F494076

General Info

Members Datasets Scaffolds Average Seq Length
1454 488 1420 185

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100169478|Ga0070674_1001694782
Length 200
Sequence MPPICVGERTRSVLIEVRPLGLDGVLEIRPRRLRDDRGFFSETWNEREFRDAGIDVSFVQDNHSLSREPGVLRGLHFQAPPFAQDKLIRVSRGSVFDVAVDIRSGSPTFGRWAAAILSAENKRHFWIPEGFAHGFAVLSDYATFSYQCTALYDHSADAAVRWNDGDIAVDWPISAPLLSVKDQRAPFLRDIPHGRLPAFA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
9 2643221607 Rhizobium sp. Root73 Isolate Unclassified
10 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
11 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
12 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2643221720 Lysobacter sp. Root916 Isolate Unclassified
15 2643221728 Lysobacter sp. Root983 Isolate Unclassified
16 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
17 2738543009 Luteibacter sp. OK325 Isolate Unclassified
18 2739367700 Dyella sp. YR388 Isolate Unclassified
19 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
20 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
21 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
22 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
23 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
24 2884411467 Dyella sp. AD56 Isolate Rhizosphere
25 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
26 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
27 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
28 2919404418 Luteibacter sp. 3190 Isolate Unclassified
29 2928963466 Dyella japonica 1073 Isolate Unclassified
30 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
31 2941471342 Luteibacter sp. 621 Isolate Unclassified
32 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
33 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
37 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
42 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
43 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
52 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
53 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
54 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
55 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
76 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
77 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
78 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
79 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
80 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
94 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
95 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
96 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
97 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
104 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
117 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
118 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
119 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
122 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
123 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
124 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
125 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
126 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
131 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
150 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
154 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
155 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
173 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
174 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
179 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
181 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
188 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
190 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
191 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
194 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
195 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
275 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
276 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
277 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
278 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
279 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
280 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
281 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
282 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
283 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
284 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
285 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
286 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
287 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
288 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
289 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
290 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
291 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
292 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
293 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
294 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
295 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
298 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
299 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
301 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
308 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
309 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
310 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
311 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
314 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
315 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
316 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
317 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
318 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
319 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
320 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
321 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
322 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
323 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
324 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
325 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
326 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
327 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
328 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
329 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
330 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
331 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
332 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
333 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
334 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
335 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
336 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
337 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
338 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
339 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
340 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
341 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
342 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
343 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
344 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
345 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
346 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
347 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
348 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
349 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
350 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
351 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
352 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
353 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
354 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
355 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
356 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
357 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
358 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
359 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
360 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
361 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
362 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
363 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
364 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
365 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
366 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
367 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
368 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
379 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
380 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
381 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
382 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
383 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
384 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
385 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
386 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
387 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
388 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
389 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
390 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
391 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
392 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
393 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
394 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
395 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
396 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
397 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
398 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
399 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
400 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
401 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
402 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
414 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
415 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
429 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
453 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
454 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
460 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
461 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
466 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
467 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
468 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
469 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
470 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
471 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
472 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
473 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
474 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
475 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
476 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
477 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
480 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
481 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
482 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
483 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
488 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0.34
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 0
Rhizoplane 2.82
Rhizosphere 78.06
Stem 0
Stem Tuber 0
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000320 3300001979 Bacteria 20427
2 JGI24740J21852_10003591 3300001979 Bacteria 6767
3 JGI24739J22299_10009127 3300001989 Bacteria 3700
4 JGI24739J22299_10045170 3300001989 Bacteria 1447
5 JGI24737J22298_10002818 3300001990 Bacteria 6157
6 JGI24737J22298_10002923 3300001990 Bacteria 6053
7 JGI24735J21928_10000210 3300002067 Bacteria 20437
8 JGI24735J21928_10008070 3300002067 Bacteria 3418
9 JGI24738J21930_10000630 3300002075 Bacteria 10160
10 JGI25162J39368_1000072 3300002737 Bacteria 122550
11 JGI25162J39368_1000403 3300002737 Bacteria 35711
12 JGI25162J39368_1000450 3300002737 Bacteria 32392
13 JGI25154J39366_1005804 3300002738 Bacteria 1905
14 JGI25157J39369_1000143 3300002741 Bacteria 60517
15 JGI25157J39369_1000145 3300002741 Bacteria 60335
16 JGI25157J39369_1000210 3300002741 Bacteria 48631
17 JGI25163J39215_1000608 3300002771 Bacteria 9915
18 JGI25164J39214_1000115 3300002772 Bacteria 77050
19 JGI25164J39214_1000122 3300002772 Bacteria 74977
20 JGI25164J39214_1000276 3300002772 Bacteria 37292
21 JGI25164J39214_1000360 3300002772 Bacteria 27828
22 JGI25164J39214_1000479 3300002772 Bacteria 19723
23 JGI25151J46595_10000165 3300003187 Bacteria 85521
24 JGI25151J46595_10012116 3300003187 Bacteria 3931
25 JGI25165J46597_1000063 3300003214 Bacteria 205051
26 JGI25165J46597_1000241 3300003214 Bacteria 74955
27 JGI25165J46597_1000419 3300003214 Bacteria 43972
28 JGI25165J46597_1001372 3300003214 Bacteria 13423
29 JGI25165J46597_1007774 3300003214 Bacteria 1745
30 JGI25153J46596_10024928 3300003215 Bacteria 2147
31 rootH1_10024742 3300003316 Bacteria 3058
32 rootH1_10071835 3300003316 Bacteria 4198
33 rootH1_10110832 3300003316 Bacteria 3620
34 rootH2_10063162 3300003320 Bacteria 4812
35 rootL2_10006308 3300003322 Bacteria 4060
36 rootL2_10061895 3300003322 Bacteria 1357
37 rootL2_10246862 3300003322 Bacteria 1747
38 rootH1_10327385 3300003323 Bacteria 2908
39 JGI26145J50221_1002765 3300003371 Bacteria 1379
40 Ga0006562J51391_1027422 3300003578 Bacteria 7490
41 Ga0055538_1004437 3300003751 Bacteria 1593
42 Ga0055539_1002939 3300003752 Bacteria 2468
43 Ga0055533_1000338 3300003756 Bacteria 20556
44 Ga0055525_1000135 3300003759 Bacteria 108217
45 Ga0055527_1000043 3300003760 Bacteria 113506
46 Ga0055527_1000079 3300003760 Bacteria 79303
47 Ga0055535_1000068 3300003761 Bacteria 115329
48 Ga0055535_1000071 3300003761 Bacteria 113506
49 Ga0055535_1000166 3300003761 Bacteria 71280
50 Ga0055535_1017601 3300003761 Bacteria 949
51 Ga0055542_1000090 3300003762 Bacteria 122550
52 Ga0055542_1000096 3300003762 Bacteria 118398
53 Ga0055542_1000210 3300003762 Bacteria 71284
54 Ga0055529_1000084 3300003763 Bacteria 143720
55 Ga0055529_1000114 3300003763 Bacteria 118398
56 Ga0055529_1000394 3300003763 Bacteria 46666
57 Ga0055529_1003020 3300003763 Bacteria 2950
58 Ga0055526_1000008 3300003771 Bacteria 300059
59 Ga0055526_1056385 3300003771 Bacteria 861
60 Ga0055524_1002861 3300003775 Bacteria 8653
61 Ga0055524_1002910 3300003775 Bacteria 8556
62 Ga0055536_1002163 3300003781 Bacteria 11201
63 Ga0055536_1003562 3300003781 Bacteria 8325
64 Ga0055528_1044392 3300003790 Bacteria 957
65 Ga0055530_10001268 3300003791 Bacteria 19106
66 Ga0055531_10004683 3300003794 Bacteria 8197
67 Ga0055531_10007280 3300003794 Bacteria 6072
68 Ga0058692_1000040 3300003856 Bacteria 132805
69 Ga0065165_1003771 3300005262 Bacteria 10154
70 Ga0065704_10087117 3300005289 Bacteria 3054
71 Ga0065715_10001173 3300005293 Bacteria 11480
72 Ga0065715_10268777 3300005293 Bacteria 1117
73 Ga0070658_10001469 3300005327 Bacteria 20090
74 Ga0070658_10324163 3300005327 Bacteria 1316
75 Ga0070658_10412723 3300005327 Bacteria 1160
76 Ga0070676_10018581 3300005328 Bacteria 3855
77 Ga0070683_100148589 3300005329 Bacteria 2221
78 Ga0070683_100705389 3300005329 Bacteria 966
79 Ga0070670_100051522 3300005331 Bacteria 3535
80 Ga0070670_100082595 3300005331 Bacteria 2761
81 Ga0070670_100156808 3300005331 Bacteria 1972
82 Ga0070670_100476960 3300005331 Bacteria 1107
83 Ga0070670_100780618 3300005331 Bacteria 862
84 Ga0070670_101066703 3300005331 Bacteria 736
85 Ga0070677_10092159 3300005333 Bacteria 1320
86 Ga0068869_100117424 3300005334 Bacteria 2031
87 Ga0068869_100123858 3300005334 Bacteria 1980
88 Ga0068869_100161403 3300005334 Bacteria 1745
89 Ga0070666_10000010 3300005335 Bacteria 264789
90 Ga0070666_10027007 3300005335 Bacteria 3756
91 Ga0070666_10028601 3300005335 Bacteria 3659
92 Ga0070666_10092942 3300005335 Bacteria 2074
93 Ga0070666_10111766 3300005335 Bacteria 1890
94 Ga0070666_10115168 3300005335 Bacteria 1862
95 Ga0070666_10345067 3300005335 Bacteria 1064
96 Ga0070680_100264546 3300005336 Bacteria 1455
97 Ga0070680_100822370 3300005336 Bacteria 801
98 Ga0070682_100363557 3300005337 Bacteria 1083
99 Ga0070682_100546560 3300005337 Bacteria 906
100 Ga0070682_100791487 3300005337 Bacteria 769
101 Ga0068868_100088396 3300005338 Bacteria 2494
102 Ga0068868_100139242 3300005338 Bacteria 1991
103 Ga0068868_100360665 3300005338 Bacteria 1247
104 Ga0070660_100071494 3300005339 Bacteria 2709
105 Ga0070660_100136540 3300005339 Bacteria 1965
106 Ga0070660_100886085 3300005339 Bacteria 752
107 Ga0070689_100002138 3300005340 Bacteria 12816
108 Ga0070689_100260673 3300005340 Bacteria 1433
109 Ga0070689_100940146 3300005340 Bacteria 766
110 Ga0070661_100008137 3300005344 Bacteria 7233
111 Ga0070661_100139444 3300005344 Bacteria 1826
112 Ga0070661_100233097 3300005344 Bacteria 1415
113 Ga0070692_10003879 3300005345 Bacteria 6161
114 Ga0070668_100049024 3300005347 Bacteria 3249
115 Ga0070668_100649769 3300005347 Bacteria 927
116 Ga0070669_100042491 3300005353 Bacteria 3308
117 Ga0070669_100168407 3300005353 Bacteria 1707
118 Ga0070675_100043062 3300005354 Bacteria 3688
119 Ga0070675_100638317 3300005354 Bacteria 967
120 Ga0070671_100112479 3300005355 Bacteria 2287
121 Ga0070671_100204590 3300005355 Bacteria 1674
122 Ga0070671_100281894 3300005355 Bacteria 1413
123 Ga0070674_100096591 3300005356 Bacteria 2144
124 Ga0070674_100169478 3300005356 Bacteria 1663
125 Ga0070673_100050203 3300005364 Bacteria 3261
126 Ga0070673_100257204 3300005364 Bacteria 1524
127 Ga0070659_100000052 3300005366 Bacteria 96862
128 Ga0070659_100004887 3300005366 Bacteria 9579
129 Ga0070667_100000150 3300005367 Bacteria 86639
130 Ga0070667_100034011 3300005367 Bacteria 4264
131 Ga0070667_100075009 3300005367 Bacteria 2887
132 Ga0070667_100087613 3300005367 Bacteria 2672
133 Ga0070667_100276494 3300005367 Bacteria 1507
134 Ga0070667_100305366 3300005367 Bacteria 1433
135 Ga0070667_100348682 3300005367 Bacteria 1340
136 Ga0070667_100454628 3300005367 Bacteria 1170
137 Ga0070667_100831502 3300005367 Bacteria 858
138 Ga0070667_100973834 3300005367 Bacteria 791
139 Ga0070714_100000393 3300005435 Bacteria 32554
140 Ga0070714_100000605 3300005435 Bacteria 25685
141 Ga0070713_100061037 3300005436 Bacteria 3154
142 Ga0070711_100095752 3300005439 Bacteria 2149
143 Ga0070711_100385734 3300005439 Bacteria 1134
144 Ga0070694_101277709 3300005444 Bacteria 617
145 Ga0070708_100139302 3300005445 Bacteria 2249
146 Ga0070663_100000029 3300005455 Bacteria 82128
147 Ga0070663_100021862 3300005455 Bacteria 4263
148 Ga0070663_100037071 3300005455 Bacteria 3392
149 Ga0070663_100172190 3300005455 Bacteria 1674
150 Ga0070663_100240101 3300005455 Bacteria 1430
151 Ga0070663_100289513 3300005455 Bacteria 1308
152 Ga0070663_100737947 3300005455 Bacteria 840
153 Ga0070663_101065424 3300005455 Bacteria 705
154 Ga0070678_100041709 3300005456 Bacteria 3256
155 Ga0070678_100127460 3300005456 Bacteria 2017
156 Ga0070678_100149741 3300005456 Bacteria 1878
157 Ga0070678_100157470 3300005456 Unclassified 1836
158 Ga0070662_100021500 3300005457 Bacteria 4406
159 Ga0070662_100549394 3300005457 Bacteria 968
160 Ga0070662_100844592 3300005457 Bacteria 780
161 Ga0070681_10028025 3300005458 Bacteria 5661
162 Ga0070681_10046264 3300005458 Bacteria 4351
163 Ga0070681_10074465 3300005458 Bacteria 3356
164 Ga0070681_10352224 3300005458 Bacteria 1383
165 Ga0070681_10537320 3300005458 Bacteria 1083
166 Ga0070681_10959932 3300005458 Bacteria 774
167 Ga0068867_100012849 3300005459 Bacteria 5926
168 Ga0068867_101047542 3300005459 Bacteria 742
169 Ga0070685_10000832 3300005466 Bacteria 16796
170 Ga0070685_10098205 3300005466 Bacteria 1784
171 Ga0070679_100323628 3300005530 Bacteria 1491
172 Ga0070679_100338414 3300005530 Bacteria 1453
173 Ga0070679_100354016 3300005530 Bacteria 1416
174 Ga0070679_100378948 3300005530 Bacteria 1361
175 Ga0070679_100494921 3300005530 Bacteria 1167
176 Ga0070679_100677980 3300005530 Bacteria 973
177 Ga0070684_100194805 3300005535 Bacteria 1845
178 Ga0070684_100555778 3300005535 Bacteria 1065
179 Ga0068853_100002537 3300005539 Bacteria 13707
