327 3300046558 Bacteria 19427
1097 Ga0495667_0003141 3300046559 Bacteria 11080
1098 Ga0495667_0004903 3300046559 Bacteria 9045
1099 Ga0495667_0079413 3300046559 Bacteria 2133
1100 Ga0495667_0095258 3300046559 Bacteria 1927
1101 Ga0495656_0000381 3300046615 Bacteria 14786
1102 Ga0495656_0072045 3300046615 Bacteria 1537
1103 Ga0495668_0076134 3300046616 Bacteria 1842
1104 Ga0495634_0003493 3300046642 Bacteria 12595
1105 Ga0495634_0033846 3300046642 Bacteria 3509
1106 Ga0495634_0038870 3300046642 Bacteria 3243
1107 Ga0495611_0001463 3300046648 Bacteria 11757
1108 Ga0495635_0002093 3300046663 Bacteria 13548
1109 Ga0495635_0028467 3300046663 Bacteria 3884
1110 Ga0495635_0116987 3300046663 Bacteria 1819
1111 Ga0495659_0003761 3300046664 Bacteria 4823
1112 Ga0495661_0082450 3300046665 Bacteria 1851
1113 Ga0495588_0002225 3300046674 Bacteria 8308
1114 Ga0495657_0006644 3300046675 Bacteria 9033
1115 Ga0495657_0008508 3300046675 Bacteria 7845
1116 Ga0495657_0008561 3300046675 Bacteria 7814
1117 Ga0495599_0021673 3300046678 Bacteria 4009
1118 Ga0495623_0026503 3300046679 Bacteria 3731
1119 Ga0495646_0004362 3300046680 Bacteria 8917
1120 Ga0495658_0000229 3300046683 Bacteria 32147
1121 Ga0495669_0000599 3300046684 Bacteria 15785
1122 Ga0495669_0001837 3300046684 Bacteria 8692
1123 Ga0495669_0010207 3300046684 Bacteria 3967
1124 Ga0495613_0011247 3300046689 Bacteria 6650
1125 Ga0495613_0037688 3300046689 Bacteria 3584
1126 Ga0495613_0103240 3300046689 Bacteria 2058
1127 Ga0495613_0121505 3300046689 Bacteria 1875
1128 Ga0495624_0001093 3300046690 Bacteria 21434
1129 Ga0495624_0022372 3300046690 Bacteria 4179
1130 Ga0495670_0002180 3300046691 Bacteria 9687
1131 Ga0495670_0003882 3300046691 Bacteria 7342
1132 Ga0495670_0102255 3300046691 Bacteria 1476
1133 Ga0495671_0000013 3300046692 Bacteria 344767
1134 Ga0495600_0019287 3300046809 Bacteria 4354
1135 Ga0495600_0067544 3300046809 Bacteria 2337
1136 Ga0495600_0084015 3300046809 Bacteria 2078
1137 Ga0495581_0054776 3300047315 Bacteria 2302
1138 Ga0495581_0056281 3300047315 Bacteria 2270
1139 Ga0495581_0058993 3300047315 Bacteria 2216
1140 Ga0495581_0084168 3300047315 Bacteria 1843
1141 Ga0495604_0002806 3300047317 Bacteria 13980
1142 Ga0495604_0008011 3300047317 Bacteria 8369
1143 Ga0495604_0009095 3300047317 Bacteria 7860
1144 Ga0495674_0001513 3300047319 Bacteria 22779
1145 Ga0495674_0151891 3300047319 Bacteria 1941
1146 Ga0495674_0280038 3300047319 Bacteria 1366
1147 Ga0495672_0002402 3300047320 Bacteria 17288
1148 Ga0495672_0004345 3300047320 Bacteria 11663
1149 Ga0495672_0083360 3300047320 Bacteria 1776
1150 Ga0495676_0072836 3300047321 Bacteria 2636
1151 Ga0495676_0125444 3300047321 Bacteria 1861
1152 Ga0495680_0016671 3300047322 Bacteria 6304
1153 Ga0495680_0025791 3300047322 Bacteria 4859
1154 Ga0495680_0028426 3300047322 Bacteria 4584
1155 Ga0495680_0077960 3300047322 Bacteria 2508
1156 Ga0495680_0098613 3300047322 Bacteria 2180
1157 Ga0495675_0005331 3300047444 Bacteria 7834
1158 Ga0495677_0018861 3300047445 Bacteria 2501
1159 Ga0495681_0001636 3300047470 Bacteria 16634
1160 Ga0495684_0000264 3300047471 Bacteria 41677
1161 Ga0495684_0001309 3300047471 Bacteria 20014
1162 Ga0495593_0030842 3300047673 Bacteria 2931
1163 Ga0495593_0046463 3300047673 Bacteria 2313
1164 Ga0495602_0005783 3300048088 Bacteria 12976
1165 Ga0495602_0021033 3300048088 Bacteria 6431
1166 Ga0495602_0040285 3300048088 Bacteria 4287
1167 Ga0495602_0186809 3300048088 Bacteria 1593
1168 Ga0495614_0012220 3300048089 Bacteria 3771
1169 Ga0495615_0004517 3300048090 Bacteria 2436
1170 Ga0495626_0000214 3300048091 Bacteria 69009
1171 Ga0496100_0001253 3300048903 Bacteria 12380
1172 Ga0496100_0040891 3300048903 Bacteria 2952
1173 Ga0496101_0001852 3300048904 Bacteria 12758
1174 Ga0496101_0002475 3300048904 Bacteria 11344
1175 Ga0496101_0004266 3300048904 Bacteria 8964
1176 Ga0496101_0043198 3300048904 Bacteria 3221
1177 Ga0496101_0061187 3300048904 Bacteria 2734
1178 Ga0496102_0002526 3300048905 Bacteria 15627
1179 Ga0496102_0006171 3300048905 Bacteria 10219
1180 Ga0496102_0024435 3300048905 Bacteria 5373
1181 Ga0496102_0203451 3300048905 Bacteria 1866
1182 Ga0496103_0000130 3300048906 Bacteria 80826
1183 Ga0496103_0000715 3300048906 Bacteria 24556
1184 Ga0496103_0012088 3300048906 Bacteria 5127
1185 Ga0496103_0031446 3300048906 Bacteria 3234
1186 Ga0496104_0000311 3300048907 Bacteria 43387
1187 Ga0496104_0000900 3300048907 Bacteria 25552
1188 Ga0496104_0001975 3300048907 Bacteria 17756
1189 Ga0496104_0011188 3300048907 Bacteria 8029
1190 Ga0496104_0047862 3300048907 Bacteria 4031
1191 Ga0496104_0095212 3300048907 Bacteria 2849
1192 Ga0496105_0000144 3300048908 Bacteria 46774
1193 Ga0496105_0000363 3300048908 Bacteria 30056
1194 Ga0496105_0010173 3300048908 Bacteria 7391
1195 Ga0496105_0052297 3300048908 Bacteria 3374
1196 Ga0496105_0075082 3300048908 Bacteria 2792
1197 Ga0496105_0075755 3300048908 Bacteria 2778
1198 Ga0496105_0200163 3300048908 Bacteria 1630
1199 Ga0496106_0000135 3300048909 Bacteria 55500
1200 Ga0496106_0005392 3300048909 Bacteria 9457
1201 Ga0496106_0011849 3300048909 Bacteria 6436
1202 Ga0496106_0015796 3300048909 Bacteria 5583
1203 Ga0496106_0106463 3300048909 Bacteria 2180
1204 Ga0496107_0012327 3300048910 Bacteria 5968
1205 Ga0496107_0031189 3300048910 Bacteria 3801
1206 Ga0496107_0059074 3300048910 Bacteria 2774
1207 Ga0496107_0120197 3300048910 Bacteria 1935
1208 Ga0496107_0255400 3300048910 Bacteria 1304
1209 Ga0496108_0000256 3300048911 Bacteria 46076
1210 Ga0496108_0004267 3300048911 Bacteria 11515
1211 Ga0496108_0005425 3300048911 Bacteria 10309
1212 Ga0496108_0005764 3300048911 Bacteria 10033
1213 Ga0496108_0008672 3300048911 Bacteria 8244
1214 Ga0496108_0022065 3300048911 Bacteria 5234
1215 Ga0496108_0040349 3300048911 Bacteria 3891
1216 Ga0496108_0125821 3300048911 Bacteria 2200
1217 Ga0496109_0000490 3300048912 Bacteria 33902
1218 Ga0496109_0000730 3300048912 Bacteria 27368
1219 Ga0496109_0012503 3300048912 Bacteria 7328
1220 Ga0496109_0027371 3300048912 Bacteria 5090
1221 Ga0496109_0041709 3300048912 Bacteria 4157
1222 Ga0496109_0048395 3300048912 Bacteria 3868
1223 Ga0496109_0066682 3300048912 Bacteria 3296
1224 Ga0496109_0167510 3300048912 Bacteria 2060
1225 Ga0496109_0219015 3300048912 Bacteria 1790
1226 Ga0496110_0005771 3300048913 Bacteria 9726
1227 Ga0496110_0008763 3300048913 Bacteria 8150
1228 Ga0496110_0008841 3300048913 Bacteria 8115
1229 Ga0496110_0010176 3300048913 Bacteria 7641
1230 Ga0496110_0124874 3300048913 Bacteria 2321
1231 Ga0496110_0257683 3300048913 Bacteria 1588
1232 Ga0496111_0002097 3300048914 Bacteria 11899
1233 Ga0496111_0012561 3300048914 Bacteria 5739
1234 Ga0496111_0015368 3300048914 Bacteria 5251
1235 Ga0496111_0030426 3300048914 Bacteria 3838
1236 Ga0496111_0047442 3300048914 Bacteria 3093
1237 Ga0496111_0074374 3300048914 Bacteria 2474
1238 Ga0496111_0084864 3300048914 Bacteria 2315
1239 Ga0496111_0098668 3300048914 Bacteria 2145
1240 Ga0496112_0002301 3300048915 Bacteria 15303
1241 Ga0496112_0040962 3300048915 Bacteria 4530
1242 Ga0496112_0051044 3300048915 Bacteria 4056
1243 Ga0496112_0053767 3300048915 Bacteria 3956
1244 Ga0496112_0083002 3300048915 Bacteria 3168
1245 Ga0496112_0086797 3300048915 Bacteria 3095
1246 Ga0496112_0116008 3300048915 Bacteria 2648
1247 Ga0496112_0196859 3300048915 Bacteria 1975
1248 Ga0496113_0000318 3300048916 Bacteria 22869
1249 Ga0496113_0004239 3300048916 Bacteria 8777
1250 Ga0496113_0008442 3300048916 Bacteria 6712
1251 Ga0496113_0016292 3300048916 Bacteria 5131
1252 Ga0496113_0079873 3300048916 Bacteria 2504
1253 Ga0496114_0000006 3300048917 Bacteria 472921
1254 Ga0496114_0000287 3300048917 Bacteria 36856
1255 Ga0496114_0058988 3300048917 Bacteria 3205
1256 Ga0496114_0131587 3300048917 Bacteria 2161
1257 Ga0496115_0003371 3300048918 Bacteria 11463
1258 Ga0496115_0009373 3300048918 Bacteria 7274
1259 Ga0496115_0018872 3300048918 Bacteria 5302
1260 Ga0496115_0019923 3300048918 Bacteria 5169
1261 Ga0496115_0061836 3300048918 Bacteria 3020
1262 Ga0496115_0064194 3300048918 Bacteria 2963
1263 Ga0496115_0113708 3300048918 Bacteria 2224
1264 Ga0496116_0000062 3300048919 Bacteria 271104
1265 Ga0496118_0039378 3300048921 Bacteria 3773
1266 Ga0496119_0000936 3300048922 Bacteria 37609
1267 Ga0496121_0002503 3300048924 Bacteria 27924
1268 Ga0496121_0010966 3300048924 Bacteria 10120
1269 Ga0496122_0000589 3300048925 Bacteria 74585
1270 Ga0496122_0009287 3300048925 Bacteria 10397
1271 Ga0496122_0019558 3300048925 Bacteria 6178
1272 Ga0496122_0020036 3300048925 Bacteria 6074
1273 Ga0496123_0000278 3300048926 Bacteria 100746
1274 Ga0496123_0000545 3300048926 Bacteria 64687
1275 Ga0496123_0001298 3300048926 Bacteria 35561
1276 Ga0496123_0002167 3300048926 Bacteria 25064
1277 Ga0496124_0010346 3300048927 Bacteria 9463
1278 Ga0496124_0052085 3300048927 Bacteria 3479
1279 Ga0496125_0004774 3300048928 Bacteria 15434
1280 Ga0496125_0027784 3300048928 Bacteria 5121
1281 Ga0496126_0000801 3300048929 Bacteria 56279
1282 Ga0501032_0039527 3300049569 Bacteria 3208
1283 Ga0501032_0063370 3300049569 Bacteria 2475
1284 Ga0501032_0162501 3300049569 Bacteria 1466
1285 Ga0501033_0004204 3300049570 Bacteria 11589
1286 Ga0501033_0024281 3300049570 Bacteria 4574
1287 Ga0501033_0026129 3300049570 Bacteria 4394
1288 Ga0501034_0000436 3300049571 Bacteria 69142
1289 Ga0501034_0005233 3300049571 Bacteria 14236
1290 Ga0501034_0009627 3300049571 Bacteria 10109
1291 Ga0501034_0027067 3300049571 Bacteria 5834
1292 Ga0501034_0099430 3300049571 Bacteria 2903
1293 Ga0501036_0001221 3300049572 Bacteria 19615
1294 Ga0501036_0027487 3300049572 Bacteria 4806
1295 Ga0501036_0044521 3300049572 Bacteria 3759
1296 Ga0501036_0131217 3300049572 Bacteria 2115
1297 Ga0501037_0003949 3300049573 Bacteria 10757
1298 Ga0501038_0028790 3300049574 Bacteria 4932
1299 Ga0501038_0085958 3300049574 Bacteria 2643
1300 Ga0501038_0095777 3300049574 Bacteria 2479
1301 Ga0501039_0033073 3300049575 Bacteria 3989
1302 Ga0501039_0044143 3300049575 Bacteria 3442
1303 Ga0501039_0214251 3300049575 Bacteria 1514
1304 Ga0501040_0108027 3300049576 Bacteria 1945
1305 Ga0501043_0008146 3300049579 Bacteria 8271
1306 Ga0501043_0009282 3300049579 Bacteria 7730
1307 Ga0501043_0034819 3300049579 Bacteria 3960
1308 Ga0501046_0105803 3300049580 Bacteria 2154
1309 Ga0501047_0000223 3300049581 Bacteria 67658
1310 Ga0501047_0000384 3300049581 Bacteria 49644
1311 Ga0501047_0035760 3300049581 Bacteria 4798
1312 Ga0501047_0116121 3300049581 Bacteria 2558
1313 Ga0501047_0146712 3300049581 Bacteria 2236
1314 Ga0501048_0000074 3300049582 Bacteria 51762
1315 Ga0501048_0123057 3300049582 Bacteria 1833
1316 Ga0501067_0011404 3300049583 Bacteria 4920
1317 Ga0501067_0055988 3300049583 Bacteria 2185
1318 Ga0501067_0076510 3300049583 Bacteria 1854
1319 Ga0501068_0032961 3300049584 Bacteria 3082
1320 Ga0501069_0006054 3300049585 Bacteria 6317
1321 Ga0501069_0019134 3300049585 Bacteria 3699
1322 Ga0501070_0008586 3300049586 Bacteria 8639
1323 Ga0501070_0011258 3300049586 Bacteria 7554
1324 Ga0501070_0025736 3300049586 Bacteria 4936
1325 Ga0501070_0032074 3300049586 Bacteria 4398
1326 Ga0501070_0032152 3300049586 Bacteria 4392
1327 Ga0501071_0011938 3300049587 Bacteria 5869
1328 Ga0501071_0071204 3300049587 Bacteria 2534
1329 Ga0501071_0126813 3300049587 Bacteria 1895
1330 Ga0501072_0001326 3300049588 Bacteria 18567
1331 Ga0501074_0012491 3300049590 Bacteria 6174
1332 Ga0501076_0012519 3300049592 Bacteria 6345
1333 Ga0501076_0064957 3300049592 Bacteria 2909
1334 Ga0501076_0091509 3300049592 Bacteria 2447
1335 Ga0501235_011191 3300049669 Bacteria 1965
1336 Ga0501221_006804 3300049704 Bacteria 1943
1337 Ga0501079_0135107 3300049741 Bacteria 1920
1338 Ga0501079_0202160 3300049741 Bacteria 1552
1339 Ga0501080_0001854 3300049742 Bacteria 18155
1340 Ga0501080_0025491 3300049742 Bacteria 5488
1341 Ga0501080_0059932 3300049742 Bacteria 3542
1342 Ga0501081_0053559 3300049743 Bacteria 2786
1343 Ga0501083_0001146 3300049744 Bacteria 17823
1344 Ga0501083_0022266 3300049744 Bacteria 4397
1345 Ga0501083_0043876 3300049744 Bacteria 3028
1346 Ga0501083_0170931 3300049744 Bacteria 1420
1347 Ga0501035_0000371 3300049822 Bacteria 51668
1348 Ga0501035_0007311 3300049822 Bacteria 10327
1349 Ga0501035_0033698 3300049822 Bacteria 4655
1350 Ga0501035_0060863 3300049822 Bacteria 3361
1351 Ga0501035_0253117 3300049822 Bacteria 1495
1352 Ga0501044_0001720 3300049823 Bacteria 25612
1353 Ga0501044_0011870 3300049823 Bacteria 9439
1354 Ga0501044_0124863 3300049823 Bacteria 2571
1355 Ga0501045_0168021 3300049824 Bacteria 1634
1356 nmdc:mga03n38_6277_c1 3300050490 Bacteria 4117
1357 nmdc:mga03n38_92370_c1 3300050490 Bacteria 1443
1358 nmdc:mga0yw44_23578_c1 3300050492 Bacteria 3470
1359 nmdc:mga0yw44_2995_c1 3300050492 Bacteria 7373
1360 nmdc:mga0yw44_63475_c1 3300050492 Bacteria 2271
1361 nmdc:mga06z11_11391_c1 3300050494 Bacteria 3833
1362 nmdc:mga06z11_49590_c1 3300050494 Bacteria 2143
1363 nmdc:mga06z11_60_c1 3300050494 Bacteria 46715
1364 nmdc:mga04h51_39509_c1 3300050495 Bacteria 1533
1365 nmdc:mga04h51_403_c1 3300050495 Bacteria 10448
1366 nmdc:mga07m45_136286_c1 3300050496 Bacteria 1421
1367 nmdc:mga07m45_81046_c1 3300050496 Bacteria 1853
1368 nmdc:mga07m45_8495_c1 3300050496 Bacteria 5282
1369 nmdc:mga05p37_1191_c1 3300050507 Bacteria 30041
1370 nmdc:mga05p37_222_c1 3300050507 Bacteria 57449
1371 nmdc:mga05p37_30060_c1 3300050507 Bacteria 6630
1372 nmdc:mga05p37_71985_c1 3300050507 Bacteria 4253
1373 nmdc:mga05p37_81621_c1 3300050507 Bacteria 3983
1374 nmdc:mga09592_16877_c1 3300050508 Bacteria 5975
1375 nmdc:mga09592_3118_c1 3300050508 Bacteria 13463
1376 nmdc:mga09592_70637_c1 3300050508 Bacteria 2963
1377 nmdc:mga0qj67_141077_c1 3300050509 Bacteria 1954
1378 nmdc:mga0qj67_1677_c1 3300050509 Bacteria 15599
1379 nmdc:mga0qj67_60328_c1 3300050509 Bacteria 3010
1380 nmdc:mga06r32_1077_c1 3300050510 Bacteria 24523
1381 nmdc:mga06r32_284100_c1 3300050510 Bacteria 1642
1382 nmdc:mga08y16_11073_c1 3300050511 Bacteria 9470
1383 nmdc:mga08y16_116433_c1 3300050511 Bacteria 2782
1384 nmdc:mga08y16_121832_c1 3300050511 Bacteria 2714
1385 nmdc:mga08y16_13536_c1 3300050511 Bacteria 8586
1386 nmdc:mga08y16_13718_c1 3300050511 Bacteria 8532
1387 nmdc:mga08y16_57400_c1 3300050511 Bacteria 4068
1388 nmdc:mga08y16_587_c1 3300050511 Bacteria 33873
1389 nmdc:mga0n895_126764_c1 3300050512 Bacteria 2577
1390 nmdc:mga0n895_150771_c1 3300050512 Bacteria 2355
1391 nmdc:mga0n895_200633_c1 3300050512 Bacteria 2026
1392 nmdc:mga0n895_425063_c1 3300050512 Bacteria 1343
1393 nmdc:mga0n895_437_c1 3300050512 Bacteria 28072
1394 nmdc:mga0n895_741_c1 3300050512 Bacteria 23095
1395 nmdc:mga0rr50_185351_c1 3300050513 Bacteria 1703
1396 nmdc:mga0rr50_5627_c1 3300050513 Bacteria 7503
1397 nmdc:mga0rr50_6644_c1 3300050513 Bacteria 7069
1398 nmdc:mga0rr50_88555_c1 3300050513 Bacteria 2405
1399 nmdc:mga08x19_165289_c1 3300050514 Bacteria 1504
1400 nmdc:mga08x19_49275_c1 3300050514 Bacteria 2701
1401 nmdc:mga0a205_158439_c1 3300050515 Bacteria 2161
1402 nmdc:mga0a205_3283_c1 3300050515 Bacteria 14388
1403 nmdc:mga0a205_40207_c1 3300050515 Bacteria 4501
1404 nmdc:mga0a205_43507_c1 3300050515 Bacteria 4330
1405 nmdc:mga0a205_6511_c1 3300050515 Bacteria 10559
1406 nmdc:mga0a205_802_c1 3300050515 Bacteria 25500
1407 nmdc:mga0sz30_19123_c1 3300050516 Bacteria 2749
1408 Ga0495601_0000441 3300053077 Bacteria 21726
1409 Ga0495601_0001951 3300053077 Bacteria 11535
1410 Ga0495601_0006078 3300053077 Bacteria 7043
1411 Ga0495601_0020031 3300053077 Bacteria 4082
1412 Ga0495601_0042861 3300053077 Bacteria 2841
1413 Ga0495612_0006563 3300053078 Bacteria 4774
1414 Ga0495612_0019001 3300053078 Bacteria 2750
1415 Ga0495612_0048622 3300053078 Bacteria 1739
1416 Ga0495595_0000551 3300053084 Bacteria 14288
1417 Ga0495595_0002072 3300053084 Bacteria 7796
1418 Ga0495595_0003250 3300053084 Bacteria 6456
1419 Ga0495595_0008006 3300053084 Bacteria 4328
1420 Ga0495595_0110045 3300053084 Bacteria 1335
1421 Ga0495619_0000063 3300053085 Bacteria 84834
1422 Ga0495619_0000170 3300053085 Bacteria 47706
1423 Ga0495619_0001482 3300053085 Bacteria 15480
1424 Ga0495619_0011350 3300053085 Bacteria 5609
1425 Ga0495619_0022077 3300053085 Bacteria 4068
1426 Ga0495619_0022235 3300053085 Bacteria 4056
1427 Ga0500644_0000715 3300053088 Bacteria 11751
1428 Ga0500651_0004383 3300053093 Bacteria 7888
1429 Ga0500641_0017324 3300053096 Bacteria 2693
1430 Ga0500556_0000160 3300053104 Bacteria 55309
1431 Ga0500593_000044 3300053117 Bacteria 45032
1432 Ga0500593_007593 3300053117 Bacteria 4424
1433 Ga0500594_0036322 3300053118 Bacteria 1326
1434 Ga0500595_000085 3300053119 Bacteria 65800
1435 Ga0500652_000056 3300053131 Bacteria 51871
1436 Ga0500652_005144 3300053131 Bacteria 4095
1437 Ga0500568_0000004 3300053139 Bacteria 621666
1438 Ga0500616_0000001 3300053153 Bacteria 1986011
1439 Ga0500616_0000038 3300053153 Bacteria 386801
1440 Ga0500624_000072 3300053157 Bacteria 57950
1441 Ga0500636_0029690 3300053177 Bacteria 3231
1442 Ga0500645_004638 3300053730 Bacteria 5232
1443 Ga0500645_006791 3300053730 Bacteria 4047
1444 Ga0501084_0128391 3300054114 Bacteria 2134
1445 Ga0501082_0001551 3300060353 Bacteria 20235
1446 Ga0501082_0060009 3300060353 Bacteria 3277
1447 Ga0501082_0083169 3300060353 Bacteria 2762
1448 Ga0501082_0127916 3300060353 Bacteria 2203