180 Ga0068853_100002647 3300005539 Bacteria 13496
181 Ga0068853_100027321 3300005539 Bacteria 4794
182 Ga0068853_100035136 3300005539 Bacteria 4256
183 Ga0068853_100035959 3300005539 Bacteria 4209
184 Ga0068853_100054340 3300005539 Bacteria 3451
185 Ga0068853_100120542 3300005539 Bacteria 2339
186 Ga0068853_100139422 3300005539 Bacteria 2176
187 Ga0068853_100406214 3300005539 Bacteria 1275
188 Ga0068853_100436905 3300005539 Bacteria 1229
189 Ga0068853_100442893 3300005539 Bacteria 1221
190 Ga0068853_100599738 3300005539 Bacteria 1046
191 Ga0068853_100600373 3300005539 Bacteria 1045
192 Ga0070672_100013517 3300005543 Bacteria 5770
193 Ga0070672_100167090 3300005543 Bacteria 1828
194 Ga0070672_100480680 3300005543 Bacteria 1073
195 Ga0070672_100597666 3300005543 Bacteria 961
196 Ga0070696_100006208 3300005546 Bacteria 7994
197 Ga0070696_100031859 3300005546 Bacteria 3615
198 Ga0070696_100641700 3300005546 Bacteria 860
199 Ga0070696_100736094 3300005546 Bacteria 807
200 Ga0070693_100005217 3300005547 Bacteria 6217
201 Ga0070693_100088297 3300005547 Bacteria 1864
202 Ga0070693_100164722 3300005547 Bacteria 1415
203 Ga0070693_100331569 3300005547 Bacteria 1036
204 Ga0070693_100446041 3300005547 Bacteria 907
205 Ga0070665_100000026 3300005548 Bacteria 365176
206 Ga0070665_100001464 3300005548 Bacteria 27669
207 Ga0070665_100004807 3300005548 Bacteria 14040
208 Ga0070665_100020504 3300005548 Bacteria 6639
209 Ga0070665_100084135 3300005548 Bacteria 3186
210 Ga0070665_100242107 3300005548 Bacteria 1804
211 Ga0070665_100585482 3300005548 Bacteria 1129
212 Ga0070665_100710045 3300005548 Bacteria 1018
213 Ga0070665_101291684 3300005548 Bacteria 740
214 Ga0068855_100000696 3300005563 Bacteria 41094
215 Ga0068855_100010588 3300005563 Bacteria 11117
216 Ga0068855_100057884 3300005563 Bacteria 4542
217 Ga0068855_100057944 3300005563 Bacteria 4539
218 Ga0068855_100176858 3300005563 Bacteria 2414
219 Ga0068855_100177473 3300005563 Bacteria 2409
220 Ga0068855_100431851 3300005563 Bacteria 1440
221 Ga0068855_100538940 3300005563 Bacteria 1265
222 Ga0068855_100690164 3300005563 Bacteria 1093
223 Ga0068855_100698421 3300005563 Bacteria 1086
224 Ga0068855_100740982 3300005563 Bacteria 1048
225 Ga0068855_100818438 3300005563 Bacteria 989
226 Ga0068855_101124889 3300005563 Bacteria 820
227 Ga0068855_101256879 3300005563 Bacteria 768
228 Ga0070664_100085989 3300005564 Bacteria 2717
229 Ga0070664_100177381 3300005564 Bacteria 1892
230 Ga0070664_100184175 3300005564 Bacteria 1858
231 Ga0070664_100292013 3300005564 Bacteria 1472
232 Ga0068857_100014664 3300005577 Bacteria 6836
233 Ga0068857_100041837 3300005577 Bacteria 4063
234 Ga0068857_100164117 3300005577 Bacteria 2016
235 Ga0068857_100230568 3300005577 Bacteria 1693
236 Ga0068857_100300958 3300005577 Bacteria 1478
237 Ga0068857_100426015 3300005577 Bacteria 1238
238 Ga0068857_100661245 3300005577 Bacteria 991
239 Ga0068857_100700902 3300005577 Bacteria 962
240 Ga0068854_100000282 3300005578 Bacteria 34044
241 Ga0068854_100006540 3300005578 Bacteria 7417
242 Ga0068854_100006900 3300005578 Bacteria 7243
243 Ga0068854_100051750 3300005578 Bacteria 2943
244 Ga0068854_100104414 3300005578 Bacteria 2129
245 Ga0068854_100202049 3300005578 Bacteria 1563
246 Ga0068856_100000022 3300005614 Bacteria 142768
247 Ga0068856_100013211 3300005614 Bacteria 7997
248 Ga0068856_100036502 3300005614 Bacteria 4818
249 Ga0068856_100119510 3300005614 Bacteria 2636
250 Ga0068856_100164207 3300005614 Bacteria 2231
251 Ga0068856_100191212 3300005614 Bacteria 2060
252 Ga0068856_101036380 3300005614 Bacteria 838
253 Ga0068852_100006662 3300005616 Bacteria 8370
254 Ga0068852_100071081 3300005616 Bacteria 3055
255 Ga0068852_100081782 3300005616 Bacteria 2868
256 Ga0068852_100176951 3300005616 Bacteria 2004
257 Ga0068852_100373403 3300005616 Bacteria 1397
258 Ga0068852_100393746 3300005616 Bacteria 1361
259 Ga0068852_100542980 3300005616 Bacteria 1162
260 Ga0068852_100569515 3300005616 Bacteria 1134
261 Ga0068852_100716187 3300005616 Bacteria 1011
262 Ga0068852_101337712 3300005616 Bacteria 738
263 Ga0068859_100001840 3300005617 Bacteria 21596
264 Ga0068859_101588311 3300005617 Bacteria 722
265 Ga0068864_100014730 3300005618 Bacteria 6495
266 Ga0068864_100112829 3300005618 Bacteria 2423
267 Ga0068864_100177450 3300005618 Bacteria 1946
268 Ga0068864_100874382 3300005618 Bacteria 887
269 Ga0068861_100087634 3300005719 Bacteria 2450
270 Ga0068861_100755419 3300005719 Bacteria 909
271 Ga0068861_100939318 3300005719 Bacteria 822
272 Ga0068851_10006767 3300005834 Bacteria 5246
273 Ga0068851_10011459 3300005834 Bacteria 4159
274 Ga0068851_10021594 3300005834 Bacteria 3125
275 Ga0068851_10036620 3300005834 Bacteria 2457
276 Ga0068851_10059334 3300005834 Bacteria 1957
277 Ga0068870_10051228 3300005840 Bacteria 2185
278 Ga0068863_100004653 3300005841 Bacteria 13528
279 Ga0068863_100005490 3300005841 Bacteria 12479
280 Ga0068863_100014974 3300005841 Bacteria 7449
281 Ga0068863_100050734 3300005841 Bacteria 3932
282 Ga0068863_100098184 3300005841 Bacteria 2781
283 Ga0068863_100624224 3300005841 Bacteria 1068
284 Ga0068863_100818070 3300005841 Bacteria 929
285 Ga0068863_101260885 3300005841 Bacteria 745
286 Ga0068858_100001617 3300005842 Bacteria 22975
287 Ga0068858_100151636 3300005842 Bacteria 2180
288 Ga0068858_100260609 3300005842 Bacteria 1648
289 Ga0068858_100304790 3300005842 Bacteria 1520
290 Ga0068858_100509095 3300005842 Bacteria 1163
291 Ga0068858_100567874 3300005842 Bacteria 1099
292 Ga0068858_100622788 3300005842 Bacteria 1048
293 Ga0068860_100025971 3300005843 Bacteria 5650
294 Ga0068860_100031104 3300005843 Bacteria 5132
295 Ga0068860_100108654 3300005843 Bacteria 2651
296 Ga0068860_100708139 3300005843 Bacteria 1017
297 Ga0068860_100926207 3300005843 Bacteria 888
298 Ga0068860_101226300 3300005843 Bacteria 770
299 Ga0068862_100000185 3300005844 Bacteria 68550
300 Ga0068862_100175378 3300005844 Bacteria 1921
301 Ga0081455_10296262 3300005937 Bacteria 1162
302 Ga0075364_10015606 3300006051 Bacteria 4713
303 Ga0070715_10095572 3300006163 Bacteria 1376
304 Ga0070712_100398115 3300006175 Bacteria 1137
305 Ga0075369_10187921 3300006186 Bacteria 951
306 Ga0075366_10016389 3300006195 Bacteria 4258
307 Ga0097621_100019859 3300006237 Bacteria 5168
308 Ga0097621_100021471 3300006237 Bacteria 4995
309 Ga0097621_100038212 3300006237 Bacteria 3852
310 Ga0097621_100133587 3300006237 Bacteria 2114
311 Ga0097621_100167732 3300006237 Bacteria 1891
312 Ga0097621_100483758 3300006237 Bacteria 1119
313 Ga0097621_101517032 3300006237 Bacteria 636
314 Ga0068871_100059368 3300006358 Bacteria 3116
315 Ga0068871_100064765 3300006358 Bacteria 2992
316 Ga0068871_100119581 3300006358 Bacteria 2224
317 Ga0068871_100236037 3300006358 Bacteria 1588
318 Ga0068871_100254438 3300006358 Bacteria 1531
319 Ga0068871_100825699 3300006358 Bacteria 856
320 Ga0075428_100116793 3300006844 Bacteria 2906
321 Ga0075428_100371580 3300006844 Bacteria 1533
322 Ga0075429_100333234 3300006880 Bacteria 1328
323 Ga0068865_100013181 3300006881 Bacteria 5218
324 Ga0068865_100096192 3300006881 Bacteria 2159
325 Ga0068865_100131071 3300006881 Bacteria 1879
326 Ga0068865_100208584 3300006881 Bacteria 1521
327 Ga0097620_100001840 3300006931 Bacteria 21596
328 Ga0097620_101588824 3300006931 Bacteria 722
329 Ga0105250_10226338 3300009092 Bacteria 794
330 Ga0105240_10000359 3300009093 Bacteria 85874
331 Ga0105240_10000633 3300009093 Bacteria 64950
332 Ga0105240_10002007 3300009093 Bacteria 33570
333 Ga0105240_10007977 3300009093 Bacteria 15268
334 Ga0105240_10009334 3300009093 Bacteria 13905
335 Ga0105240_10013427 3300009093 Bacteria 11248
336 Ga0105240_10022190 3300009093 Bacteria 8422
337 Ga0105240_10050541 3300009093 Bacteria 5240
338 Ga0105240_10074426 3300009093 Bacteria 4192
339 Ga0105240_10209967 3300009093 Bacteria 2276
340 Ga0105240_10884759 3300009093 Bacteria 962
341 Ga0105245_10377566 3300009098 Bacteria 1411
342 Ga0105245_10788223 3300009098 Bacteria 988
343 Ga0105245_10947848 3300009098 Bacteria 903
344 Ga0105245_11070398 3300009098 Bacteria 852
345 Ga0114129_10035130 3300009147 Bacteria 7082
346 Ga0105243_10073372 3300009148 Bacteria 2773
347 Ga0105241_10008871 3300009174 Bacteria 7395
348 Ga0105241_10037744 3300009174 Bacteria 3639
349 Ga0105241_10046045 3300009174 Bacteria 3312
350 Ga0105241_10064718 3300009174 Bacteria 2824
351 Ga0105241_10214683 3300009174 Bacteria 1614
352 Ga0105241_10251234 3300009174 Bacteria 1499
353 Ga0105241_10857754 3300009174 Bacteria 840
354 Ga0105241_11254522 3300009174 Bacteria 704
355 Ga0105242_10002842 3300009176 Bacteria 13567
356 Ga0105242_10041120 3300009176 Bacteria 3727
357 Ga0105242_10593268 3300009176 Bacteria 1069
358 Ga0105242_10722576 3300009176 Bacteria 977
359 Ga0105248_10000246 3300009177 Bacteria 62735
360 Ga0105248_10044683 3300009177 Bacteria 4968
361 Ga0105248_10096662 3300009177 Bacteria 3327
362 Ga0105248_10466046 3300009177 Bacteria 1424
363 Ga0105248_10843250 3300009177 Bacteria 1034
364 Ga0105248_10941610 3300009177 Bacteria 975
365 Ga0105248_11019248 3300009177 Bacteria 935
366 Ga0105237_10000148 3300009545 Bacteria 98986
367 Ga0105237_10000231 3300009545 Bacteria 79368
368 Ga0105237_10000383 3300009545 Bacteria 63065
369 Ga0105237_10004315 3300009545 Bacteria 16486
370 Ga0105237_10128389 3300009545 Bacteria 2529
371 Ga0105237_10144331 3300009545 Bacteria 2375
372 Ga0105237_10173267 3300009545 Bacteria 2158
373 Ga0105237_10345613 3300009545 Bacteria 1492
374 Ga0105237_10413818 3300009545 Bacteria 1353
375 Ga0105237_10479787 3300009545 Bacteria 1250
376 Ga0105237_10544780 3300009545 Bacteria 1167
377 Ga0105237_10709464 3300009545 Bacteria 1012
378 Ga0105238_10000044 3300009551 Bacteria 151485
379 Ga0105238_10007919 3300009551 Bacteria 10634
380 Ga0105238_10010855 3300009551 Bacteria 9155
381 Ga0105238_10034862 3300009551 Bacteria 5119
382 Ga0105238_10049939 3300009551 Bacteria 4211
383 Ga0105238_10097896 3300009551 Bacteria 2918
384 Ga0105238_10202715 3300009551 Bacteria 1960
385 Ga0105238_10217876 3300009551 Bacteria 1885
386 Ga0105238_10333048 3300009551 Bacteria 1505
387 Ga0105238_10538112 3300009551 Bacteria 1172
388 Ga0105238_10733790 3300009551 Bacteria 1001
389 Ga0105249_10001225 3300009553 Bacteria 22566
390 Ga0105249_10027305 3300009553 Bacteria 5151
391 Ga0105249_10380955 3300009553 Bacteria 1436
392 Ga0105148_100676 3300009978 Bacteria 2682
393 Ga0105029_100269 3300009984 Bacteria 2698
394 Ga0105239_10000033 3300010375 Bacteria 223933
395 Ga0105239_10003454 3300010375 Bacteria 19337
396 Ga0105239_10009780 3300010375 Bacteria 10778
397 Ga0105239_10014339 3300010375 Bacteria 8793
398 Ga0105239_10021477 3300010375 Bacteria 7117
399 Ga0105239_10026779 3300010375 Bacteria 6346
400 Ga0105239_10121007 3300010375 Bacteria 2907
401 Ga0105239_10152397 3300010375 Bacteria 2580
402 Ga0105239_10157972 3300010375 Bacteria 2533
403 Ga0105239_10256728 3300010375 Bacteria 1964
404 Ga0105239_10286830 3300010375 Bacteria 1854
405 Ga0105239_10660194 3300010375 Bacteria 1195
406 Ga0105239_10699703 3300010375 Bacteria 1159
407 Ga0105239_11489580 3300010375 Bacteria 782
408 Ga0105246_10009566 3300011119 Bacteria 5972
409 Ga0157318_1000739 3300012482 Bacteria 1497
410 Ga0157314_1000098 3300012500 Bacteria 9231
411 Ga0157314_1001103 3300012500 Bacteria 2022
412 Ga0157326_1021775 3300012513 Bacteria 796
413 Ga0157373_10034519 3300013100 Bacteria 3632
414 Ga0157373_10048721 3300013100 Bacteria 3021
415 Ga0157371_10021671 3300013102 Bacteria 4715
416 Ga0157370_10000495 3300013104 Bacteria 48993
417 Ga0157370_10002719 3300013104 Bacteria 21150
418 Ga0157370_10004280 3300013104 Bacteria 16440
419 Ga0157370_10070640 3300013104 Bacteria 3296
420 Ga0157370_10095746 3300013104 Bacteria 2785
421 Ga0157370_10099538 3300013104 Bacteria 2725
422 Ga0157370_10121328 3300013104 Bacteria 2440
423 Ga0157370_10123802 3300013104 Bacteria 2414
424 Ga0157370_10133349 3300013104 Bacteria 2316
425 Ga0157370_10168588 3300013104 Bacteria 2036
426 Ga0157370_10189039 3300013104 Bacteria 1912
427 Ga0157370_10253027 3300013104 Bacteria 1629
428 Ga0157370_10444388 3300013104 Bacteria 1192
429 Ga0157370_10535365 3300013104 Bacteria 1074
430 Ga0157370_11027177 3300013104 Bacteria 746
431 Ga0157370_11101015 3300013104 Bacteria 718
432 Ga0157369_10000464 3300013105 Bacteria 53767
433 Ga0157369_10005929 3300013105 Bacteria 14190
434 Ga0157369_10031464 3300013105 Bacteria 5842
435 Ga0157369_10262059 3300013105 Bacteria 1803
436 Ga0157369_10281052 3300013105 Bacteria 1733
437 Ga0157369_10778324 3300013105 Bacteria 984
438 Ga0157369_10976478 3300013105 Bacteria 868
439 Ga0157374_10066420 3300013296 Bacteria 3389
440 Ga0157374_10130567 3300013296 Bacteria 2431
441 Ga0157374_10474783 3300013296 Bacteria 1253
442 Ga0157378_10001405 3300013297 Bacteria 21654
443 Ga0157378_10691065 3300013297 Bacteria 1039
444 Ga0157378_11048265 3300013297 Bacteria 851
445 Ga0163162_10000021 3300013306 Bacteria 214873
446 Ga0163162_10000193 3300013306 Bacteria 56063
447 Ga0163162_10002029 3300013306 Bacteria 19053
448 Ga0163162_10064563 3300013306 Bacteria 3706
449 Ga0163162_10069740 3300013306 Bacteria 3567
450 Ga0163162_10153910 3300013306 Bacteria 2418
451 Ga0163162_10449684 3300013306 Bacteria 1420
452 Ga0163162_10638951 3300013306 Bacteria 1188
453 Ga0157372_10011884 3300013307 Bacteria 9277
454 Ga0157372_10014982 3300013307 Bacteria 8297
455 Ga0157372_10052222 3300013307 Bacteria 4551
456 Ga0157372_10064309 3300013307 Bacteria 4116
457 Ga0157372_10167991 3300013307 Bacteria 2537
458 Ga0157372_10186027 3300013307 Bacteria 2405
459 Ga0157372_10299531 3300013307 Bacteria 1870
460 Ga0157372_10423863 3300013307 Bacteria 1551
461 Ga0157372_10444901 3300013307 Bacteria 1510
462 Ga0157372_10704796 3300013307 Bacteria 1175
463 Ga0157372_10889204 3300013307 Bacteria 1034
464 Ga0157372_10892887 3300013307 Bacteria 1031
465 Ga0157372_11088308 3300013307 Bacteria 925
466 Ga0157372_11158308 3300013307 Bacteria 894
467 Ga0157372_12292690 3300013307 Bacteria 620
468 Ga0157375_10000950 3300013308 Bacteria 25099
469 Ga0157375_10016908 3300013308 Bacteria 6570
470 Ga0157375_10050059 3300013308 Bacteria 4097
471 Ga0157375_10122204 3300013308 Bacteria 2715
472 Ga0163163_10000403 3300014325 Bacteria 40776
473 Ga0163163_10006152 3300014325 Bacteria 10460
474 Ga0163163_10113006 3300014325 Bacteria 2745
475 Ga0163163_10284699 3300014325 Bacteria 1705
476 Ga0157380_10082842 3300014326 Bacteria 2626
477 Ga0182008_10000209 3300014497 Bacteria 46251
478 Ga0182008_10030065 3300014497 Bacteria 2740
479 Ga0182008_10032240 3300014497 Bacteria 2633
480 Ga0182008_10046665 3300014497 Bacteria 2153
481 Ga0157379_10003888 3300014968 Bacteria 12730
482 Ga0157379_10202302 3300014968 Bacteria 1796
483 Ga0157379_10208706 3300014968 Bacteria 1767
484 Ga0157376_10006685 3300014969 Bacteria 8162
485 Ga0157376_10017225 3300014969 Bacteria 5505
486 Ga0157376_10019219 3300014969 Bacteria 5260
487 Ga0157376_10107390 3300014969 Bacteria 2450
488 Ga0157376_10124715 3300014969 Bacteria 2288
489 Ga0157376_10334337 3300014969 Bacteria 1444
490 Ga0182006_1000034 3300015261 Bacteria 232484
491 Ga0182006_1007770 3300015261 Bacteria 4890
492 Ga0182006_1032677 3300015261 Bacteria 2089
493 Ga0182006_1047053 3300015261 Bacteria 1674
494 Ga0182007_10001346 3300015262 Bacteria 13262
495 Ga0182007_10005029 3300015262 Bacteria 5871
496 Ga0182007_10052110 3300015262 Bacteria 1349
497 Ga0182007_10067388 3300015262 Bacteria 1172
498 Ga0182007_10090807 3300015262 Bacteria 1006
499 Ga0182005_1000064 3300015265 Bacteria 95976
500 Ga0182005_1002932 3300015265 Bacteria 5921
501 Ga0182005_1016840 3300015265 Bacteria 2028
502 Ga0183369_1003 3300015685 Bacteria 726443
503 Ga0183368_1002 3300015687 Bacteria 1865598
504 Ga0163161_10001385 3300017792 Bacteria 17927
505 Ga0163161_10012090 3300017792 Bacteria 5987
506 Ga0163161_10038479 3300017792 Bacteria 3431
507 Ga0206353_10771426 3300020082 Bacteria 2282
508 Ga0154015_1053000 3300020610 Bacteria 2405
509 Ga0213875_10120439 3300021388 Bacteria 1226
510 Ga0224712_10075440 3300022467 Bacteria 1379
511 Ga0209435_108278 3300025206 Bacteria 1146
512 Ga0209760_100294 3300025207 Bacteria 17371
513 Ga0209784_100042 3300025224 Bacteria 218070
514 Ga0209674_100033 3300025226 Bacteria 423450
515 Ga0209674_100441 3300025226 Bacteria 19236
516 Ga0209674_101207 3300025226 Bacteria 7354
517 Ga0209674_103716 3300025226 Bacteria 2714
518 Ga0209672_100004 3300025228 Bacteria 1467504
519 Ga0209672_100008 3300025228 Bacteria 946876
520 Ga0209672_100916 3300025228 Bacteria 13362
521 Ga0209672_102162 3300025228 Bacteria 5180
522 Ga0209563_100036 3300025230 Bacteria 448275
523 Ga0207427_100037 3300025231 Bacteria 303108
524 Ga0207427_100049 3300025231 Bacteria 237504
525 Ga0207427_100078 3300025231 Bacteria 147526
526 Ga0207427_100096 3300025231 Bacteria 123398
527 Ga0207427_105412 3300025231 Bacteria 1806
528 Ga0209437_100074 3300025233 Bacteria 300858
529 Ga0209437_100083 3300025233 Bacteria 256005
530 Ga0209437_100090 3300025233 Bacteria 247138
531 Ga0209437_100157 3300025233 Bacteria 151821
532 Ga0209437_100691 3300025233 Bacteria 17825
533 Ga0209437_100872 3300025233 Bacteria 12437
534 Ga0209437_101965 3300025233 Bacteria 4257
535 Ga0209437_104672 3300025233 Bacteria 2387
536 Ga0209258_100003 3300025242 Bacteria 1467504
537 Ga0209258_100004 3300025242 Bacteria 1376422
538 Ga0209258_100008 3300025242 Bacteria 1009355
539 Ga0209258_100136 3300025242 Bacteria 169078
540 Ga0209258_101400 3300025242 Bacteria 8612
541 Ga0209258_110007 3300025242 Bacteria 1248
542 Ga0209646_1000863 3300025246 Bacteria 10119
543 Ga0209646_1012353 3300025246 Bacteria 1311
544 Ga0209026_1000045 3300025250 Bacteria 263431
545 Ga0209026_1000072 3300025250 Bacteria 205447
546 Ga0209026_1000129 3300025250 Bacteria 121927
547 Ga0209026_1000153 3300025250 Bacteria 109259
548 Ga0209026_1000442 3300025250 Bacteria 33393
549 Ga0209026_1016918 3300025250 Bacteria 1173
550 Ga0209026_1021965 3300025250 Bacteria 981
551 Ga0209677_100348 3300025253 Bacteria 28879
552 Ga0209148_1000025 3300025254 Bacteria 663262
553 Ga0209148_1000036 3300025254 Bacteria 530505
554 Ga0209148_1000053 3300025254 Bacteria 373506
555 Ga0209148_1000791 3300025254 Bacteria 23435
556 Ga0209759_1000140 3300025256 Bacteria 124850
557 Ga0209759_1000831 3300025256 Bacteria 24394
558 Ga0209759_1002615 3300025256 Bacteria 7765
559 Ga0209759_1003821 3300025256 Bacteria 5846
560 Ga0209129_1000604 3300025258 Bacteria 24333
561 Ga0209129_1002103 3300025258 Bacteria 10163
562 Ga0209233_1000040 3300025261 Bacteria 530395
563 Ga0209233_1000075 3300025261 Bacteria 356837
564 Ga0209233_1000077 3300025261 Bacteria 349570
565 Ga0209233_1000096 3300025261 Bacteria 303482
566 Ga0209233_1003582 3300025261 Bacteria 5450
567 Ga0209233_1028224 3300025261 Bacteria 1349
568 Ga0209455_1000004 3300025272 Bacteria 1467504
569 Ga0209455_1000007 3300025272 Bacteria 1157983
570 Ga0209455_1000071 3300025272 Bacteria 300858
571 Ga0209455_1000215 3300025272 Bacteria 81196
572 Ga0209455_1013624 3300025272 Bacteria 1878
573 Ga0209673_1003811 3300025273 Bacteria 8549
574 Ga0209130_1007509 3300025284 Bacteria 3353
575 Ga0209675_1014295 3300025291 Bacteria 2423
576 Ga0209675_1017692 3300025291 Bacteria 2026
577 Ga0209676_1001264 3300025292 Bacteria 26303
578 Ga0209676_1002621 3300025292 Bacteria 12291
579 Ga0209676_1007907 3300025292 Bacteria 4874
580 Ga0209676_1008848 3300025292 Bacteria 4429
581 Ga0209676_1036126 3300025292 Bacteria 1441
582 Ga0209025_1001373 3300025294 Bacteria 32662
583 Ga0209025_1034165 3300025294 Bacteria 2330
584 Ga0209025_1050506 3300025294 Bacteria 1662
585 Ga0209025_1053805 3300025294 Bacteria 1575
586 Ga0209025_1055046 3300025294 Bacteria 1542
587 Ga0209564_1009685 3300025295 Bacteria 4544
588 Ga0209758_1000481 3300025297 Bacteria 65650
589 Ga0209758_1058569 3300025297 Bacteria 1287
590 Ga0209758_1061354 3300025297 Bacteria 1239
591 Ga0209050_1001626 3300025298 Bacteria 23042
592 Ga0209256_1001873 3300025299 Bacteria 19411
593 Ga0209256_1002659 3300025299 Bacteria 14029
594 Ga0209256_1010555 3300025299 Bacteria 3844
595 Ga0209256_1011879 3300025299 Bacteria 3418
596 Ga0209051_1005661 3300025303 Bacteria 7227
597 Ga0209257_1000274 3300025304 Bacteria 117076
598 Ga0209257_1000307 3300025304 Bacteria 105179
599 Ga0209257_1002641 3300025304 Bacteria 17251
600 Ga0209257_1007987 3300025304 Bacteria 6183
601 Ga0207656_10004823 3300025321 Bacteria 4734
602 Ga0207656_10411102 3300025321 Bacteria 681