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10068034 Ga0157372_100680342 327
2 3300048910 Ga0496107_0255400 Ga0496107_0255400_19_1080 352
3 3300025917 Ga0207660_10237190 Ga0207660_102371901 358
4 3300005366 Ga0070659_100263079 Ga0070659_1002630791 360
5 3300005616 Ga0068852_100015664 Ga0068852_1000156645 360
6 3300025919 Ga0207657_10019526 Ga0207657_100195262 360
7 3300025933 Ga0207706_10027262 Ga0207706_100272622 360
8 3300026142 Ga0207698_10044221 Ga0207698_100442213 360
9 3300044684 Ga0466966_0167740 Ga0466966_0167740_16_1134 360
10 3300060353 Ga0501082_0060009 Ga0501082_0060009_2064_3164 366
11 3300046524 Ga0495648_0037541 Ga0495648_0037541_1938_3077 367
12 3300048914 Ga0496111_0098668 Ga0496111_0098668_40_1191 367
13 3300013104 Ga0157370_10021346 Ga0157370_100213466 369
14 3300009551 Ga0105238_10038260 Ga0105238_100382602 372
15 3300013105 Ga0157369_10088883 Ga0157369_100888833 372
16 3300026116 Ga0207674_10002181 Ga0207674_1000218125 372
17 3300049704 Ga0501221_006804 Ga0501221_006804_256_1500 377
18 3300031824 Ga0307413_10005807 Ga0307413_100058072 379
19 3300042006 Ga0439432_023841 Ga0439432_023841_718_1962 379
20 3300047445 Ga0495677_0018861 Ga0495677_0018861_919_2127 387
21 3300001990 JGI24737J22298_10023419 JGI24737J22298_100234191 390
22 3300005327 Ga0070658_10124174 Ga0070658_101241742 390
23 3300005355 Ga0070671_100083737 Ga0070671_1000837372 390
24 3300005458 Ga0070681_10052703 Ga0070681_100527032 390
25 3300005578 Ga0068854_100037514 Ga0068854_1000375142 390
26 3300005616 Ga0068852_100039158 Ga0068852_1000391582 390
27 3300009093 Ga0105240_10021899 Ga0105240_100218998 390
28 3300010375 Ga0105239_10021456 Ga0105239_100214564 390
29 3300013102 Ga0157371_10123912 Ga0157371_101239122 390
30 3300025912 Ga0207707_10059659 Ga0207707_100596592 390
31 3300025919 Ga0207657_10018720 Ga0207657_100187205 390
32 3300025921 Ga0207652_10015009 Ga0207652_100150092 390
33 3300025921 Ga0207652_10114203 Ga0207652_101142032 390
34 3300025932 Ga0207690_10042617 Ga0207690_100426172 390
35 3300025986 Ga0207658_10071331 Ga0207658_100713312 390
36 3300026067 Ga0207678_10001535 Ga0207678_1000153519 390
37 3300026067 Ga0207678_10003104 Ga0207678_100031042 390
38 3300026116 Ga0207674_10002696 Ga0207674_100026969 390
39 3300026142 Ga0207698_10162661 Ga0207698_101626612 390
40 3300028379 Ga0268266_10028106 Ga0268266_100281062 390
41 3300031824 Ga0307413_10041306 Ga0307413_100413063 390
42 3300031852 Ga0307410_10067718 Ga0307410_100677182 390
43 3300031852 Ga0307410_10078392 Ga0307410_100783922 390
44 3300031911 Ga0307412_10095467 Ga0307412_100954672 390
45 3300031911 Ga0307412_10117210 Ga0307412_101172102 390
46 3300032004 Ga0307414_10044294 Ga0307414_100442943 390
47 3300032004 Ga0307414_10091118 Ga0307414_100911183 390
48 3300048908 Ga0496105_0200163 Ga0496105_0200163_19_1215 390
49 3300031911 Ga0307412_10018182 Ga0307412_100181824 391
50 3300032002 Ga0307416_100063662 Ga0307416_1000636622 391
51 3300032002 Ga0307416_100167519 Ga0307416_1001675192 391
52 3300032005 Ga0307411_10104022 Ga0307411_101040222 391
53 3300005354 Ga0070675_100002418 Ga0070675_10000241811 392
54 3300005457 Ga0070662_100064810 Ga0070662_1000648103 392
55 3300025926 Ga0207659_10000885 Ga0207659_100008852 392
56 3300025933 Ga0207706_10065107 Ga0207706_100651072 392
57 3300031852 Ga0307410_10006424 Ga0307410_100064245 392
58 3300031995 Ga0307409_100000135 Ga0307409_10000013511 392
59 3300031995 Ga0307409_100031858 Ga0307409_1000318581 392
60 3300032002 Ga0307416_100004600 Ga0307416_1000046005 392
61 3300032005 Ga0307411_10002367 Ga0307411_100023675 392
62 iso_pu_bacteria 8054302542 8054306822 394
63 3300002067 JGI24735J21928_10001811 JGI24735J21928_100018116 395
64 3300005341 Ga0070691_10037130 Ga0070691_100371302 395
65 3300005366 Ga0070659_100005493 Ga0070659_1000054932 395
66 3300005563 Ga0068855_100033428 Ga0068855_1000334284 395
67 3300025904 Ga0207647_10006288 Ga0207647_100062884 395
68 3300025911 Ga0207654_10028711 Ga0207654_100287113 395
69 3300025912 Ga0207707_10041404 Ga0207707_100414043 395
70 3300025913 Ga0207695_10043579 Ga0207695_100435793 395
71 3300025924 Ga0207694_10001718 Ga0207694_100017184 395
72 3300025932 Ga0207690_10015489 Ga0207690_100154893 395
73 3300026041 Ga0207639_10001105 Ga0207639_1000110518 395
74 3300005327 Ga0070658_10049510 Ga0070658_100495103 397
75 3300005333 Ga0070677_10027622 Ga0070677_100276222 397
76 3300005344 Ga0070661_100006306 Ga0070661_1000063067 397
77 3300005354 Ga0070675_100092638 Ga0070675_1000926382 397
78 3300005530 Ga0070679_100004731 Ga0070679_10000473110 397
79 3300005530 Ga0070679_100150520 Ga0070679_1001505202 397
80 3300005543 Ga0070672_100027974 Ga0070672_1000279745 397
81 3300005546 Ga0070696_100250150 Ga0070696_1002501501 397
82 3300005547 Ga0070693_100007754 Ga0070693_1000077543 397
83 3300005617 Ga0068859_100209476 Ga0068859_1002094762 397
84 3300006931 Ga0097620_100209474 Ga0097620_1002094742 397
85 3300009551 Ga0105238_10004728 Ga0105238_100047286 397
86 3300013100 Ga0157373_10014713 Ga0157373_100147134 397
87 3300013105 Ga0157369_10042326 Ga0157369_100423266 397
88 3300025909 Ga0207705_10049030 Ga0207705_100490301 397
89 3300025912 Ga0207707_10185051 Ga0207707_101850512 397
90 3300025919 Ga0207657_10001742 Ga0207657_100017428 397
91 3300025926 Ga0207659_10033789 Ga0207659_100337892 397
92 3300025932 Ga0207690_10148699 Ga0207690_101486992 397
93 3300025940 Ga0207691_10037116 Ga0207691_100371165 397
94 3300025941 Ga0207711_10015227 Ga0207711_100152273 397
95 3300031995 Ga0307409_100122463 Ga0307409_1001224632 397
96 3300037418 Ga0395900_0001169 Ga0395900_0001169_11694_12914 397
97 3300037471 Ga0395905_0000818 Ga0395905_0000818_3561_4781 397
98 3300037471 Ga0395905_0002761 Ga0395905_0002761_7142_8359 397
99 3300037471 Ga0395905_0021647 Ga0395905_0021647_3264_4484 397
100 3300038443 Ga0395901_0002866 Ga0395901_0002866_7093_8313 397
101 3300038443 Ga0395901_0114738 Ga0395901_0114738_693_1913 397
102 3300045976 Ga0466967_0081609 Ga0466967_0081609_1127_2344 397
103 3300045976 Ga0466967_0178004 Ga0466967_0178004_464_1681 397
104 3300046539 Ga0495621_0019245 Ga0495621_0019245_912_2129 397
105 3300046616 Ga0495668_0076134 Ga0495668_0076134_457_1674 397
106 3300046684 Ga0495669_0000599 Ga0495669_0000599_11507_12724 397
107 3300046684 Ga0495669_0001837 Ga0495669_0001837_4905_6122 397
108 3300046684 Ga0495669_0010207 Ga0495669_0010207_864_2081 397
109 iso_pu_bacteria 2885427238 2885427367 397
110 3300003791 Ga0055530_10006443 Ga0055530_100064434 398
111 3300031548 Ga0307408_100175266 Ga0307408_1001752662 398
112 3300037466 Ga0395898_0067555 Ga0395898_0067555_1886_3112 398
113 3300049583 Ga0501067_0011404 Ga0501067_0011404_190_1422 398
114 3300009094 Ga0111539_10001792 Ga0111539_1000179229 400
115 3300046539 Ga0495621_0000652 Ga0495621_0000652_904_2151 400
116 3300046691 Ga0495670_0003882 Ga0495670_0003882_6004_7251 400
117 3300048924 Ga0496121_0002503 Ga0496121_0002503_3651_4904 400
118 3300027876 Ga0209974_10006072 Ga0209974_100060724 401
119 3300031548 Ga0307408_100036610 Ga0307408_1000366102 401
120 3300031852 Ga0307410_10008268 Ga0307410_100082682 401
121 3300031903 Ga0307407_10002297 Ga0307407_100022975 401
122 3300031911 Ga0307412_10082897 Ga0307412_100828972 401
123 3300031995 Ga0307409_100003671 Ga0307409_1000036714 401
124 3300032002 Ga0307416_100030220 Ga0307416_1000302202 401
125 3300032002 Ga0307416_100036347 Ga0307416_1000363472 401
126 3300032004 Ga0307414_10080811 Ga0307414_100808112 401
127 3300032004 Ga0307414_10116781 Ga0307414_101167812 401
128 3300032005 Ga0307411_10022155 Ga0307411_100221554 401
129 iso_pu_bacteria 2919709256 2919709844 401
130 3300001915 JGI24741J21665_1005824 JGI24741J21665_10058242 402
131 3300001915 JGI24741J21665_1006916 JGI24741J21665_10069162 402
132 3300001979 JGI24740J21852_10018132 JGI24740J21852_100181322 402
133 3300001979 JGI24740J21852_10032414 JGI24740J21852_100324142 402
134 3300001989 JGI24739J22299_10002234 JGI24739J22299_100022346 402
135 3300001989 JGI24739J22299_10007003 JGI24739J22299_100070032 402
136 3300001991 JGI24743J22301_10001925 JGI24743J22301_100019252 402
137 3300002067 JGI24735J21928_10002726 JGI24735J21928_100027263 402
138 3300002075 JGI24738J21930_10003659 JGI24738J21930_100036592 402
139 3300005327 Ga0070658_10000264 Ga0070658_1000026422 402
140 3300005327 Ga0070658_10002220 Ga0070658_100022203 402
141 3300005327 Ga0070658_10008993 Ga0070658_100089934 402
142 3300005327 Ga0070658_10022506 Ga0070658_100225063 402
143 3300005327 Ga0070658_10126593 Ga0070658_101265932 402
144 3300005329 Ga0070683_100096585 Ga0070683_1000965853 402
145 3300005331 Ga0070670_100007186 Ga0070670_1000071864 402
146 3300005331 Ga0070670_100062640 Ga0070670_1000626402 402
147 3300005336 Ga0070680_100007728 Ga0070680_1000077289 402
148 3300005336 Ga0070680_100142711 Ga0070680_1001427112 402
149 3300005336 Ga0070680_100196106 Ga0070680_1001961062 402
150 3300005337 Ga0070682_100069856 Ga0070682_1000698562 402
151 3300005339 Ga0070660_100000091 Ga0070660_10000009125 402
152 3300005339 Ga0070660_100004304 Ga0070660_1000043042 402
153 3300005339 Ga0070660_100005461 Ga0070660_1000054612 402
154 3300005339 Ga0070660_100064748 Ga0070660_1000647483 402
155 3300005339 Ga0070660_100165159 Ga0070660_1001651592 402
156 3300005344 Ga0070661_100018063 Ga0070661_1000180633 402
157 3300005344 Ga0070661_100057653 Ga0070661_1000576532 402
158 3300005345 Ga0070692_10056796 Ga0070692_100567962 402
159 3300005345 Ga0070692_10069571 Ga0070692_100695712 402
160 3300005353 Ga0070669_100062266 Ga0070669_1000622662 402
161 3300005355 Ga0070671_100011792 Ga0070671_1000117929 402
162 3300005355 Ga0070671_100018174 Ga0070671_1000181744 402
163 3300005355 Ga0070671_100019157 Ga0070671_1000191574 402
164 3300005355 Ga0070671_100116863 Ga0070671_1001168632 402
165 3300005364 Ga0070673_100153387 Ga0070673_1001533872 402
166 3300005364 Ga0070673_100169148 Ga0070673_1001691482 402
167 3300005366 Ga0070659_100002194 Ga0070659_10000219411 402
168 3300005366 Ga0070659_100132646 Ga0070659_1001326462 402
169 3300005366 Ga0070659_100139737 Ga0070659_1001397372 402
170 3300005366 Ga0070659_100192052 Ga0070659_1001920522 402
171 3300005367 Ga0070667_100005633 Ga0070667_1000056333 402
172 3300005367 Ga0070667_100015164 Ga0070667_1000151645 402
173 3300005367 Ga0070667_100253537 Ga0070667_1002535371 402
174 3300005435 Ga0070714_100022892 Ga0070714_1000228924 402
175 3300005455 Ga0070663_100015911 Ga0070663_1000159113 402
176 3300005455 Ga0070663_100085590 Ga0070663_1000855902 402
177 3300005455 Ga0070663_100121253 Ga0070663_1001212531 402
178 3300005457 Ga0070662_100001002 Ga0070662_10000100215 402
179 3300005457 Ga0070662_100069580 Ga0070662_1000695803 402
180 3300005458 Ga0070681_10047969 Ga0070681_100479693 402
181 3300005458 Ga0070681_10123273 Ga0070681_101232732 402
182 3300005530 Ga0070679_100261883 Ga0070679_1002618832 402
183 3300005539 Ga0068853_100083372 Ga0068853_1000833722 402
184 3300005539 Ga0068853_100251885 Ga0068853_1002518851 402
185 3300005543 Ga0070672_100028466 Ga0070672_1000284662 402
186 3300005543 Ga0070672_100094811 Ga0070672_1000948112 402
187 3300005548 Ga0070665_100043426 Ga0070665_1000434262 402
188 3300005563 Ga0068855_100000129 Ga0068855_10000012953 402
189 3300005563 Ga0068855_100034657 Ga0068855_1000346577 402
190 3300005563 Ga0068855_100058535 Ga0068855_1000585352 402
191 3300005563 Ga0068855_100187219 Ga0068855_1001872192 402
192 3300005564 Ga0070664_100048170 Ga0070664_1000481703 402
193 3300005564 Ga0070664_100232242 Ga0070664_1002322421 402
194 3300005577 Ga0068857_100002666 Ga0068857_1000026665 402
195 3300005577 Ga0068857_100012690 Ga0068857_1000126903 402
196 3300005616 Ga0068852_100044588 Ga0068852_1000445884 402
197 3300005616 Ga0068852_100090988 Ga0068852_1000909882 402
198 3300005616 Ga0068852_100179374 Ga0068852_1001793742 402
199 3300005617 Ga0068859_100000088 Ga0068859_10000008859 402
200 3300005617 Ga0068859_100132405 Ga0068859_1001324052 402
201 3300005618 Ga0068864_100000136 Ga0068864_10000013642 402
202 3300005618 Ga0068864_100003805 Ga0068864_1000038053 402
203 3300005841 Ga0068863_100000384 Ga0068863_10000038443 402
204 3300005841 Ga0068863_100074646 Ga0068863_1000746462 402
205 3300005842 Ga0068858_100000063 Ga0068858_10000006345 402
206 3300005842 Ga0068858_100021963 Ga0068858_1000219633 402
207 3300005843 Ga0068860_100022772 Ga0068860_1000227724 402
208 3300005843 Ga0068860_100034044 Ga0068860_1000340443 402
209 3300005843 Ga0068860_100067885 Ga0068860_1000678853 402
210 3300005843 Ga0068860_100079433 Ga0068860_1000794331 402
211 3300005843 Ga0068860_100080163 Ga0068860_1000801633 402
212 3300005843 Ga0068860_100237878 Ga0068860_1002378783 402
213 3300005844 Ga0068862_100007190 Ga0068862_1000071904 402
214 3300005844 Ga0068862_100011427 Ga0068862_1000114275 402
215 3300005844 Ga0068862_100079551 Ga0068862_1000795512 402
216 3300006852 Ga0075433_10028588 Ga0075433_100285882 402
217 3300006881 Ga0068865_100133796 Ga0068865_1001337962 402
218 3300006931 Ga0097620_100000088 Ga0097620_10000008859 402
219 3300006931 Ga0097620_100132405 Ga0097620_1001324052 402
220 3300009011 Ga0105251_10034057 Ga0105251_100340572 402
221 3300009098 Ga0105245_10051976 Ga0105245_100519762 402
222 3300009177 Ga0105248_10000169 Ga0105248_1000016951 402
223 3300009177 Ga0105248_10020884 Ga0105248_100208847 402
224 3300009177 Ga0105248_10021626 Ga0105248_100216263 402
225 3300009553 Ga0105249_10039603 Ga0105249_100396032 402
226 3300010375 Ga0105239_10079131 Ga0105239_100791312 402
227 3300011119 Ga0105246_10056113 Ga0105246_100561133 402
228 3300013102 Ga0157371_10005808 Ga0157371_1000580813 402
229 3300013102 Ga0157371_10031596 Ga0157371_100315962 402
230 3300013102 Ga0157371_10035537 Ga0157371_100355372 402
231 3300013102 Ga0157371_10036397 Ga0157371_100363971 402
232 3300013102 Ga0157371_10202790 Ga0157371_102027902 402
233 3300013102 Ga0157371_10211537 Ga0157371_102115371 402
234 3300013296 Ga0157374_10059192 Ga0157374_100591923 402
235 3300013306 Ga0163162_10041821 Ga0163162_100418214 402
236 3300013307 Ga0157372_10243052 Ga0157372_102430522 402
237 3300013307 Ga0157372_10336092 Ga0157372_103360921 402
238 3300013308 Ga0157375_10056614 Ga0157375_100566142 402
239 3300014325 Ga0163163_10000170 Ga0163163_1000017065 402
240 3300014968 Ga0157379_10008961 Ga0157379_100089614 402
241 3300025901 Ga0207688_10008183 Ga0207688_100081832 402
242 3300025904 Ga0207647_10000627 Ga0207647_100006274 402
243 3300025904 Ga0207647_10004040 Ga0207647_100040403 402
244 3300025904 Ga0207647_10097072 Ga0207647_100970722 402
245 3300025907 Ga0207645_10005447 Ga0207645_100054471 402
246 3300025908 Ga0207643_10117178 Ga0207643_101171782 402
247 3300025909 Ga0207705_10000091 Ga0207705_1000009193 402
248 3300025909 Ga0207705_10009087 Ga0207705_100090877 402
249 3300025909 Ga0207705_10029024 Ga0207705_100290243 402
250 3300025909 Ga0207705_10037339 Ga0207705_100373394 402
251 3300025909 Ga0207705_10069088 Ga0207705_100690882 402
252 3300025912 Ga0207707_10017298 Ga0207707_100172984 402
253 3300025917 Ga0207660_10000864 Ga0207660_100008642 402
254 3300025917 Ga0207660_10006249 Ga0207660_100062498 402