603 Ga0207692_10191756 3300025898 Bacteria 1196
604 Ga0207710_10028650 3300025900 Bacteria 2418
605 Ga0207680_10000002 3300025903 Bacteria 1018646
606 Ga0207680_10000092 3300025903 Bacteria 41687
607 Ga0207680_10034939 3300025903 Bacteria 2880
608 Ga0207680_10037462 3300025903 Bacteria 2800
609 Ga0207680_10095683 3300025903 Bacteria 1898
610 Ga0207647_10000010 3300025904 Bacteria 174219
611 Ga0207647_10000066 3300025904 Bacteria 81782
612 Ga0207647_10004970 3300025904 Bacteria 9802
613 Ga0207647_10006265 3300025904 Bacteria 8664
614 Ga0207647_10010431 3300025904 Bacteria 6563
615 Ga0207647_10012093 3300025904 Bacteria 6023
616 Ga0207685_10072312 3300025905 Bacteria 1401
617 Ga0207699_10505620 3300025906 Bacteria 873
618 Ga0207645_10043108 3300025907 Bacteria 2887
619 Ga0207645_10096932 3300025907 Bacteria 1900
620 Ga0207643_10008509 3300025908 Bacteria 5503
621 Ga0207705_10001094 3300025909 Bacteria 22061
622 Ga0207705_10035118 3300025909 Bacteria 3586
623 Ga0207705_10039069 3300025909 Bacteria 3401
624 Ga0207705_10238245 3300025909 Bacteria 1385
625 Ga0207705_10303490 3300025909 Bacteria 1225
626 Ga0207654_10001128 3300025911 Bacteria 14430
627 Ga0207654_10181410 3300025911 Bacteria 1374
628 Ga0207654_10229994 3300025911 Bacteria 1234
629 Ga0207654_10733376 3300025911 Bacteria 711
630 Ga0207654_10766565 3300025911 Bacteria 696
631 Ga0207707_10010148 3300025912 Bacteria 8173
632 Ga0207707_10057230 3300025912 Bacteria 3394
633 Ga0207707_10129717 3300025912 Bacteria 2205
634 Ga0207707_10292260 3300025912 Bacteria 1410
635 Ga0207707_10296316 3300025912 Bacteria 1399
636 Ga0207695_10000014 3300025913 Bacteria 812599
637 Ga0207695_10000322 3300025913 Bacteria 114700
638 Ga0207695_10000809 3300025913 Bacteria 58219
639 Ga0207695_10000856 3300025913 Bacteria 55795
640 Ga0207695_10005750 3300025913 Bacteria 16327
641 Ga0207695_10006442 3300025913 Bacteria 15244
642 Ga0207695_10008494 3300025913 Bacteria 12841
643 Ga0207695_10032475 3300025913 Bacteria 5711
644 Ga0207695_10046519 3300025913 Bacteria 4599
645 Ga0207695_10069276 3300025913 Bacteria 3610
646 Ga0207695_10366560 3300025913 Bacteria 1327
647 Ga0207695_11306862 3300025913 Bacteria 606
648 Ga0207671_10000028 3300025914 Bacteria 263092
649 Ga0207671_10000357 3300025914 Bacteria 65092
650 Ga0207671_10001588 3300025914 Bacteria 25826
651 Ga0207671_10004399 3300025914 Bacteria 13503
652 Ga0207671_10318069 3300025914 Bacteria 1231
653 Ga0207671_10458907 3300025914 Bacteria 1015
654 Ga0207663_10264346 3300025916 Bacteria 1272
655 Ga0207663_10308392 3300025916 Bacteria 1185
656 Ga0207660_10097251 3300025917 Bacteria 2193
657 Ga0207660_10263573 3300025917 Bacteria 1363
658 Ga0207660_10390745 3300025917 Bacteria 1119
659 Ga0207657_10009521 3300025919 Bacteria 9756
660 Ga0207657_10011833 3300025919 Bacteria 8637
661 Ga0207657_10042168 3300025919 Bacteria 4028
662 Ga0207657_10335228 3300025919 Bacteria 1194
663 Ga0207657_10861449 3300025919 Bacteria 699
664 Ga0207649_10002084 3300025920 Bacteria 11361
665 Ga0207649_10032583 3300025920 Bacteria 3108
666 Ga0207649_10033209 3300025920 Bacteria 3081
667 Ga0207649_10197571 3300025920 Bacteria 1418
668 Ga0207649_10424825 3300025920 Bacteria 999
669 Ga0207652_10165752 3300025921 Bacteria 1981
670 Ga0207652_10218605 3300025921 Bacteria 1717
671 Ga0207652_10297561 3300025921 Bacteria 1456
672 Ga0207652_10342189 3300025921 Bacteria 1350
673 Ga0207681_10001858 3300025923 Bacteria 13543
674 Ga0207681_10007276 3300025923 Bacteria 6785
675 Ga0207681_10033681 3300025923 Bacteria 3361
676 Ga0207681_10503930 3300025923 Bacteria 991
677 Ga0207694_10000109 3300025924 Bacteria 86216
678 Ga0207694_10000850 3300025924 Bacteria 27165
679 Ga0207694_10001341 3300025924 Bacteria 21199
680 Ga0207694_10097782 3300025924 Bacteria 2323
681 Ga0207694_10140943 3300025924 Bacteria 1938
682 Ga0207694_10185078 3300025924 Bacteria 1690
683 Ga0207694_10269754 3300025924 Bacteria 1396
684 Ga0207650_10021916 3300025925 Bacteria 4521
685 Ga0207650_10229804 3300025925 Bacteria 1496
686 Ga0207659_10373732 3300025926 Bacteria 1187
687 Ga0207687_10344965 3300025927 Bacteria 1212
688 Ga0207687_10554219 3300025927 Bacteria 965
689 Ga0207687_11142225 3300025927 Bacteria 669
690 Ga0207664_10000553 3300025929 Bacteria 26494
691 Ga0207664_10000624 3300025929 Bacteria 24530
692 Ga0207644_10166416 3300025931 Bacteria 1718
693 Ga0207644_10174658 3300025931 Bacteria 1680
694 Ga0207644_10556744 3300025931 Bacteria 949
695 Ga0207690_10000061 3300025932 Bacteria 98910
696 Ga0207690_10000375 3300025932 Bacteria 29631
697 Ga0207690_10006084 3300025932 Bacteria 7149
698 Ga0207690_10030475 3300025932 Bacteria 3441
699 Ga0207690_10145847 3300025932 Bacteria 1750
700 Ga0207706_10042475 3300025933 Bacteria 4029
701 Ga0207706_10049684 3300025933 Bacteria 3706
702 Ga0207686_10003423 3300025934 Bacteria 8519
703 Ga0207709_10005775 3300025935 Bacteria 6992
704 Ga0207670_10001621 3300025936 Bacteria 11738
705 Ga0207670_10446551 3300025936 Bacteria 1042
706 Ga0207670_10758146 3300025936 Bacteria 806
707 Ga0207704_10010792 3300025938 Bacteria 4471
708 Ga0207704_10032219 3300025938 Bacteria 2964
709 Ga0207704_10069820 3300025938 Bacteria 2222
710 Ga0207704_10078000 3300025938 Bacteria 2129
711 Ga0207704_10090427 3300025938 Bacteria 2009
712 Ga0207691_10007374 3300025940 Bacteria 10598
713 Ga0207691_10028648 3300025940 Bacteria 5213
714 Ga0207691_10082771 3300025940 Bacteria 2882
715 Ga0207691_10166529 3300025940 Bacteria 1931
716 Ga0207711_10002283 3300025941 Bacteria 17214
717 Ga0207711_10160406 3300025941 Bacteria 2035
718 Ga0207711_10226669 3300025941 Bacteria 1711
719 Ga0207711_10438985 3300025941 Bacteria 1215
720 Ga0207711_10896166 3300025941 Bacteria 825
721 Ga0207689_10070324 3300025942 Bacteria 2875
722 Ga0207689_10237908 3300025942 Bacteria 1505
723 Ga0207689_10322233 3300025942 Bacteria 1283
724 Ga0207689_10453363 3300025942 Bacteria 1072
725 Ga0207661_10258427 3300025944 Bacteria 1550
726 Ga0207667_10000080 3300025949 Bacteria 163287
727 Ga0207667_10000344 3300025949 Bacteria 63681
728 Ga0207667_10056069 3300025949 Bacteria 4140
729 Ga0207667_10092352 3300025949 Bacteria 3126
730 Ga0207667_10092784 3300025949 Bacteria 3118
731 Ga0207667_10186083 3300025949 Bacteria 2132
732 Ga0207667_10206622 3300025949 Bacteria 2013
733 Ga0207667_10599640 3300025949 Bacteria 1111
734 Ga0207667_11040940 3300025949 Bacteria 804
735 Ga0207667_11463710 3300025949 Bacteria 655
736 Ga0207651_10183658 3300025960 Bacteria 1662
737 Ga0207651_10392254 3300025960 Bacteria 1179
738 Ga0207712_10001195 3300025961 Bacteria 17947
739 Ga0207712_10001216 3300025961 Bacteria 17755
740 Ga0207712_10559312 3300025961 Bacteria 985
741 Ga0207668_10011602 3300025972 Bacteria 5360
742 Ga0207668_10166366 3300025972 Bacteria 1724
743 Ga0207668_10203353 3300025972 Bacteria 1579
744 Ga0207668_10254721 3300025972 Bacteria 1427
745 Ga0207668_10359841 3300025972 Bacteria 1219
746 Ga0207640_10000190 3300025981 Bacteria 43737
747 Ga0207640_10001549 3300025981 Bacteria 12373
748 Ga0207640_10003414 3300025981 Bacteria 8553
749 Ga0207640_10009903 3300025981 Bacteria 5350
750 Ga0207640_10016638 3300025981 Bacteria 4283
751 Ga0207640_10163223 3300025981 Bacteria 1651
752 Ga0207640_10241418 3300025981 Bacteria 1396
753 Ga0207658_10000013 3300025986 Bacteria 220396
754 Ga0207658_10029268 3300025986 Bacteria 3888
755 Ga0207658_10118548 3300025986 Bacteria 2106
756 Ga0207658_10193319 3300025986 Bacteria 1693
757 Ga0207658_10329933 3300025986 Bacteria 1323
758 Ga0207658_10667254 3300025986 Bacteria 938
759 Ga0207658_10891040 3300025986 Bacteria 810
760 Ga0207658_10892344 3300025986 Bacteria 809
761 Ga0207677_10086112 3300026023 Bacteria 2270
762 Ga0207677_10106765 3300026023 Bacteria 2075
763 Ga0207703_10000793 3300026035 Bacteria 31116
764 Ga0207703_10269178 3300026035 Bacteria 1543
765 Ga0207703_10395672 3300026035 Bacteria 1281
766 Ga0207703_10397394 3300026035 Bacteria 1278
767 Ga0207639_10000479 3300026041 Bacteria 27677
768 Ga0207639_10000595 3300026041 Bacteria 24859
769 Ga0207639_10004215 3300026041 Bacteria 9688
770 Ga0207639_10035499 3300026041 Bacteria 3690
771 Ga0207639_10082054 3300026041 Bacteria 2555
772 Ga0207639_10210802 3300026041 Bacteria 1672
773 Ga0207639_10255015 3300026041 Bacteria 1531
774 Ga0207639_10302611 3300026041 Bacteria 1414
775 Ga0207639_10366920 3300026041 Bacteria 1290
776 Ga0207639_10479588 3300026041 Bacteria 1133
777 Ga0207639_10504114 3300026041 Bacteria 1106
778 Ga0207639_10713675 3300026041 Bacteria 931
779 Ga0207639_11203159 3300026041 Bacteria 711
780 Ga0207678_10000035 3300026067 Bacteria 104807
781 Ga0207678_10012465 3300026067 Bacteria 7465
782 Ga0207678_10016540 3300026067 Bacteria 6478
783 Ga0207678_10055104 3300026067 Bacteria 3425
784 Ga0207678_10208614 3300026067 Bacteria 1671
785 Ga0207678_10702636 3300026067 Bacteria 890
786 Ga0207708_10303999 3300026075 Bacteria 1298
787 Ga0207702_10000049 3300026078 Bacteria 140303
788 Ga0207702_10000380 3300026078 Bacteria 50635
789 Ga0207702_10010670 3300026078 Bacteria 7676
790 Ga0207702_10011899 3300026078 Bacteria 7241
791 Ga0207702_10197901 3300026078 Bacteria 1861
792 Ga0207702_10722423 3300026078 Bacteria 982
793 Ga0207702_10821687 3300026078 Bacteria 919
794 Ga0207641_10006513 3300026088 Bacteria 9828
795 Ga0207641_10025673 3300026088 Bacteria 4857
796 Ga0207641_10162028 3300026088 Bacteria 2034
797 Ga0207641_10278074 3300026088 Bacteria 1573
798 Ga0207641_10415131 3300026088 Bacteria 1295
799 Ga0207648_10011901 3300026089 Bacteria 8174
800 Ga0207648_10076457 3300026089 Bacteria 2918
801 Ga0207648_10873773 3300026089 Bacteria 839
802 Ga0207676_10009897 3300026095 Bacteria 6783
803 Ga0207676_10188024 3300026095 Bacteria 1815
804 Ga0207676_10200669 3300026095 Bacteria 1762
805 Ga0207676_10562303 3300026095 Bacteria 1091
806 Ga0207674_10000090 3300026116 Bacteria 99821
807 Ga0207674_10005138 3300026116 Bacteria 15610
808 Ga0207674_10082164 3300026116 Bacteria 3223
809 Ga0207674_10089465 3300026116 Bacteria 3071
810 Ga0207674_10217853 3300026116 Bacteria 1857
811 Ga0207675_100022876 3300026118 Bacteria 5814
812 Ga0207675_100368478 3300026118 Bacteria 1411
813 Ga0207675_100722810 3300026118 Bacteria 1006
814 Ga0207683_10015518 3300026121 Bacteria 6486
815 Ga0207683_10114431 3300026121 Bacteria 2417
816 Ga0207683_10125025 3300026121 Bacteria 2311
817 Ga0207683_10221619 3300026121 Bacteria 1723
818 Ga0207698_10000982 3300026142 Bacteria 16584
819 Ga0207698_10007692 3300026142 Bacteria 6759
820 Ga0207698_10018109 3300026142 Bacteria 4793
821 Ga0207698_10130712 3300026142 Bacteria 2145
822 Ga0207698_10380200 3300026142 Bacteria 1343
823 Ga0207698_10444189 3300026142 Bacteria 1250
824 Ga0207698_10583094 3300026142 Bacteria 1100
825 Ga0207698_10798323 3300026142 Bacteria 946
826 Ga0209973_1003226 3300027252 Bacteria 1589
827 Ga0209371_1000048 3300027312 Bacteria 281705
828 Ga0209984_1001727 3300027424 Bacteria 2391
829 Ga0209999_1000442 3300027543 Bacteria 6380
830 Ga0209982_1001040 3300027552 Bacteria 3693
831 Ga0209970_1008325 3300027614 Bacteria 1702
832 Ga0209971_1001367 3300027682 Bacteria 6057
833 Ga0209974_10001896 3300027876 Bacteria 7638
834 Ga0209974_10006797 3300027876 Bacteria 3971
835 Ga0268266_10000001 3300028379 Bacteria 4040580
836 Ga0268266_10000008 3300028379 Bacteria 1161875
837 Ga0268266_10012196 3300028379 Bacteria 7438
838 Ga0268266_10105549 3300028379 Bacteria 2489
839 Ga0268266_10416320 3300028379 Bacteria 1273
840 Ga0268265_10096396 3300028380 Bacteria 2377
841 Ga0268264_10012879 3300028381 Bacteria 6880
842 Ga0268264_10013020 3300028381 Bacteria 6837
843 Ga0268264_10172359 3300028381 Bacteria 1958
844 Ga0268264_10596859 3300028381 Bacteria 1088
845 Ga0307517_10145217 3300028786 Bacteria 1649
846 Ga0265338_10483232 3300028800 Bacteria 874
847 Ga0268256_1000049 3300030500 Bacteria 307229
848 Ga0316177_1156649 3300030731 Bacteria 6363
849 Ga0316182_1026731 3300030745 Bacteria 5630
850 Ga0307408_100079013 3300031548 Bacteria 2454
851 Ga0307408_100092241 3300031548 Bacteria 2289
852 Ga0307408_100161570 3300031548 Bacteria 1780
853 Ga0307408_100300972 3300031548 Bacteria 1343
854 Ga0307408_100798105 3300031548 Bacteria 856
855 Ga0307508_10030073 3300031616 Bacteria 4908
856 Ga0307508_10203007 3300031616 Bacteria 1583
857 Ga0316575_10076918 3300031665 Bacteria 1344
858 Ga0316576_10265740 3300031727 Bacteria 1287
859 Ga0307516_10216777 3300031730 Bacteria 1625
860 Ga0307405_10204962 3300031731 Bacteria 1435
861 Ga0307413_10005298 3300031824 Bacteria 5737
862 Ga0307413_10036935 3300031824 Bacteria 2817
863 Ga0307413_10124312 3300031824 Bacteria 1753
864 Ga0307413_10301187 3300031824 Bacteria 1216
865 Ga0307413_10776646 3300031824 Bacteria 803
866 Ga0307410_10151037 3300031852 Bacteria 1729
867 Ga0307410_10431738 3300031852 Bacteria 1071
868 Ga0307410_10489988 3300031852 Bacteria 1010
869 Ga0307406_10285424 3300031901 Bacteria 1261
870 Ga0307407_10010967 3300031903 Bacteria 4294
871 Ga0307412_10031558 3300031911 Bacteria 3347
872 Ga0307412_10042740 3300031911 Bacteria 2947
873 Ga0307412_10107047 3300031911 Bacteria 1989
874 Ga0307412_10504300 3300031911 Bacteria 1008
875 Ga0307412_10905455 3300031911 Bacteria 773
876 Ga0307409_101348517 3300031995 Bacteria 739
877 Ga0307416_100243197 3300032002 Bacteria 1745
878 Ga0307416_100337613 3300032002 Bacteria 1518
879 Ga0307416_100600800 3300032002 Bacteria 1180
880 Ga0307414_10040312 3300032004 Bacteria 3153
881 Ga0307414_10067056 3300032004 Bacteria 2568
882 Ga0307414_10113207 3300032004 Bacteria 2070
883 Ga0307414_10138684 3300032004 Bacteria 1900
884 Ga0307414_10179116 3300032004 Bacteria 1703
885 Ga0307414_10292186 3300032004 Bacteria 1374
886 Ga0307414_10406811 3300032004 Bacteria 1183
887 Ga0307414_10457216 3300032004 Bacteria 1121
888 Ga0307414_10522699 3300032004 Bacteria 1053
889 Ga0307411_10013448 3300032005 Bacteria 4516
890 Ga0307411_10084979 3300032005 Bacteria 2190
891 Ga0307411_10333992 3300032005 Bacteria 1229
892 Ga0307411_10460650 3300032005 Bacteria 1066
893 Ga0307411_10476638 3300032005 Bacteria 1050
894 Ga0307411_10834155 3300032005 Bacteria 814
895 Ga0307415_100796717 3300032126 Bacteria 862
896 Ga0307507_10032693 3300033179 Bacteria 5424
897 Ga0307510_10132276 3300033180 Bacteria 2163
898 Ga0373959_0023707 3300034820 Bacteria 1195
899 Ga0373944_0103121 3300035089 Bacteria 966
900 Ga0373936_0155331 3300035113 Bacteria 994
901 Ga0373954_0261813 3300035118 Bacteria 852
902 Ga0373957_0116767 3300035120 Bacteria 1078
903 Ga0373947_0456849 3300035725 Bacteria 865
904 Ga0373937_0422145 3300036401 Bacteria 1266
905 Ga0373937_0855561 3300036401 Bacteria 858
906 Ga0395899_0001125 3300037312 Bacteria 23866
907 Ga0395899_0029586 3300037312 Bacteria 4120
908 Ga0395899_0082043 3300037312 Bacteria 2345
909 Ga0395899_0178593 3300037312 Bacteria 1491
910 Ga0395899_0206202 3300037312 Bacteria 1368
911 Ga0395899_0287868 3300037312 Bacteria 1115
912 Ga0395899_0457805 3300037312 Bacteria 834
913 Ga0395900_0001304 3300037418 Bacteria 30351
914 Ga0395900_0004445 3300037418 Bacteria 14854
915 Ga0395900_0024057 3300037418 Bacteria 6233
916 Ga0395900_0032548 3300037418 Bacteria 5361
917 Ga0395900_0046052 3300037418 Bacteria 4491
918 Ga0395900_0050386 3300037418 Bacteria 4289
919 Ga0395900_0066734 3300037418 Bacteria 3697
920 Ga0395900_0713229 3300037418 Bacteria 936
921 Ga0395900_1152336 3300037418 Bacteria 691
922 Ga0395898_0001583 3300037466 Bacteria 31093
923 Ga0395898_0002066 3300037466 Bacteria 25003
924 Ga0395898_0002627 3300037466 Bacteria 20893
925 Ga0395898_0002725 3300037466 Bacteria 20379
926 Ga0395898_0013479 3300037466 Bacteria 8416
927 Ga0395898_0036705 3300037466 Bacteria 4865
928 Ga0395898_0114789 3300037466 Bacteria 2580
929 Ga0395898_0136496 3300037466 Bacteria 2349
930 Ga0395898_0317809 3300037466 Bacteria 1485
931 Ga0436364_0095944 3300037853 Bacteria 1339
932 Ga0395901_0000259 3300038443 Bacteria 66203
933 Ga0395901_0001429 3300038443 Bacteria 24902
934 Ga0395901_0049227 3300038443 Bacteria 4378
935 Ga0395901_0053602 3300038443 Bacteria 4190
936 Ga0395901_0061507 3300038443 Bacteria 3907
937 Ga0395901_0063473 3300038443 Bacteria 3844
938 Ga0395901_0220090 3300038443 Bacteria 1984
939 Ga0395901_0244857 3300038443 Bacteria 1869
940 Ga0395901_0324327 3300038443 Bacteria 1593
941 Ga0395901_0530985 3300038443 Bacteria 1194
942 Ga0237819_00140 3300038705 Bacteria 27368
943 Ga0400488_38144 3300038741 Unclassified 1235
944 Ga0400486_30133 3300038742 Bacteria 4675
945 Ga0436365_0119571 3300039437 Bacteria 638
946 Ga0436365_0324168 3300039437 Bacteria 3849
947 Ga0436363_0359992 3300039450 Bacteria 2727
948 Ga0436362_0657356 3300039453 Bacteria 1590
949 Ga0439436_0003731 3300041404 Bacteria 4651
950 Ga0439436_0049721 3300041404 Bacteria 1188
951 Ga0439436_0062325 3300041404 Bacteria 1043
952 Ga0439447_001069 3300041407 Bacteria 9935
953 Ga0439465_0000006 3300041413 Bacteria 54247
954 Ga0439465_0004178 3300041413 Bacteria 4697
955 Ga0451789_0416833 3300041443 Bacteria 1156
956 Ga0451793_1086667 3300041452 Bacteria 3180
957 Ga0451797_0190827 3300041453 Bacteria 1333
958 Ga0451795_0046765 3300041456 Bacteria 1080
959 Ga0451800_1451396 3300041459 Bacteria 1082
960 Ga0451802_0727430 3300041460 Bacteria 761
961 Ga0451806_127485 3300041462 Bacteria 616
962 Ga0451807_0483911 3300041486 Bacteria 980
963 Ga0451835_0771462 3300041492 Bacteria 597
964 Ga0451837_1048697 3300041494 Bacteria 892
965 Ga0451837_1628237 3300041494 Bacteria 2570
966 Ga0451839_0794977 3300041496 Bacteria 966
967 Ga0451849_0604301 3300041505 Bacteria 689
968 Ga0451843_1708573 3300041509 Bacteria 733
969 Ga0451853_1416507 3300041512 Bacteria 660
970 Ga0451853_1645120 3300041512 Bacteria 1005
971 Ga0451853_3750318 3300041512 Bacteria 783
972 Ga0439431_0002900 3300041997 Bacteria 3774
973 Ga0439433_0037525 3300041999 Bacteria 1122
974 Ga0439445_0000142 3300042004 Bacteria 12656
975 Ga0439448_0102780 3300042005 Bacteria 972
976 Ga0439432_065208 3300042006 Bacteria 1117
977 Ga0439432_108552 3300042006 Bacteria 827
978 Ga0439449_0020297 3300042007 Bacteria 2490
979 Ga0439449_0127096 3300042007 Bacteria 947
980 Ga0439452_004747 3300042010 Bacteria 4496
981 Ga0439459_0002300 3300042438 Bacteria 2931
982 Ga0439459_0002709 3300042438 Bacteria 2755
983 Ga0451577_0000425 3300042876 Bacteria 75871
984 Ga0451577_0008483 3300042876 Bacteria 10003
985 Ga0466969_0015351 3300044656 Bacteria 4014
986 Ga0466969_0030228 3300044656 Bacteria 2761
987 Ga0466972_0000647 3300044658 Bacteria 16793
988 Ga0466972_0001847 3300044658 Bacteria 10373
989 Ga0466972_0002963 3300044658 Bacteria 8405
990 Ga0466982_0000007 3300044672 Bacteria 250854
991 Ga0466982_0000029 3300044672 Bacteria 60348
992 Ga0466965_0000764 3300044683 Bacteria 12107
993 Ga0466965_0002141 3300044683 Bacteria 8293
994 Ga0466965_0007999 3300044683 Bacteria 4878
995 Ga0466965_0032814 3300044683 Bacteria 2536
996 Ga0466965_0104626 3300044683 Bacteria 1450
997 Ga0466966_0000343 3300044684 Bacteria 30095
998 Ga0466966_0001588 3300044684 Bacteria 14607
999 Ga0466961_0000199 3300044693 Bacteria 40467
1000 Ga0466961_0002917 3300044693 Bacteria 10619
1001 Ga0466961_0096135 3300044693 Bacteria 1868
1002 Ga0466961_0282415 3300044693 Bacteria 1016
1003 Ga0466961_0586090 3300044693 Bacteria 671
1004 Ga0466964_0000680 3300044706 Bacteria 10952
1005 Ga0453684_0025105 3300044712 Bacteria 8669
1006 Ga0466971_0004638 3300044719 Bacteria 5938
1007 Ga0466968_0019341 3300044735 Bacteria 2742
1008 Ga0466970_0000132 3300044765 Bacteria 34193
1009 Ga0466970_0000260 3300044765 Bacteria 25913
1010 Ga0466970_0058767 3300044765 Bacteria 2058
1011 Ga0466970_0076519 3300044765 Bacteria 1803
1012 Ga0466957_0001273 3300044842 Bacteria 13130
1013 Ga0466957_0030641 3300044842 Bacteria 3212
1014 Ga0466960_0106077 3300044901 Bacteria 1453
1015 Ga0466959_0000293 3300045049 Bacteria 29880
1016 Ga0466959_0058398 3300045049 Bacteria 2810
1017 Ga0466959_0227903 3300045049 Bacteria 1290
1018 Ga0466958_0003516 3300045836 Bacteria 8143
1019 Ga0466967_0409936 3300045976 Bacteria 1320
1020 Ga0495617_000122 3300046452 Bacteria 51915
1021 Ga0495617_000504 3300046452 Bacteria 20437
1022 Ga0495590_0181138 3300046457 Bacteria 770
1023 Ga0495629_0240917 3300046459 Bacteria 1245
1024 Ga0495638_0000106 3300046460 Bacteria 133921
1025 Ga0495638_0000237 3300046460 Bacteria 75347
1026 Ga0495638_0000479 3300046460 Bacteria 47958
1027 Ga0495641_0134174 3300046461 Bacteria 1105
1028 Ga0495650_0000074 3300046471 Bacteria 251346