255 3300025919 Ga0207657_10000092 Ga0207657_1000009266 402
256 3300025919 Ga0207657_10000252 Ga0207657_1000025236 402
257 3300025919 Ga0207657_10002395 Ga0207657_1000239512 402
258 3300025919 Ga0207657_10019350 Ga0207657_100193502 402
259 3300025919 Ga0207657_10024115 Ga0207657_100241153 402
260 3300025919 Ga0207657_10164423 Ga0207657_101644232 402
261 3300025920 Ga0207649_10114529 Ga0207649_101145292 402
262 3300025921 Ga0207652_10070600 Ga0207652_100706002 402
263 3300025921 Ga0207652_10085936 Ga0207652_100859362 402
264 3300025923 Ga0207681_10018745 Ga0207681_100187452 402
265 3300025924 Ga0207694_10007596 Ga0207694_100075962 402
266 3300025925 Ga0207650_10044215 Ga0207650_100442153 402
267 3300025926 Ga0207659_10245158 Ga0207659_102451581 402
268 3300025929 Ga0207664_10042440 Ga0207664_100424402 402
269 3300025931 Ga0207644_10005264 Ga0207644_100052645 402
270 3300025931 Ga0207644_10048211 Ga0207644_100482111 402
271 3300025931 Ga0207644_10057501 Ga0207644_100575012 402
272 3300025931 Ga0207644_10120300 Ga0207644_101203002 402
273 3300025932 Ga0207690_10000709 Ga0207690_1000070917 402
274 3300025932 Ga0207690_10002665 Ga0207690_1000266510 402
275 3300025932 Ga0207690_10031479 Ga0207690_100314793 402
276 3300025932 Ga0207690_10136594 Ga0207690_101365942 402
277 3300025933 Ga0207706_10000568 Ga0207706_1000056840 402
278 3300025933 Ga0207706_10000746 Ga0207706_1000074622 402
279 3300025933 Ga0207706_10011126 Ga0207706_100111266 402
280 3300025933 Ga0207706_10281828 Ga0207706_102818281 402
281 3300025940 Ga0207691_10017079 Ga0207691_100170792 402
282 3300025940 Ga0207691_10077281 Ga0207691_100772813 402
283 3300025941 Ga0207711_10000039 Ga0207711_10000039150 402
284 3300025941 Ga0207711_10001557 Ga0207711_100015576 402
285 3300025941 Ga0207711_10070811 Ga0207711_100708114 402
286 3300025942 Ga0207689_10007517 Ga0207689_100075172 402
287 3300025942 Ga0207689_10027153 Ga0207689_100271533 402
288 3300025945 Ga0207679_10026824 Ga0207679_100268243 402
289 3300025949 Ga0207667_10000303 Ga0207667_1000030344 402
290 3300025949 Ga0207667_10198839 Ga0207667_101988391 402
291 3300025960 Ga0207651_10224986 Ga0207651_102249862 402
292 3300025961 Ga0207712_10000195 Ga0207712_1000019543 402
293 3300025972 Ga0207668_10132031 Ga0207668_101320312 402
294 3300025972 Ga0207668_10137641 Ga0207668_101376412 402
295 3300025981 Ga0207640_10026231 Ga0207640_100262312 402
296 3300025986 Ga0207658_10001042 Ga0207658_100010424 402
297 3300025986 Ga0207658_10003771 Ga0207658_100037715 402
298 3300025986 Ga0207658_10017582 Ga0207658_100175824 402
299 3300025986 Ga0207658_10072259 Ga0207658_100722592 402
300 3300026035 Ga0207703_10000327 Ga0207703_1000032728 402
301 3300026035 Ga0207703_10250734 Ga0207703_102507342 402
302 3300026035 Ga0207703_10302439 Ga0207703_103024392 402
303 3300026041 Ga0207639_10048488 Ga0207639_100484882 402
304 3300026041 Ga0207639_10093241 Ga0207639_100932412 402
305 3300026067 Ga0207678_10001718 Ga0207678_1000171821 402
306 3300026067 Ga0207678_10026959 Ga0207678_100269593 402
307 3300026067 Ga0207678_10034704 Ga0207678_100347043 402
308 3300026067 Ga0207678_10099602 Ga0207678_100996023 402
309 3300026067 Ga0207678_10160785 Ga0207678_101607852 402
310 3300026088 Ga0207641_10000138 Ga0207641_1000013861 402
311 3300026088 Ga0207641_10054912 Ga0207641_100549122 402
312 3300026088 Ga0207641_10142163 Ga0207641_101421632 402
313 3300026095 Ga0207676_10000983 Ga0207676_100009836 402
314 3300026095 Ga0207676_10016480 Ga0207676_100164802 402
315 3300026116 Ga0207674_10000185 Ga0207674_1000018566 402
316 3300026116 Ga0207674_10024950 Ga0207674_100249505 402
317 3300026118 Ga0207675_100162829 Ga0207675_1001628292 402
318 3300026121 Ga0207683_10127233 Ga0207683_101272332 402
319 3300026142 Ga0207698_10084683 Ga0207698_100846833 402
320 3300026142 Ga0207698_10220339 Ga0207698_102203392 402
321 3300028379 Ga0268266_10019041 Ga0268266_100190411 402
322 3300028380 Ga0268265_10002015 Ga0268265_100020156 402
323 3300028380 Ga0268265_10019093 Ga0268265_100190933 402
324 3300028380 Ga0268265_10036082 Ga0268265_100360822 402
325 3300028380 Ga0268265_10073525 Ga0268265_100735253 402
326 3300028380 Ga0268265_10108458 Ga0268265_101084582 402
327 3300028380 Ga0268265_10115467 Ga0268265_101154672 402
328 3300028381 Ga0268264_10002587 Ga0268264_100025874 402
329 3300028381 Ga0268264_10003561 Ga0268264_100035618 402
330 3300028381 Ga0268264_10184721 Ga0268264_101847212 402
331 3300031548 Ga0307408_100020885 Ga0307408_1000208853 402
332 3300031731 Ga0307405_10019312 Ga0307405_100193124 402
333 3300031901 Ga0307406_10006125 Ga0307406_100061253 402
334 3300031903 Ga0307407_10027269 Ga0307407_100272694 402
335 3300031995 Ga0307409_100023312 Ga0307409_1000233123 402
336 3300032004 Ga0307414_10008740 Ga0307414_100087405 402
337 3300032004 Ga0307414_10230655 Ga0307414_102306552 402
338 3300032005 Ga0307411_10046202 Ga0307411_100462023 402
339 3300032005 Ga0307411_10047788 Ga0307411_100477882 402
340 3300032126 Ga0307415_100031263 Ga0307415_1000312632 402
341 3300032126 Ga0307415_100059518 Ga0307415_1000595182 402
342 3300032126 Ga0307415_100226374 Ga0307415_1002263742 402
343 3300035115 Ga0373941_0031985 Ga0373941_0031985_83_1315 402
344 3300037312 Ga0395899_0000132 Ga0395899_0000132_30373_31605 402
345 3300037312 Ga0395899_0025245 Ga0395899_0025245_927_2171 402
346 3300037418 Ga0395900_0000477 Ga0395900_0000477_39940_41172 402
347 3300037418 Ga0395900_0000997 Ga0395900_0000997_28455_29687 402
348 3300037418 Ga0395900_0016968 Ga0395900_0016968_3655_4887 402
349 3300037418 Ga0395900_0078138 Ga0395900_0078138_1667_2899 402
350 3300037418 Ga0395900_0085220 Ga0395900_0085220_1334_2566 402
351 3300037466 Ga0395898_0015973 Ga0395898_0015973_620_1864 402
352 3300037466 Ga0395898_0017326 Ga0395898_0017326_4355_5587 402
353 3300037466 Ga0395898_0117554 Ga0395898_0117554_411_1643 402
354 3300037471 Ga0395905_0001164 Ga0395905_0001164_7069_8301 402
355 3300037471 Ga0395905_0010864 Ga0395905_0010864_3635_4867 402
356 3300037471 Ga0395905_0043421 Ga0395905_0043421_736_1968 402
357 3300037471 Ga0395905_0068826 Ga0395905_0068826_2013_3245 402
358 3300038443 Ga0395901_0000208 Ga0395901_0000208_17079_18311 402
359 3300038443 Ga0395901_0000589 Ga0395901_0000589_18719_19951 402
360 3300038443 Ga0395901_0087854 Ga0395901_0087854_526_1770 402
361 3300038443 Ga0395901_0197617 Ga0395901_0197617_470_1702 402
362 3300038443 Ga0395901_0368745 Ga0395901_0368745_133_1377 402
363 3300042004 Ga0439445_0002205 Ga0439445_0002205_2474_3706 402
364 3300042006 Ga0439432_008816 Ga0439432_008816_1147_2379 402
365 3300042010 Ga0439452_023708 Ga0439452_023708_282_1526 402
366 3300042015 Ga0439462_0031594 Ga0439462_0031594_104_1327 402
367 3300042142 Ga0450905_003094 Ga0450905_003094_887_2119 402
368 3300042144 Ga0450889_000019 Ga0450889_000019_10281_11513 402
369 3300044658 Ga0466972_0068169 Ga0466972_0068169_260_1504 402
370 3300044694 Ga0466963_0015451 Ga0466963_0015451_2288_3520 402
371 3300044694 Ga0466963_0155714 Ga0466963_0155714_280_1512 402
372 3300045976 Ga0466967_0002255 Ga0466967_0002255_3997_5229 402
373 3300045976 Ga0466967_0007911 Ga0466967_0007911_2389_3621 402
374 3300045976 Ga0466967_0191450 Ga0466967_0191450_516_1751 402
375 3300048909 Ga0496106_0011849 Ga0496106_0011849_2068_3300 402
376 3300048911 Ga0496108_0004267 Ga0496108_0004267_8181_9413 402
377 3300048911 Ga0496108_0005425 Ga0496108_0005425_8065_9294 402
378 3300048911 Ga0496108_0022065 Ga0496108_0022065_2662_3894 402
379 3300048912 Ga0496109_0012503 Ga0496109_0012503_806_2038 402
380 3300048912 Ga0496109_0027371 Ga0496109_0027371_3526_4758 402
381 3300048912 Ga0496109_0167510 Ga0496109_0167510_530_1762 402
382 3300048913 Ga0496110_0008763 Ga0496110_0008763_4669_5901 402
383 3300048915 Ga0496112_0040962 Ga0496112_0040962_2782_4014 402
384 3300048915 Ga0496112_0116008 Ga0496112_0116008_1119_2351 402
385 3300048916 Ga0496113_0016292 Ga0496113_0016292_3094_4326 402
386 3300048917 Ga0496114_0000006 Ga0496114_0000006_363044_364276 402
387 3300048918 Ga0496115_0009373 Ga0496115_0009373_3085_4317 402
388 3300049583 Ga0501067_0055988 Ga0501067_0055988_208_1440 402
389 3300049669 Ga0501235_011191 Ga0501235_011191_530_1774 402
390 3300050511 nmdc:mga08y16_121832_c1 nmdc:mga08y16_121832_c1_1269_2501 402
391 3300050515 nmdc:mga0a205_802_c1 nmdc:mga0a205_802_c1_6371_7603 402
392 3300005327 Ga0070658_10010453 Ga0070658_100104532 403
393 3300005328 Ga0070676_10102088 Ga0070676_101020882 403
394 3300005331 Ga0070670_100187930 Ga0070670_1001879302 403
395 3300005339 Ga0070660_100119041 Ga0070660_1001190411 403
396 3300005343 Ga0070687_100134806 Ga0070687_1001348061 403
397 3300005344 Ga0070661_100087437 Ga0070661_1000874372 403
398 3300005366 Ga0070659_100187150 Ga0070659_1001871501 403
399 3300005367 Ga0070667_100016010 Ga0070667_1000160106 403
400 3300005455 Ga0070663_100131583 Ga0070663_1001315831 403
401 3300005563 Ga0068855_100217650 Ga0068855_1002176502 403
402 3300005564 Ga0070664_100005421 Ga0070664_1000054212 403
403 3300005841 Ga0068863_100024134 Ga0068863_1000241344 403
404 3300006358 Ga0068871_100200826 Ga0068871_1002008262 403
405 3300007788 Ga0099795_10048007 Ga0099795_100480071 403
406 3300009177 Ga0105248_10005067 Ga0105248_1000506710 403
407 3300013306 Ga0163162_10370488 Ga0163162_103704882 403
408 3300025909 Ga0207705_10018644 Ga0207705_100186443 403
409 3300025909 Ga0207705_10035312 Ga0207705_100353122 403
410 3300025918 Ga0207662_10110690 Ga0207662_101106902 403
411 3300025919 Ga0207657_10004547 Ga0207657_100045471 403
412 3300025919 Ga0207657_10019679 Ga0207657_100196794 403
413 3300025933 Ga0207706_10024460 Ga0207706_100244603 403
414 3300025941 Ga0207711_10014181 Ga0207711_100141814 403
415 3300025945 Ga0207679_10002925 Ga0207679_1000292510 403
416 3300025945 Ga0207679_10010577 Ga0207679_100105774 403
417 3300025986 Ga0207658_10257038 Ga0207658_102570382 403
418 3300026067 Ga0207678_10011286 Ga0207678_100112866 403
419 3300026067 Ga0207678_10161923 Ga0207678_101619232 403
420 3300026088 Ga0207641_10009374 Ga0207641_100093749 403
421 3300028380 Ga0268265_10010473 Ga0268265_100104736 403
422 3300028381 Ga0268264_10123474 Ga0268264_101234742 403
423 3300031731 Ga0307405_10099604 Ga0307405_100996042 403
424 3300031852 Ga0307410_10000196 Ga0307410_1000019620 403
425 3300031901 Ga0307406_10082294 Ga0307406_100822942 403
426 3300031903 Ga0307407_10005484 Ga0307407_100054842 403
427 3300032004 Ga0307414_10219992 Ga0307414_102199922 403
428 3300032005 Ga0307411_10001690 Ga0307411_100016904 403
429 3300032005 Ga0307411_10008891 Ga0307411_100088912 403
430 3300032005 Ga0307411_10068032 Ga0307411_100680322 403
431 3300032126 Ga0307415_100148538 Ga0307415_1001485381 403
432 3300045976 Ga0466967_0066726 Ga0466967_0066726_673_1932 403
433 3300048913 Ga0496110_0257683 Ga0496110_0257683_146_1393 403
434 3300031824 Ga0307413_10004947 Ga0307413_100049472 404
435 3300031852 Ga0307410_10107900 Ga0307410_101079001 404
436 3300032004 Ga0307414_10031793 Ga0307414_100317933 404
437 3300032005 Ga0307411_10042276 Ga0307411_100422762 404
438 3300025298 Ga0209050_1000262 Ga0209050_100026295 405
439 3300028380 Ga0268265_10006389 Ga0268265_100063893 405
440 3300048919 Ga0496116_0000062 Ga0496116_0000062_227657_228901 405
441 3300048921 Ga0496118_0039378 Ga0496118_0039378_815_2059 405
442 3300048924 Ga0496121_0010966 Ga0496121_0010966_147_1391 405
443 3300048925 Ga0496122_0009287 Ga0496122_0009287_2668_3912 405
444 3300048925 Ga0496122_0019558 Ga0496122_0019558_4058_5302 405
445 3300048926 Ga0496123_0000545 Ga0496123_0000545_42220_43464 405
446 3300048926 Ga0496123_0002167 Ga0496123_0002167_9896_11140 405
447 3300048927 Ga0496124_0010346 Ga0496124_0010346_395_1639 405
448 3300048927 Ga0496124_0052085 Ga0496124_0052085_2203_3447 405
449 3300048928 Ga0496125_0004774 Ga0496125_0004774_1303_2547 405
450 3300048929 Ga0496126_0000801 Ga0496126_0000801_34222_35466 405
451 3300049822 Ga0501035_0253117 Ga0501035_0253117_80_1330 405
452 iso_pu_bacteria 2512564014 2512645674 405
453 iso_pu_bacteria 2808606401 2809063054 405
454 iso_pu_bacteria 2808606404 2809079018 405
455 iso_pu_bacteria 2808606405 2809083607 405
456 iso_pu_bacteria 2880518877 2880520309 405
457 3300046500 Ga0495596_0008510 Ga0495596_0008510_2671_3930 406
458 3300046512 Ga0495610_0002641 Ga0495610_0002641_3311_4570 406
459 3300048091 Ga0495626_0000214 Ga0495626_0000214_10530_11789 406
460 iso_pu_bacteria 2818991438 2819552788 406
461 3300031250 Ga0265331_10023779 Ga0265331_100237793 407
462 3300049575 Ga0501039_0214251 Ga0501039_0214251_159_1382 407
463 3300049587 Ga0501071_0071204 Ga0501071_0071204_134_1357 407
464 3300049592 Ga0501076_0091509 Ga0501076_0091509_704_1927 407
465 3300049743 Ga0501081_0053559 Ga0501081_0053559_1083_2306 407
466 3300047320 Ga0495672_0002402 Ga0495672_0002402_7032_8291 408
467 3300006042 Ga0075368_10000129 Ga0075368_100001296 409
468 3300006178 Ga0075367_10002669 Ga0075367_100026696 409
469 3300009176 Ga0105242_10023628 Ga0105242_100236282 409
470 3300027866 Ga0209813_10000184 Ga0209813_100001846 409
471 3300028381 Ga0268264_10048516 Ga0268264_100485163 409
472 3300046460 Ga0495638_0000204 Ga0495638_0000204_34580_35938 409
473 3300046519 Ga0495632_0000075 Ga0495632_0000075_96772_98037 409
474 3300046520 Ga0495637_0000123 Ga0495637_0000123_3939_5204 409
475 3300046522 Ga0495643_0000009 Ga0495643_0000009_314921_316186 409
476 3300046525 Ga0495663_0000003 Ga0495663_0000003_143456_144721 409
477 3300046558 Ga0495633_0000173 Ga0495633_0000173_66180_67445 409
478 3300046558 Ga0495633_0001327 Ga0495633_0001327_16469_17734 409
479 3300046692 Ga0495671_0000013 Ga0495671_0000013_314921_316186 409
480 3300047470 Ga0495681_0001636 Ga0495681_0001636_3988_5253 409
481 3300049581 Ga0501047_0000223 Ga0501047_0000223_47564_48823 409
482 3300049742 Ga0501080_0059932 Ga0501080_0059932_1084_2343 409
483 3300049744 Ga0501083_0022266 Ga0501083_0022266_1266_2525 409
484 3300050490 nmdc:mga03n38_92370_c1 nmdc:mga03n38_92370_c1_121_1386 409
485 3300050494 nmdc:mga06z11_60_c1 nmdc:mga06z11_60_c1_38817_40082 409
486 3300050495 nmdc:mga04h51_403_c1 nmdc:mga04h51_403_c1_6671_7936 409
487 3300050496 nmdc:mga07m45_136286_c1 nmdc:mga07m45_136286_c1_34_1299 409
488 3300060353 Ga0501082_0001551 Ga0501082_0001551_6349_7608 409
489 iso_pu_bacteria 2513237087 2513590353 409
490 iso_pu_bacteria 2919450847 2919452146 409
491 iso_pu_bacteria 8001845381 8001845825 409
492 3300048925 Ga0496122_0000589 Ga0496122_0000589_28366_29625 410
493 3300048926 Ga0496123_0000278 Ga0496123_0000278_17370_18629 410
494 3300048928 Ga0496125_0027784 Ga0496125_0027784_936_2195 410
495 3300053157 Ga0500624_000072 Ga0500624_000072_29290_30564 410
496 3300053177 Ga0500636_0029690 Ga0500636_0029690_1356_2630 410
497 3300005329 Ga0070683_100231247 Ga0070683_1002312471 411
498 3300005344 Ga0070661_100085828 Ga0070661_1000858281 411
499 3300005354 Ga0070675_100016370 Ga0070675_1000163701 411
500 3300005455 Ga0070663_100191807 Ga0070663_1001918072 411
501 3300005535 Ga0070684_100134572 Ga0070684_1001345722 411
502 3300005543 Ga0070672_100013010 Ga0070672_1000130107 411