1029 Ga0495650_0000134 3300046471 Bacteria 173331
1030 Ga0495580_0237075 3300046472 Bacteria 1251
1031 Ga0495582_0033576 3300046473 Bacteria 2821
1032 Ga0495639_0064198 3300046475 Bacteria 1687
1033 Ga0495584_0001870 3300046491 Bacteria 12175
1034 Ga0495594_0189023 3300046499 Bacteria 1173
1035 Ga0495607_0000042 3300046501 Bacteria 130434
1036 Ga0495607_0004080 3300046501 Bacteria 10918
1037 Ga0495583_0000833 3300046506 Bacteria 37749
1038 Ga0495583_0003138 3300046506 Bacteria 13041
1039 Ga0495583_0008323 3300046506 Bacteria 6359
1040 Ga0495606_0000562 3300046507 Bacteria 59044
1041 Ga0495606_0001636 3300046507 Bacteria 29195
1042 Ga0495606_0008349 3300046507 Bacteria 9018
1043 Ga0495606_0015682 3300046507 Bacteria 5822
1044 Ga0495610_0000711 3300046512 Bacteria 31740
1045 Ga0495616_0000617 3300046513 Bacteria 26769
1046 Ga0495616_0003053 3300046513 Bacteria 10846
1047 Ga0495620_0000182 3300046515 Bacteria 48877
1048 Ga0495620_0000216 3300046515 Bacteria 43506
1049 Ga0495620_0027243 3300046515 Bacteria 2677
1050 Ga0495630_0161208 3300046517 Bacteria 1708
1051 Ga0495632_0000241 3300046519 Bacteria 54558
1052 Ga0495637_0014597 3300046520 Bacteria 3703
1053 Ga0495648_0001366 3300046524 Bacteria 24119
1054 Ga0495663_0051406 3300046525 Bacteria 1277
1055 Ga0495663_0122884 3300046525 Bacteria 870
1056 Ga0495587_0708173 3300046536 Bacteria 552
1057 Ga0495609_0030336 3300046538 Bacteria 2461
1058 Ga0495622_0106668 3300046557 Bacteria 1283
1059 Ga0495656_0000847 3300046615 Bacteria 9876
1060 Ga0495656_0121006 3300046615 Bacteria 1235
1061 Ga0495668_0000411 3300046616 Bacteria 55902
1062 Ga0495611_0000004 3300046648 Bacteria 308149
1063 Ga0495611_0000023 3300046648 Bacteria 120553
1064 Ga0495611_0002701 3300046648 Bacteria 7998
1065 Ga0495625_0000024 3300046660 Bacteria 271126
1066 Ga0495625_0001652 3300046660 Bacteria 26150
1067 Ga0495625_0018885 3300046660 Bacteria 5368
1068 Ga0495625_0047054 3300046660 Bacteria 3111
1069 Ga0495625_0057783 3300046660 Bacteria 2757
1070 Ga0495625_0160641 3300046660 Bacteria 1505
1071 Ga0495625_0382372 3300046660 Bacteria 883
1072 Ga0495588_0071922 3300046674 Bacteria 1799
1073 Ga0495588_0153472 3300046674 Bacteria 1217
1074 Ga0495657_0095923 3300046675 Bacteria 1895
1075 Ga0495599_0389719 3300046678 Bacteria 831
1076 Ga0495647_0032678 3300046681 Bacteria 1941
1077 Ga0495613_0656007 3300046689 Bacteria 694
1078 Ga0495670_0009105 3300046691 Bacteria 4882
1079 Ga0495670_0129075 3300046691 Bacteria 1317
1080 Ga0495671_0000390 3300046692 Bacteria 36237
1081 Ga0495649_0000687 3300046694 Bacteria 27564
1082 Ga0495589_0000038 3300046794 Bacteria 149381
1083 Ga0495589_0000547 3300046794 Bacteria 26112
1084 Ga0495600_0117039 3300046809 Bacteria 1735
1085 Ga0495660_0000321 3300046810 Bacteria 42518
1086 Ga0495636_0003246 3300047318 Bacteria 6308
1087 Ga0495636_0006414 3300047318 Bacteria 4622
1088 Ga0495636_0086670 3300047318 Bacteria 1354
1089 Ga0495672_0000544 3300047320 Bacteria 42844
1090 Ga0495679_000011 3300047446 Bacteria 324498
1091 Ga0495673_0000616 3300047469 Bacteria 35177
1092 Ga0495681_0015144 3300047470 Bacteria 4375
1093 Ga0495684_0168776 3300047471 Bacteria 1629
1094 Ga0495686_0000608 3300047472 Bacteria 49564
1095 Ga0495686_0010132 3300047472 Bacteria 6726
1096 Ga0495686_0010763 3300047472 Bacteria 6488
1097 Ga0495686_0061393 3300047472 Bacteria 2334
1098 Ga0495686_0071603 3300047472 Bacteria 2133
1099 Ga0495686_0127698 3300047472 Bacteria 1510
1100 Ga0495686_0250464 3300047472 Bacteria 995
1101 Ga0495602_0158386 3300048088 Bacteria 1771
1102 Ga0496100_0001740 3300048903 Bacteria 10855
1103 Ga0496100_0584488 3300048903 Bacteria 866
1104 Ga0496101_0012388 3300048904 Bacteria 5690
1105 Ga0496101_0073503 3300048904 Bacteria 2512
1106 Ga0496101_0132636 3300048904 Bacteria 1893
1107 Ga0496102_0082098 3300048905 Bacteria 2973
1108 Ga0496102_0583618 3300048905 Bacteria 1040
1109 Ga0496104_0000012 3300048907 Bacteria 438011
1110 Ga0496104_0338658 3300048907 Bacteria 1417
1111 Ga0496105_0000011 3300048908 Bacteria 302186
1112 Ga0496106_0175573 3300048909 Bacteria 1699
1113 Ga0496107_0035157 3300048910 Bacteria 3592
1114 Ga0496107_0094425 3300048910 Bacteria 2188
1115 Ga0496107_0378835 3300048910 Bacteria 1052
1116 Ga0496108_0724804 3300048911 Bacteria 861
1117 Ga0496108_1175036 3300048911 Bacteria 650
1118 Ga0496110_0298806 3300048913 Bacteria 1466
1119 Ga0496112_0540649 3300048915 Bacteria 1099
1120 Ga0496113_0024417 3300048916 Bacteria 4297
1121 Ga0496113_0203915 3300048916 Bacteria 1572
1122 Ga0496113_1191232 3300048916 Bacteria 595
1123 Ga0496114_0001533 3300048917 Bacteria 17508
1124 Ga0496114_0006408 3300048917 Bacteria 9269
1125 Ga0496114_0172916 3300048917 Bacteria 1883
1126 Ga0496114_0208232 3300048917 Bacteria 1715
1127 Ga0496115_0000092 3300048918 Bacteria 83381
1128 Ga0496115_0000193 3300048918 Bacteria 56720
1129 Ga0496115_0000617 3300048918 Bacteria 27037
1130 Ga0496115_0004525 3300048918 Bacteria 10055
1131 Ga0496115_0031269 3300048918 Bacteria 4193
1132 Ga0496115_0145340 3300048918 Bacteria 1957
1133 Ga0496115_0221537 3300048918 Bacteria 1561
1134 Ga0496117_0004278 3300048920 Bacteria 15910
1135 Ga0496117_0005719 3300048920 Bacteria 12931
1136 Ga0496117_0009436 3300048920 Bacteria 9080
1137 Ga0496118_0000885 3300048921 Bacteria 47246
1138 Ga0496118_0001282 3300048921 Bacteria 38428
1139 Ga0496118_0001962 3300048921 Bacteria 29176
1140 Ga0496118_0002465 3300048921 Bacteria 24852
1141 Ga0496118_0004440 3300048921 Bacteria 16648
1142 Ga0496118_0012974 3300048921 Bacteria 7933
1143 Ga0496118_0241615 3300048921 Bacteria 1033
1144 Ga0496119_0041672 3300048922 Bacteria 2921
1145 Ga0496120_0107468 3300048923 Bacteria 1463
1146 Ga0496120_0117853 3300048923 Bacteria 1377
1147 Ga0496121_0000071 3300048924 Bacteria 247039
1148 Ga0496121_0000942 3300048924 Bacteria 52638
1149 Ga0496121_0001620 3300048924 Bacteria 37310
1150 Ga0496121_0001863 3300048924 Bacteria 33851
1151 Ga0496121_0001864 3300048924 Bacteria 33829
1152 Ga0496121_0001888 3300048924 Bacteria 33577
1153 Ga0496121_0002280 3300048924 Bacteria 29844
1154 Ga0496121_0006661 3300048924 Bacteria 14212
1155 Ga0496121_0016652 3300048924 Bacteria 7570
1156 Ga0496121_0037969 3300048924 Bacteria 4272
1157 Ga0496121_0142210 3300048924 Bacteria 1778
1158 Ga0496122_0000062 3300048925 Bacteria 241387
1159 Ga0496122_0016999 3300048925 Bacteria 6833
1160 Ga0496122_0018310 3300048925 Bacteria 6482
1161 Ga0496122_0048979 3300048925 Bacteria 3243
1162 Ga0496122_0066017 3300048925 Bacteria 2618
1163 Ga0496123_0004387 3300048926 Bacteria 14875
1164 Ga0496123_0009110 3300048926 Bacteria 8985
1165 Ga0496123_0012934 3300048926 Bacteria 7057
1166 Ga0496123_0013031 3300048926 Bacteria 7018
1167 Ga0496123_0075915 3300048926 Bacteria 2071
1168 Ga0496124_0000313 3300048927 Bacteria 89891
1169 Ga0496124_0000314 3300048927 Bacteria 89797
1170 Ga0496124_0007021 3300048927 Bacteria 12067
1171 Ga0496125_0000291 3300048928 Bacteria 98752
1172 Ga0496125_0024124 3300048928 Bacteria 5600
1173 Ga0496125_0060859 3300048928 Bacteria 3032
1174 Ga0496125_0349895 3300048928 Bacteria 883
1175 Ga0496126_0000160 3300048929 Bacteria 155144
1176 Ga0496126_0003733 3300048929 Bacteria 18974
1177 Ga0496126_0004079 3300048929 Bacteria 17716
1178 Ga0496126_0004964 3300048929 Bacteria 15517
1179 Ga0496126_0009232 3300048929 Bacteria 10514
1180 Ga0496126_0011982 3300048929 Bacteria 8913
1181 Ga0496126_0017284 3300048929 Bacteria 7188
1182 Ga0496126_0018434 3300048929 Bacteria 6914
1183 Ga0496126_0050363 3300048929 Bacteria 3796
1184 Ga0496126_0060206 3300048929 Bacteria 3416
1185 Ga0496126_0080523 3300048929 Bacteria 2882
1186 Ga0496126_0086649 3300048929 Bacteria 2760
1187 Ga0496126_1012005 3300048929 Bacteria 623
1188 Ga0495678_000062 3300049459 Bacteria 140706
1189 Ga0495678_025362 3300049459 Bacteria 2547
1190 Ga0495682_0000283 3300049460 Bacteria 39664
1191 Ga0495682_0000341 3300049460 Bacteria 34546
1192 Ga0495682_0000372 3300049460 Bacteria 32548
1193 Ga0495682_0013547 3300049460 Bacteria 3102
1194 Ga0501031_0002957 3300049568 Bacteria 10872
1195 Ga0501031_0016767 3300049568 Bacteria 4758
1196 Ga0501031_0047333 3300049568 Bacteria 2804
1197 Ga0501031_0076103 3300049568 Bacteria 2185
1198 Ga0501031_0117963 3300049568 Bacteria 1734
1199 Ga0501031_0207521 3300049568 Bacteria 1277
1200 Ga0501031_0357314 3300049568 Bacteria 945
1201 Ga0501032_0000485 3300049569 Bacteria 32254
1202 Ga0501032_0004538 3300049569 Bacteria 10445
1203 Ga0501032_0007187 3300049569 Bacteria 8145
1204 Ga0501032_0042745 3300049569 Bacteria 3073
1205 Ga0501032_0100806 3300049569 Bacteria 1913
1206 Ga0501032_0174762 3300049569 Bacteria 1407
1207 Ga0501032_0225935 3300049569 Bacteria 1217
1208 Ga0501032_0589179 3300049569 Bacteria 708
1209 Ga0501033_0002332 3300049570 Bacteria 16174
1210 Ga0501033_0002853 3300049570 Bacteria 14482
1211 Ga0501033_0004295 3300049570 Bacteria 11444
1212 Ga0501033_0005340 3300049570 Bacteria 10182
1213 Ga0501033_0036768 3300049570 Bacteria 3667
1214 Ga0501033_0265859 3300049570 Bacteria 1213
1215 Ga0501034_0000544 3300049571 Bacteria 59969
1216 Ga0501034_0001449 3300049571 Bacteria 31438
1217 Ga0501034_0004230 3300049571 Bacteria 16025
1218 Ga0501034_0006520 3300049571 Bacteria 12549
1219 Ga0501034_0006867 3300049571 Bacteria 12170
1220 Ga0501034_0010307 3300049571 Bacteria 9744
1221 Ga0501034_0012391 3300049571 Bacteria 8807
1222 Ga0501034_0042361 3300049571 Bacteria 4609
1223 Ga0501034_0056437 3300049571 Bacteria 3952
1224 Ga0501034_0073006 3300049571 Bacteria 3439
1225 Ga0501034_0125919 3300049571 Bacteria 2547
1226 Ga0501034_0141390 3300049571 Bacteria 2386
1227 Ga0501034_0294235 3300049571 Bacteria 1561
1228 Ga0501034_0356522 3300049571 Bacteria 1390
1229 Ga0501034_0778465 3300049571 Bacteria 851
1230 Ga0501036_0008476 3300049572 Bacteria 8426
1231 Ga0501036_0047433 3300049572 Bacteria 3638
1232 Ga0501036_0108054 3300049572 Bacteria 2352
1233 Ga0501036_0375127 3300049572 Bacteria 1187
1234 Ga0501036_0579029 3300049572 Bacteria 932
1235 Ga0501036_0739410 3300049572 Bacteria 812
1236 Ga0501036_0794192 3300049572 Bacteria 780
1237 Ga0501037_0004806 3300049573 Bacteria 9821
1238 Ga0501037_0028275 3300049573 Bacteria 4141
1239 Ga0501037_0091448 3300049573 Bacteria 2200
1240 Ga0501037_0096898 3300049573 Bacteria 2131
1241 Ga0501037_0104567 3300049573 Bacteria 2041
1242 Ga0501037_0206295 3300049573 Bacteria 1387
1243 Ga0501037_0360052 3300049573 Bacteria 1002
1244 Ga0501037_0388123 3300049573 Bacteria 959
1245 Ga0501037_0413500 3300049573 Bacteria 924
1246 Ga0501038_0000251 3300049574 Bacteria 45437
1247 Ga0501038_0006634 3300049574 Bacteria 10706
1248 Ga0501038_0011631 3300049574 Bacteria 8028
1249 Ga0501038_0023411 3300049574 Bacteria 5521
1250 Ga0501038_0220810 3300049574 Bacteria 1512
1251 Ga0501038_0222956 3300049574 Bacteria 1503
1252 Ga0501038_0489651 3300049574 Bacteria 941
1253 Ga0501039_0007491 3300049575 Bacteria 8335
1254 Ga0501039_0055978 3300049575 Bacteria 3055
1255 Ga0501039_0073969 3300049575 Bacteria 2647
1256 Ga0501039_0144966 3300049575 Bacteria 1866
1257 Ga0501039_0195532 3300049575 Bacteria 1590
1258 Ga0501039_0223697 3300049575 Bacteria 1479
1259 Ga0501040_0118373 3300049576 Bacteria 1857
1260 Ga0501042_0398761 3300049578 Bacteria 996
1261 Ga0501043_0003128 3300049579 Bacteria 13725
1262 Ga0501043_0003723 3300049579 Bacteria 12532
1263 Ga0501043_0009046 3300049579 Bacteria 7837
1264 Ga0501043_0014418 3300049579 Bacteria 6184
1265 Ga0501043_0017421 3300049579 Bacteria 5631
1266 Ga0501043_0019309 3300049579 Bacteria 5350
1267 Ga0501043_0063840 3300049579 Bacteria 2892
1268 Ga0501043_0129292 3300049579 Bacteria 1979
1269 Ga0501043_0208162 3300049579 Bacteria 1516
1270 Ga0501043_0252463 3300049579 Bacteria 1358
1271 Ga0501046_0009056 3300049580 Bacteria 8630
1272 Ga0501046_0013125 3300049580 Bacteria 7032
1273 Ga0501046_0015580 3300049580 Bacteria 6385
1274 Ga0501046_0024091 3300049580 Bacteria 4997
1275 Ga0501046_0093130 3300049580 Bacteria 2316
1276 Ga0501046_0124060 3300049580 Bacteria 1963
1277 Ga0501046_0156218 3300049580 Bacteria 1718
1278 Ga0501047_0000250 3300049581 Bacteria 63699
1279 Ga0501047_0002064 3300049581 Bacteria 19202
1280 Ga0501047_0004581 3300049581 Bacteria 13005
1281 Ga0501047_0008714 3300049581 Bacteria 9572
1282 Ga0501047_0050558 3300049581 Bacteria 4014
1283 Ga0501047_0143168 3300049581 Bacteria 2268
1284 Ga0501047_0167971 3300049581 Bacteria 2064
1285 Ga0501047_0219175 3300049581 Bacteria 1759
1286 Ga0501047_0220542 3300049581 Bacteria 1753
1287 Ga0501047_0299928 3300049581 Bacteria 1449
1288 Ga0501047_0311134 3300049581 Bacteria 1416
1289 Ga0501047_0412210 3300049581 Bacteria 1183
1290 Ga0501048_0017672 3300049582 Bacteria 5250
1291 Ga0501048_0039385 3300049582 Bacteria 3390
1292 Ga0501048_0112774 3300049582 Bacteria 1920
1293 Ga0501067_0000560 3300049583 Bacteria 20112
1294 Ga0501067_0008269 3300049583 Bacteria 5779
1295 Ga0501068_0016281 3300049584 Bacteria 4285
1296 Ga0501068_0031539 3300049584 Bacteria 3148
1297 Ga0501068_0094355 3300049584 Bacteria 1849
1298 Ga0501068_0094652 3300049584 Bacteria 1846
1299 Ga0501068_0399129 3300049584 Bacteria 886
1300 Ga0501069_0016989 3300049585 Bacteria 3910
1301 Ga0501069_0018450 3300049585 Bacteria 3764
1302 Ga0501069_0024864 3300049585 Bacteria 3270
1303 Ga0501069_0045605 3300049585 Bacteria 2429
1304 Ga0501070_0003399 3300049586 Bacteria 13818
1305 Ga0501070_0022970 3300049586 Bacteria 5221
1306 Ga0501070_0026818 3300049586 Bacteria 4832
1307 Ga0501070_0080766 3300049586 Bacteria 2690
1308 Ga0501070_0149339 3300049586 Bacteria 1928
1309 Ga0501070_0157905 3300049586 Bacteria 1870
1310 Ga0501070_0240087 3300049586 Bacteria 1483
1311 Ga0501070_0263973 3300049586 Bacteria 1407
1312 Ga0501070_0727883 3300049586 Bacteria 783
1313 Ga0501071_0040096 3300049587 Bacteria 3351
1314 Ga0501071_0205648 3300049587 Bacteria 1479
1315 Ga0501072_0003501 3300049588 Bacteria 11825
1316 Ga0501072_0016955 3300049588 Bacteria 5597
1317 Ga0501073_0001096 3300049589 Bacteria 19612
1318 Ga0501073_0003002 3300049589 Bacteria 12643
1319 Ga0501073_0004205 3300049589 Bacteria 10794
1320 Ga0501073_0110334 3300049589 Bacteria 1908
1321 Ga0501073_0230488 3300049589 Bacteria 1279
1322 Ga0501073_0351642 3300049589 Bacteria 1017
1323 Ga0501073_0360338 3300049589 Bacteria 1004
1324 Ga0501073_0658082 3300049589 Unclassified 723
1325 Ga0501074_0019562 3300049590 Bacteria 4914
1326 Ga0501074_0034353 3300049590 Bacteria 3676
1327 Ga0501074_0035175 3300049590 Bacteria 3629
1328 Ga0501074_0049890 3300049590 Bacteria 3021
1329 Ga0501074_0058058 3300049590 Bacteria 2787
1330 Ga0501074_0067221 3300049590 Bacteria 2578
1331 Ga0501074_0110530 3300049590 Bacteria 1967
1332 Ga0501076_0571329 3300049592 Bacteria 932
1333 Ga0501077_0360496 3300049593 Bacteria 928
1334 Ga0501077_0393926 3300049593 Bacteria 885
1335 Ga0501202_016651 3300049652 Bacteria 1429
1336 Ga0501079_0112934 3300049741 Bacteria 2112
1337 Ga0501079_0120832 3300049741 Bacteria 2037
1338 Ga0501079_0183846 3300049741 Bacteria 1631
1339 Ga0501079_0270545 3300049741 Bacteria 1328
1340 Ga0501079_0385713 3300049741 Bacteria 1098
1341 Ga0501080_0000306 3300049742 Bacteria 37439
1342 Ga0501080_0000320 3300049742 Bacteria 36678
1343 Ga0501080_0001885 3300049742 Bacteria 18044
1344 Ga0501080_0038508 3300049742 Bacteria 4463
1345 Ga0501080_0051615 3300049742 Bacteria 3827
1346 Ga0501080_0060509 3300049742 Bacteria 3526
1347 Ga0501080_0095289 3300049742 Bacteria 2764
1348 Ga0501080_0126272 3300049742 Bacteria 2369
1349 Ga0501080_0197515 3300049742 Bacteria 1847
1350 Ga0501080_0775118 3300049742 Bacteria 842
1351 Ga0501081_0086682 3300049743 Bacteria 2198
1352 Ga0501083_0007488 3300049744 Bacteria 7734
1353 Ga0501083_0068982 3300049744 Bacteria 2353
1354 Ga0501266_011828 3300049763 Bacteria 1122
1355 Ga0501269_035278 3300049766 Bacteria 653
1356 Ga0501035_0009752 3300049822 Bacteria 8926
1357 Ga0501035_0016886 3300049822 Bacteria 6730
1358 Ga0501035_0017379 3300049822 Bacteria 6632
1359 Ga0501035_0025209 3300049822 Bacteria 5451
1360 Ga0501035_0026599 3300049822 Bacteria 5292
1361 Ga0501035_0034014 3300049822 Bacteria 4632
1362 Ga0501035_0050395 3300049822 Bacteria 3731
1363 Ga0501035_0055280 3300049822 Bacteria 3544
1364 Ga0501035_0111994 3300049822 Bacteria 2391
1365 Ga0501035_0385476 3300049822 Bacteria 1168
1366 Ga0501035_0723091 3300049822 Bacteria 801
1367 Ga0501035_0780814 3300049822 Bacteria 764
1368 Ga0501044_0003969 3300049823 Bacteria 16569
1369 Ga0501044_0005486 3300049823 Bacteria 14091
1370 Ga0501044_0017657 3300049823 Bacteria 7652
1371 Ga0501044_0028186 3300049823 Bacteria 5928
1372 Ga0501044_0075598 3300049823 Bacteria 3420
1373 Ga0501044_0107242 3300049823 Bacteria 2805
1374 Ga0501044_0108743 3300049823 Bacteria 2782
1375 Ga0501044_0140742 3300049823 Bacteria 2401
1376 Ga0501044_0143207 3300049823 Bacteria 2378
1377 Ga0501044_0174273 3300049823 Bacteria 2121
1378 Ga0501044_0225483 3300049823 Bacteria 1823
1379 Ga0501044_0295543 3300049823 Bacteria 1550
1380 Ga0501044_0304012 3300049823 Bacteria 1523
1381 Ga0501044_0323959 3300049823 Bacteria 1465
1382 Ga0501044_0400469 3300049823 Bacteria 1285
1383 Ga0501044_0462230 3300049823 Bacteria 1174
1384 Ga0501044_0926429 3300049823 Bacteria 745
1385 Ga0501044_1144822 3300049823 Bacteria 646
1386 Ga0501045_0144308 3300049824 Bacteria 1770
1387 Ga0501045_0591876 3300049824 Bacteria 822
1388 nmdc:mga05p37_32385_c1 3300050507 Bacteria 4070
1389 nmdc:mga09592_180455_c1 3300050508 Bacteria 1826
1390 nmdc:mga0sz30_16282_c1 3300050516 Bacteria 2554
1391 Ga0500610_0003017 3300053079 Bacteria 6354
1392 Ga0495619_0081142 3300053085 Bacteria 2184
1393 Ga0500643_001605 3300053087 Bacteria 12714
1394 Ga0500643_008552 3300053087 Bacteria 4016
1395 Ga0500643_008927 3300053087 Bacteria 3881
1396 Ga0500651_0002320 3300053093 Bacteria 10000
1397 Ga0500651_0015083 3300053093 Bacteria 4738
1398 Ga0500566_0191366 3300053094 Bacteria 1041
1399 Ga0500641_0017442 3300053096 Bacteria 2685
1400 Ga0500555_000235 3300053103 Bacteria 24708
1401 Ga0500562_042424 3300053108 Bacteria 1210
1402 Ga0500597_000019 3300053120 Bacteria 34589
1403 Ga0500628_146496 3300053129 Bacteria 658
1404 Ga0500658_0005949 3300053134 Bacteria 4536
1405 Ga0500559_0281522 3300053136 Bacteria 782
1406 Ga0500568_0001313 3300053139 Bacteria 16297
1407 Ga0500577_0003758 3300053142 Bacteria 3959
1408 Ga0500616_0044457 3300053153 Bacteria 2370
1409 Ga0500636_0389787 3300053177 Bacteria 650
1410 Ga0500645_000167 3300053730 Bacteria 51590
1411 Ga0501084_0015131 3300054114 Bacteria 6398
1412 Ga0501084_0414703 3300054114 Bacteria 1138
1413 Ga0501084_0645659 3300054114 Bacteria 893
1414 Ga0587073_0046370 3300059492 Bacteria 968
1415 Ga0501082_0000394 3300060353 Bacteria 38764
1416 Ga0501082_0093743 3300060353 Bacteria 2594
1417 Ga0501082_0124847 3300060353 Bacteria 2232
1418 Ga0501082_0326672 3300060353 Bacteria 1337
1419 Ga0466962_0001724 3300061719 Bacteria 10272
1420 Ga0466962_0005053 3300061719 Bacteria 6345

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0708173 Ga0495587_0708173_14_535 169
2 3300005843 Ga0068860_100926207 Ga0068860_1009262072 170
3 3300032004 Ga0307414_10138684 Ga0307414_101386842 170
4 3300041505 Ga0451849_0604301 Ga0451849_0604301_19_543 170
5 3300041999 Ga0439433_0037525 Ga0439433_0037525_545_1102 170
6 3300044693 Ga0466961_0586090 Ga0466961_0586090_98_622 170
7 3300009177 Ga0105248_10843250 Ga0105248_108432502 171
8 3300014326 Ga0157380_10082842 Ga0157380_100828423 171
9 3300026041 Ga0207639_10302611 Ga0207639_103026112 171
10 3300038741 Ga0400488_38144 Ga0400488_38144_107_622 171
11 3300038742 Ga0400486_30133 Ga0400486_30133_2950_3465 171
12 3300031548 Ga0307408_100161570 Ga0307408_1001615701 172
13 3300044712 Ga0453684_0025105 Ga0453684_0025105_5096_5614 172
14 3300013104 Ga0157370_11101015 Ga0157370_111010152 173
15 3300013308 Ga0157375_10122204 Ga0157375_101222042 173
16 3300032004 Ga0307414_10179116 Ga0307414_101791162 174
17 3300005578 Ga0068854_100051750 Ga0068854_1000517501 176
18 3300025981 Ga0207640_10009903 Ga0207640_100099031 176
19 3300037312 Ga0395899_0206202 Ga0395899_0206202_693_1235 176
20 3300037466 Ga0395898_0001583 Ga0395898_0001583_27348_27890 176
21 3300048926 Ga0496123_0075915 Ga0496123_0075915_22_588 176
22 3300048927 Ga0496124_0007021 Ga0496124_0007021_10327_10893 176
23 3300048928 Ga0496125_0349895 Ga0496125_0349895_182_748 176
24 3300003322 rootL2_10006308 rootL2_100063082 177
25 3300049585 Ga0501069_0024864 Ga0501069_0024864_527_1069 177