503 3300005564 Ga0070664_100017741 Ga0070664_1000177412 411
504 3300005577 Ga0068857_100244218 Ga0068857_1002442182 411
505 3300005617 Ga0068859_100397254 Ga0068859_1003972542 411
506 3300005618 Ga0068864_100019015 Ga0068864_1000190152 411
507 3300005834 Ga0068851_10049564 Ga0068851_100495642 411
508 3300005841 Ga0068863_100107829 Ga0068863_1001078292 411
509 3300005841 Ga0068863_100271166 Ga0068863_1002711661 411
510 3300005842 Ga0068858_100026552 Ga0068858_1000265525 411
511 3300005843 Ga0068860_100198147 Ga0068860_1001981472 411
512 3300005844 Ga0068862_100024857 Ga0068862_1000248573 411
513 3300006048 Ga0075363_100002771 Ga0075363_1000027715 411
514 3300006173 Ga0070716_100044410 Ga0070716_1000444102 411
515 3300006931 Ga0097620_100397247 Ga0097620_1003972472 411
516 3300009093 Ga0105240_10190806 Ga0105240_101908062 411
517 3300009098 Ga0105245_10160885 Ga0105245_101608852 411
518 3300009101 Ga0105247_10014764 Ga0105247_100147642 411
519 3300010375 Ga0105239_10025721 Ga0105239_100257217 411
520 3300011119 Ga0105246_10122645 Ga0105246_101226451 411
521 3300013296 Ga0157374_10023096 Ga0157374_100230965 411
522 3300013297 Ga0157378_10050000 Ga0157378_100500004 411
523 3300025893 Ga0207682_10001899 Ga0207682_100018996 411
524 3300025898 Ga0207692_10041374 Ga0207692_100413742 411
525 3300025900 Ga0207710_10005202 Ga0207710_100052022 411
526 3300025904 Ga0207647_10120962 Ga0207647_101209621 411
527 3300025908 Ga0207643_10000613 Ga0207643_100006132 411
528 3300025918 Ga0207662_10011850 Ga0207662_100118502 411
529 3300025919 Ga0207657_10040408 Ga0207657_100404085 411
530 3300025925 Ga0207650_10019900 Ga0207650_100199005 411
531 3300025932 Ga0207690_10054048 Ga0207690_100540482 411
532 3300025933 Ga0207706_10015457 Ga0207706_100154577 411
533 3300025937 Ga0207669_10004706 Ga0207669_100047066 411
534 3300025937 Ga0207669_10007517 Ga0207669_100075172 411
535 3300025940 Ga0207691_10006907 Ga0207691_100069073 411
536 3300025944 Ga0207661_10019697 Ga0207661_100196972 411
537 3300025961 Ga0207712_10116473 Ga0207712_101164732 411
538 3300025986 Ga0207658_10268364 Ga0207658_102683641 411
539 3300026023 Ga0207677_10003572 Ga0207677_100035724 411
540 3300026067 Ga0207678_10047163 Ga0207678_100471633 411
541 3300026078 Ga0207702_10091065 Ga0207702_100910653 411
542 3300026089 Ga0207648_10063136 Ga0207648_100631362 411
543 3300026095 Ga0207676_10005202 Ga0207676_100052026 411
544 3300026116 Ga0207674_10044244 Ga0207674_100442444 411
545 3300031239 Ga0265328_10011073 Ga0265328_100110733 411
546 3300031456 Ga0307513_10200910 Ga0307513_102009102 411
547 3300035089 Ga0373944_0024959 Ga0373944_0024959_52_1287 411
548 3300035695 Ga0373927_0114791 Ga0373927_0114791_424_1659 411
549 3300037418 Ga0395900_0003479 Ga0395900_0003479_11091_12326 411
550 3300037466 Ga0395898_0028510 Ga0395898_0028510_4221_5456 411
551 3300037471 Ga0395905_0053027 Ga0395905_0053027_2490_3725 411
552 3300038443 Ga0395901_0295086 Ga0395901_0295086_56_1291 411
553 3300046455 Ga0495603_0087900 Ga0495603_0087900_186_1421 411
554 3300046460 Ga0495638_0017966 Ga0495638_0017966_1728_2966 411
555 3300046476 Ga0495662_0015169 Ga0495662_0015169_1579_2814 411
556 3300046491 Ga0495584_0074316 Ga0495584_0074316_437_1672 411
557 3300046492 Ga0495585_0006706 Ga0495585_0006706_91_1326 411
558 3300046514 Ga0495618_0066673 Ga0495618_0066673_391_1626 411
559 3300046518 Ga0495631_0016466 Ga0495631_0016466_1523_2758 411
560 3300046519 Ga0495632_0046880 Ga0495632_0046880_422_1657 411
561 3300046536 Ga0495587_0072252 Ga0495587_0072252_685_1920 411
562 3300046537 Ga0495598_0003015 Ga0495598_0003015_69_1304 411
563 3300046615 Ga0495656_0072045 Ga0495656_0072045_261_1496 411
564 3300046665 Ga0495661_0082450 Ga0495661_0082450_577_1812 411
565 3300046689 Ga0495613_0121505 Ga0495613_0121505_606_1841 411
566 3300046691 Ga0495670_0102255 Ga0495670_0102255_107_1342 411
567 3300047315 Ga0495581_0084168 Ga0495581_0084168_99_1334 411
568 3300047321 Ga0495676_0072836 Ga0495676_0072836_198_1433 411
569 3300048088 Ga0495602_0186809 Ga0495602_0186809_144_1379 411
570 3300048090 Ga0495615_0004517 Ga0495615_0004517_15_1250 411
571 3300048904 Ga0496101_0004266 Ga0496101_0004266_2749_3984 411
572 3300048904 Ga0496101_0043198 Ga0496101_0043198_647_1882 411
573 3300048905 Ga0496102_0002526 Ga0496102_0002526_10392_11627 411
574 3300048906 Ga0496103_0000715 Ga0496103_0000715_3894_5129 411
575 3300048906 Ga0496103_0012088 Ga0496103_0012088_3154_4389 411
576 3300048907 Ga0496104_0001975 Ga0496104_0001975_10079_11314 411
577 3300048908 Ga0496105_0000363 Ga0496105_0000363_2108_3343 411
578 3300048908 Ga0496105_0010173 Ga0496105_0010173_6030_7265 411
579 3300048909 Ga0496106_0015796 Ga0496106_0015796_3643_4878 411
580 3300048910 Ga0496107_0031189 Ga0496107_0031189_1516_2751 411
581 3300048911 Ga0496108_0000256 Ga0496108_0000256_40911_42146 411
582 3300048912 Ga0496109_0000730 Ga0496109_0000730_25339_26574 411
583 3300048912 Ga0496109_0066682 Ga0496109_0066682_1814_3049 411
584 3300048913 Ga0496110_0005771 Ga0496110_0005771_7004_8239 411
585 3300048914 Ga0496111_0002097 Ga0496111_0002097_795_2030 411
586 3300048914 Ga0496111_0015368 Ga0496111_0015368_145_1380 411
587 3300048915 Ga0496112_0002301 Ga0496112_0002301_3736_4971 411
588 3300048915 Ga0496112_0083002 Ga0496112_0083002_120_1355 411
589 3300048916 Ga0496113_0000318 Ga0496113_0000318_11556_12791 411
590 3300048916 Ga0496113_0079873 Ga0496113_0079873_1025_2260 411
591 3300048918 Ga0496115_0018872 Ga0496115_0018872_3043_4278 411
592 3300049588 Ga0501072_0001326 Ga0501072_0001326_8212_9450 411
593 3300049744 Ga0501083_0043876 Ga0501083_0043876_44_1279 411
594 3300049744 Ga0501083_0170931 Ga0501083_0170931_172_1410 411
595 3300050495 nmdc:mga04h51_39509_c1 nmdc:mga04h51_39509_c1_280_1515 411
596 3300050511 nmdc:mga08y16_57400_c1 nmdc:mga08y16_57400_c1_1472_2707 411
597 3300050515 nmdc:mga0a205_158439_c1 nmdc:mga0a205_158439_c1_539_1774 411
598 3300053077 Ga0495601_0042861 Ga0495601_0042861_1335_2570 411
599 3300053085 Ga0495619_0022235 Ga0495619_0022235_2216_3451 411
600 3300053118 Ga0500594_0036322 Ga0500594_0036322_19_1257 411
601 3300053153 Ga0500616_0000038 Ga0500616_0000038_144062_145297 411
602 3300000041 ARcpr5oldR_c000003 ARcpr5oldR_00000354 412
603 3300000042 ARSoilYngRDRAFT_c00037 ARSoilYngRDRAFT_0003710 412
604 3300000043 ARcpr5yngRDRAFT_c000010 ARcpr5yngRDRAFT_00001035 412
605 3300000044 ARSoilOldRDRAFT_c000045 ARSoilOldRDRAFT_00004522 412
606 3300000652 ARCol0yngRDRAFT_1000086 ARCol0yngRDRAFT_10000864 412
607 3300005983 Ga0081540_1010246 Ga0081540_10102463 412
608 3300007788 Ga0099795_10033014 Ga0099795_100330141 412
609 3300009094 Ga0111539_10289486 Ga0111539_102894862 412
610 3300010375 Ga0105239_10001436 Ga0105239_1000143632 412
611 3300011119 Ga0105246_10001322 Ga0105246_1000132215 412
612 3300013306 Ga0163162_10002546 Ga0163162_1000254618 412
613 3300013308 Ga0157375_10161948 Ga0157375_101619482 412
614 3300014325 Ga0163163_10122875 Ga0163163_101228752 412
615 3300014968 Ga0157379_10008840 Ga0157379_1000884012 412
616 3300014969 Ga0157376_10000126 Ga0157376_1000012646 412
617 3300021377 Ga0213874_10001300 Ga0213874_100013004 412
618 3300031238 Ga0265332_10035887 Ga0265332_100358872 412
619 3300031595 Ga0265313_10017993 Ga0265313_100179933 412
620 3300031911 Ga0307412_10178438 Ga0307412_101784381 412
621 3300035171 Ga0373946_0063818 Ga0373946_0063818_185_1426 412
622 3300046559 Ga0495667_0079413 Ga0495667_0079413_229_1467 412
623 3300047320 Ga0495672_0083360 Ga0495672_0083360_456_1694 412
624 3300047321 Ga0495676_0125444 Ga0495676_0125444_450_1691 412
625 3300047322 Ga0495680_0028426 Ga0495680_0028426_614_1852 412
626 3300048907 Ga0496104_0095212 Ga0496104_0095212_605_1846 412
627 3300048908 Ga0496105_0075755 Ga0496105_0075755_446_1687 412
628 3300048912 Ga0496109_0048395 Ga0496109_0048395_1150_2391 412
629 3300048913 Ga0496110_0124874 Ga0496110_0124874_805_2046 412
630 3300048914 Ga0496111_0047442 Ga0496111_0047442_416_1657 412
631 3300048914 Ga0496111_0084864 Ga0496111_0084864_523_1764 412
632 3300048915 Ga0496112_0051044 Ga0496112_0051044_1779_3020 412
633 3300048916 Ga0496113_0008442 Ga0496113_0008442_5351_6592 412
634 3300048918 Ga0496115_0113708 Ga0496115_0113708_488_1729 412
635 3300049569 Ga0501032_0039527 Ga0501032_0039527_84_1322 412
636 3300049569 Ga0501032_0162501 Ga0501032_0162501_93_1331 412
637 3300049570 Ga0501033_0024281 Ga0501033_0024281_654_1892 412
638 3300049571 Ga0501034_0009627 Ga0501034_0009627_3932_5170 412
639 3300049572 Ga0501036_0027487 Ga0501036_0027487_3164_4402 412
640 3300049572 Ga0501036_0131217 Ga0501036_0131217_302_1540 412
641 3300049575 Ga0501039_0044143 Ga0501039_0044143_314_1552 412
642 3300049581 Ga0501047_0035760 Ga0501047_0035760_2453_3691 412
643 3300049584 Ga0501068_0032961 Ga0501068_0032961_1189_2427 412
644 3300049585 Ga0501069_0006054 Ga0501069_0006054_2662_3900 412
645 3300049822 Ga0501035_0007311 Ga0501035_0007311_4848_6086 412
646 3300049823 Ga0501044_0124863 Ga0501044_0124863_612_1850 412
647 3300050490 nmdc:mga03n38_6277_c1 nmdc:mga03n38_6277_c1_1068_2306 412
648 3300050492 nmdc:mga0yw44_23578_c1 nmdc:mga0yw44_23578_c1_1529_2767 412
649 3300050494 nmdc:mga06z11_49590_c1 nmdc:mga06z11_49590_c1_330_1568 412
650 3300050496 nmdc:mga07m45_81046_c1 nmdc:mga07m45_81046_c1_52_1290 412
651 3300050516 nmdc:mga0sz30_19123_c1 nmdc:mga0sz30_19123_c1_1129_2367 412
652 3300053084 Ga0495595_0003250 Ga0495595_0003250_4988_6226 412
653 3300053085 Ga0495619_0000063 Ga0495619_0000063_610_1848 412
654 3300053088 Ga0500644_0000715 Ga0500644_0000715_3351_4589 412
655 3300053093 Ga0500651_0004383 Ga0500651_0004383_2845_4083 412
656 3300053096 Ga0500641_0017324 Ga0500641_0017324_733_1971 412
657 3300053119 Ga0500595_000085 Ga0500595_000085_12446_13684 412
658 3300053131 Ga0500652_000056 Ga0500652_000056_17865_19103 412
659 3300053131 Ga0500652_005144 Ga0500652_005144_2263_3501 412
660 3300053153 Ga0500616_0000001 Ga0500616_0000001_888894_890132 412
661 3300053730 Ga0500645_006791 Ga0500645_006791_406_1644 412
662 3300025918 Ga0207662_10024769 Ga0207662_100247693 413
663 3300048922 Ga0496119_0000936 Ga0496119_0000936_19899_21152 413
664 3300048925 Ga0496122_0020036 Ga0496122_0020036_4667_6001 413
665 3300048926 Ga0496123_0001298 Ga0496123_0001298_918_2252 413
666 3300053104 Ga0500556_0000160 Ga0500556_0000160_45821_47074 413
667 3300053117 Ga0500593_000044 Ga0500593_000044_14871_16124 413
668 3300053139 Ga0500568_0000004 Ga0500568_0000004_171516_172769 413
669 3300053730 Ga0500645_004638 Ga0500645_004638_3752_5005 413
670 iso_pu_bacteria 2643221547 2643758965 413
671 iso_pu_bacteria 2643221651 2644290723 413
672 iso_pu_bacteria 2721755755 2723849349 413
673 iso_pu_bacteria 2922361189 2922364341 413
674 3300046460 Ga0495638_0021126 Ga0495638_0021126_2589_3833 414
675 3300006844 Ga0075428_100009313 Ga0075428_1000093131 415
676 3300006846 Ga0075430_100034066 Ga0075430_1000340664 415
677 3300006880 Ga0075429_100007463 Ga0075429_1000074634 415
678 3300009094 Ga0111539_10016539 Ga0111539_100165399 415
679 3300009147 Ga0114129_10024577 Ga0114129_100245774 415
680 3300042436 Ga0439435_0000116 Ga0439435_0000116_8405_9658 415
681 3300050507 nmdc:mga05p37_1191_c1 nmdc:mga05p37_1191_c1_16595_17842 415
682 3300050508 nmdc:mga09592_3118_c1 nmdc:mga09592_3118_c1_8675_9922 415
683 3300050509 nmdc:mga0qj67_141077_c1 nmdc:mga0qj67_141077_c1_329_1576 415
684 3300050511 nmdc:mga08y16_13718_c1 nmdc:mga08y16_13718_c1_4201_5448 415
685 3300002070 JGI24750J21931_1001976 JGI24750J21931_10019762 416
686 3300002077 JGI24744J21845_10008784 JGI24744J21845_100087842 416
687 3300003203 JGI25406J46586_10033627 JGI25406J46586_100336272 416
688 3300005328 Ga0070676_10025905 Ga0070676_100259052 416
689 3300005329 Ga0070683_100037722 Ga0070683_1000377221 416
690 3300005331 Ga0070670_100011611 Ga0070670_1000116112 416
691 3300005331 Ga0070670_100024387 Ga0070670_1000243873 416
692 3300005331 Ga0070670_100036861 Ga0070670_1000368612 416
693 3300005335 Ga0070666_10056441 Ga0070666_100564412 416
694 3300005337 Ga0070682_100096978 Ga0070682_1000969782 416
695 3300005340 Ga0070689_100006518 Ga0070689_1000065186 416
696 3300005341 Ga0070691_10022854 Ga0070691_100228542 416
697 3300005343 Ga0070687_100010015 Ga0070687_1000100153 416
698 3300005355 Ga0070671_100010789 Ga0070671_1000107895 416
699 3300005356 Ga0070674_100035850 Ga0070674_1000358502 416
700 3300005356 Ga0070674_100063764 Ga0070674_1000637642 416
701 3300005365 Ga0070688_100054570 Ga0070688_1000545702 416
702 3300005367 Ga0070667_100058925 Ga0070667_1000589252 416
703 3300005435 Ga0070714_100050119 Ga0070714_1000501191 416
704 3300005436 Ga0070713_100063116 Ga0070713_1000631162 416
705 3300005436 Ga0070713_100067951 Ga0070713_1000679512 416
706 3300005437 Ga0070710_10008568 Ga0070710_100085683 416
707 3300005437 Ga0070710_10010806 Ga0070710_100108062 416
708 3300005438 Ga0070701_10019632 Ga0070701_100196323 416
709 3300005439 Ga0070711_100011116 Ga0070711_1000111163 416
710 3300005441 Ga0070700_100006474 Ga0070700_1000064747 416
711 3300005445 Ga0070708_100112727 Ga0070708_1001127272 416
712 3300005457 Ga0070662_100076669 Ga0070662_1000766691 416
713 3300005459 Ga0068867_100083074 Ga0068867_1000830742 416
714 3300005466 Ga0070685_10002699 Ga0070685_100026995 416
715 3300005468 Ga0070707_100043599 Ga0070707_1000435993 416
716 3300005518 Ga0070699_100014320 Ga0070699_1000143203 416
717 3300005535 Ga0070684_100031635 Ga0070684_1000316353 416
718 3300005536 Ga0070697_100137122 Ga0070697_1001371222 416
719 3300005539 Ga0068853_100017670 Ga0068853_1000176707 416
720 3300005546 Ga0070696_100056926 Ga0070696_1000569262 416
721 3300005615 Ga0070702_100008357 Ga0070702_1000083573 416
722 3300005937 Ga0081455_10015834 Ga0081455_100158343 416
723 3300005981 Ga0081538_10002523 Ga0081538_1000252312 416
724 3300005981 Ga0081538_10021900 Ga0081538_100219003 416
725 3300005983 Ga0081540_1001201 Ga0081540_10012018 416
726 3300005983 Ga0081540_1009095 Ga0081540_10090953 416
727 3300005985 Ga0081539_10000522 Ga0081539_1000052241 416
728 3300006028 Ga0070717_10001785 Ga0070717_1000178513 416
729 3300006038 Ga0075365_10013799 Ga0075365_100137993 416
730 3300006048 Ga0075363_100004616 Ga0075363_1000046165 416
731 3300006163 Ga0070715_10005920 Ga0070715_100059204 416
732 3300006173 Ga0070716_100000730 Ga0070716_10000073013 416
733 3300006175 Ga0070712_100000963 Ga0070712_10000096310 416
734 3300006844 Ga0075428_100055661 Ga0075428_1000556613 416
735 3300006846 Ga0075430_100005415 Ga0075430_1000054155 416
736 3300006846 Ga0075430_100069113 Ga0075430_1000691133 416
737 3300006847 Ga0075431_100035384 Ga0075431_1000353842 416
738 3300006871 Ga0075434_100035969 Ga0075434_1000359693 416
739 3300006880 Ga0075429_100022293 Ga0075429_1000222936 416
740 3300025885 Ga0207653_10009245 Ga0207653_100092453 416
741 3300025898 Ga0207692_10034318 Ga0207692_100343182 416
742 3300025901 Ga0207688_10001997 Ga0207688_100019975 416
743 3300025915 Ga0207693_10012871 Ga0207693_100128714 416
744 3300025916 Ga0207663_10004685 Ga0207663_100046854 416
745 3300025916 Ga0207663_10018835 Ga0207663_100188353 416
746 3300025918 Ga0207662_10003504 Ga0207662_100035045 416