26 3300049589 Ga0501073_0658082 Ga0501073_0658082_10_543 177
27 iso_pu_bacteria 2537561836 2538833768 177
28 iso_pu_bacteria 2571042365 2572255430 177
29 iso_pu_bacteria 2593339238 2595447285 177
30 iso_pu_bacteria 2593339239 2595450067 177
31 iso_pu_bacteria 2643221562 2643831102 177
32 iso_pu_bacteria 2643221573 2643881487 177
33 iso_pu_bacteria 2643221577 2643896863 177
34 iso_pu_bacteria 2643221685 2644479067 177
35 iso_pu_bacteria 2643221720 2644662624 177
36 iso_pu_bacteria 2643221728 2644698422 177
37 iso_pu_bacteria 2687453130 2687581894 177
38 iso_pu_bacteria 2738543009 2739227158 177
39 iso_pu_bacteria 2739367700 2739729813 177
40 iso_pu_bacteria 2818991440 2819565670 177
41 iso_pu_bacteria 2842914999 2842918322 177
42 iso_pu_bacteria 2884338543 2884339425 177
43 iso_pu_bacteria 2884411467 2884416050 177
44 iso_pu_bacteria 2895395659 2895396287 177
45 iso_pu_bacteria 2904463128 2904465954 177
46 iso_pu_bacteria 2919404418 2919406608 177
47 iso_pu_bacteria 2928963466 2928966003 177
48 iso_pu_bacteria 2939611941 2939614796 177
49 iso_pu_bacteria 2941471342 2941473178 177
50 iso_pu_bacteria 2953994433 2953995650 177
51 iso_pu_bacteria 8002869464 8002869637 177
52 3300003316 rootH1_10024742 rootH1_100247423 178
53 3300048918 Ga0496115_0000617 Ga0496115_0000617_5112_5666 178
54 3300025961 Ga0207712_10559312 Ga0207712_105593122 179
55 3300046809 Ga0495600_0117039 Ga0495600_0117039_987_1526 179
56 iso_pu_bacteria 2643221691 2644507094 179
57 3300042876 Ga0451577_0000425 Ga0451577_0000425_71174_71722 180
58 3300001979 JGI24740J21852_10003591 JGI24740J21852_100035916 181
59 3300001989 JGI24739J22299_10009127 JGI24739J22299_100091272 181
60 3300001989 JGI24739J22299_10045170 JGI24739J22299_100451702 181
61 3300001990 JGI24737J22298_10002818 JGI24737J22298_100028184 181
62 3300001990 JGI24737J22298_10002923 JGI24737J22298_100029234 181
63 3300002067 JGI24735J21928_10000210 JGI24735J21928_100002103 181
64 3300002067 JGI24735J21928_10008070 JGI24735J21928_100080703 181
65 3300002075 JGI24738J21930_10000630 JGI24738J21930_100006307 181
66 3300002737 JGI25162J39368_1000072 JGI25162J39368_100007284 181
67 3300002737 JGI25162J39368_1000403 JGI25162J39368_100040323 181
68 3300002737 JGI25162J39368_1000450 JGI25162J39368_10004503 181
69 3300002738 JGI25154J39366_1005804 JGI25154J39366_10058042 181
70 3300002741 JGI25157J39369_1000143 JGI25157J39369_10001435 181
71 3300002741 JGI25157J39369_1000145 JGI25157J39369_100014513 181
72 3300002741 JGI25157J39369_1000210 JGI25157J39369_100021037 181
73 3300002771 JGI25163J39215_1000608 JGI25163J39215_10006085 181
74 3300002772 JGI25164J39214_1000115 JGI25164J39214_100011521 181
75 3300002772 JGI25164J39214_1000122 JGI25164J39214_100012241 181
76 3300002772 JGI25164J39214_1000276 JGI25164J39214_10002763 181
77 3300002772 JGI25164J39214_1000360 JGI25164J39214_100036017 181
78 3300002772 JGI25164J39214_1000479 JGI25164J39214_10004796 181
79 3300003187 JGI25151J46595_10000165 JGI25151J46595_100001655 181
80 3300003187 JGI25151J46595_10012116 JGI25151J46595_100121162 181
81 3300003214 JGI25165J46597_1000063 JGI25165J46597_1000063109 181
82 3300003214 JGI25165J46597_1000241 JGI25165J46597_100024119 181
83 3300003214 JGI25165J46597_1000419 JGI25165J46597_100041923 181
84 3300003214 JGI25165J46597_1001372 JGI25165J46597_10013723 181
85 3300003214 JGI25165J46597_1007774 JGI25165J46597_10077742 181
86 3300003215 JGI25153J46596_10024928 JGI25153J46596_100249283 181
87 3300003316 rootH1_10071835 rootH1_100718352 181
88 3300003316 rootH1_10110832 rootH1_101108323 181
89 3300003320 rootH2_10063162 rootH2_100631622 181
90 3300003322 rootL2_10061895 rootL2_100618952 181
91 3300003322 rootL2_10246862 rootL2_102468622 181
92 3300003323 rootH1_10327385 rootH1_103273853 181
93 3300003578 Ga0006562J51391_1027422 Ga0006562J51391_10274224 181
94 3300003751 Ga0055538_1004437 Ga0055538_10044372 181
95 3300003752 Ga0055539_1002939 Ga0055539_10029392 181
96 3300003756 Ga0055533_1000338 Ga0055533_100033811 181
97 3300003759 Ga0055525_1000135 Ga0055525_100013542 181
98 3300003760 Ga0055527_1000043 Ga0055527_100004357 181
99 3300003760 Ga0055527_1000079 Ga0055527_100007923 181
100 3300003761 Ga0055535_1000068 Ga0055535_100006884 181
101 3300003761 Ga0055535_1000071 Ga0055535_100007157 181
102 3300003761 Ga0055535_1000166 Ga0055535_100016642 181
103 3300003761 Ga0055535_1017601 Ga0055535_10176012 181
104 3300003762 Ga0055542_1000090 Ga0055542_100009084 181
105 3300003762 Ga0055542_1000096 Ga0055542_100009642 181
106 3300003762 Ga0055542_1000210 Ga0055542_100021017 181
107 3300003763 Ga0055529_1000084 Ga0055529_100008484 181
108 3300003763 Ga0055529_1000114 Ga0055529_100011463 181
109 3300003763 Ga0055529_1000394 Ga0055529_100039417 181
110 3300003763 Ga0055529_1003020 Ga0055529_10030202 181
111 3300003771 Ga0055526_1000008 Ga0055526_100000863 181
112 3300003771 Ga0055526_1056385 Ga0055526_10563852 181
113 3300003775 Ga0055524_1002861 Ga0055524_10028615 181
114 3300003775 Ga0055524_1002910 Ga0055524_10029102 181
115 3300003781 Ga0055536_1002163 Ga0055536_10021638 181
116 3300003781 Ga0055536_1003562 Ga0055536_10035624 181
117 3300003790 Ga0055528_1044392 Ga0055528_10443922 181
118 3300003791 Ga0055530_10001268 Ga0055530_100012687 181
119 3300003794 Ga0055531_10004683 Ga0055531_100046834 181
120 3300003794 Ga0055531_10007280 Ga0055531_100072802 181
121 3300003856 Ga0058692_1000040 Ga0058692_100004076 181
122 3300005262 Ga0065165_1003771 Ga0065165_10037717 181
123 3300005289 Ga0065704_10087117 Ga0065704_100871173 181
124 3300005293 Ga0065715_10001173 Ga0065715_100011737 181
125 3300005293 Ga0065715_10268777 Ga0065715_102687772 181
126 3300005327 Ga0070658_10001469 Ga0070658_1000146913 181
127 3300005327 Ga0070658_10324163 Ga0070658_103241632 181
128 3300005327 Ga0070658_10412723 Ga0070658_104127232 181
129 3300005328 Ga0070676_10018581 Ga0070676_100185813 181
130 3300005329 Ga0070683_100148589 Ga0070683_1001485892 181
131 3300005329 Ga0070683_100705389 Ga0070683_1007053891 181
132 3300005331 Ga0070670_100051522 Ga0070670_1000515223 181
133 3300005331 Ga0070670_100082595 Ga0070670_1000825952 181
134 3300005331 Ga0070670_100156808 Ga0070670_1001568083 181
135 3300005331 Ga0070670_100476960 Ga0070670_1004769602 181
136 3300005331 Ga0070670_100780618 Ga0070670_1007806182 181
137 3300005331 Ga0070670_101066703 Ga0070670_1010667032 181
138 3300005333 Ga0070677_10092159 Ga0070677_100921592 181
139 3300005334 Ga0068869_100117424 Ga0068869_1001174243 181
140 3300005334 Ga0068869_100123858 Ga0068869_1001238582 181
141 3300005334 Ga0068869_100161403 Ga0068869_1001614032 181
142 3300005335 Ga0070666_10000010 Ga0070666_10000010145 181
143 3300005335 Ga0070666_10027007 Ga0070666_100270073 181
144 3300005335 Ga0070666_10028601 Ga0070666_100286014 181
145 3300005335 Ga0070666_10092942 Ga0070666_100929422 181
146 3300005335 Ga0070666_10111766 Ga0070666_101117663 181
147 3300005335 Ga0070666_10115168 Ga0070666_101151682 181
148 3300005335 Ga0070666_10345067 Ga0070666_103450672 181
149 3300005336 Ga0070680_100264546 Ga0070680_1002645462 181
150 3300005336 Ga0070680_100822370 Ga0070680_1008223701 181
151 3300005337 Ga0070682_100363557 Ga0070682_1003635572 181
152 3300005337 Ga0070682_100546560 Ga0070682_1005465601 181
153 3300005337 Ga0070682_100791487 Ga0070682_1007914872 181
154 3300005338 Ga0068868_100088396 Ga0068868_1000883962 181
155 3300005338 Ga0068868_100139242 Ga0068868_1001392423 181
156 3300005338 Ga0068868_100360665 Ga0068868_1003606651 181
157 3300005339 Ga0070660_100071494 Ga0070660_1000714943 181
158 3300005339 Ga0070660_100886085 Ga0070660_1008860851 181
159 3300005340 Ga0070689_100002138 Ga0070689_1000021382 181
160 3300005340 Ga0070689_100260673 Ga0070689_1002606732 181
161 3300005344 Ga0070661_100008137 Ga0070661_1000081376 181
162 3300005344 Ga0070661_100139444 Ga0070661_1001394442 181
163 3300005344 Ga0070661_100233097 Ga0070661_1002330972 181
164 3300005347 Ga0070668_100049024 Ga0070668_1000490242 181
165 3300005347 Ga0070668_100649769 Ga0070668_1006497692 181
166 3300005353 Ga0070669_100042491 Ga0070669_1000424913 181
167 3300005353 Ga0070669_100168407 Ga0070669_1001684072 181
168 3300005354 Ga0070675_100043062 Ga0070675_1000430622 181
169 3300005354 Ga0070675_100638317 Ga0070675_1006383172 181
170 3300005355 Ga0070671_100112479 Ga0070671_1001124792 181
171 3300005355 Ga0070671_100204590 Ga0070671_1002045902 181
172 3300005355 Ga0070671_100281894 Ga0070671_1002818942 181
173 3300005356 Ga0070674_100096591 Ga0070674_1000965912 181
174 3300005364 Ga0070673_100050203 Ga0070673_1000502032 181
175 3300005364 Ga0070673_100257204 Ga0070673_1002572042 181
176 3300005366 Ga0070659_100004887 Ga0070659_1000048873 181
177 3300005367 Ga0070667_100000150 Ga0070667_10000015041 181
178 3300005367 Ga0070667_100034011 Ga0070667_1000340113 181
179 3300005367 Ga0070667_100075009 Ga0070667_1000750092 181
180 3300005367 Ga0070667_100087613 Ga0070667_1000876133 181
181 3300005367 Ga0070667_100305366 Ga0070667_1003053661 181
182 3300005367 Ga0070667_100348682 Ga0070667_1003486822 181
183 3300005367 Ga0070667_100454628 Ga0070667_1004546281 181
184 3300005367 Ga0070667_100973834 Ga0070667_1009738342 181
185 3300005435 Ga0070714_100000393 Ga0070714_10000039324 181
186 3300005435 Ga0070714_100000605 Ga0070714_10000060517 181
187 3300005436 Ga0070713_100061037 Ga0070713_1000610373 181
188 3300005439 Ga0070711_100095752 Ga0070711_1000957522 181
189 3300005439 Ga0070711_100385734 Ga0070711_1003857341 181
190 3300005444 Ga0070694_101277709 Ga0070694_1012777091 181
191 3300005445 Ga0070708_100139302 Ga0070708_1001393022 181
192 3300005455 Ga0070663_100000029 Ga0070663_10000002943 181
193 3300005455 Ga0070663_100021862 Ga0070663_1000218624 181
194 3300005455 Ga0070663_100037071 Ga0070663_1000370714 181
195 3300005455 Ga0070663_100172190 Ga0070663_1001721902 181
196 3300005455 Ga0070663_100240101 Ga0070663_1002401012 181
197 3300005455 Ga0070663_100737947 Ga0070663_1007379472 181
198 3300005455 Ga0070663_101065424 Ga0070663_1010654241 181
199 3300005456 Ga0070678_100041709 Ga0070678_1000417092 181
200 3300005456 Ga0070678_100127460 Ga0070678_1001274602 181
201 3300005456 Ga0070678_100149741 Ga0070678_1001497413 181
202 3300005456 Ga0070678_100157470 Ga0070678_1001574702 181
203 3300005457 Ga0070662_100021500 Ga0070662_1000215004 181
204 3300005457 Ga0070662_100549394 Ga0070662_1005493942 181
205 3300005457 Ga0070662_100844592 Ga0070662_1008445922 181
206 3300005458 Ga0070681_10028025 Ga0070681_100280252 181
207 3300005458 Ga0070681_10046264 Ga0070681_100462643 181
208 3300005458 Ga0070681_10074465 Ga0070681_100744653 181
209 3300005458 Ga0070681_10352224 Ga0070681_103522242 181
210 3300005458 Ga0070681_10537320 Ga0070681_105373201 181
211 3300005458 Ga0070681_10959932 Ga0070681_109599322 181
212 3300005459 Ga0068867_100012849 Ga0068867_1000128492 181
213 3300005459 Ga0068867_101047542 Ga0068867_1010475421 181
214 3300005466 Ga0070685_10000832 Ga0070685_100008326 181
215 3300005466 Ga0070685_10098205 Ga0070685_100982052 181
216 3300005530 Ga0070679_100323628 Ga0070679_1003236282 181
217 3300005530 Ga0070679_100338414 Ga0070679_1003384142 181
218 3300005530 Ga0070679_100354016 Ga0070679_1003540162 181
219 3300005530 Ga0070679_100378948 Ga0070679_1003789482 181
220 3300005530 Ga0070679_100494921 Ga0070679_1004949211 181
221 3300005530 Ga0070679_100677980 Ga0070679_1006779802 181
222 3300005535 Ga0070684_100194805 Ga0070684_1001948052 181
223 3300005535 Ga0070684_100555778 Ga0070684_1005557781 181
224 3300005539 Ga0068853_100002537 Ga0068853_1000025379 181
225 3300005539 Ga0068853_100002647 Ga0068853_10000264712 181
226 3300005539 Ga0068853_100027321 Ga0068853_1000273214 181
227 3300005539 Ga0068853_100035136 Ga0068853_1000351362 181
228 3300005539 Ga0068853_100035959 Ga0068853_1000359592 181
229 3300005539 Ga0068853_100054340 Ga0068853_1000543402 181
230 3300005539 Ga0068853_100120542 Ga0068853_1001205422 181
231 3300005539 Ga0068853_100139422 Ga0068853_1001394222 181
232 3300005539 Ga0068853_100406214 Ga0068853_1004062142 181
233 3300005539 Ga0068853_100436905 Ga0068853_1004369052 181
234 3300005539 Ga0068853_100442893 Ga0068853_1004428931 181
235 3300005539 Ga0068853_100599738 Ga0068853_1005997382 181
236 3300005539 Ga0068853_100600373 Ga0068853_1006003731 181
237 3300005543 Ga0070672_100013517 Ga0070672_1000135173 181
238 3300005543 Ga0070672_100167090 Ga0070672_1001670902 181
239 3300005543 Ga0070672_100480680 Ga0070672_1004806801 181
240 3300005543 Ga0070672_100597666 Ga0070672_1005976662 181
241 3300005546 Ga0070696_100006208 Ga0070696_1000062084 181
242 3300005546 Ga0070696_100031859 Ga0070696_1000318594 181
243 3300005546 Ga0070696_100641700 Ga0070696_1006417002 181
244 3300005546 Ga0070696_100736094 Ga0070696_1007360941 181
245 3300005547 Ga0070693_100005217 Ga0070693_1000052175 181
246 3300005547 Ga0070693_100088297 Ga0070693_1000882973 181
247 3300005547 Ga0070693_100164722 Ga0070693_1001647222 181
248 3300005547 Ga0070693_100331569 Ga0070693_1003315692 181
249 3300005547 Ga0070693_100446041 Ga0070693_1004460412 181
250 3300005548 Ga0070665_100000026 Ga0070665_100000026206 181
251 3300005548 Ga0070665_100001464 Ga0070665_10000146418 181
252 3300005548 Ga0070665_100004807 Ga0070665_10000480712 181
253 3300005548 Ga0070665_100020504 Ga0070665_1000205043 181
254 3300005548 Ga0070665_100084135 Ga0070665_1000841353 181
255 3300005548 Ga0070665_100242107 Ga0070665_1002421072 181
256 3300005548 Ga0070665_100585482 Ga0070665_1005854822 181
257 3300005548 Ga0070665_100710045 Ga0070665_1007100451 181
258 3300005548 Ga0070665_101291684 Ga0070665_1012916842 181
259 3300005563 Ga0068855_100000696 Ga0068855_1000006968 181
260 3300005563 Ga0068855_100010588 Ga0068855_1000105882 181
261 3300005563 Ga0068855_100057884 Ga0068855_1000578843 181
262 3300005563 Ga0068855_100057944 Ga0068855_1000579444 181
263 3300005563 Ga0068855_100176858 Ga0068855_1001768582 181
264 3300005563 Ga0068855_100177473 Ga0068855_1001774733 181
265 3300005563 Ga0068855_100431851 Ga0068855_1004318512 181
266 3300005563 Ga0068855_100538940 Ga0068855_1005389402 181
267 3300005563 Ga0068855_100690164 Ga0068855_1006901642 181
268 3300005563 Ga0068855_100698421 Ga0068855_1006984212 181
269 3300005563 Ga0068855_100740982 Ga0068855_1007409822 181
270 3300005563 Ga0068855_100818438 Ga0068855_1008184381 181
271 3300005563 Ga0068855_101124889 Ga0068855_1011248892 181
272 3300005563 Ga0068855_101256879 Ga0068855_1012568791 181
273 3300005564 Ga0070664_100085989 Ga0070664_1000859892 181
274 3300005564 Ga0070664_100177381 Ga0070664_1001773813 181
275 3300005564 Ga0070664_100184175 Ga0070664_1001841752 181
276 3300005564 Ga0070664_100292013 Ga0070664_1002920132 181
277 3300005577 Ga0068857_100014664 Ga0068857_1000146645 181
278 3300005577 Ga0068857_100041837 Ga0068857_1000418372 181
279 3300005577 Ga0068857_100164117 Ga0068857_1001641172 181
280 3300005577 Ga0068857_100230568 Ga0068857_1002305682 181
281 3300005577 Ga0068857_100300958 Ga0068857_1003009582 181
282 3300005577 Ga0068857_100426015 Ga0068857_1004260152 181
283 3300005577 Ga0068857_100661245 Ga0068857_1006612452 181
284 3300005577 Ga0068857_100700902 Ga0068857_1007009022 181
285 3300005578 Ga0068854_100000282 Ga0068854_10000028220 181
286 3300005578 Ga0068854_100006540 Ga0068854_1000065403 181
287 3300005578 Ga0068854_100006900 Ga0068854_1000069002 181
288 3300005578 Ga0068854_100104414 Ga0068854_1001044142 181
289 3300005578 Ga0068854_100202049 Ga0068854_1002020492 181
290 3300005614 Ga0068856_100000022 Ga0068856_10000002223 181
291 3300005614 Ga0068856_100013211 Ga0068856_1000132113 181
292 3300005614 Ga0068856_100036502 Ga0068856_1000365022 181
293 3300005614 Ga0068856_100119510 Ga0068856_1001195103 181
294 3300005614 Ga0068856_100164207 Ga0068856_1001642073 181
295 3300005614 Ga0068856_100191212 Ga0068856_1001912122 181
296 3300005614 Ga0068856_101036380 Ga0068856_1010363801 181
297 3300005616 Ga0068852_100006662 Ga0068852_1000066628 181
298 3300005616 Ga0068852_100071081 Ga0068852_1000710812 181
299 3300005616 Ga0068852_100081782 Ga0068852_1000817823 181
300 3300005616 Ga0068852_100176951 Ga0068852_1001769512 181
301 3300005616 Ga0068852_100373403 Ga0068852_1003734032 181
302 3300005616 Ga0068852_100393746 Ga0068852_1003937462 181
303 3300005616 Ga0068852_100542980 Ga0068852_1005429802 181
304 3300005616 Ga0068852_100569515 Ga0068852_1005695151 181
305 3300005616 Ga0068852_100716187 Ga0068852_1007161871 181
306 3300005617 Ga0068859_100001840 Ga0068859_1000018404 181
307 3300005617 Ga0068859_101588311 Ga0068859_1015883112 181
308 3300005618 Ga0068864_100014730 Ga0068864_1000147305 181
309 3300005618 Ga0068864_100112829 Ga0068864_1001128292 181
310 3300005618 Ga0068864_100177450 Ga0068864_1001774502 181
311 3300005719 Ga0068861_100087634 Ga0068861_1000876342 181
312 3300005719 Ga0068861_100755419 Ga0068861_1007554192 181
313 3300005719 Ga0068861_100939318 Ga0068861_1009393182 181
314 3300005834 Ga0068851_10006767 Ga0068851_100067674 181
315 3300005834 Ga0068851_10011459 Ga0068851_100114594 181
316 3300005834 Ga0068851_10021594 Ga0068851_100215943 181
317 3300005834 Ga0068851_10036620 Ga0068851_100366203 181
318 3300005834 Ga0068851_10059334 Ga0068851_100593342 181
319 3300005840 Ga0068870_10051228 Ga0068870_100512283 181
320 3300005841 Ga0068863_100004653 Ga0068863_10000465312 181
321 3300005841 Ga0068863_100005490 Ga0068863_1000054905 181
322 3300005841 Ga0068863_100014974 Ga0068863_1000149743 181
323 3300005841 Ga0068863_100050734 Ga0068863_1000507342 181
324 3300005841 Ga0068863_100098184 Ga0068863_1000981842 181
325 3300005841 Ga0068863_100624224 Ga0068863_1006242242 181
326 3300005841 Ga0068863_100818070 Ga0068863_1008180702 181
327 3300005841 Ga0068863_101260885 Ga0068863_1012608851 181
328 3300005842 Ga0068858_100001617 Ga0068858_1000016173 181
329 3300005842 Ga0068858_100151636 Ga0068858_1001516362 181
330 3300005842 Ga0068858_100260609 Ga0068858_1002606092 181
331 3300005842 Ga0068858_100304790 Ga0068858_1003047902 181
332 3300005842 Ga0068858_100509095 Ga0068858_1005090952 181
333 3300005842 Ga0068858_100567874 Ga0068858_1005678742 181
334 3300005842 Ga0068858_100622788 Ga0068858_1006227882 181
335 3300005843 Ga0068860_100025971 Ga0068860_1000259716 181
336 3300005843 Ga0068860_100031104 Ga0068860_1000311043 181
337 3300005843 Ga0068860_100108654 Ga0068860_1001086543 181
338 3300005843 Ga0068860_100708139 Ga0068860_1007081392 181
339 3300005843 Ga0068860_101226300 Ga0068860_1012263002 181
340 3300005844 Ga0068862_100000185 Ga0068862_10000018539 181
341 3300005844 Ga0068862_100175378 Ga0068862_1001753782 181
342 3300005937 Ga0081455_10296262 Ga0081455_102962622 181
343 3300006163 Ga0070715_10095572 Ga0070715_100955722 181
344 3300006175 Ga0070712_100398115 Ga0070712_1003981152 181
345 3300006186 Ga0075369_10187921 Ga0075369_101879212 181
346 3300006237 Ga0097621_100019859 Ga0097621_1000198593 181
347 3300006237 Ga0097621_100021471 Ga0097621_1000214712 181
348 3300006237 Ga0097621_100038212 Ga0097621_1000382123 181
349 3300006237 Ga0097621_100133587 Ga0097621_1001335872 181
350 3300006237 Ga0097621_100167732 Ga0097621_1001677323 181
351 3300006237 Ga0097621_100483758 Ga0097621_1004837582 181
352 3300006237 Ga0097621_101517032 Ga0097621_1015170321 181
353 3300006358 Ga0068871_100059368 Ga0068871_1000593682 181
354 3300006358 Ga0068871_100064765 Ga0068871_1000647653 181
355 3300006358 Ga0068871_100119581 Ga0068871_1001195812 181
356 3300006358 Ga0068871_100236037 Ga0068871_1002360372 181
357 3300006358 Ga0068871_100254438 Ga0068871_1002544382 181
358 3300006358 Ga0068871_100825699 Ga0068871_1008256992 181
359 3300006881 Ga0068865_100013181 Ga0068865_1000131814 181
360 3300006881 Ga0068865_100096192 Ga0068865_1000961922 181
361 3300006881 Ga0068865_100131071 Ga0068865_1001310712 181
362 3300006881 Ga0068865_100208584 Ga0068865_1002085842 181
363 3300006931 Ga0097620_100001840 Ga0097620_1000018404 181
364 3300006931 Ga0097620_101588824 Ga0097620_1015888242 181
365 3300009092 Ga0105250_10226338 Ga0105250_102263381 181
366 3300009093 Ga0105240_10000359 Ga0105240_1000035964 181
367 3300009093 Ga0105240_10000633 Ga0105240_1000063342 181
368 3300009093 Ga0105240_10002007 Ga0105240_100020077 181
369 3300009093 Ga0105240_10007977 Ga0105240_1000797713 181
370 3300009093 Ga0105240_10009334 Ga0105240_100093344 181
371 3300009093 Ga0105240_10013427 Ga0105240_100134276 181
372 3300009093 Ga0105240_10022190 Ga0105240_100221905 181