747 3300025925 Ga0207650_10007269 Ga0207650_100072696 416
748 3300025927 Ga0207687_10003253 Ga0207687_100032535 416
749 3300025935 Ga0207709_10010336 Ga0207709_100103363 416
750 3300025939 Ga0207665_10000117 Ga0207665_1000011734 416
751 3300025940 Ga0207691_10005532 Ga0207691_1000553215 416
752 3300025942 Ga0207689_10009414 Ga0207689_100094144 416
753 3300025942 Ga0207689_10052697 Ga0207689_100526972 416
754 3300025945 Ga0207679_10139096 Ga0207679_101390961 416
755 3300026075 Ga0207708_10001777 Ga0207708_1000177710 416
756 3300026089 Ga0207648_10004308 Ga0207648_100043083 416
757 3300026118 Ga0207675_100018253 Ga0207675_1000182535 416
758 3300026121 Ga0207683_10038667 Ga0207683_100386674 416
759 3300028381 Ga0268264_10010537 Ga0268264_100105372 416
760 3300028577 Ga0265318_10022180 Ga0265318_100221802 416
761 3300031238 Ga0265332_10066004 Ga0265332_100660042 416
762 3300031241 Ga0265325_10050320 Ga0265325_100503202 416
763 3300031344 Ga0265316_10008071 Ga0265316_100080713 416
764 3300031344 Ga0265316_10023549 Ga0265316_100235493 416
765 3300031548 Ga0307408_100038872 Ga0307408_1000388722 416
766 3300031691 Ga0316579_10007010 Ga0316579_100070103 416
767 3300031711 Ga0265314_10034505 Ga0265314_100345052 416
768 3300031712 Ga0265342_10075153 Ga0265342_100751532 416
769 3300035086 Ga0373934_0047832 Ga0373934_0047832_99_1349 416
770 3300035119 Ga0373956_0006720 Ga0373956_0006720_500_1750 416
771 3300035120 Ga0373957_0013818 Ga0373957_0013818_285_1535 416
772 3300035172 Ga0373955_0000962 Ga0373955_0000962_1957_3207 416
773 3300035724 Ga0373933_0009812 Ga0373933_0009812_948_2198 416
774 3300036401 Ga0373937_0004822 Ga0373937_0004822_119_1369 416
775 3300036401 Ga0373937_0117379 Ga0373937_0117379_839_2089 416
776 3300036647 Ga0316582_0080845 Ga0316582_0080845_260_1510 416
777 3300037466 Ga0395898_0061634 Ga0395898_0061634_1218_2468 416
778 3300039437 Ga0436365_0458815 Ga0436365_0458815_1861_3114 416
779 3300039447 Ga0436361_0896735 Ga0436361_0896735_11842_13092 416
780 3300044694 Ga0466963_0003406 Ga0466963_0003406_6406_7656 416
781 3300045976 Ga0466967_0053981 Ga0466967_0053981_1297_2547 416
782 3300046491 Ga0495584_0055204 Ga0495584_0055204_91_1341 416
783 3300046525 Ga0495663_0017730 Ga0495663_0017730_65_1318 416
784 3300046539 Ga0495621_0011175 Ga0495621_0011175_185_1438 416
785 3300046675 Ga0495657_0008561 Ga0495657_0008561_3137_4387 416
786 3300047322 Ga0495680_0025791 Ga0495680_0025791_2681_3931 416
787 3300048088 Ga0495602_0021033 Ga0495602_0021033_3775_5025 416
788 3300048907 Ga0496104_0000900 Ga0496104_0000900_20228_21478 416
789 3300048907 Ga0496104_0011188 Ga0496104_0011188_2807_4057 416
790 3300048908 Ga0496105_0052297 Ga0496105_0052297_1352_2602 416
791 3300048909 Ga0496106_0106463 Ga0496106_0106463_626_1876 416
792 3300048911 Ga0496108_0040349 Ga0496108_0040349_27_1277 416
793 3300048912 Ga0496109_0041709 Ga0496109_0041709_2144_3394 416
794 3300048917 Ga0496114_0131587 Ga0496114_0131587_800_2050 416
795 3300048918 Ga0496115_0061836 Ga0496115_0061836_1644_2894 416
796 3300049576 Ga0501040_0108027 Ga0501040_0108027_278_1528 416
797 3300049586 Ga0501070_0025736 Ga0501070_0025736_452_1702 416
798 3300049587 Ga0501071_0126813 Ga0501071_0126813_130_1380 416
799 3300049741 Ga0501079_0202160 Ga0501079_0202160_223_1473 416
800 3300049742 Ga0501080_0025491 Ga0501080_0025491_1181_2431 416
801 3300050492 nmdc:mga0yw44_2995_c1 nmdc:mga0yw44_2995_c1_4644_5894 416
802 3300050492 nmdc:mga0yw44_63475_c1 nmdc:mga0yw44_63475_c1_437_1687 416
803 3300050507 nmdc:mga05p37_71985_c1 nmdc:mga05p37_71985_c1_676_1926 416
804 3300050508 nmdc:mga09592_70637_c1 nmdc:mga09592_70637_c1_1524_2774 416
805 3300050509 nmdc:mga0qj67_60328_c1 nmdc:mga0qj67_60328_c1_1733_2983 416
806 3300050510 nmdc:mga06r32_284100_c1 nmdc:mga06r32_284100_c1_96_1346 416
807 3300050511 nmdc:mga08y16_116433_c1 nmdc:mga08y16_116433_c1_490_1824 416
808 3300050512 nmdc:mga0n895_200633_c1 nmdc:mga0n895_200633_c1_417_1667 416
809 3300050512 nmdc:mga0n895_425063_c1 nmdc:mga0n895_425063_c1_82_1332 416
810 3300050513 nmdc:mga0rr50_88555_c1 nmdc:mga0rr50_88555_c1_1008_2258 416
811 3300050515 nmdc:mga0a205_40207_c1 nmdc:mga0a205_40207_c1_873_2207 416
812 3300053077 Ga0495601_0020031 Ga0495601_0020031_1642_2892 416
813 3300053078 Ga0495612_0048622 Ga0495612_0048622_424_1674 416
814 3300053084 Ga0495595_0002072 Ga0495595_0002072_1629_2879 416
815 3300053084 Ga0495595_0110045 Ga0495595_0110045_35_1285 416
816 3300053085 Ga0495619_0011350 Ga0495619_0011350_3010_4260 416
817 3300054114 Ga0501084_0128391 Ga0501084_0128391_451_1701 416
818 2209111006 2214745200 2213754613 417
819 3300001977 JGI24746J21847_1000225 JGI24746J21847_10002254 417
820 3300001989 JGI24739J22299_10000887 JGI24739J22299_100008878 417
821 3300001990 JGI24737J22298_10000286 JGI24737J22298_1000028615 417
822 3300001990 JGI24737J22298_10018510 JGI24737J22298_100185102 417
823 3300001991 JGI24743J22301_10004783 JGI24743J22301_100047832 417
824 3300002070 JGI24750J21931_1000044 JGI24750J21931_10000445 417
825 3300002074 JGI24748J21848_1003070 JGI24748J21848_10030701 417
826 3300002075 JGI24738J21930_10000666 JGI24738J21930_100006662 417
827 3300002076 JGI24749J21850_1002556 JGI24749J21850_10025562 417
828 3300002077 JGI24744J21845_10001499 JGI24744J21845_100014996 417
829 3300002126 JGI24035J26624_1000205 JGI24035J26624_10002057 417
830 3300002239 JGI24034J26672_10000348 JGI24034J26672_100003488 417
831 3300002244 JGI24742J22300_10000091 JGI24742J22300_100000912 417
832 3300002459 JGI24751J29686_10009779 JGI24751J29686_100097791 417
833 3300003659 JGI25404J52841_10005123 JGI25404J52841_100051232 417
834 3300005277 Ga0065716_1001671 Ga0065716_10016712 417
835 3300005290 Ga0065712_10001083 Ga0065712_1000108312 417
836 3300005290 Ga0065712_10016249 Ga0065712_100162491 417
837 3300005290 Ga0065712_10081197 Ga0065712_100811972 417
838 3300005293 Ga0065715_10089726 Ga0065715_100897261 417
839 3300005328 Ga0070676_10000186 Ga0070676_100001862 417
840 3300005329 Ga0070683_100000064 Ga0070683_10000006470 417
841 3300005330 Ga0070690_100055973 Ga0070690_1000559731 417
842 3300005330 Ga0070690_100078858 Ga0070690_1000788582 417
843 3300005331 Ga0070670_100002541 Ga0070670_1000025412 417
844 3300005331 Ga0070670_100006533 Ga0070670_1000065333 417
845 3300005333 Ga0070677_10000050 Ga0070677_100000507 417
846 3300005334 Ga0068869_100000191 Ga0068869_1000001912 417
847 3300005334 Ga0068869_100027748 Ga0068869_1000277482 417
848 3300005334 Ga0068869_100149583 Ga0068869_1001495831 417
849 3300005335 Ga0070666_10022428 Ga0070666_100224282 417
850 3300005335 Ga0070666_10059573 Ga0070666_100595733 417
851 3300005336 Ga0070680_100066516 Ga0070680_1000665164 417
852 3300005337 Ga0070682_100001714 Ga0070682_1000017141 417
853 3300005337 Ga0070682_100035477 Ga0070682_1000354773 417
854 3300005338 Ga0068868_100000233 Ga0068868_10000023334 417
855 3300005338 Ga0068868_100032246 Ga0068868_1000322462 417
856 3300005339 Ga0070660_100117995 Ga0070660_1001179951 417
857 3300005340 Ga0070689_100113223 Ga0070689_1001132232 417
858 3300005341 Ga0070691_10006662 Ga0070691_100066627 417
859 3300005343 Ga0070687_100000337 Ga0070687_1000003372 417
860 3300005343 Ga0070687_100050606 Ga0070687_1000506062 417
861 3300005344 Ga0070661_100000188 Ga0070661_10000018847 417
862 3300005344 Ga0070661_100160492 Ga0070661_1001604921 417
863 3300005345 Ga0070692_10050483 Ga0070692_100504832 417
864 3300005347 Ga0070668_100000409 Ga0070668_1000004092 417
865 3300005353 Ga0070669_100000523 Ga0070669_10000052330 417
866 3300005354 Ga0070675_100000034 Ga0070675_10000003483 417
867 3300005355 Ga0070671_100000111 Ga0070671_10000011151 417
868 3300005355 Ga0070671_100001584 Ga0070671_1000015848 417
869 3300005355 Ga0070671_100045533 Ga0070671_1000455332 417
870 3300005356 Ga0070674_100003026 Ga0070674_1000030264 417
871 3300005364 Ga0070673_100001357 Ga0070673_10000135716 417
872 3300005364 Ga0070673_100008515 Ga0070673_1000085157 417
873 3300005365 Ga0070688_100000401 Ga0070688_10000040125 417
874 3300005365 Ga0070688_100052107 Ga0070688_1000521072 417
875 3300005365 Ga0070688_100071567 Ga0070688_1000715671 417
876 3300005366 Ga0070659_100114249 Ga0070659_1001142492 417
877 3300005366 Ga0070659_100117346 Ga0070659_1001173462 417
878 3300005367 Ga0070667_100010235 Ga0070667_1000102352 417
879 3300005367 Ga0070667_100186025 Ga0070667_1001860252 417
880 3300005434 Ga0070709_10028699 Ga0070709_100286992 417
881 3300005434 Ga0070709_10035379 Ga0070709_100353792 417
882 3300005435 Ga0070714_100011938 Ga0070714_1000119383 417
883 3300005435 Ga0070714_100087174 Ga0070714_1000871742 417
884 3300005435 Ga0070714_100238776 Ga0070714_1002387762 417
885 3300005436 Ga0070713_100007751 Ga0070713_1000077513 417
886 3300005436 Ga0070713_100010936 Ga0070713_1000109364 417
887 3300005437 Ga0070710_10021500 Ga0070710_100215004 417
888 3300005437 Ga0070710_10022840 Ga0070710_100228403 417
889 3300005438 Ga0070701_10000524 Ga0070701_1000052415 417
890 3300005439 Ga0070711_100015201 Ga0070711_1000152013 417
891 3300005439 Ga0070711_100023573 Ga0070711_1000235733 417
892 3300005440 Ga0070705_100000252 Ga0070705_10000025233 417
893 3300005441 Ga0070700_100000657 Ga0070700_1000006572 417
894 3300005444 Ga0070694_100021318 Ga0070694_1000213182 417
895 3300005444 Ga0070694_100089908 Ga0070694_1000899082 417
896 3300005455 Ga0070663_100004855 Ga0070663_10000485511 417
897 3300005455 Ga0070663_100028662 Ga0070663_1000286623 417
898 3300005456 Ga0070678_100001414 Ga0070678_1000014145 417
899 3300005456 Ga0070678_100010734 Ga0070678_1000107343 417
900 3300005456 Ga0070678_100011766 Ga0070678_1000117662 417
901 3300005457 Ga0070662_100017420 Ga0070662_1000174206 417
902 3300005458 Ga0070681_10071322 Ga0070681_100713224 417
903 3300005458 Ga0070681_10072311 Ga0070681_100723115 417
904 3300005458 Ga0070681_10082351 Ga0070681_100823514 417
905 3300005459 Ga0068867_100001011 Ga0068867_1000010114 417
906 3300005466 Ga0070685_10065248 Ga0070685_100652482 417
907 3300005530 Ga0070679_100016615 Ga0070679_1000166159 417
908 3300005530 Ga0070679_100034565 Ga0070679_1000345652 417
909 3300005530 Ga0070679_100036926 Ga0070679_1000369266 417
910 3300005535 Ga0070684_100000275 Ga0070684_1000002754 417
911 3300005535 Ga0070684_100061891 Ga0070684_1000618913 417
912 3300005535 Ga0070684_100123682 Ga0070684_1001236822 417
913 3300005539 Ga0068853_100002273 Ga0068853_10000227316 417
914 3300005539 Ga0068853_100160014 Ga0068853_1001600142 417
915 3300005543 Ga0070672_100000008 Ga0070672_1000000085 417
916 3300005544 Ga0070686_100062116 Ga0070686_1000621163 417
917 3300005544 Ga0070686_100080097 Ga0070686_1000800972 417
918 3300005545 Ga0070695_100063612 Ga0070695_1000636122 417
919 3300005546 Ga0070696_100017449 Ga0070696_1000174496 417
920 3300005546 Ga0070696_100070532 Ga0070696_1000705322 417
921 3300005547 Ga0070693_100008375 Ga0070693_1000083756 417
922 3300005549 Ga0070704_100001016 Ga0070704_10000101616 417
923 3300005549 Ga0070704_100091417 Ga0070704_1000914172 417
924 3300005563 Ga0068855_100007455 Ga0068855_10000745516 417
925 3300005563 Ga0068855_100055594 Ga0068855_1000555942 417
926 3300005564 Ga0070664_100000419 Ga0070664_10000041933 417
927 3300005564 Ga0070664_100036462 Ga0070664_1000364625 417
928 3300005577 Ga0068857_100009744 Ga0068857_10000974411 417
929 3300005578 Ga0068854_100001824 Ga0068854_10000182415 417
930 3300005614 Ga0068856_100000963 Ga0068856_10000096331 417
931 3300005615 Ga0070702_100003016 Ga0070702_10000301610 417
932 3300005616 Ga0068852_100001994 Ga0068852_10000199412 417
933 3300005617 Ga0068859_100107572 Ga0068859_1001075724 417
934 3300005617 Ga0068859_100311275 Ga0068859_1003112752 417
935 3300005618 Ga0068864_100001346 Ga0068864_10000134617 417
936 3300005718 Ga0068866_10000291 Ga0068866_100002912 417
937 3300005719 Ga0068861_100001924 Ga0068861_10000192416 417
938 3300005719 Ga0068861_100116771 Ga0068861_1001167712 417
939 3300005840 Ga0068870_10000005 Ga0068870_100000055 417
940 3300005841 Ga0068863_100000608 Ga0068863_10000060832 417
941 3300005842 Ga0068858_100011061 Ga0068858_1000110611 417
942 3300005842 Ga0068858_100149146 Ga0068858_1001491463 417
943 3300005842 Ga0068858_100244735 Ga0068858_1002447351 417
944 3300005843 Ga0068860_100001183 Ga0068860_1000011832 417
945 3300005843 Ga0068860_100113496 Ga0068860_1001134962 417
946 3300005844 Ga0068862_100010432 Ga0068862_1000104322 417
947 3300005844 Ga0068862_100017057 Ga0068862_1000170572 417
948 3300005937 Ga0081455_10000002 Ga0081455_1000000227 417
949 3300005937 Ga0081455_10000329 Ga0081455_1000032958 417
950 3300006038 Ga0075365_10024810 Ga0075365_100248105 417
951 3300006058 Ga0075432_10013821 Ga0075432_100138212 417
952 3300006163 Ga0070715_10009052 Ga0070715_100090523 417
953 3300006163 Ga0070715_10025330 Ga0070715_100253303 417
954 3300006173 Ga0070716_100012351 Ga0070716_1000123516 417
955 3300006175 Ga0070712_100041974 Ga0070712_1000419742 417
956 3300006175 Ga0070712_100048764 Ga0070712_1000487642 417
957 3300006175 Ga0070712_100153292 Ga0070712_1001532921 417
958 3300006177 Ga0075362_10013349 Ga0075362_100133493 417
959 3300006178 Ga0075367_10014764 Ga0075367_100147645 417
960 3300006194 Ga0075427_10000026 Ga0075427_100000267 417
961 3300006195 Ga0075366_10089288 Ga0075366_100892881 417
962 3300006237 Ga0097621_100000006 Ga0097621_10000000650 417
963 3300006237 Ga0097621_100008279 Ga0097621_1000082794 417
964 3300006237 Ga0097621_100182116 Ga0097621_1001821161 417
965 3300006358 Ga0068871_100000022 Ga0068871_10000002276 417
966 3300006358 Ga0068871_100030110 Ga0068871_1000301102 417
967 3300006844 Ga0075428_100003527 Ga0075428_10000352710 417
968 3300006846 Ga0075430_100001061 Ga0075430_1000010612 417
969 3300006847 Ga0075431_100000856 Ga0075431_10000085610 417
970 3300006852 Ga0075433_10003278 Ga0075433_100032786 417
971 3300006871 Ga0075434_100000346 Ga0075434_10000034616 417
972 3300006871 Ga0075434_100017393 Ga0075434_1000173932 417
973 3300006871 Ga0075434_100171152 Ga0075434_1001711521 417
974 3300006880 Ga0075429_100001137 Ga0075429_10000113723 417
975 3300006881 Ga0068865_100000196 Ga0068865_1000001965 417
976 3300006931 Ga0097620_100107561 Ga0097620_1001075614 417
977 3300006931 Ga0097620_100311247 Ga0097620_1003112471 417
978 3300007076 Ga0075435_100003799 Ga0075435_10000379912 417
979 3300007076 Ga0075435_100019065 Ga0075435_1000190653 417
980 3300007076 Ga0075435_100038442 Ga0075435_1000384424 417
981 3300009092 Ga0105250_10013627 Ga0105250_100136273 417
982 3300009093 Ga0105240_10068944 Ga0105240_100689442 417
983 3300009093 Ga0105240_10380728 Ga0105240_103807282 417
984 3300009094 Ga0111539_10000817 Ga0111539_1000081729 417
985 3300009094 Ga0111539_10001765 Ga0111539_100017651 417
986 3300009098 Ga0105245_10006255 Ga0105245_100062555 417
987 3300009098 Ga0105245_10053755 Ga0105245_100537553 417
988 3300009101 Ga0105247_10004177 Ga0105247_100041772 417
989 3300009101 Ga0105247_10113196 Ga0105247_101131962 417
990 3300009147 Ga0114129_10001060 Ga0114129_1000106033 417
991 3300009147 Ga0114129_10003956 Ga0114129_1000395617 417
992 3300009147 Ga0114129_10021909 Ga0114129_100219095 417
993 3300009148 Ga0105243_10003212 Ga0105243_100032122 417
994 3300009174 Ga0105241_10002185 Ga0105241_100021852 417
995 3300009174 Ga0105241_10022254 Ga0105241_100222544 417
996 3300009174 Ga0105241_10044485 Ga0105241_100444852 417
997 3300009176 Ga0105242_10002746 Ga0105242_1000274611 417
998 3300009177 Ga0105248_10006401 Ga0105248_1000640113 417
999 3300009177 Ga0105248_10214425 Ga0105248_102144251 417
1000 3300009545 Ga0105237_10085695 Ga0105237_100856953 417
1001 3300009545 Ga0105237_10096569 Ga0105237_100965692 417
1002 3300009553 Ga0105249_10003096 Ga0105249_100030962 417
1003 3300009553 Ga0105249_10139808 Ga0105249_101398082 417
1004 3300013100 Ga0157373_10062685 Ga0157373_100626853 417
1005 3300013102 Ga0157371_10011416 Ga0157371_100114164 417
1006 3300013104 Ga0157370_10040486 Ga0157370_100404862 417
1007 3300013297 Ga0157378_10004038 Ga0157378_100040385 417
1008 3300013306 Ga0163162_10039471 Ga0163162_100394712 417
1009 3300013307 Ga0157372_10029143 Ga0157372_100291434 417
1010 3300013307 Ga0157372_10066996 Ga0157372_100669962 417
1011 3300014325 Ga0163163_10001683 Ga0163163_100016832 417
1012 3300014325 Ga0163163_10066801 Ga0163163_100668014 417
1013 3300014325 Ga0163163_10188748 Ga0163163_101887482 417
1014 3300014326 Ga0157380_10067347 Ga0157380_100673472 417
1015 3300014745 Ga0157377_10000127 Ga0157377_100001274 417
1016 3300014968 Ga0157379_10013169 Ga0157379_100131697 417
1017 3300014968 Ga0157379_10054179 Ga0157379_100541791 417
1018 3300014969 Ga0157376_10011024 Ga0157376_100110245 417
1019 3300017792 Ga0163161_10000562 Ga0163161_1000056227 417
1020 3300017792 Ga0163161_10049148 Ga0163161_100491482 417
1021 3300021384 Ga0213876_10054320 Ga0213876_100543202 417
1022 3300024227 Ga0228598_1000321 Ga0228598_10003213 417
1023 3300025271 Ga0207666_1002396 Ga0207666_10023962 417
1024 3300025290 Ga0207673_1000208 Ga0207673_10002088 417
1025 3300025315 Ga0207697_10029097 Ga0207697_100290972 417
1026 3300025893 Ga0207682_10000001 Ga0207682_1000000164 417
1027 3300025899 Ga0207642_10001429 Ga0207642_100014295 417
1028 3300025900 Ga0207710_10000895 Ga0207710_1000089511 417
1029 3300025901 Ga0207688_10053713 Ga0207688_100537132 417
1030 3300025903 Ga0207680_10007725 Ga0207680_100077252 417
1031 3300025904 Ga0207647_10002335 Ga0207647_100023352 417
1032 3300025906 Ga0207699_10044303 Ga0207699_100443032 417
1033 3300025906 Ga0207699_10045606 Ga0207699_100456062 417
1034 3300025907 Ga0207645_10000276 Ga0207645_1000027643 417
1035 3300025907 Ga0207645_10020893 Ga0207645_100208933 417
1036 3300025908 Ga0207643_10000041 Ga0207643_1000004159 417
1037 3300025909 Ga0207705_10044392 Ga0207705_100443922 417
1038 3300025911 Ga0207654_10003566 Ga0207654_1000356611 417
1039 3300025912 Ga0207707_10005534 Ga0207707_100055348 417
1040 3300025912 Ga0207707_10205317 Ga0207707_102053172 417
1041 3300025914 Ga0207671_10013164 Ga0207671_100131642 417
1042 3300025914 Ga0207671_10054159 Ga0207671_100541592 417
1043 3300025915 Ga0207693_10004802 Ga0207693_100048028 417
1044 3300025915 Ga0207693_10005773 Ga0207693_100057739 417
1045 3300025915 Ga0207693_10052850 Ga0207693_100528502 417
1046 3300025915 Ga0207693_10054500 Ga0207693_100545002 417
1047 3300025915 Ga0207693_10093817 Ga0207693_100938172 417
1048 3300025916 Ga0207663_10036004 Ga0207663_100360042 417
1049 3300025917 Ga0207660_10000006 Ga0207660_1000000693 417
1050 3300025917 Ga0207660_10043755 Ga0207660_100437552 417
1051 3300025918 Ga0207662_10000207 Ga0207662_1000020729 417
1052 3300025919 Ga0207657_10004799 Ga0207657_1000479915 417
1053 3300025919 Ga0207657_10015568 Ga0207657_100155683 417
1054 3300025919 Ga0207657_10054523 Ga0207657_100545232 417
1055 3300025920 Ga0207649_10000049 Ga0207649_1000004912 417
1056 3300025921 Ga0207652_10000300 Ga0207652_1000030035 417
1057 3300025921 Ga0207652_10017153 Ga0207652_100171533 417
1058 3300025923 Ga0207681_10000024 Ga0207681_10000024127 417
1059 3300025925 Ga0207650_10000990 Ga0207650_1000099016 417
1060 3300025925 Ga0207650_10005202 Ga0207650_1000520211 417
1061 3300025926 Ga0207659_10000042 Ga0207659_1000004282 417
1062 3300025926 Ga0207659_10024411 Ga0207659_100244111 417
1063 3300025927 Ga0207687_10124486 Ga0207687_101244862 417
1064 3300025928 Ga0207700_10001840 Ga0207700_1000184014 417
1065 3300025928 Ga0207700_10142645 Ga0207700_101426452 417
1066 3300025929 Ga0207664_10035347 Ga0207664_100353472 417
1067 3300025929 Ga0207664_10051499 Ga0207664_100514992 417
1068 3300025929 Ga0207664_10171022 Ga0207664_101710222 417
1069 3300025931 Ga0207644_10000041 Ga0207644_1000004179 417
1070 3300025931 Ga0207644_10001327 Ga0207644_100013277 417
1071 3300025931 Ga0207644_10015084 Ga0207644_100150847 417
1072 3300025932 Ga0207690_10000137 Ga0207690_100001372 417
1073 3300025933 Ga0207706_10004407 Ga0207706_1000440715 417
1074 3300025933 Ga0207706_10010385 Ga0207706_100103857 417
1075 3300025933 Ga0207706_10131449 Ga0207706_101314492 417
1076 3300025934 Ga0207686_10000571 Ga0207686_100005715 417
1077 3300025934 Ga0207686_10056004 Ga0207686_100560043 417
1078 3300025935 Ga0207709_10000220 Ga0207709_1000022064 417
1079 3300025935 Ga0207709_10089212 Ga0207709_100892122 417
1080 3300025935 Ga0207709_10201888 Ga0207709_102018881 417
1081 3300025936 Ga0207670_10000323 Ga0207670_1000032329 417
1082 3300025937 Ga0207669_10000005 Ga0207669_10000005104 417
1083 3300025937 Ga0207669_10008276 Ga0207669_100082762 417
1084 3300025938 Ga0207704_10000060 Ga0207704_100000605 417
1085 3300025939 Ga0207665_10000210 Ga0207665_1000021019 417
1086 3300025940 Ga0207691_10129432 Ga0207691_101294322 417
1087 3300025940 Ga0207691_10129978 Ga0207691_101299782 417
1088 3300025941 Ga0207711_10022126 Ga0207711_100221267 417
1089 3300025941 Ga0207711_10031874 Ga0207711_100318743 417
1090 3300025941 Ga0207711_10063794 Ga0207711_100637943 417
1091 3300025942 Ga0207689_10000053 Ga0207689_100000532 417
1092 3300025944 Ga0207661_10000036 Ga0207661_10000036117 417
1093 3300025945 Ga0207679_10000060 Ga0207679_1000006072 417
1094 3300025945 Ga0207679_10081322 Ga0207679_100813223 417
1095 3300025945 Ga0207679_10106286 Ga0207679_101062862 417
1096 3300025949 Ga0207667_10197000 Ga0207667_101970002 417
1097 3300025960 Ga0207651_10000014 Ga0207651_1000001474 417
1098 3300025961 Ga0207712_10000134 Ga0207712_1000013449 417
1099 3300025972 Ga0207668_10000350 Ga0207668_100003504 417
1100 3300025972 Ga0207668_10075099 Ga0207668_100750992 417
1101 3300025972 Ga0207668_10114395 Ga0207668_101143951 417
1102 3300025981 Ga0207640_10001960 Ga0207640_100019608 417
1103 3300025986 Ga0207658_10001227 Ga0207658_1000122718 417
1104 3300026023 Ga0207677_10003136 Ga0207677_100031364 417
1105 3300026035 Ga0207703_10032671 Ga0207703_100326712 417
1106 3300026041 Ga0207639_10000835 Ga0207639_100008354 417
1107 3300026067 Ga0207678_10000892 Ga0207678_100008922 417
1108 3300026067 Ga0207678_10041314 Ga0207678_100413142 417
1109 3300026075 Ga0207708_10101112 Ga0207708_101011122 417
1110 3300026075 Ga0207708_10101648 Ga0207708_101016482 417
1111 3300026078 Ga0207702_10011181 Ga0207702_100111813 417
1112 3300026088 Ga0207641_10000664 Ga0207641_1000066429 417
1113 3300026089 Ga0207648_10017594 Ga0207648_100175942 417
1114 3300026095 Ga0207676_10000358 Ga0207676_1000035824 417
1115 3300026116 Ga0207674_10000314 Ga0207674_1000031424 417
1116 3300026118 Ga0207675_100002850 Ga0207675_1000028503 417
1117 3300026118 Ga0207675_100154693 Ga0207675_1001546932 417
1118 3300026121 Ga0207683_10000001 Ga0207683_10000001229 417
1119 3300026121 Ga0207683_10027328 Ga0207683_100273282 417
1120 3300026142 Ga0207698_10000857 Ga0207698_1000085715 417
1121 3300027512 Ga0209179_1005986 Ga0209179_10059862 417
1122 3300027695 Ga0209966_1000701 Ga0209966_10007015 417
1123 3300027907 Ga0207428_10000316 Ga0207428_1000031623 417
1124 3300027907 Ga0207428_10000897 Ga0207428_100008974 417
1125 3300027907 Ga0207428_10000923 Ga0207428_100009234 417
1126 3300028379 Ga0268266_10016735 Ga0268266_100167359 417
1127 3300028379 Ga0268266_10028711 Ga0268266_100287111 417
1128 3300028380 Ga0268265_10007116 Ga0268265_100071164 417
1129 3300028381 Ga0268264_10000976 Ga0268264_1000097628 417
1130 3300028381 Ga0268264_10118751 Ga0268264_101187512 417
1131 3300028800 Ga0265338_10014430 Ga0265338_100144303 417
1132 3300031090 Ga0265760_10023408 Ga0265760_100234082 417
1133 3300031235 Ga0265330_10021930 Ga0265330_100219302 417
1134 3300031241 Ga0265325_10000097 Ga0265325_1000009761 417
1135 3300031241 Ga0265325_10003705 Ga0265325_100037056 417
1136 3300031241 Ga0265325_10009260 Ga0265325_100092602 417
1137 3300031241 Ga0265325_10009896 Ga0265325_100098964 417
1138 3300031247 Ga0265340_10010971 Ga0265340_100109712 417
1139 3300031249 Ga0265339_10000091 Ga0265339_1000009131 417
1140 3300031249 Ga0265339_10007468 Ga0265339_100074684 417
1141 3300031249 Ga0265339_10013800 Ga0265339_100138002 417
1142 3300031595 Ga0265313_10000260 Ga0265313_1000026049 417
1143 3300031595 Ga0265313_10004440 Ga0265313_100044404 417
1144 3300031595 Ga0265313_10006139 Ga0265313_1000613910 417
1145 3300031595 Ga0265313_10009745 Ga0265313_100097455 417
1146 3300031595 Ga0265313_10026282 Ga0265313_100262824 417
1147 3300031595 Ga0265313_10063235 Ga0265313_100632352 417
1148 3300031711 Ga0265314_10001493 Ga0265314_1000149331 417
1149 3300031711 Ga0265314_10029986 Ga0265314_100299862 417
1150 3300031712 Ga0265342_10035680 Ga0265342_100356802 417
1151 3300031712 Ga0265342_10065731 Ga0265342_100657311 417
1152 3300032133 Ga0316583_10000081 Ga0316583_1000008117 417
1153 3300034816 Ga0373930_0000006 Ga0373930_0000006_11805_13220 417
1154 3300034819 Ga0373958_0000694 Ga0373958_0000694_2343_3758 417
1155 3300034819 Ga0373958_0001103 Ga0373958_0001103_803_2056 417
1156 3300034820 Ga0373959_0005640 Ga0373959_0005640_658_1911 417
1157 3300034957 Ga0373938_0000479 Ga0373938_0000479_4611_6005 417
1158 3300034957 Ga0373938_0001513 Ga0373938_0001513_567_1820 417
1159 3300035083 Ga0373926_0007041 Ga0373926_0007041_434_1687 417
1160 3300035084 Ga0373928_0003420 Ga0373928_0003420_330_1745 417
1161 3300035084 Ga0373928_0004315 Ga0373928_0004315_1127_2380 417
1162 3300035085 Ga0373929_0000474 Ga0373929_0000474_330_1745 417
1163 3300035086 Ga0373934_0003474 Ga0373934_0003474_2377_3630 417
1164 3300035088 Ga0373940_0000343 Ga0373940_0000343_3759_5174 417
1165 3300035088 Ga0373940_0008788 Ga0373940_0008788_447_1700 417
1166 3300035089 Ga0373944_0002019 Ga0373944_0002019_1953_3218 417
1167 3300035089 Ga0373944_0002875 Ga0373944_0002875_2245_3498 417
1168 3300035089 Ga0373944_0003428 Ga0373944_0003428_2680_3933 417
1169 3300035091 Ga0373951_0000313 Ga0373951_0000313_1416_2831 417
1170 3300035092 Ga0373952_0000218 Ga0373952_0000218_4099_5514 417
1171 3300035092 Ga0373952_0000939 Ga0373952_0000939_731_1984 417
1172 3300035111 Ga0373923_0018708 Ga0373923_0018708_770_2023 417
1173 3300035112 Ga0373932_0002670 Ga0373932_0002670_2044_3297 417
1174 3300035112 Ga0373932_0003226 Ga0373932_0003226_896_2311 417
1175 3300035112 Ga0373932_0017848 Ga0373932_0017848_208_1461 417
1176 3300035113 Ga0373936_0045373 Ga0373936_0045373_327_1592 417
1177 3300035114 Ga0373939_0000569 Ga0373939_0000569_7650_8903 417
1178 3300035114 Ga0373939_0005627 Ga0373939_0005627_110_1525 417
1179 3300035115 Ga0373941_0001350 Ga0373941_0001350_110_1525 417
1180 3300035115 Ga0373941_0025498 Ga0373941_0025498_164_1417 417
1181 3300035116 Ga0373945_0004285 Ga0373945_0004285_970_2223 417
1182 3300035116 Ga0373945_0012804 Ga0373945_0012804_1438_2691 417
1183 3300035117 Ga0373953_0006282 Ga0373953_0006282_1357_2610 417
1184 3300035118 Ga0373954_0013421 Ga0373954_0013421_1426_2679 417
1185 3300035118 Ga0373954_0016582 Ga0373954_0016582_448_1701 417
1186 3300035118 Ga0373954_0036014 Ga0373954_0036014_104_1357 417
1187 3300035119 Ga0373956_0037549 Ga0373956_0037549_713_1981 417
1188 3300035119 Ga0373956_0040827 Ga0373956_0040827_349_1602 417
1189 3300035121 Ga0373960_0000093 Ga0373960_0000093_6262_7677 417
1190 3300035170 Ga0373943_0000567 Ga0373943_0000567_7062_8327 417
1191 3300035170 Ga0373943_0012619 Ga0373943_0012619_246_1499 417
1192 3300035171 Ga0373946_0002942 Ga0373946_0002942_3219_4484 417
1193 3300035171 Ga0373946_0008443 Ga0373946_0008443_732_1985 417
1194 3300035171 Ga0373946_0023518 Ga0373946_0023518_1099_2352 417
1195 3300035172 Ga0373955_0001391 Ga0373955_0001391_1080_2333 417
1196 3300035172 Ga0373955_0025552 Ga0373955_0025552_423_1676 417
1197 3300035172 Ga0373955_0043621 Ga0373955_0043621_554_1822 417
1198 3300035207 Ga0373942_0000292 Ga0373942_0000292_11863_13278 417
1199 3300035207 Ga0373942_0010958 Ga0373942_0010958_285_1538 417
1200 3300035241 Ga0373961_0001147 Ga0373961_0001147_5962_7377 417
1201 3300035241 Ga0373961_0010379 Ga0373961_0010379_571_1824 417
1202 3300035242 Ga0373962_0000301 Ga0373962_0000301_5453_6868 417
1203 3300035242 Ga0373962_0001628 Ga0373962_0001628_334_1587 417
1204 3300035242 Ga0373962_0011123 Ga0373962_0011123_879_2132 417
1205 3300035691 Ga0373931_0000086 Ga0373931_0000086_39956_41209 417
1206 3300035691 Ga0373931_0003593 Ga0373931_0003593_3315_4730 417
1207 3300035692 Ga0373935_0031599 Ga0373935_0031599_607_1860 417
1208 3300035692 Ga0373935_0057184 Ga0373935_0057184_893_2146 417
1209 3300035692 Ga0373935_0065204 Ga0373935_0065204_536_1789 417
1210 3300035692 Ga0373935_0067547 Ga0373935_0067547_368_1633 417
1211 3300035695 Ga0373927_0005131 Ga0373927_0005131_6573_7826 417
1212 3300035695 Ga0373927_0034920 Ga0373927_0034920_939_2192 417
1213 3300035695 Ga0373927_0059331 Ga0373927_0059331_372_1625 417
1214 3300035695 Ga0373927_0071753 Ga0373927_0071753_310_1578 417
1215 3300035724 Ga0373933_0017845 Ga0373933_0017845_2455_3708 417
1216 3300035724 Ga0373933_0028060 Ga0373933_0028060_1173_2426 417
1217 3300035725 Ga0373947_0009204 Ga0373947_0009204_183_1436 417
1218 3300035725 Ga0373947_0014769 Ga0373947_0014769_955_2208 417
1219 3300035725 Ga0373947_0021695 Ga0373947_0021695_2127_3380 417
1220 3300036401 Ga0373937_0004313 Ga0373937_0004313_5279_6532 417
1221 3300036401 Ga0373937_0013053 Ga0373937_0013053_120_1373 417
1222 3300036401 Ga0373937_0023035 Ga0373937_0023035_3527_4795 417
1223 3300036401 Ga0373937_0031048 Ga0373937_0031048_712_1965 417
1224 3300037068 Ga0373925_0003922 Ga0373925_0003922_9159_10424 417
1225 3300037068 Ga0373925_0015075 Ga0373925_0015075_1827_3080 417
1226 3300037068 Ga0373925_0023858 Ga0373925_0023858_2041_3294 417
1227 3300037418 Ga0395900_0091734 Ga0395900_0091734_832_2088 417
1228 3300037466 Ga0395898_0121892 Ga0395898_0121892_1188_2444 417
1229 3300037853 Ga0436364_0319726 Ga0436364_0319726_411_1664 417
1230 3300038443 Ga0395901_0007227 Ga0395901_0007227_3146_4402 417
1231 3300039437 Ga0436365_0414414 Ga0436365_0414414_34757_36010 417
1232 3300039438 Ga0436360_0251329 Ga0436360_0251329_484_1737 417
1233 3300042005 Ga0439448_0020086 Ga0439448_0020086_331_1584 417
1234 3300042012 Ga0439455_0025551 Ga0439455_0025551_170_1423 417
1235 3300042876 Ga0451577_0012529 Ga0451577_0012529_2798_4213 417
1236 3300044694 Ga0466963_0042944 Ga0466963_0042944_149_1417 417
1237 3300044712 Ga0453684_0082525 Ga0453684_0082525_2037_3452 417
1238 3300045049 Ga0466959_0059587 Ga0466959_0059587_13_1281 417