373 3300009093 Ga0105240_10050541 Ga0105240_100505416 181
374 3300009093 Ga0105240_10074426 Ga0105240_100744264 181
375 3300009093 Ga0105240_10209967 Ga0105240_102099672 181
376 3300009093 Ga0105240_10884759 Ga0105240_108847592 181
377 3300009098 Ga0105245_10377566 Ga0105245_103775662 181
378 3300009098 Ga0105245_10788223 Ga0105245_107882232 181
379 3300009098 Ga0105245_10947848 Ga0105245_109478482 181
380 3300009098 Ga0105245_11070398 Ga0105245_110703981 181
381 3300009148 Ga0105243_10073372 Ga0105243_100733723 181
382 3300009174 Ga0105241_10008871 Ga0105241_100088714 181
383 3300009174 Ga0105241_10037744 Ga0105241_100377442 181
384 3300009174 Ga0105241_10046045 Ga0105241_100460452 181
385 3300009174 Ga0105241_10064718 Ga0105241_100647183 181
386 3300009174 Ga0105241_10214683 Ga0105241_102146831 181
387 3300009174 Ga0105241_10251234 Ga0105241_102512342 181
388 3300009174 Ga0105241_10857754 Ga0105241_108577542 181
389 3300009174 Ga0105241_11254522 Ga0105241_112545222 181
390 3300009176 Ga0105242_10002842 Ga0105242_100028424 181
391 3300009176 Ga0105242_10041120 Ga0105242_100411202 181
392 3300009176 Ga0105242_10593268 Ga0105242_105932682 181
393 3300009176 Ga0105242_10722576 Ga0105242_107225761 181
394 3300009177 Ga0105248_10000246 Ga0105248_1000024623 181
395 3300009177 Ga0105248_10044683 Ga0105248_100446833 181
396 3300009177 Ga0105248_10096662 Ga0105248_100966622 181
397 3300009177 Ga0105248_10466046 Ga0105248_104660462 181
398 3300009177 Ga0105248_10941610 Ga0105248_109416102 181
399 3300009177 Ga0105248_11019248 Ga0105248_110192482 181
400 3300009545 Ga0105237_10000148 Ga0105237_1000014876 181
401 3300009545 Ga0105237_10000231 Ga0105237_1000023136 181
402 3300009545 Ga0105237_10000383 Ga0105237_1000038338 181
403 3300009545 Ga0105237_10004315 Ga0105237_100043155 181
404 3300009545 Ga0105237_10128389 Ga0105237_101283892 181
405 3300009545 Ga0105237_10144331 Ga0105237_101443312 181
406 3300009545 Ga0105237_10173267 Ga0105237_101732672 181
407 3300009545 Ga0105237_10345613 Ga0105237_103456132 181
408 3300009545 Ga0105237_10413818 Ga0105237_104138182 181
409 3300009545 Ga0105237_10479787 Ga0105237_104797872 181
410 3300009545 Ga0105237_10544780 Ga0105237_105447801 181
411 3300009545 Ga0105237_10709464 Ga0105237_107094641 181
412 3300009551 Ga0105238_10000044 Ga0105238_1000004474 181
413 3300009551 Ga0105238_10007919 Ga0105238_100079194 181
414 3300009551 Ga0105238_10010855 Ga0105238_100108554 181
415 3300009551 Ga0105238_10034862 Ga0105238_100348625 181
416 3300009551 Ga0105238_10049939 Ga0105238_100499392 181
417 3300009551 Ga0105238_10202715 Ga0105238_102027152 181
418 3300009551 Ga0105238_10217876 Ga0105238_102178762 181
419 3300009551 Ga0105238_10333048 Ga0105238_103330482 181
420 3300009551 Ga0105238_10538112 Ga0105238_105381122 181
421 3300009551 Ga0105238_10733790 Ga0105238_107337902 181
422 3300009553 Ga0105249_10001225 Ga0105249_100012258 181
423 3300009553 Ga0105249_10027305 Ga0105249_100273053 181
424 3300009553 Ga0105249_10380955 Ga0105249_103809552 181
425 3300009978 Ga0105148_100676 Ga0105148_1006763 181
426 3300009984 Ga0105029_100269 Ga0105029_1002692 181
427 3300010375 Ga0105239_10000033 Ga0105239_10000033134 181
428 3300010375 Ga0105239_10003454 Ga0105239_100034549 181
429 3300010375 Ga0105239_10009780 Ga0105239_100097809 181
430 3300010375 Ga0105239_10014339 Ga0105239_1001433911 181
431 3300010375 Ga0105239_10021477 Ga0105239_100214772 181
432 3300010375 Ga0105239_10026779 Ga0105239_100267793 181
433 3300010375 Ga0105239_10121007 Ga0105239_101210073 181
434 3300010375 Ga0105239_10152397 Ga0105239_101523973 181
435 3300010375 Ga0105239_10157972 Ga0105239_101579722 181
436 3300010375 Ga0105239_10256728 Ga0105239_102567282 181
437 3300010375 Ga0105239_10286830 Ga0105239_102868302 181
438 3300010375 Ga0105239_10660194 Ga0105239_106601942 181
439 3300010375 Ga0105239_10699703 Ga0105239_106997032 181
440 3300011119 Ga0105246_10009566 Ga0105246_100095665 181
441 3300012482 Ga0157318_1000739 Ga0157318_10007392 181
442 3300012500 Ga0157314_1000098 Ga0157314_10000989 181
443 3300012500 Ga0157314_1001103 Ga0157314_10011031 181
444 3300012513 Ga0157326_1021775 Ga0157326_10217752 181
445 3300013100 Ga0157373_10034519 Ga0157373_100345194 181
446 3300013100 Ga0157373_10048721 Ga0157373_100487212 181
447 3300013102 Ga0157371_10021671 Ga0157371_100216713 181
448 3300013104 Ga0157370_10000495 Ga0157370_1000049514 181
449 3300013104 Ga0157370_10002719 Ga0157370_100027194 181
450 3300013104 Ga0157370_10004280 Ga0157370_1000428013 181
451 3300013104 Ga0157370_10070640 Ga0157370_100706403 181
452 3300013104 Ga0157370_10095746 Ga0157370_100957462 181
453 3300013104 Ga0157370_10099538 Ga0157370_100995382 181
454 3300013104 Ga0157370_10121328 Ga0157370_101213282 181
455 3300013104 Ga0157370_10123802 Ga0157370_101238022 181
456 3300013104 Ga0157370_10133349 Ga0157370_101333492 181
457 3300013104 Ga0157370_10168588 Ga0157370_101685883 181
458 3300013104 Ga0157370_10189039 Ga0157370_101890393 181
459 3300013104 Ga0157370_10253027 Ga0157370_102530273 181
460 3300013104 Ga0157370_10444388 Ga0157370_104443882 181
461 3300013104 Ga0157370_10535365 Ga0157370_105353651 181
462 3300013104 Ga0157370_11027177 Ga0157370_110271772 181
463 3300013105 Ga0157369_10000464 Ga0157369_1000046414 181
464 3300013105 Ga0157369_10005929 Ga0157369_100059295 181
465 3300013105 Ga0157369_10031464 Ga0157369_100314643 181
466 3300013105 Ga0157369_10262059 Ga0157369_102620592 181
467 3300013105 Ga0157369_10281052 Ga0157369_102810522 181
468 3300013105 Ga0157369_10778324 Ga0157369_107783241 181
469 3300013105 Ga0157369_10976478 Ga0157369_109764782 181
470 3300013296 Ga0157374_10066420 Ga0157374_100664202 181
471 3300013296 Ga0157374_10130567 Ga0157374_101305672 181
472 3300013296 Ga0157374_10474783 Ga0157374_104747832 181
473 3300013297 Ga0157378_10001405 Ga0157378_100014056 181
474 3300013297 Ga0157378_10691065 Ga0157378_106910651 181
475 3300013297 Ga0157378_11048265 Ga0157378_110482652 181
476 3300013306 Ga0163162_10000021 Ga0163162_10000021192 181
477 3300013306 Ga0163162_10000193 Ga0163162_1000019310 181
478 3300013306 Ga0163162_10002029 Ga0163162_100020299 181
479 3300013306 Ga0163162_10064563 Ga0163162_100645633 181
480 3300013306 Ga0163162_10069740 Ga0163162_100697403 181
481 3300013306 Ga0163162_10153910 Ga0163162_101539101 181
482 3300013306 Ga0163162_10449684 Ga0163162_104496842 181
483 3300013306 Ga0163162_10638951 Ga0163162_106389512 181
484 3300013307 Ga0157372_10011884 Ga0157372_100118842 181
485 3300013307 Ga0157372_10014982 Ga0157372_100149824 181
486 3300013307 Ga0157372_10052222 Ga0157372_100522224 181
487 3300013307 Ga0157372_10064309 Ga0157372_100643093 181
488 3300013307 Ga0157372_10167991 Ga0157372_101679912 181
489 3300013307 Ga0157372_10186027 Ga0157372_101860273 181
490 3300013307 Ga0157372_10299531 Ga0157372_102995312 181
491 3300013307 Ga0157372_10423863 Ga0157372_104238632 181
492 3300013307 Ga0157372_10444901 Ga0157372_104449012 181
493 3300013307 Ga0157372_10704796 Ga0157372_107047962 181
494 3300013307 Ga0157372_10889204 Ga0157372_108892042 181
495 3300013307 Ga0157372_10892887 Ga0157372_108928872 181
496 3300013307 Ga0157372_11088308 Ga0157372_110883082 181
497 3300013307 Ga0157372_11158308 Ga0157372_111583082 181
498 3300013307 Ga0157372_12292690 Ga0157372_122926901 181
499 3300013308 Ga0157375_10000950 Ga0157375_1000095010 181
500 3300013308 Ga0157375_10016908 Ga0157375_100169085 181
501 3300013308 Ga0157375_10050059 Ga0157375_100500595 181
502 3300014325 Ga0163163_10000403 Ga0163163_100004038 181
503 3300014325 Ga0163163_10006152 Ga0163163_100061527 181
504 3300014325 Ga0163163_10113006 Ga0163163_101130062 181
505 3300014497 Ga0182008_10000209 Ga0182008_1000020931 181
506 3300014497 Ga0182008_10030065 Ga0182008_100300652 181
507 3300014497 Ga0182008_10032240 Ga0182008_100322402 181
508 3300014497 Ga0182008_10046665 Ga0182008_100466652 181
509 3300014968 Ga0157379_10003888 Ga0157379_100038884 181
510 3300014968 Ga0157379_10202302 Ga0157379_102023023 181
511 3300014968 Ga0157379_10208706 Ga0157379_102087062 181
512 3300014969 Ga0157376_10006685 Ga0157376_100066854 181
513 3300014969 Ga0157376_10017225 Ga0157376_100172253 181
514 3300014969 Ga0157376_10019219 Ga0157376_100192194 181
515 3300014969 Ga0157376_10107390 Ga0157376_101073902 181
516 3300014969 Ga0157376_10124715 Ga0157376_101247152 181
517 3300014969 Ga0157376_10334337 Ga0157376_103343372 181
518 3300015261 Ga0182006_1000034 Ga0182006_100003499 181
519 3300015261 Ga0182006_1007770 Ga0182006_10077703 181
520 3300015261 Ga0182006_1032677 Ga0182006_10326772 181
521 3300015261 Ga0182006_1047053 Ga0182006_10470532 181
522 3300015262 Ga0182007_10001346 Ga0182007_100013465 181
523 3300015262 Ga0182007_10005029 Ga0182007_100050293 181
524 3300015262 Ga0182007_10052110 Ga0182007_100521102 181
525 3300015262 Ga0182007_10067388 Ga0182007_100673882 181
526 3300015262 Ga0182007_10090807 Ga0182007_100908072 181
527 3300015265 Ga0182005_1000064 Ga0182005_100006439 181
528 3300015265 Ga0182005_1002932 Ga0182005_10029325 181
529 3300015265 Ga0182005_1016840 Ga0182005_10168402 181
530 3300015685 Ga0183369_1003 Ga0183369_1003172 181
531 3300015687 Ga0183368_1002 Ga0183368_1002839 181
532 3300017792 Ga0163161_10001385 Ga0163161_100013857 181
533 3300017792 Ga0163161_10038479 Ga0163161_100384793 181
534 3300020082 Ga0206353_10771426 Ga0206353_107714262 181
535 3300020610 Ga0154015_1053000 Ga0154015_10530002 181
536 3300022467 Ga0224712_10075440 Ga0224712_100754401 181
537 3300025206 Ga0209435_108278 Ga0209435_1082782 181
538 3300025207 Ga0209760_100294 Ga0209760_1002945 181
539 3300025224 Ga0209784_100042 Ga0209784_100042113 181
540 3300025226 Ga0209674_100033 Ga0209674_100033276 181
541 3300025226 Ga0209674_100441 Ga0209674_1004415 181
542 3300025226 Ga0209674_101207 Ga0209674_1012074 181
543 3300025226 Ga0209674_103716 Ga0209674_1037162 181
544 3300025228 Ga0209672_100004 Ga0209672_100004805 181
545 3300025228 Ga0209672_100008 Ga0209672_100008720 181
546 3300025228 Ga0209672_100916 Ga0209672_1009165 181
547 3300025228 Ga0209672_102162 Ga0209672_1021624 181
548 3300025230 Ga0209563_100036 Ga0209563_10003689 181
549 3300025231 Ga0207427_100037 Ga0207427_100037131 181
550 3300025231 Ga0207427_100049 Ga0207427_100049101 181
551 3300025231 Ga0207427_100078 Ga0207427_100078111 181
552 3300025231 Ga0207427_100096 Ga0207427_10009682 181
553 3300025231 Ga0207427_105412 Ga0207427_1054123 181
554 3300025233 Ga0209437_100074 Ga0209437_100074186 181
555 3300025233 Ga0209437_100083 Ga0209437_100083141 181
556 3300025233 Ga0209437_100090 Ga0209437_10009090 181
557 3300025233 Ga0209437_100157 Ga0209437_100157132 181
558 3300025233 Ga0209437_100691 Ga0209437_1006913 181
559 3300025233 Ga0209437_100872 Ga0209437_1008726 181
560 3300025233 Ga0209437_101965 Ga0209437_1019654 181
561 3300025233 Ga0209437_104672 Ga0209437_1046722 181
562 3300025242 Ga0209258_100003 Ga0209258_100003805 181
563 3300025242 Ga0209258_100004 Ga0209258_100004469 181
564 3300025242 Ga0209258_100008 Ga0209258_10000894 181
565 3300025242 Ga0209258_100136 Ga0209258_10013624 181
566 3300025242 Ga0209258_101400 Ga0209258_1014004 181
567 3300025242 Ga0209258_110007 Ga0209258_1100072 181
568 3300025246 Ga0209646_1000863 Ga0209646_10008636 181
569 3300025246 Ga0209646_1012353 Ga0209646_10123532 181
570 3300025250 Ga0209026_1000045 Ga0209026_100004596 181
571 3300025250 Ga0209026_1000072 Ga0209026_100007282 181
572 3300025250 Ga0209026_1000129 Ga0209026_100012983 181
573 3300025250 Ga0209026_1000153 Ga0209026_100015371 181
574 3300025250 Ga0209026_1000442 Ga0209026_100044219 181
575 3300025250 Ga0209026_1016918 Ga0209026_10169182 181
576 3300025250 Ga0209026_1021965 Ga0209026_10219652 181
577 3300025253 Ga0209677_100348 Ga0209677_1003483 181
578 3300025254 Ga0209148_1000025 Ga0209148_1000025109 181
579 3300025254 Ga0209148_1000036 Ga0209148_1000036187 181
580 3300025254 Ga0209148_1000053 Ga0209148_1000053214 181
581 3300025254 Ga0209148_1000791 Ga0209148_10007918 181
582 3300025256 Ga0209759_1000140 Ga0209759_100014036 181
583 3300025256 Ga0209759_1000831 Ga0209759_10008315 181
584 3300025256 Ga0209759_1002615 Ga0209759_10026152 181
585 3300025256 Ga0209759_1003821 Ga0209759_10038215 181
586 3300025258 Ga0209129_1000604 Ga0209129_100060420 181
587 3300025258 Ga0209129_1002103 Ga0209129_10021036 181
588 3300025261 Ga0209233_1000040 Ga0209233_1000040185 181
589 3300025261 Ga0209233_1000075 Ga0209233_1000075183 181
590 3300025261 Ga0209233_1000077 Ga0209233_1000077187 181
591 3300025261 Ga0209233_1000096 Ga0209233_1000096132 181
592 3300025261 Ga0209233_1003582 Ga0209233_10035823 181
593 3300025261 Ga0209233_1028224 Ga0209233_10282242 181
594 3300025272 Ga0209455_1000004 Ga0209455_1000004805 181
595 3300025272 Ga0209455_1000007 Ga0209455_1000007214 181
596 3300025272 Ga0209455_1000071 Ga0209455_1000071186 181
597 3300025272 Ga0209455_1000215 Ga0209455_100021512 181
598 3300025272 Ga0209455_1013624 Ga0209455_10136242 181
599 3300025273 Ga0209673_1003811 Ga0209673_10038113 181
600 3300025284 Ga0209130_1007509 Ga0209130_10075093 181
601 3300025291 Ga0209675_1014295 Ga0209675_10142952 181
602 3300025291 Ga0209675_1017692 Ga0209675_10176922 181
603 3300025292 Ga0209676_1001264 Ga0209676_10012645 181
604 3300025292 Ga0209676_1002621 Ga0209676_10026219 181
605 3300025292 Ga0209676_1007907 Ga0209676_10079073 181
606 3300025292 Ga0209676_1008848 Ga0209676_10088488 181
607 3300025292 Ga0209676_1036126 Ga0209676_10361262 181
608 3300025294 Ga0209025_1001373 Ga0209025_100137314 181
609 3300025294 Ga0209025_1034165 Ga0209025_10341652 181
610 3300025294 Ga0209025_1050506 Ga0209025_10505061 181
611 3300025294 Ga0209025_1053805 Ga0209025_10538052 181
612 3300025294 Ga0209025_1055046 Ga0209025_10550462 181
613 3300025295 Ga0209564_1009685 Ga0209564_10096854 181
614 3300025297 Ga0209758_1000481 Ga0209758_10004815 181
615 3300025297 Ga0209758_1058569 Ga0209758_10585692 181
616 3300025297 Ga0209758_1061354 Ga0209758_10613542 181
617 3300025298 Ga0209050_1001626 Ga0209050_100162612 181
618 3300025299 Ga0209256_1001873 Ga0209256_100187310 181
619 3300025299 Ga0209256_1002659 Ga0209256_100265910 181
620 3300025299 Ga0209256_1010555 Ga0209256_10105554 181
621 3300025299 Ga0209256_1011879 Ga0209256_10118794 181
622 3300025303 Ga0209051_1005661 Ga0209051_10056616 181
623 3300025304 Ga0209257_1000274 Ga0209257_100027487 181
624 3300025304 Ga0209257_1000307 Ga0209257_100030786 181
625 3300025304 Ga0209257_1002641 Ga0209257_10026414 181
626 3300025304 Ga0209257_1007987 Ga0209257_10079872 181
627 3300025321 Ga0207656_10004823 Ga0207656_100048233 181
628 3300025321 Ga0207656_10411102 Ga0207656_104111022 181
629 3300025900 Ga0207710_10028650 Ga0207710_100286501 181
630 3300025903 Ga0207680_10000002 Ga0207680_10000002246 181
631 3300025903 Ga0207680_10000092 Ga0207680_1000009220 181
632 3300025903 Ga0207680_10034939 Ga0207680_100349392 181
633 3300025903 Ga0207680_10037462 Ga0207680_100374622 181
634 3300025903 Ga0207680_10095683 Ga0207680_100956832 181
635 3300025904 Ga0207647_10000010 Ga0207647_10000010115 181
636 3300025904 Ga0207647_10000066 Ga0207647_100000663 181
637 3300025904 Ga0207647_10004970 Ga0207647_100049705 181
638 3300025904 Ga0207647_10006265 Ga0207647_100062655 181
639 3300025904 Ga0207647_10010431 Ga0207647_100104315 181
640 3300025904 Ga0207647_10012093 Ga0207647_100120934 181
641 3300025905 Ga0207685_10072312 Ga0207685_100723122 181
642 3300025906 Ga0207699_10505620 Ga0207699_105056202 181
643 3300025907 Ga0207645_10043108 Ga0207645_100431082 181
644 3300025907 Ga0207645_10096932 Ga0207645_100969322 181
645 3300025908 Ga0207643_10008509 Ga0207643_100085095 181
646 3300025909 Ga0207705_10001094 Ga0207705_1000109413 181
647 3300025909 Ga0207705_10035118 Ga0207705_100351182 181
648 3300025909 Ga0207705_10039069 Ga0207705_100390693 181
649 3300025909 Ga0207705_10238245 Ga0207705_102382452 181
650 3300025909 Ga0207705_10303490 Ga0207705_103034902 181
651 3300025911 Ga0207654_10001128 Ga0207654_100011287 181
652 3300025911 Ga0207654_10181410 Ga0207654_101814102 181
653 3300025911 Ga0207654_10229994 Ga0207654_102299941 181
654 3300025911 Ga0207654_10733376 Ga0207654_107333761 181
655 3300025911 Ga0207654_10766565 Ga0207654_107665651 181
656 3300025912 Ga0207707_10010148 Ga0207707_100101482 181
657 3300025912 Ga0207707_10057230 Ga0207707_100572303 181
658 3300025912 Ga0207707_10129717 Ga0207707_101297172 181
659 3300025912 Ga0207707_10292260 Ga0207707_102922602 181
660 3300025912 Ga0207707_10296316 Ga0207707_102963162 181
661 3300025913 Ga0207695_10000014 Ga0207695_10000014516 181
662 3300025913 Ga0207695_10000322 Ga0207695_1000032259 181
663 3300025913 Ga0207695_10000809 Ga0207695_1000080930 181
664 3300025913 Ga0207695_10000856 Ga0207695_1000085631 181
665 3300025913 Ga0207695_10005750 Ga0207695_100057502 181
666 3300025913 Ga0207695_10006442 Ga0207695_100064423 181
667 3300025913 Ga0207695_10008494 Ga0207695_1000849411 181
668 3300025913 Ga0207695_10032475 Ga0207695_100324751 181
669 3300025913 Ga0207695_10046519 Ga0207695_100465192 181
670 3300025913 Ga0207695_10069276 Ga0207695_100692763 181
671 3300025913 Ga0207695_10366560 Ga0207695_103665602 181
672 3300025913 Ga0207695_11306862 Ga0207695_113068621 181
673 3300025914 Ga0207671_10000028 Ga0207671_100000289 181
674 3300025914 Ga0207671_10000357 Ga0207671_1000035720 181
675 3300025914 Ga0207671_10001588 Ga0207671_1000158811 181
676 3300025914 Ga0207671_10004399 Ga0207671_100043994 181
677 3300025914 Ga0207671_10318069 Ga0207671_103180692 181
678 3300025914 Ga0207671_10458907 Ga0207671_104589072 181
679 3300025916 Ga0207663_10264346 Ga0207663_102643462 181
680 3300025916 Ga0207663_10308392 Ga0207663_103083922 181
681 3300025917 Ga0207660_10097251 Ga0207660_100972512 181
682 3300025917 Ga0207660_10263573 Ga0207660_102635732 181
683 3300025917 Ga0207660_10390745 Ga0207660_103907452 181
684 3300025919 Ga0207657_10009521 Ga0207657_100095214 181
685 3300025919 Ga0207657_10011833 Ga0207657_100118339 181
686 3300025919 Ga0207657_10335228 Ga0207657_103352282 181
687 3300025919 Ga0207657_10861449 Ga0207657_108614492 181
688 3300025920 Ga0207649_10002084 Ga0207649_100020848 181
689 3300025920 Ga0207649_10032583 Ga0207649_100325833 181
690 3300025920 Ga0207649_10033209 Ga0207649_100332092 181
691 3300025920 Ga0207649_10197571 Ga0207649_101975712 181
692 3300025920 Ga0207649_10424825 Ga0207649_104248251 181
693 3300025921 Ga0207652_10165752 Ga0207652_101657522 181
694 3300025921 Ga0207652_10218605 Ga0207652_102186052 181
695 3300025921 Ga0207652_10297561 Ga0207652_102975612 181
696 3300025921 Ga0207652_10342189 Ga0207652_103421892 181
697 3300025923 Ga0207681_10007276 Ga0207681_100072762 181
698 3300025923 Ga0207681_10033681 Ga0207681_100336813 181
699 3300025923 Ga0207681_10503930 Ga0207681_105039302 181
700 3300025924 Ga0207694_10000109 Ga0207694_1000010981 181
701 3300025924 Ga0207694_10000850 Ga0207694_1000085019 181
702 3300025924 Ga0207694_10001341 Ga0207694_100013414 181
703 3300025924 Ga0207694_10097782 Ga0207694_100977822 181
704 3300025924 Ga0207694_10140943 Ga0207694_101409432 181
705 3300025924 Ga0207694_10185078 Ga0207694_101850782 181
706 3300025925 Ga0207650_10021916 Ga0207650_100219162 181
707 3300025925 Ga0207650_10229804 Ga0207650_102298042 181
708 3300025926 Ga0207659_10373732 Ga0207659_103737322 181
709 3300025927 Ga0207687_10344965 Ga0207687_103449652 181
710 3300025927 Ga0207687_10554219 Ga0207687_105542192 181
711 3300025927 Ga0207687_11142225 Ga0207687_111422251 181
712 3300025929 Ga0207664_10000553 Ga0207664_100005534 181
713 3300025929 Ga0207664_10000624 Ga0207664_100006246 181
714 3300025931 Ga0207644_10174658 Ga0207644_101746582 181
715 3300025931 Ga0207644_10556744 Ga0207644_105567442 181
716 3300025932 Ga0207690_10000375 Ga0207690_100003755 181
717 3300025932 Ga0207690_10006084 Ga0207690_100060843 181
718 3300025932 Ga0207690_10030475 Ga0207690_100304753 181
719 3300025932 Ga0207690_10145847 Ga0207690_101458472 181
720 3300025933 Ga0207706_10042475 Ga0207706_100424752 181
721 3300025933 Ga0207706_10049684 Ga0207706_100496843 181
722 3300025934 Ga0207686_10003423 Ga0207686_100034233 181
723 3300025935 Ga0207709_10005775 Ga0207709_100057757 181
724 3300025936 Ga0207670_10001621 Ga0207670_100016218 181
725 3300025936 Ga0207670_10446551 Ga0207670_104465511 181
726 3300025936 Ga0207670_10758146 Ga0207670_107581462 181
727 3300025938 Ga0207704_10010792 Ga0207704_100107922 181
728 3300025938 Ga0207704_10032219 Ga0207704_100322192 181