1239 3300045051 Ga0451576_0027924 Ga0451576_0027924_4022_5437 417
1240 3300045836 Ga0466958_0035584 Ga0466958_0035584_1252_2520 417
1241 3300045976 Ga0466967_0172865 Ga0466967_0172865_739_2007 417
1242 3300046454 Ga0495592_0008217 Ga0495592_0008217_1959_3212 417
1243 3300046454 Ga0495592_0027775 Ga0495592_0027775_2999_4252 417
1244 3300046454 Ga0495592_0101871 Ga0495592_0101871_607_1875 417
1245 3300046459 Ga0495629_0000668 Ga0495629_0000668_6699_7952 417
1246 3300046459 Ga0495629_0135648 Ga0495629_0135648_394_1659 417
1247 3300046461 Ga0495641_0034802 Ga0495641_0034802_299_1552 417
1248 3300046461 Ga0495641_0068827 Ga0495641_0068827_273_1526 417
1249 3300046462 Ga0495651_0000237 Ga0495651_0000237_18052_19305 417
1250 3300046462 Ga0495651_0009743 Ga0495651_0009743_1792_3045 417
1251 3300046462 Ga0495651_0014732 Ga0495651_0014732_1791_3059 417
1252 3300046462 Ga0495651_0064792 Ga0495651_0064792_825_2078 417
1253 3300046463 Ga0495653_0009351 Ga0495653_0009351_6607_7860 417
1254 3300046463 Ga0495653_0020295 Ga0495653_0020295_1191_2456 417
1255 3300046463 Ga0495653_0047643 Ga0495653_0047643_306_1559 417
1256 3300046472 Ga0495580_0024260 Ga0495580_0024260_1674_2939 417
1257 3300046472 Ga0495580_0044157 Ga0495580_0044157_997_2250 417
1258 3300046473 Ga0495582_0035811 Ga0495582_0035811_67_1320 417
1259 3300046475 Ga0495639_0020552 Ga0495639_0020552_1016_2269 417
1260 3300046476 Ga0495662_0000280 Ga0495662_0000280_7709_8974 417
1261 3300046476 Ga0495662_0007973 Ga0495662_0007973_661_1914 417
1262 3300046477 Ga0495664_0000112 Ga0495664_0000112_19785_21050 417
1263 3300046477 Ga0495664_0006025 Ga0495664_0006025_5075_6328 417
1264 3300046477 Ga0495664_0092353 Ga0495664_0092353_218_1471 417
1265 3300046491 Ga0495584_0011269 Ga0495584_0011269_1124_2377 417
1266 3300046492 Ga0495585_0000734 Ga0495585_0000734_27956_29209 417
1267 3300046501 Ga0495607_0011035 Ga0495607_0011035_747_2000 417
1268 3300046511 Ga0495608_0005221 Ga0495608_0005221_4247_5500 417
1269 3300046511 Ga0495608_0067866 Ga0495608_0067866_376_1629 417
1270 3300046514 Ga0495618_0001016 Ga0495618_0001016_17274_18539 417
1271 3300046514 Ga0495618_0007304 Ga0495618_0007304_4181_5434 417
1272 3300046514 Ga0495618_0134541 Ga0495618_0134541_158_1411 417
1273 3300046516 Ga0495628_0004625 Ga0495628_0004625_7947_9200 417
1274 3300046516 Ga0495628_0018442 Ga0495628_0018442_587_1840 417
1275 3300046516 Ga0495628_0211069 Ga0495628_0211069_161_1429 417
1276 3300046517 Ga0495630_0024126 Ga0495630_0024126_669_1922 417
1277 3300046517 Ga0495630_0034111 Ga0495630_0034111_285_1550 417
1278 3300046520 Ga0495637_0034787 Ga0495637_0034787_928_2181 417
1279 3300046523 Ga0495644_0000306 Ga0495644_0000306_19098_20351 417
1280 3300046526 Ga0495666_0023948 Ga0495666_0023948_546_1799 417
1281 3300046526 Ga0495666_0034834 Ga0495666_0034834_1174_2427 417
1282 3300046529 Ga0495652_0019482 Ga0495652_0019482_666_1919 417
1283 3300046529 Ga0495652_0105926 Ga0495652_0105926_64_1317 417
1284 3300046531 Ga0495665_0007482 Ga0495665_0007482_2160_3413 417
1285 3300046531 Ga0495665_0012616 Ga0495665_0012616_161_1414 417
1286 3300046531 Ga0495665_0030802 Ga0495665_0030802_453_1718 417
1287 3300046533 Ga0495640_0000871 Ga0495640_0000871_12103_13368 417
1288 3300046533 Ga0495640_0084501 Ga0495640_0084501_514_1767 417
1289 3300046535 Ga0495586_0014023 Ga0495586_0014023_1190_2443 417
1290 3300046535 Ga0495586_0041668 Ga0495586_0041668_65_1330 417
1291 3300046535 Ga0495586_0111993 Ga0495586_0111993_218_1471 417
1292 3300046536 Ga0495587_0006533 Ga0495587_0006533_793_2046 417
1293 3300046536 Ga0495587_0118441 Ga0495587_0118441_104_1357 417
1294 3300046543 Ga0495645_0003375 Ga0495645_0003375_8689_9942 417
1295 3300046543 Ga0495645_0004586 Ga0495645_0004586_3351_4616 417
1296 3300046543 Ga0495645_0076719 Ga0495645_0076719_1006_2259 417
1297 3300046557 Ga0495622_0034756 Ga0495622_0034756_902_2155 417
1298 3300046557 Ga0495622_0054674 Ga0495622_0054674_335_1588 417
1299 3300046558 Ga0495633_0001183 Ga0495633_0001183_668_1921 417
1300 3300046559 Ga0495667_0003141 Ga0495667_0003141_2974_4227 417
1301 3300046559 Ga0495667_0004903 Ga0495667_0004903_1849_3102 417
1302 3300046559 Ga0495667_0095258 Ga0495667_0095258_517_1770 417
1303 3300046615 Ga0495656_0000381 Ga0495656_0000381_4711_5964 417
1304 3300046642 Ga0495634_0003493 Ga0495634_0003493_11300_12565 417
1305 3300046642 Ga0495634_0033846 Ga0495634_0033846_235_1500 417
1306 3300046642 Ga0495634_0038870 Ga0495634_0038870_1895_3148 417
1307 3300046648 Ga0495611_0001463 Ga0495611_0001463_5645_6898 417
1308 3300046663 Ga0495635_0002093 Ga0495635_0002093_12125_13390 417
1309 3300046663 Ga0495635_0028467 Ga0495635_0028467_1637_2890 417
1310 3300046663 Ga0495635_0116987 Ga0495635_0116987_412_1680 417
1311 3300046664 Ga0495659_0003761 Ga0495659_0003761_2997_4250 417
1312 3300046674 Ga0495588_0002225 Ga0495588_0002225_4624_5877 417
1313 3300046675 Ga0495657_0006644 Ga0495657_0006644_6406_7659 417
1314 3300046675 Ga0495657_0008508 Ga0495657_0008508_728_1981 417
1315 3300046678 Ga0495599_0021673 Ga0495599_0021673_2081_3334 417
1316 3300046679 Ga0495623_0026503 Ga0495623_0026503_731_1999 417
1317 3300046680 Ga0495646_0004362 Ga0495646_0004362_3964_5217 417
1318 3300046683 Ga0495658_0000229 Ga0495658_0000229_25946_27199 417
1319 3300046689 Ga0495613_0011247 Ga0495613_0011247_2443_3696 417
1320 3300046689 Ga0495613_0037688 Ga0495613_0037688_684_1937 417
1321 3300046689 Ga0495613_0103240 Ga0495613_0103240_688_1953 417
1322 3300046690 Ga0495624_0001093 Ga0495624_0001093_16966_18231 417
1323 3300046690 Ga0495624_0022372 Ga0495624_0022372_2680_3933 417
1324 3300046691 Ga0495670_0002180 Ga0495670_0002180_2191_3444 417
1325 3300046809 Ga0495600_0019287 Ga0495600_0019287_2757_4025 417
1326 3300046809 Ga0495600_0067544 Ga0495600_0067544_621_1874 417
1327 3300046809 Ga0495600_0084015 Ga0495600_0084015_311_1564 417
1328 3300047315 Ga0495581_0054776 Ga0495581_0054776_710_1975 417
1329 3300047315 Ga0495581_0056281 Ga0495581_0056281_1007_2260 417
1330 3300047315 Ga0495581_0058993 Ga0495581_0058993_213_1466 417
1331 3300047317 Ga0495604_0002806 Ga0495604_0002806_1949_3202 417
1332 3300047317 Ga0495604_0008011 Ga0495604_0008011_5126_6379 417
1333 3300047317 Ga0495604_0009095 Ga0495604_0009095_4462_5715 417
1334 3300047319 Ga0495674_0001513 Ga0495674_0001513_311_1576 417
1335 3300047319 Ga0495674_0151891 Ga0495674_0151891_263_1516 417
1336 3300047319 Ga0495674_0280038 Ga0495674_0280038_13_1266 417
1337 3300047320 Ga0495672_0004345 Ga0495672_0004345_453_1706 417
1338 3300047322 Ga0495680_0016671 Ga0495680_0016671_1670_2923 417
1339 3300047322 Ga0495680_0077960 Ga0495680_0077960_1072_2325 417
1340 3300047322 Ga0495680_0098613 Ga0495680_0098613_134_1387 417
1341 3300047444 Ga0495675_0005331 Ga0495675_0005331_1991_3244 417
1342 3300047471 Ga0495684_0000264 Ga0495684_0000264_40086_41351 417
1343 3300047471 Ga0495684_0001309 Ga0495684_0001309_370_1635 417
1344 3300047673 Ga0495593_0030842 Ga0495593_0030842_1283_2536 417
1345 3300047673 Ga0495593_0046463 Ga0495593_0046463_371_1636 417
1346 3300048088 Ga0495602_0005783 Ga0495602_0005783_3718_4986 417
1347 3300048088 Ga0495602_0040285 Ga0495602_0040285_2138_3391 417
1348 3300048089 Ga0495614_0012220 Ga0495614_0012220_1180_2433 417
1349 3300048903 Ga0496100_0001253 Ga0496100_0001253_4625_5878 417
1350 3300048903 Ga0496100_0040891 Ga0496100_0040891_93_1346 417
1351 3300048904 Ga0496101_0001852 Ga0496101_0001852_7776_9029 417
1352 3300048904 Ga0496101_0002475 Ga0496101_0002475_2372_3625 417
1353 3300048904 Ga0496101_0061187 Ga0496101_0061187_74_1342 417
1354 3300048905 Ga0496102_0006171 Ga0496102_0006171_4342_5595 417
1355 3300048905 Ga0496102_0024435 Ga0496102_0024435_3343_4596 417
1356 3300048905 Ga0496102_0203451 Ga0496102_0203451_330_1724 417
1357 3300048906 Ga0496103_0000130 Ga0496103_0000130_41460_42713 417
1358 3300048906 Ga0496103_0031446 Ga0496103_0031446_1000_2253 417
1359 3300048907 Ga0496104_0000311 Ga0496104_0000311_27914_29167 417
1360 3300048907 Ga0496104_0047862 Ga0496104_0047862_861_2114 417
1361 3300048908 Ga0496105_0000144 Ga0496105_0000144_37068_38321 417
1362 3300048908 Ga0496105_0075082 Ga0496105_0075082_1189_2442 417
1363 3300048909 Ga0496106_0000135 Ga0496106_0000135_15099_16352 417
1364 3300048909 Ga0496106_0005392 Ga0496106_0005392_532_1947 417
1365 3300048910 Ga0496107_0012327 Ga0496107_0012327_4470_5723 417
1366 3300048910 Ga0496107_0059074 Ga0496107_0059074_898_2151 417
1367 3300048910 Ga0496107_0120197 Ga0496107_0120197_443_1696 417
1368 3300048911 Ga0496108_0005764 Ga0496108_0005764_8618_9871 417
1369 3300048911 Ga0496108_0008672 Ga0496108_0008672_6253_7506 417
1370 3300048911 Ga0496108_0125821 Ga0496108_0125821_449_1702 417
1371 3300048912 Ga0496109_0000490 Ga0496109_0000490_3272_4525 417
1372 3300048912 Ga0496109_0219015 Ga0496109_0219015_351_1604 417
1373 3300048913 Ga0496110_0008841 Ga0496110_0008841_6645_7898 417
1374 3300048913 Ga0496110_0010176 Ga0496110_0010176_3500_4753 417
1375 3300048914 Ga0496111_0012561 Ga0496111_0012561_2420_3673 417
1376 3300048914 Ga0496111_0030426 Ga0496111_0030426_520_1935 417
1377 3300048914 Ga0496111_0074374 Ga0496111_0074374_898_2151 417
1378 3300048915 Ga0496112_0053767 Ga0496112_0053767_2638_3891 417
1379 3300048915 Ga0496112_0086797 Ga0496112_0086797_479_1732 417
1380 3300048915 Ga0496112_0196859 Ga0496112_0196859_688_1956 417
1381 3300048916 Ga0496113_0004239 Ga0496113_0004239_7306_8559 417
1382 3300048917 Ga0496114_0000287 Ga0496114_0000287_20125_21378 417
1383 3300048917 Ga0496114_0058988 Ga0496114_0058988_727_1980 417
1384 3300048918 Ga0496115_0003371 Ga0496115_0003371_9576_10829 417
1385 3300048918 Ga0496115_0019923 Ga0496115_0019923_629_1882 417
1386 3300048918 Ga0496115_0064194 Ga0496115_0064194_969_2222 417
1387 3300049569 Ga0501032_0063370 Ga0501032_0063370_1185_2438 417
1388 3300049570 Ga0501033_0004204 Ga0501033_0004204_234_1490 417
1389 3300049570 Ga0501033_0026129 Ga0501033_0026129_2181_3434 417
1390 3300049571 Ga0501034_0000436 Ga0501034_0000436_19961_21214 417
1391 3300049571 Ga0501034_0005233 Ga0501034_0005233_9699_10952 417
1392 3300049571 Ga0501034_0027067 Ga0501034_0027067_3758_5011 417
1393 3300049571 Ga0501034_0099430 Ga0501034_0099430_340_1596 417
1394 3300049572 Ga0501036_0001221 Ga0501036_0001221_12866_14119 417
1395 3300049572 Ga0501036_0044521 Ga0501036_0044521_196_1452 417
1396 3300049573 Ga0501037_0003949 Ga0501037_0003949_2433_3686 417
1397 3300049574 Ga0501038_0028790 Ga0501038_0028790_1474_2730 417
1398 3300049574 Ga0501038_0085958 Ga0501038_0085958_341_1597 417
1399 3300049574 Ga0501038_0095777 Ga0501038_0095777_1150_2403 417
1400 3300049575 Ga0501039_0033073 Ga0501039_0033073_206_1459 417
1401 3300049579 Ga0501043_0008146 Ga0501043_0008146_3153_4409 417
1402 3300049579 Ga0501043_0009282 Ga0501043_0009282_3508_4857 417
1403 3300049579 Ga0501043_0034819 Ga0501043_0034819_161_1414 417
1404 3300049580 Ga0501046_0105803 Ga0501046_0105803_288_1541 417
1405 3300049581 Ga0501047_0000384 Ga0501047_0000384_27230_28483 417
1406 3300049581 Ga0501047_0116121 Ga0501047_0116121_163_1419 417
1407 3300049581 Ga0501047_0146712 Ga0501047_0146712_875_2128 417
1408 3300049582 Ga0501048_0000074 Ga0501048_0000074_47466_48719 417
1409 3300049582 Ga0501048_0123057 Ga0501048_0123057_420_1673 417
1410 3300049583 Ga0501067_0076510 Ga0501067_0076510_65_1318 417
1411 3300049585 Ga0501069_0019134 Ga0501069_0019134_120_1373 417
1412 3300049586 Ga0501070_0008586 Ga0501070_0008586_5382_6635 417
1413 3300049586 Ga0501070_0011258 Ga0501070_0011258_5308_6561 417
1414 3300049586 Ga0501070_0032074 Ga0501070_0032074_1183_2439 417
1415 3300049586 Ga0501070_0032152 Ga0501070_0032152_1576_2832 417
1416 3300049587 Ga0501071_0011938 Ga0501071_0011938_2714_3967 417
1417 3300049590 Ga0501074_0012491 Ga0501074_0012491_2727_3980 417
1418 3300049592 Ga0501076_0012519 Ga0501076_0012519_970_2223 417
1419 3300049592 Ga0501076_0064957 Ga0501076_0064957_662_1915 417
1420 3300049741 Ga0501079_0135107 Ga0501079_0135107_642_1895 417
1421 3300049742 Ga0501080_0001854 Ga0501080_0001854_11107_12360 417
1422 3300049744 Ga0501083_0001146 Ga0501083_0001146_6627_7880 417
1423 3300049822 Ga0501035_0000371 Ga0501035_0000371_26622_27875 417
1424 3300049822 Ga0501035_0033698 Ga0501035_0033698_2351_3607 417
1425 3300049822 Ga0501035_0060863 Ga0501035_0060863_55_1311 417
1426 3300049823 Ga0501044_0001720 Ga0501044_0001720_18522_19775 417
1427 3300049823 Ga0501044_0011870 Ga0501044_0011870_4775_6031 417
1428 3300049824 Ga0501045_0168021 Ga0501045_0168021_229_1482 417
1429 3300050494 nmdc:mga06z11_11391_c1 nmdc:mga06z11_11391_c1_736_1989 417
1430 3300050496 nmdc:mga07m45_8495_c1 nmdc:mga07m45_8495_c1_762_2066 417
1431 3300050507 nmdc:mga05p37_222_c1 nmdc:mga05p37_222_c1_36176_37429 417
1432 3300050507 nmdc:mga05p37_30060_c1 nmdc:mga05p37_30060_c1_2330_3583 417
1433 3300050507 nmdc:mga05p37_81621_c1 nmdc:mga05p37_81621_c1_2693_3946 417
1434 3300050508 nmdc:mga09592_16877_c1 nmdc:mga09592_16877_c1_2708_3961 417
1435 3300050509 nmdc:mga0qj67_1677_c1 nmdc:mga0qj67_1677_c1_5591_6844 417
1436 3300050510 nmdc:mga06r32_1077_c1 nmdc:mga06r32_1077_c1_14115_15368 417
1437 3300050511 nmdc:mga08y16_11073_c1 nmdc:mga08y16_11073_c1_6639_8054 417
1438 3300050511 nmdc:mga08y16_13536_c1 nmdc:mga08y16_13536_c1_2836_4089 417
1439 3300050511 nmdc:mga08y16_587_c1 nmdc:mga08y16_587_c1_30178_31431 417
1440 3300050512 nmdc:mga0n895_126764_c1 nmdc:mga0n895_126764_c1_1079_2332 417
1441 3300050512 nmdc:mga0n895_150771_c1 nmdc:mga0n895_150771_c1_899_2152 417
1442 3300050512 nmdc:mga0n895_437_c1 nmdc:mga0n895_437_c1_25923_27176 417
1443 3300050512 nmdc:mga0n895_741_c1 nmdc:mga0n895_741_c1_16381_17634 417
1444 3300050513 nmdc:mga0rr50_185351_c1 nmdc:mga0rr50_185351_c1_209_1462 417
1445 3300050513 nmdc:mga0rr50_5627_c1 nmdc:mga0rr50_5627_c1_2950_4203 417
1446 3300050513 nmdc:mga0rr50_6644_c1 nmdc:mga0rr50_6644_c1_4940_6193 417
1447 3300050514 nmdc:mga08x19_165289_c1 nmdc:mga08x19_165289_c1_93_1361 417
1448 3300050514 nmdc:mga08x19_49275_c1 nmdc:mga08x19_49275_c1_1394_2647 417
1449 3300050515 nmdc:mga0a205_3283_c1 nmdc:mga0a205_3283_c1_5446_6699 417
1450 3300050515 nmdc:mga0a205_43507_c1 nmdc:mga0a205_43507_c1_427_1680 417
1451 3300050515 nmdc:mga0a205_6511_c1 nmdc:mga0a205_6511_c1_5211_6464 417
1452 3300053077 Ga0495601_0000441 Ga0495601_0000441_11309_12562 417
1453 3300053077 Ga0495601_0001951 Ga0495601_0001951_3315_4580 417
1454 3300053077 Ga0495601_0006078 Ga0495601_0006078_5406_6659 417
1455 3300053078 Ga0495612_0006563 Ga0495612_0006563_2159_3427 417
1456 3300053078 Ga0495612_0019001 Ga0495612_0019001_1002_2255 417
1457 3300053084 Ga0495595_0000551 Ga0495595_0000551_10812_12065 417
1458 3300053084 Ga0495595_0008006 Ga0495595_0008006_103_1371 417
1459 3300053085 Ga0495619_0000170 Ga0495619_0000170_37434_38687 417
1460 3300053085 Ga0495619_0001482 Ga0495619_0001482_6153_7406 417
1461 3300053085 Ga0495619_0022077 Ga0495619_0022077_459_1712 417
1462 3300053117 Ga0500593_007593 Ga0500593_007593_2959_4212 417
1463 3300060353 Ga0501082_0083169 Ga0501082_0083169_146_1399 417
1464 3300060353 Ga0501082_0127916 Ga0501082_0127916_915_2168 417