729 3300025938 Ga0207704_10069820 Ga0207704_100698202 181
730 3300025938 Ga0207704_10078000 Ga0207704_100780002 181
731 3300025938 Ga0207704_10090427 Ga0207704_100904272 181
732 3300025940 Ga0207691_10028648 Ga0207691_100286482 181
733 3300025940 Ga0207691_10082771 Ga0207691_100827713 181
734 3300025940 Ga0207691_10166529 Ga0207691_101665292 181
735 3300025941 Ga0207711_10002283 Ga0207711_100022835 181
736 3300025941 Ga0207711_10160406 Ga0207711_101604062 181
737 3300025941 Ga0207711_10226669 Ga0207711_102266692 181
738 3300025941 Ga0207711_10438985 Ga0207711_104389852 181
739 3300025941 Ga0207711_10896166 Ga0207711_108961662 181
740 3300025942 Ga0207689_10070324 Ga0207689_100703242 181
741 3300025942 Ga0207689_10237908 Ga0207689_102379082 181
742 3300025942 Ga0207689_10322233 Ga0207689_103222332 181
743 3300025942 Ga0207689_10453363 Ga0207689_104533632 181
744 3300025944 Ga0207661_10258427 Ga0207661_102584272 181
745 3300025949 Ga0207667_10000080 Ga0207667_100000809 181
746 3300025949 Ga0207667_10000344 Ga0207667_1000034428 181
747 3300025949 Ga0207667_10056069 Ga0207667_100560693 181
748 3300025949 Ga0207667_10092352 Ga0207667_100923522 181
749 3300025949 Ga0207667_10092784 Ga0207667_100927842 181
750 3300025949 Ga0207667_10186083 Ga0207667_101860832 181
751 3300025949 Ga0207667_10206622 Ga0207667_102066222 181
752 3300025949 Ga0207667_10599640 Ga0207667_105996402 181
753 3300025949 Ga0207667_11040940 Ga0207667_110409401 181
754 3300025949 Ga0207667_11463710 Ga0207667_114637101 181
755 3300025960 Ga0207651_10183658 Ga0207651_101836582 181
756 3300025960 Ga0207651_10392254 Ga0207651_103922541 181
757 3300025961 Ga0207712_10001195 Ga0207712_100011955 181
758 3300025961 Ga0207712_10001216 Ga0207712_100012164 181
759 3300025972 Ga0207668_10011602 Ga0207668_100116023 181
760 3300025972 Ga0207668_10166366 Ga0207668_101663662 181
761 3300025972 Ga0207668_10203353 Ga0207668_102033532 181
762 3300025972 Ga0207668_10254721 Ga0207668_102547212 181
763 3300025972 Ga0207668_10359841 Ga0207668_103598412 181
764 3300025981 Ga0207640_10000190 Ga0207640_1000019028 181
765 3300025981 Ga0207640_10001549 Ga0207640_100015499 181
766 3300025981 Ga0207640_10003414 Ga0207640_100034149 181
767 3300025981 Ga0207640_10016638 Ga0207640_100166382 181
768 3300025981 Ga0207640_10163223 Ga0207640_101632232 181
769 3300025981 Ga0207640_10241418 Ga0207640_102414182 181
770 3300025986 Ga0207658_10000013 Ga0207658_10000013167 181
771 3300025986 Ga0207658_10029268 Ga0207658_100292683 181
772 3300025986 Ga0207658_10118548 Ga0207658_101185482 181
773 3300025986 Ga0207658_10329933 Ga0207658_103299332 181
774 3300025986 Ga0207658_10667254 Ga0207658_106672542 181
775 3300025986 Ga0207658_10891040 Ga0207658_108910402 181
776 3300025986 Ga0207658_10892344 Ga0207658_108923442 181
777 3300026023 Ga0207677_10086112 Ga0207677_100861123 181
778 3300026023 Ga0207677_10106765 Ga0207677_101067652 181
779 3300026035 Ga0207703_10000793 Ga0207703_100007933 181
780 3300026035 Ga0207703_10269178 Ga0207703_102691782 181
781 3300026035 Ga0207703_10395672 Ga0207703_103956722 181
782 3300026035 Ga0207703_10397394 Ga0207703_103973942 181
783 3300026041 Ga0207639_10000479 Ga0207639_1000047919 181
784 3300026041 Ga0207639_10000595 Ga0207639_1000059519 181
785 3300026041 Ga0207639_10004215 Ga0207639_100042155 181
786 3300026041 Ga0207639_10035499 Ga0207639_100354992 181
787 3300026041 Ga0207639_10082054 Ga0207639_100820543 181
788 3300026041 Ga0207639_10255015 Ga0207639_102550152 181
789 3300026041 Ga0207639_10366920 Ga0207639_103669202 181
790 3300026041 Ga0207639_10479588 Ga0207639_104795882 181
791 3300026041 Ga0207639_10504114 Ga0207639_105041142 181
792 3300026041 Ga0207639_10713675 Ga0207639_107136751 181
793 3300026041 Ga0207639_11203159 Ga0207639_112031592 181
794 3300026067 Ga0207678_10000035 Ga0207678_1000003574 181
795 3300026067 Ga0207678_10012465 Ga0207678_100124653 181
796 3300026067 Ga0207678_10016540 Ga0207678_100165406 181
797 3300026067 Ga0207678_10055104 Ga0207678_100551042 181
798 3300026067 Ga0207678_10208614 Ga0207678_102086142 181
799 3300026067 Ga0207678_10702636 Ga0207678_107026362 181
800 3300026075 Ga0207708_10303999 Ga0207708_103039992 181
801 3300026078 Ga0207702_10000049 Ga0207702_1000004992 181
802 3300026078 Ga0207702_10000380 Ga0207702_100003806 181
803 3300026078 Ga0207702_10010670 Ga0207702_100106703 181
804 3300026078 Ga0207702_10011899 Ga0207702_100118993 181
805 3300026078 Ga0207702_10197901 Ga0207702_101979012 181
806 3300026078 Ga0207702_10722423 Ga0207702_107224232 181
807 3300026078 Ga0207702_10821687 Ga0207702_108216872 181
808 3300026088 Ga0207641_10006513 Ga0207641_100065134 181
809 3300026088 Ga0207641_10025673 Ga0207641_100256731 181
810 3300026088 Ga0207641_10162028 Ga0207641_101620281 181
811 3300026088 Ga0207641_10278074 Ga0207641_102780742 181
812 3300026088 Ga0207641_10415131 Ga0207641_104151312 181
813 3300026089 Ga0207648_10011901 Ga0207648_100119014 181
814 3300026089 Ga0207648_10076457 Ga0207648_100764573 181
815 3300026089 Ga0207648_10873773 Ga0207648_108737732 181
816 3300026095 Ga0207676_10009897 Ga0207676_100098975 181
817 3300026095 Ga0207676_10188024 Ga0207676_101880242 181
818 3300026095 Ga0207676_10200669 Ga0207676_102006692 181
819 3300026116 Ga0207674_10000090 Ga0207674_1000009076 181
820 3300026116 Ga0207674_10005138 Ga0207674_1000513810 181
821 3300026116 Ga0207674_10082164 Ga0207674_100821643 181
822 3300026116 Ga0207674_10089465 Ga0207674_100894653 181
823 3300026116 Ga0207674_10217853 Ga0207674_102178532 181
824 3300026118 Ga0207675_100022876 Ga0207675_1000228766 181
825 3300026118 Ga0207675_100368478 Ga0207675_1003684782 181
826 3300026118 Ga0207675_100722810 Ga0207675_1007228102 181
827 3300026121 Ga0207683_10015518 Ga0207683_100155182 181
828 3300026121 Ga0207683_10114431 Ga0207683_101144312 181
829 3300026121 Ga0207683_10125025 Ga0207683_101250252 181
830 3300026121 Ga0207683_10221619 Ga0207683_102216192 181
831 3300026142 Ga0207698_10000982 Ga0207698_100009829 181
832 3300026142 Ga0207698_10007692 Ga0207698_100076926 181
833 3300026142 Ga0207698_10018109 Ga0207698_100181095 181
834 3300026142 Ga0207698_10130712 Ga0207698_101307123 181
835 3300026142 Ga0207698_10380200 Ga0207698_103802002 181
836 3300026142 Ga0207698_10444189 Ga0207698_104441892 181
837 3300026142 Ga0207698_10583094 Ga0207698_105830942 181
838 3300026142 Ga0207698_10798323 Ga0207698_107983232 181
839 3300027312 Ga0209371_1000048 Ga0209371_1000048205 181
840 3300028379 Ga0268266_10000001 Ga0268266_100000011064 181
841 3300028379 Ga0268266_10000008 Ga0268266_100000081004 181
842 3300028379 Ga0268266_10012196 Ga0268266_100121962 181
843 3300028379 Ga0268266_10105549 Ga0268266_101055493 181
844 3300028379 Ga0268266_10416320 Ga0268266_104163202 181
845 3300028380 Ga0268265_10096396 Ga0268265_100963962 181
846 3300028381 Ga0268264_10012879 Ga0268264_100128795 181
847 3300028381 Ga0268264_10013020 Ga0268264_100130203 181
848 3300028381 Ga0268264_10172359 Ga0268264_101723592 181
849 3300028381 Ga0268264_10596859 Ga0268264_105968592 181
850 3300028786 Ga0307517_10145217 Ga0307517_101452172 181
851 3300028800 Ga0265338_10483232 Ga0265338_104832322 181
852 3300030500 Ga0268256_1000049 Ga0268256_100004963 181
853 3300030731 Ga0316177_1156649 Ga0316177_11566497 181
854 3300030745 Ga0316182_1026731 Ga0316182_10267313 181
855 3300031548 Ga0307408_100079013 Ga0307408_1000790132 181
856 3300031548 Ga0307408_100092241 Ga0307408_1000922412 181
857 3300031548 Ga0307408_100300972 Ga0307408_1003009722 181
858 3300031616 Ga0307508_10030073 Ga0307508_100300735 181
859 3300031616 Ga0307508_10203007 Ga0307508_102030072 181
860 3300031665 Ga0316575_10076918 Ga0316575_100769182 181
861 3300031727 Ga0316576_10265740 Ga0316576_102657401 181
862 3300031730 Ga0307516_10216777 Ga0307516_102167772 181
863 3300031824 Ga0307413_10005298 Ga0307413_100052984 181
864 3300031824 Ga0307413_10036935 Ga0307413_100369353 181
865 3300031824 Ga0307413_10124312 Ga0307413_101243123 181
866 3300031824 Ga0307413_10301187 Ga0307413_103011872 181
867 3300031852 Ga0307410_10431738 Ga0307410_104317382 181
868 3300031852 Ga0307410_10489988 Ga0307410_104899882 181
869 3300031901 Ga0307406_10285424 Ga0307406_102854242 181
870 3300031911 Ga0307412_10042740 Ga0307412_100427403 181
871 3300031911 Ga0307412_10107047 Ga0307412_101070473 181
872 3300031911 Ga0307412_10504300 Ga0307412_105043002 181
873 3300031911 Ga0307412_10905455 Ga0307412_109054551 181
874 3300031995 Ga0307409_101348517 Ga0307409_1013485171 181
875 3300032002 Ga0307416_100337613 Ga0307416_1003376132 181
876 3300032002 Ga0307416_100600800 Ga0307416_1006008002 181
877 3300032004 Ga0307414_10040312 Ga0307414_100403124 181
878 3300032004 Ga0307414_10067056 Ga0307414_100670562 181
879 3300032004 Ga0307414_10113207 Ga0307414_101132073 181
880 3300032004 Ga0307414_10292186 Ga0307414_102921862 181
881 3300032004 Ga0307414_10406811 Ga0307414_104068112 181
882 3300032004 Ga0307414_10457216 Ga0307414_104572161 181
883 3300032004 Ga0307414_10522699 Ga0307414_105226992 181
884 3300032005 Ga0307411_10013448 Ga0307411_100134483 181
885 3300032005 Ga0307411_10084979 Ga0307411_100849792 181
886 3300032005 Ga0307411_10333992 Ga0307411_103339922 181
887 3300032005 Ga0307411_10460650 Ga0307411_104606502 181
888 3300032005 Ga0307411_10476638 Ga0307411_104766382 181
889 3300032005 Ga0307411_10834155 Ga0307411_108341552 181
890 3300032126 Ga0307415_100796717 Ga0307415_1007967172 181
891 3300033179 Ga0307507_10032693 Ga0307507_100326933 181
892 3300033180 Ga0307510_10132276 Ga0307510_101322763 181
893 3300034820 Ga0373959_0023707 Ga0373959_0023707_299_856 181
894 3300035089 Ga0373944_0103121 Ga0373944_0103121_174_740 181
895 3300035113 Ga0373936_0155331 Ga0373936_0155331_20_586 181
896 3300035118 Ga0373954_0261813 Ga0373954_0261813_84_650 181
897 3300035120 Ga0373957_0116767 Ga0373957_0116767_455_1021 181
898 3300036401 Ga0373937_0422145 Ga0373937_0422145_608_1165 181
899 3300036401 Ga0373937_0855561 Ga0373937_0855561_24_587 181
900 3300037312 Ga0395899_0001125 Ga0395899_0001125_247_804 181
901 3300037312 Ga0395899_0029586 Ga0395899_0029586_1027_1584 181
902 3300037312 Ga0395899_0082043 Ga0395899_0082043_1300_1857 181
903 3300037312 Ga0395899_0178593 Ga0395899_0178593_902_1459 181
904 3300037312 Ga0395899_0287868 Ga0395899_0287868_33_590 181
905 3300037312 Ga0395899_0457805 Ga0395899_0457805_190_747 181
906 3300037418 Ga0395900_0001304 Ga0395900_0001304_23003_23575 181
907 3300037418 Ga0395900_0004445 Ga0395900_0004445_6138_6695 181
908 3300037418 Ga0395900_0024057 Ga0395900_0024057_5230_5787 181
909 3300037418 Ga0395900_0032548 Ga0395900_0032548_4772_5329 181
910 3300037418 Ga0395900_0046052 Ga0395900_0046052_1560_2117 181
911 3300037418 Ga0395900_0050386 Ga0395900_0050386_86_643 181
912 3300037418 Ga0395900_0066734 Ga0395900_0066734_589_1146 181
913 3300037418 Ga0395900_0713229 Ga0395900_0713229_186_743 181
914 3300037418 Ga0395900_1152336 Ga0395900_1152336_102_659 181
915 3300037466 Ga0395898_0002066 Ga0395898_0002066_23142_23699 181
916 3300037466 Ga0395898_0002627 Ga0395898_0002627_775_1332 181
917 3300037466 Ga0395898_0002725 Ga0395898_0002725_18496_19053 181
918 3300037466 Ga0395898_0013479 Ga0395898_0013479_5287_5844 181
919 3300037466 Ga0395898_0036705 Ga0395898_0036705_3004_3561 181
920 3300037466 Ga0395898_0114789 Ga0395898_0114789_889_1446 181
921 3300037466 Ga0395898_0136496 Ga0395898_0136496_1136_1693 181
922 3300037466 Ga0395898_0317809 Ga0395898_0317809_787_1344 181
923 3300038443 Ga0395901_0000259 Ga0395901_0000259_5969_6526 181
924 3300038443 Ga0395901_0001429 Ga0395901_0001429_18496_19053 181
925 3300038443 Ga0395901_0049227 Ga0395901_0049227_1202_1759 181
926 3300038443 Ga0395901_0053602 Ga0395901_0053602_1019_1576 181
927 3300038443 Ga0395901_0061507 Ga0395901_0061507_1929_2486 181
928 3300038443 Ga0395901_0063473 Ga0395901_0063473_1874_2431 181
929 3300038443 Ga0395901_0220090 Ga0395901_0220090_1395_1952 181
930 3300038443 Ga0395901_0244857 Ga0395901_0244857_399_956 181
931 3300038443 Ga0395901_0324327 Ga0395901_0324327_793_1350 181
932 3300038443 Ga0395901_0530985 Ga0395901_0530985_544_1101 181
933 3300038705 Ga0237819_00140 Ga0237819_00140_3889_4446 181
934 3300039437 Ga0436365_0119571 Ga0436365_0119571_52_609 181
935 3300041404 Ga0439436_0003731 Ga0439436_0003731_1896_2453 181
936 3300041404 Ga0439436_0049721 Ga0439436_0049721_400_957 181
937 3300041404 Ga0439436_0062325 Ga0439436_0062325_369_926 181
938 3300041407 Ga0439447_001069 Ga0439447_001069_7284_7841 181
939 3300041413 Ga0439465_0004178 Ga0439465_0004178_883_1440 181
940 3300041443 Ga0451789_0416833 Ga0451789_0416833_369_932 181
941 3300041452 Ga0451793_1086667 Ga0451793_1086667_1816_2364 181
942 3300041453 Ga0451797_0190827 Ga0451797_0190827_258_815 181
943 3300041456 Ga0451795_0046765 Ga0451795_0046765_505_1062 181
944 3300041459 Ga0451800_1451396 Ga0451800_1451396_60_614 181
945 3300041460 Ga0451802_0727430 Ga0451802_0727430_45_602 181
946 3300041462 Ga0451806_127485 Ga0451806_127485_15_572 181
947 3300041486 Ga0451807_0483911 Ga0451807_0483911_145_699 181
948 3300041492 Ga0451835_0771462 Ga0451835_0771462_11_568 181
949 3300041494 Ga0451837_1048697 Ga0451837_1048697_180_737 181
950 3300041494 Ga0451837_1628237 Ga0451837_1628237_1825_2382 181
951 3300041496 Ga0451839_0794977 Ga0451839_0794977_320_874 181
952 3300041509 Ga0451843_1708573 Ga0451843_1708573_19_576 181
953 3300041512 Ga0451853_1416507 Ga0451853_1416507_46_600 181
954 3300041512 Ga0451853_3750318 Ga0451853_3750318_161_718 181
955 3300042005 Ga0439448_0102780 Ga0439448_0102780_13_570 181
956 3300042006 Ga0439432_065208 Ga0439432_065208_70_627 181
957 3300042006 Ga0439432_108552 Ga0439432_108552_227_784 181
958 3300042007 Ga0439449_0020297 Ga0439449_0020297_1115_1672 181
959 3300042010 Ga0439452_004747 Ga0439452_004747_943_1500 181
960 3300042438 Ga0439459_0002300 Ga0439459_0002300_1307_1864 181
961 3300042438 Ga0439459_0002709 Ga0439459_0002709_2132_2689 181
962 3300042876 Ga0451577_0008483 Ga0451577_0008483_9165_9725 181
963 3300044656 Ga0466969_0015351 Ga0466969_0015351_1958_2515 181
964 3300044656 Ga0466969_0030228 Ga0466969_0030228_1479_2036 181
965 3300044658 Ga0466972_0000647 Ga0466972_0000647_13562_14119 181
966 3300044658 Ga0466972_0001847 Ga0466972_0001847_5959_6516 181
967 3300044658 Ga0466972_0002963 Ga0466972_0002963_551_1108 181
968 3300044672 Ga0466982_0000007 Ga0466982_0000007_202946_203503 181
969 3300044672 Ga0466982_0000029 Ga0466982_0000029_10247_10804 181
970 3300044683 Ga0466965_0000764 Ga0466965_0000764_8881_9438 181
971 3300044683 Ga0466965_0002141 Ga0466965_0002141_5922_6479 181
972 3300044683 Ga0466965_0007999 Ga0466965_0007999_3689_4246 181
973 3300044683 Ga0466965_0032814 Ga0466965_0032814_1669_2226 181
974 3300044683 Ga0466965_0104626 Ga0466965_0104626_181_738 181
975 3300044684 Ga0466966_0000343 Ga0466966_0000343_28053_28610 181
976 3300044684 Ga0466966_0001588 Ga0466966_0001588_8352_8909 181
977 3300044693 Ga0466961_0000199 Ga0466961_0000199_7810_8367 181
978 3300044693 Ga0466961_0002917 Ga0466961_0002917_5539_6096 181
979 3300044693 Ga0466961_0096135 Ga0466961_0096135_642_1199 181
980 3300044693 Ga0466961_0282415 Ga0466961_0282415_316_873 181
981 3300044706 Ga0466964_0000680 Ga0466964_0000680_4559_5116 181
982 3300044719 Ga0466971_0004638 Ga0466971_0004638_1301_1858 181
983 3300044735 Ga0466968_0019341 Ga0466968_0019341_1875_2432 181
984 3300044765 Ga0466970_0000132 Ga0466970_0000132_614_1171 181
985 3300044765 Ga0466970_0000260 Ga0466970_0000260_3809_4366 181
986 3300044765 Ga0466970_0058767 Ga0466970_0058767_1416_1973 181
987 3300044765 Ga0466970_0076519 Ga0466970_0076519_1018_1575 181
988 3300044842 Ga0466957_0001273 Ga0466957_0001273_9098_9655 181
989 3300044842 Ga0466957_0030641 Ga0466957_0030641_949_1506 181
990 3300044901 Ga0466960_0106077 Ga0466960_0106077_446_1003 181
991 3300045049 Ga0466959_0000293 Ga0466959_0000293_8678_9235 181
992 3300045049 Ga0466959_0058398 Ga0466959_0058398_2127_2684 181
993 3300045049 Ga0466959_0227903 Ga0466959_0227903_476_1033 181
994 3300045836 Ga0466958_0003516 Ga0466958_0003516_2143_2700 181
995 3300045976 Ga0466967_0409936 Ga0466967_0409936_371_928 181
996 3300046452 Ga0495617_000122 Ga0495617_000122_38841_39398 181
997 3300046452 Ga0495617_000504 Ga0495617_000504_7811_8368 181
998 3300046457 Ga0495590_0181138 Ga0495590_0181138_18_575 181
999 3300046459 Ga0495629_0240917 Ga0495629_0240917_240_806 181
1000 3300046460 Ga0495638_0000106 Ga0495638_0000106_113066_113623 181
1001 3300046460 Ga0495638_0000237 Ga0495638_0000237_15569_16126 181
1002 3300046460 Ga0495638_0000479 Ga0495638_0000479_21219_21782 181
1003 3300046461 Ga0495641_0134174 Ga0495641_0134174_83_640 181
1004 3300046471 Ga0495650_0000074 Ga0495650_0000074_68961_69518 181
1005 3300046471 Ga0495650_0000134 Ga0495650_0000134_97176_97733 181
1006 3300046472 Ga0495580_0237075 Ga0495580_0237075_42_608 181
1007 3300046473 Ga0495582_0033576 Ga0495582_0033576_502_1068 181
1008 3300046475 Ga0495639_0064198 Ga0495639_0064198_507_1073 181
1009 3300046491 Ga0495584_0001870 Ga0495584_0001870_3666_4223 181
1010 3300046499 Ga0495594_0189023 Ga0495594_0189023_541_1107 181
1011 3300046501 Ga0495607_0000042 Ga0495607_0000042_100919_101476 181
1012 3300046501 Ga0495607_0004080 Ga0495607_0004080_729_1286 181
1013 3300046506 Ga0495583_0000833 Ga0495583_0000833_33317_33874 181
1014 3300046506 Ga0495583_0003138 Ga0495583_0003138_8530_9087 181
1015 3300046506 Ga0495583_0008323 Ga0495583_0008323_567_1124 181
1016 3300046507 Ga0495606_0000562 Ga0495606_0000562_34793_35350 181
1017 3300046507 Ga0495606_0001636 Ga0495606_0001636_25946_26503 181
1018 3300046507 Ga0495606_0008349 Ga0495606_0008349_7348_7905 181
1019 3300046507 Ga0495606_0015682 Ga0495606_0015682_1844_2401 181
1020 3300046512 Ga0495610_0000711 Ga0495610_0000711_5039_5596 181
1021 3300046513 Ga0495616_0000617 Ga0495616_0000617_17173_17730 181
1022 3300046513 Ga0495616_0003053 Ga0495616_0003053_4441_4998 181
1023 3300046515 Ga0495620_0000182 Ga0495620_0000182_11973_12530 181
1024 3300046515 Ga0495620_0000216 Ga0495620_0000216_31339_31896 181
1025 3300046515 Ga0495620_0027243 Ga0495620_0027243_1180_1737 181
1026 3300046517 Ga0495630_0161208 Ga0495630_0161208_513_1079 181
1027 3300046519 Ga0495632_0000241 Ga0495632_0000241_40232_40789 181
1028 3300046520 Ga0495637_0014597 Ga0495637_0014597_391_948 181
1029 3300046524 Ga0495648_0001366 Ga0495648_0001366_4154_4711 181
1030 3300046525 Ga0495663_0051406 Ga0495663_0051406_496_1053 181
1031 3300046538 Ga0495609_0030336 Ga0495609_0030336_1063_1620 181
1032 3300046557 Ga0495622_0106668 Ga0495622_0106668_304_867 181
1033 3300046615 Ga0495656_0000847 Ga0495656_0000847_4357_4914 181
1034 3300046615 Ga0495656_0121006 Ga0495656_0121006_108_665 181
1035 3300046616 Ga0495668_0000411 Ga0495668_0000411_48052_48609 181
1036 3300046648 Ga0495611_0000004 Ga0495611_0000004_248293_248850 181
1037 3300046648 Ga0495611_0000023 Ga0495611_0000023_70468_71025 181
1038 3300046648 Ga0495611_0002701 Ga0495611_0002701_3837_4394 181
1039 3300046660 Ga0495625_0000024 Ga0495625_0000024_211270_211827 181
1040 3300046660 Ga0495625_0001652 Ga0495625_0001652_16585_17142 181
1041 3300046660 Ga0495625_0018885 Ga0495625_0018885_981_1538 181
1042 3300046660 Ga0495625_0057783 Ga0495625_0057783_1672_2229 181
1043 3300046660 Ga0495625_0160641 Ga0495625_0160641_902_1459 181
1044 3300046660 Ga0495625_0382372 Ga0495625_0382372_55_612 181
1045 3300046674 Ga0495588_0071922 Ga0495588_0071922_279_836 181
1046 3300046675 Ga0495657_0095923 Ga0495657_0095923_1132_1695 181
1047 3300046678 Ga0495599_0389719 Ga0495599_0389719_11_574 181
1048 3300046681 Ga0495647_0032678 Ga0495647_0032678_455_1021 181
1049 3300046689 Ga0495613_0656007 Ga0495613_0656007_44_601 181
1050 3300046691 Ga0495670_0009105 Ga0495670_0009105_2010_2567 181
1051 3300046691 Ga0495670_0129075 Ga0495670_0129075_658_1215 181
1052 3300046692 Ga0495671_0000390 Ga0495671_0000390_13252_13809 181
1053 3300046694 Ga0495649_0000687 Ga0495649_0000687_24881_25438 181
1054 3300046794 Ga0495589_0000038 Ga0495589_0000038_122206_122763 181
1055 3300046794 Ga0495589_0000547 Ga0495589_0000547_16547_17104 181
1056 3300046810 Ga0495660_0000321 Ga0495660_0000321_28484_29041 181
1057 3300047318 Ga0495636_0003246 Ga0495636_0003246_2402_2959 181
1058 3300047318 Ga0495636_0006414 Ga0495636_0006414_226_783 181
1059 3300047318 Ga0495636_0086670 Ga0495636_0086670_226_783 181