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22468

ACT_9

ACT domain

423

481

0.98

PF13840

ACT_7

ACT domain

417

479

0.97

PF22468

ACT_9

ACT domain

344

405

0.94

PF00696

AA_kinase

Amino acid kinase family

71

301

0.91

PF01842

ACT

ACT domain

342

407

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go7-assembly1.cif.gz_X-2 the regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis 0.9585 258 415
3s1t-assembly1.cif.gz_B structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis 0.9577 260 413
2re1-assembly1.cif.gz_A crystal structure of aspartokinase alpha and beta subunits 0.9565 262 413
4go5-assembly1.cif.gz_X-2 the regulatory subunit of aspartate kinase from mycobacterium tuberculosis 0.956 258 413
2zho-assembly3.cif.gz_F crystal structure of the regulatory subunit of aspartate kinase from thermus thermophilus (ligand free form) 0.9464 262 412
ID Description Score Start End Superfamily
4go5X02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9589 272 348 3.30.70.260
2zhoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9478 350 412 3.30.70.260
5yeiG02 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9442 262 415 3.30.2130.10
af_Q2FYP1_2_256_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9298 1 267 3.40.1160.10
2zhoB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9296 271 347 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A7Z9K1I4-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9695 267 417 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A3P1Y057-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9642 258 413 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A7Z9K1I4-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9571 267 417 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A2H0LI16-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9555 270 416 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A3D3R500-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9551 258 414 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090

Feature Viewer

pLDDT pTM Quality
87.78 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map