1060 3300047446 Ga0495679_000011 Ga0495679_000011_59222_59779 181
1061 3300047469 Ga0495673_0000616 Ga0495673_0000616_11493_12050 181
1062 3300047471 Ga0495684_0168776 Ga0495684_0168776_570_1136 181
1063 3300047472 Ga0495686_0000608 Ga0495686_0000608_32749_33306 181
1064 3300047472 Ga0495686_0010132 Ga0495686_0010132_406_963 181
1065 3300047472 Ga0495686_0010763 Ga0495686_0010763_4339_4896 181
1066 3300047472 Ga0495686_0061393 Ga0495686_0061393_156_713 181
1067 3300047472 Ga0495686_0071603 Ga0495686_0071603_24_581 181
1068 3300047472 Ga0495686_0127698 Ga0495686_0127698_29_586 181
1069 3300047472 Ga0495686_0250464 Ga0495686_0250464_63_620 181
1070 3300048903 Ga0496100_0001740 Ga0496100_0001740_10238_10795 181
1071 3300048903 Ga0496100_0584488 Ga0496100_0584488_182_739 181
1072 3300048904 Ga0496101_0012388 Ga0496101_0012388_92_649 181
1073 3300048904 Ga0496101_0073503 Ga0496101_0073503_994_1551 181
1074 3300048904 Ga0496101_0132636 Ga0496101_0132636_769_1326 181
1075 3300048905 Ga0496102_0082098 Ga0496102_0082098_1073_1630 181
1076 3300048905 Ga0496102_0583618 Ga0496102_0583618_101_658 181
1077 3300048907 Ga0496104_0000012 Ga0496104_0000012_381024_381590 181
1078 3300048907 Ga0496104_0338658 Ga0496104_0338658_687_1244 181
1079 3300048908 Ga0496105_0000011 Ga0496105_0000011_56424_56990 181
1080 3300048909 Ga0496106_0175573 Ga0496106_0175573_1019_1576 181
1081 3300048910 Ga0496107_0094425 Ga0496107_0094425_877_1434 181
1082 3300048910 Ga0496107_0378835 Ga0496107_0378835_185_742 181
1083 3300048911 Ga0496108_1175036 Ga0496108_1175036_18_575 181
1084 3300048913 Ga0496110_0298806 Ga0496110_0298806_352_909 181
1085 3300048915 Ga0496112_0540649 Ga0496112_0540649_388_945 181
1086 3300048916 Ga0496113_0024417 Ga0496113_0024417_2490_3047 181
1087 3300048916 Ga0496113_0203915 Ga0496113_0203915_994_1551 181
1088 3300048916 Ga0496113_1191232 Ga0496113_1191232_17_574 181
1089 3300048917 Ga0496114_0001533 Ga0496114_0001533_6546_7103 181
1090 3300048917 Ga0496114_0172916 Ga0496114_0172916_310_867 181
1091 3300048917 Ga0496114_0208232 Ga0496114_0208232_793_1350 181
1092 3300048918 Ga0496115_0000092 Ga0496115_0000092_62318_62875 181
1093 3300048918 Ga0496115_0000193 Ga0496115_0000193_37841_38398 181
1094 3300048918 Ga0496115_0004525 Ga0496115_0004525_2775_3332 181
1095 3300048918 Ga0496115_0031269 Ga0496115_0031269_798_1355 181
1096 3300048918 Ga0496115_0145340 Ga0496115_0145340_479_1036 181
1097 3300048918 Ga0496115_0221537 Ga0496115_0221537_608_1189 181
1098 3300048920 Ga0496117_0004278 Ga0496117_0004278_11061_11618 181
1099 3300048920 Ga0496117_0005719 Ga0496117_0005719_9248_9805 181
1100 3300048920 Ga0496117_0009436 Ga0496117_0009436_7510_8067 181
1101 3300048921 Ga0496118_0000885 Ga0496118_0000885_4257_4814 181
1102 3300048921 Ga0496118_0001282 Ga0496118_0001282_11927_12484 181
1103 3300048921 Ga0496118_0001962 Ga0496118_0001962_27867_28424 181
1104 3300048921 Ga0496118_0002465 Ga0496118_0002465_7145_7705 181
1105 3300048921 Ga0496118_0004440 Ga0496118_0004440_8557_9114 181
1106 3300048921 Ga0496118_0012974 Ga0496118_0012974_2713_3270 181
1107 3300048921 Ga0496118_0241615 Ga0496118_0241615_402_959 181
1108 3300048922 Ga0496119_0041672 Ga0496119_0041672_1518_2075 181
1109 3300048923 Ga0496120_0107468 Ga0496120_0107468_459_1016 181
1110 3300048923 Ga0496120_0117853 Ga0496120_0117853_147_704 181
1111 3300048924 Ga0496121_0000071 Ga0496121_0000071_140456_141013 181
1112 3300048924 Ga0496121_0000942 Ga0496121_0000942_13054_13611 181
1113 3300048924 Ga0496121_0001620 Ga0496121_0001620_34326_34883 181
1114 3300048924 Ga0496121_0001863 Ga0496121_0001863_21941_22498 181
1115 3300048924 Ga0496121_0001864 Ga0496121_0001864_21234_21791 181
1116 3300048924 Ga0496121_0001888 Ga0496121_0001888_13585_14142 181
1117 3300048924 Ga0496121_0002280 Ga0496121_0002280_26448_27005 181
1118 3300048924 Ga0496121_0006661 Ga0496121_0006661_4825_5382 181
1119 3300048924 Ga0496121_0016652 Ga0496121_0016652_2117_2674 181
1120 3300048924 Ga0496121_0037969 Ga0496121_0037969_3236_3793 181
1121 3300048924 Ga0496121_0142210 Ga0496121_0142210_48_605 181
1122 3300048925 Ga0496122_0000062 Ga0496122_0000062_224719_225276 181
1123 3300048925 Ga0496122_0016999 Ga0496122_0016999_4868_5425 181
1124 3300048925 Ga0496122_0018310 Ga0496122_0018310_27_584 181
1125 3300048925 Ga0496122_0048979 Ga0496122_0048979_2049_2606 181
1126 3300048925 Ga0496122_0066017 Ga0496122_0066017_1876_2433 181
1127 3300048926 Ga0496123_0004387 Ga0496123_0004387_14169_14726 181
1128 3300048926 Ga0496123_0009110 Ga0496123_0009110_2099_2656 181
1129 3300048926 Ga0496123_0012934 Ga0496123_0012934_3826_4383 181
1130 3300048926 Ga0496123_0013031 Ga0496123_0013031_3775_4332 181
1131 3300048927 Ga0496124_0000313 Ga0496124_0000313_15455_16012 181
1132 3300048927 Ga0496124_0000314 Ga0496124_0000314_72548_73105 181
1133 3300048928 Ga0496125_0000291 Ga0496125_0000291_6608_7165 181
1134 3300048928 Ga0496125_0024124 Ga0496125_0024124_2696_3253 181
1135 3300048928 Ga0496125_0060859 Ga0496125_0060859_61_618 181
1136 3300048929 Ga0496126_0000160 Ga0496126_0000160_35145_35702 181
1137 3300048929 Ga0496126_0003733 Ga0496126_0003733_7996_8553 181
1138 3300048929 Ga0496126_0004079 Ga0496126_0004079_8268_8825 181
1139 3300048929 Ga0496126_0004964 Ga0496126_0004964_2257_2814 181
1140 3300048929 Ga0496126_0009232 Ga0496126_0009232_6362_6919 181
1141 3300048929 Ga0496126_0011982 Ga0496126_0011982_2315_2872 181
1142 3300048929 Ga0496126_0017284 Ga0496126_0017284_3608_4165 181
1143 3300048929 Ga0496126_0018434 Ga0496126_0018434_6069_6626 181
1144 3300048929 Ga0496126_0050363 Ga0496126_0050363_952_1509 181
1145 3300048929 Ga0496126_0060206 Ga0496126_0060206_2659_3216 181
1146 3300048929 Ga0496126_0080523 Ga0496126_0080523_92_649 181
1147 3300048929 Ga0496126_0086649 Ga0496126_0086649_1023_1580 181
1148 3300049459 Ga0495678_000062 Ga0495678_000062_28598_29155 181
1149 3300049459 Ga0495678_025362 Ga0495678_025362_1359_1916 181
1150 3300049460 Ga0495682_0000283 Ga0495682_0000283_30016_30573 181
1151 3300049460 Ga0495682_0000341 Ga0495682_0000341_10776_11333 181
1152 3300049460 Ga0495682_0000372 Ga0495682_0000372_6536_7093 181
1153 3300049460 Ga0495682_0013547 Ga0495682_0013547_2369_2926 181
1154 3300049568 Ga0501031_0002957 Ga0501031_0002957_1184_1738 181
1155 3300049568 Ga0501031_0016767 Ga0501031_0016767_523_1083 181
1156 3300049568 Ga0501031_0047333 Ga0501031_0047333_917_1477 181
1157 3300049568 Ga0501031_0117963 Ga0501031_0117963_58_615 181
1158 3300049568 Ga0501031_0207521 Ga0501031_0207521_636_1190 181
1159 3300049568 Ga0501031_0357314 Ga0501031_0357314_332_892 181
1160 3300049569 Ga0501032_0000485 Ga0501032_0000485_26698_27252 181
1161 3300049569 Ga0501032_0004538 Ga0501032_0004538_6681_7241 181
1162 3300049569 Ga0501032_0007187 Ga0501032_0007187_2397_2954 181
1163 3300049569 Ga0501032_0042745 Ga0501032_0042745_2446_3003 181
1164 3300049569 Ga0501032_0100806 Ga0501032_0100806_124_684 181
1165 3300049569 Ga0501032_0174762 Ga0501032_0174762_835_1389 181
1166 3300049569 Ga0501032_0225935 Ga0501032_0225935_629_1189 181
1167 3300049569 Ga0501032_0589179 Ga0501032_0589179_93_650 181
1168 3300049570 Ga0501033_0002332 Ga0501033_0002332_3278_3838 181
1169 3300049570 Ga0501033_0002853 Ga0501033_0002853_11414_11971 181
1170 3300049570 Ga0501033_0005340 Ga0501033_0005340_7167_7721 181
1171 3300049570 Ga0501033_0036768 Ga0501033_0036768_2807_3367 181
1172 3300049570 Ga0501033_0265859 Ga0501033_0265859_602_1156 181
1173 3300049571 Ga0501034_0000544 Ga0501034_0000544_27155_27712 181
1174 3300049571 Ga0501034_0001449 Ga0501034_0001449_13410_13967 181
1175 3300049571 Ga0501034_0004230 Ga0501034_0004230_11925_12482 181
1176 3300049571 Ga0501034_0006520 Ga0501034_0006520_2727_3281 181
1177 3300049571 Ga0501034_0006867 Ga0501034_0006867_4678_5238 181
1178 3300049571 Ga0501034_0010307 Ga0501034_0010307_7871_8428 181
1179 3300049571 Ga0501034_0012391 Ga0501034_0012391_1062_1616 181
1180 3300049571 Ga0501034_0042361 Ga0501034_0042361_1389_1946 181
1181 3300049571 Ga0501034_0073006 Ga0501034_0073006_2851_3411 181
1182 3300049571 Ga0501034_0125919 Ga0501034_0125919_786_1340 181
1183 3300049571 Ga0501034_0141390 Ga0501034_0141390_1195_1752 181
1184 3300049571 Ga0501034_0294235 Ga0501034_0294235_897_1457 181
1185 3300049571 Ga0501034_0778465 Ga0501034_0778465_160_717 181
1186 3300049572 Ga0501036_0008476 Ga0501036_0008476_6809_7369 181
1187 3300049572 Ga0501036_0047433 Ga0501036_0047433_1560_2117 181
1188 3300049572 Ga0501036_0108054 Ga0501036_0108054_191_745 181
1189 3300049572 Ga0501036_0375127 Ga0501036_0375127_360_917 181
1190 3300049572 Ga0501036_0579029 Ga0501036_0579029_80_658 181
1191 3300049572 Ga0501036_0739410 Ga0501036_0739410_198_755 181
1192 3300049572 Ga0501036_0794192 Ga0501036_0794192_115_672 181
1193 3300049573 Ga0501037_0004806 Ga0501037_0004806_6063_6623 181
1194 3300049573 Ga0501037_0028275 Ga0501037_0028275_62_616 181
1195 3300049573 Ga0501037_0091448 Ga0501037_0091448_172_732 181
1196 3300049573 Ga0501037_0096898 Ga0501037_0096898_1408_1968 181
1197 3300049573 Ga0501037_0104567 Ga0501037_0104567_733_1290 181
1198 3300049573 Ga0501037_0206295 Ga0501037_0206295_479_1036 181
1199 3300049573 Ga0501037_0360052 Ga0501037_0360052_331_888 181
1200 3300049573 Ga0501037_0388123 Ga0501037_0388123_53_631 181
1201 3300049573 Ga0501037_0413500 Ga0501037_0413500_279_836 181
1202 3300049574 Ga0501038_0000251 Ga0501038_0000251_3882_4436 181
1203 3300049574 Ga0501038_0006634 Ga0501038_0006634_9915_10472 181
1204 3300049574 Ga0501038_0011631 Ga0501038_0011631_6851_7405 181
1205 3300049574 Ga0501038_0023411 Ga0501038_0023411_3636_4196 181
1206 3300049574 Ga0501038_0220810 Ga0501038_0220810_290_847 181
1207 3300049574 Ga0501038_0222956 Ga0501038_0222956_403_960 181
1208 3300049574 Ga0501038_0489651 Ga0501038_0489651_29_589 181
1209 3300049575 Ga0501039_0007491 Ga0501039_0007491_5884_6444 181
1210 3300049575 Ga0501039_0055978 Ga0501039_0055978_1251_1805 181
1211 3300049575 Ga0501039_0073969 Ga0501039_0073969_1735_2295 181
1212 3300049575 Ga0501039_0144966 Ga0501039_0144966_237_791 181
1213 3300049575 Ga0501039_0195532 Ga0501039_0195532_271_828 181
1214 3300049575 Ga0501039_0223697 Ga0501039_0223697_658_1215 181
1215 3300049576 Ga0501040_0118373 Ga0501040_0118373_1121_1681 181
1216 3300049578 Ga0501042_0398761 Ga0501042_0398761_371_931 181
1217 3300049579 Ga0501043_0003128 Ga0501043_0003128_4079_4636 181
1218 3300049579 Ga0501043_0003723 Ga0501043_0003723_7467_8027 181
1219 3300049579 Ga0501043_0009046 Ga0501043_0009046_5724_6284 181
1220 3300049579 Ga0501043_0014418 Ga0501043_0014418_4979_5533 181
1221 3300049579 Ga0501043_0017421 Ga0501043_0017421_1086_1640 181
1222 3300049579 Ga0501043_0019309 Ga0501043_0019309_773_1330 181
1223 3300049579 Ga0501043_0063840 Ga0501043_0063840_252_809 181
1224 3300049579 Ga0501043_0129292 Ga0501043_0129292_353_913 181
1225 3300049579 Ga0501043_0208162 Ga0501043_0208162_343_900 181
1226 3300049579 Ga0501043_0252463 Ga0501043_0252463_414_971 181
1227 3300049580 Ga0501046_0009056 Ga0501046_0009056_7133_7687 181
1228 3300049580 Ga0501046_0013125 Ga0501046_0013125_80_637 181
1229 3300049580 Ga0501046_0015580 Ga0501046_0015580_4658_5218 181
1230 3300049580 Ga0501046_0024091 Ga0501046_0024091_2367_2927 181
1231 3300049580 Ga0501046_0093130 Ga0501046_0093130_1026_1586 181
1232 3300049580 Ga0501046_0124060 Ga0501046_0124060_370_927 181
1233 3300049580 Ga0501046_0156218 Ga0501046_0156218_110_667 181
1234 3300049581 Ga0501047_0000250 Ga0501047_0000250_49720_50277 181
1235 3300049581 Ga0501047_0002064 Ga0501047_0002064_1969_2526 181
1236 3300049581 Ga0501047_0004581 Ga0501047_0004581_812_1372 181
1237 3300049581 Ga0501047_0008714 Ga0501047_0008714_4995_5549 181
1238 3300049581 Ga0501047_0050558 Ga0501047_0050558_1718_2278 181
1239 3300049581 Ga0501047_0143168 Ga0501047_0143168_1408_1968 181
1240 3300049581 Ga0501047_0167971 Ga0501047_0167971_730_1287 181
1241 3300049581 Ga0501047_0219175 Ga0501047_0219175_210_767 181
1242 3300049581 Ga0501047_0220542 Ga0501047_0220542_164_721 181
1243 3300049581 Ga0501047_0299928 Ga0501047_0299928_266_823 181
1244 3300049581 Ga0501047_0311134 Ga0501047_0311134_67_624 181
1245 3300049582 Ga0501048_0017672 Ga0501048_0017672_2519_3076 181
1246 3300049582 Ga0501048_0039385 Ga0501048_0039385_29_589 181
1247 3300049582 Ga0501048_0112774 Ga0501048_0112774_468_1022 181
1248 3300049583 Ga0501067_0000560 Ga0501067_0000560_6127_6684 181
1249 3300049583 Ga0501067_0008269 Ga0501067_0008269_2810_3370 181
1250 3300049584 Ga0501068_0016281 Ga0501068_0016281_2172_2729 181
1251 3300049584 Ga0501068_0031539 Ga0501068_0031539_67_624 181
1252 3300049584 Ga0501068_0094355 Ga0501068_0094355_153_713 181
1253 3300049584 Ga0501068_0094652 Ga0501068_0094652_651_1205 181
1254 3300049584 Ga0501068_0399129 Ga0501068_0399129_160_717 181
1255 3300049585 Ga0501069_0016989 Ga0501069_0016989_2185_2742 181
1256 3300049585 Ga0501069_0018450 Ga0501069_0018450_629_1189 181
1257 3300049585 Ga0501069_0045605 Ga0501069_0045605_1426_2004 181
1258 3300049586 Ga0501070_0003399 Ga0501070_0003399_3836_4393 181
1259 3300049586 Ga0501070_0022970 Ga0501070_0022970_4101_4661 181
1260 3300049586 Ga0501070_0026818 Ga0501070_0026818_3631_4191 181
1261 3300049586 Ga0501070_0080766 Ga0501070_0080766_1077_1631 181
1262 3300049586 Ga0501070_0149339 Ga0501070_0149339_667_1224 181
1263 3300049586 Ga0501070_0157905 Ga0501070_0157905_555_1115 181
1264 3300049586 Ga0501070_0240087 Ga0501070_0240087_242_796 181
1265 3300049586 Ga0501070_0263973 Ga0501070_0263973_258_815 181
1266 3300049586 Ga0501070_0727883 Ga0501070_0727883_68_625 181
1267 3300049587 Ga0501071_0040096 Ga0501071_0040096_2199_2759 181
1268 3300049587 Ga0501071_0205648 Ga0501071_0205648_855_1415 181
1269 3300049588 Ga0501072_0003501 Ga0501072_0003501_5069_5626 181
1270 3300049588 Ga0501072_0016955 Ga0501072_0016955_3142_3702 181
1271 3300049589 Ga0501073_0001096 Ga0501073_0001096_5435_5992 181
1272 3300049589 Ga0501073_0003002 Ga0501073_0003002_10312_10872 181
1273 3300049589 Ga0501073_0004205 Ga0501073_0004205_5230_5784 181
1274 3300049589 Ga0501073_0110334 Ga0501073_0110334_534_1091 181
1275 3300049589 Ga0501073_0230488 Ga0501073_0230488_203_760 181
1276 3300049589 Ga0501073_0351642 Ga0501073_0351642_187_744 181
1277 3300049589 Ga0501073_0360338 Ga0501073_0360338_436_993 181
1278 3300049590 Ga0501074_0019562 Ga0501074_0019562_448_1005 181
1279 3300049590 Ga0501074_0034353 Ga0501074_0034353_2988_3566 181
1280 3300049590 Ga0501074_0035175 Ga0501074_0035175_942_1499 181
1281 3300049590 Ga0501074_0049890 Ga0501074_0049890_1707_2267 181
1282 3300049590 Ga0501074_0058058 Ga0501074_0058058_29_589 181
1283 3300049590 Ga0501074_0067221 Ga0501074_0067221_1023_1583 181
1284 3300049590 Ga0501074_0110530 Ga0501074_0110530_479_1036 181
1285 3300049592 Ga0501076_0571329 Ga0501076_0571329_56_616 181
1286 3300049593 Ga0501077_0360496 Ga0501077_0360496_268_825 181
1287 3300049593 Ga0501077_0393926 Ga0501077_0393926_88_648 181
1288 3300049652 Ga0501202_016651 Ga0501202_016651_519_1076 181
1289 3300049741 Ga0501079_0112934 Ga0501079_0112934_1522_2079 181
1290 3300049741 Ga0501079_0120832 Ga0501079_0120832_280_840 181
1291 3300049741 Ga0501079_0183846 Ga0501079_0183846_115_675 181
1292 3300049741 Ga0501079_0270545 Ga0501079_0270545_268_825 181
1293 3300049741 Ga0501079_0385713 Ga0501079_0385713_489_1049 181
1294 3300049742 Ga0501080_0000306 Ga0501080_0000306_19566_20123 181
1295 3300049742 Ga0501080_0000320 Ga0501080_0000320_7873_8433 181
1296 3300049742 Ga0501080_0001885 Ga0501080_0001885_811_1368 181
1297 3300049742 Ga0501080_0038508 Ga0501080_0038508_3617_4177 181
1298 3300049742 Ga0501080_0051615 Ga0501080_0051615_436_990 181
1299 3300049742 Ga0501080_0060509 Ga0501080_0060509_831_1388 181
1300 3300049742 Ga0501080_0095289 Ga0501080_0095289_1688_2248 181
1301 3300049742 Ga0501080_0126272 Ga0501080_0126272_101_658 181
1302 3300049742 Ga0501080_0197515 Ga0501080_0197515_271_825 181
1303 3300049742 Ga0501080_0775118 Ga0501080_0775118_96_674 181
1304 3300049743 Ga0501081_0086682 Ga0501081_0086682_1017_1577 181
1305 3300049744 Ga0501083_0007488 Ga0501083_0007488_1804_2361 181
1306 3300049744 Ga0501083_0068982 Ga0501083_0068982_277_834 181
1307 3300049763 Ga0501266_011828 Ga0501266_011828_428_985 181
1308 3300049766 Ga0501269_035278 Ga0501269_035278_57_617 181
1309 3300049822 Ga0501035_0009752 Ga0501035_0009752_4007_4564 181
1310 3300049822 Ga0501035_0016886 Ga0501035_0016886_3882_4442 181
1311 3300049822 Ga0501035_0017379 Ga0501035_0017379_1481_2035 181
1312 3300049822 Ga0501035_0025209 Ga0501035_0025209_4361_4915 181
1313 3300049822 Ga0501035_0026599 Ga0501035_0026599_1242_1799 181
1314 3300049822 Ga0501035_0034014 Ga0501035_0034014_764_1324 181
1315 3300049822 Ga0501035_0050395 Ga0501035_0050395_259_819 181
1316 3300049822 Ga0501035_0055280 Ga0501035_0055280_2670_3230 181
1317 3300049822 Ga0501035_0111994 Ga0501035_0111994_139_696 181
1318 3300049822 Ga0501035_0385476 Ga0501035_0385476_207_764 181
1319 3300049822 Ga0501035_0723091 Ga0501035_0723091_206_763 181
1320 3300049822 Ga0501035_0780814 Ga0501035_0780814_57_614 181
1321 3300049823 Ga0501044_0003969 Ga0501044_0003969_4985_5539 181
1322 3300049823 Ga0501044_0005486 Ga0501044_0005486_7809_8366 181
1323 3300049823 Ga0501044_0017657 Ga0501044_0017657_3200_3760 181
1324 3300049823 Ga0501044_0028186 Ga0501044_0028186_5086_5646 181
1325 3300049823 Ga0501044_0107242 Ga0501044_0107242_663_1220 181
1326 3300049823 Ga0501044_0108743 Ga0501044_0108743_1302_1859 181
1327 3300049823 Ga0501044_0140742 Ga0501044_0140742_288_848 181
1328 3300049823 Ga0501044_0143207 Ga0501044_0143207_231_788 181
1329 3300049823 Ga0501044_0174273 Ga0501044_0174273_15_572 181
1330 3300049823 Ga0501044_0225483 Ga0501044_0225483_254_811 181
1331 3300049823 Ga0501044_0295543 Ga0501044_0295543_698_1255 181
1332 3300049823 Ga0501044_0304012 Ga0501044_0304012_526_1083 181
1333 3300049823 Ga0501044_0323959 Ga0501044_0323959_488_1045 181
1334 3300049823 Ga0501044_0462230 Ga0501044_0462230_252_830 181
1335 3300049823 Ga0501044_0926429 Ga0501044_0926429_83_640 181
1336 3300049823 Ga0501044_1144822 Ga0501044_1144822_72_629 181
1337 3300049824 Ga0501045_0144308 Ga0501045_0144308_554_1114 181
1338 3300049824 Ga0501045_0591876 Ga0501045_0591876_47_607 181
1339 3300050516 nmdc:mga0sz30_16282_c1 nmdc:mga0sz30_16282_c1_1882_2439 181
1340 3300053079 Ga0500610_0003017 Ga0500610_0003017_1810_2367 181
1341 3300053087 Ga0500643_008927 Ga0500643_008927_859_1416 181
1342 3300053093 Ga0500651_0002320 Ga0500651_0002320_8157_8714 181
1343 3300053093 Ga0500651_0015083 Ga0500651_0015083_3335_3892 181
1344 3300053094 Ga0500566_0191366 Ga0500566_0191366_242_808 181
1345 3300053103 Ga0500555_000235 Ga0500555_000235_21670_22227 181
1346 3300053108 Ga0500562_042424 Ga0500562_042424_531_1088 181
1347 3300053120 Ga0500597_000019 Ga0500597_000019_20433_20990 181
1348 3300053129 Ga0500628_146496 Ga0500628_146496_51_608 181
1349 3300053136 Ga0500559_0281522 Ga0500559_0281522_213_770 181
1350 3300053139 Ga0500568_0001313 Ga0500568_0001313_14818_15375 181
1351 3300053177 Ga0500636_0389787 Ga0500636_0389787_18_575 181
1352 3300053730 Ga0500645_000167 Ga0500645_000167_37386_37943 181
1353 3300054114 Ga0501084_0015131 Ga0501084_0015131_323_880 181
1354 3300054114 Ga0501084_0414703 Ga0501084_0414703_528_1085 181
1355 3300054114 Ga0501084_0645659 Ga0501084_0645659_291_851 181
1356 3300059492 Ga0587073_0046370 Ga0587073_0046370_248_805 181
1357 3300060353 Ga0501082_0000394 Ga0501082_0000394_17024_17581 181
1358 3300060353 Ga0501082_0093743 Ga0501082_0093743_1735_2295 181
1359 3300060353 Ga0501082_0124847 Ga0501082_0124847_1108_1668 181
1360 3300060353 Ga0501082_0326672 Ga0501082_0326672_60_620 181
1361 3300061719 Ga0466962_0001724 Ga0466962_0001724_2246_2803 181
1362 3300061719 Ga0466962_0005053 Ga0466962_0005053_2670_3227 181
1363 3300003371 JGI26145J50221_1002765 JGI26145J50221_10027651 182
1364 3300005339 Ga0070660_100136540 Ga0070660_1001365402 182
1365 3300005340 Ga0070689_100940146 Ga0070689_1009401461 182
1366 3300005345 Ga0070692_10003879 Ga0070692_100038792 182
1367 3300005366 Ga0070659_100000052 Ga0070659_10000005248 182
1368 3300005367 Ga0070667_100276494 Ga0070667_1002764942 182
1369 3300006844 Ga0075428_100116793 Ga0075428_1001167932 182
1370 3300025898 Ga0207692_10191756 Ga0207692_101917562 182
1371 3300025919 Ga0207657_10042168 Ga0207657_100421682 182
1372 3300025923 Ga0207681_10001858 Ga0207681_1000185815 182
1373 3300025932 Ga0207690_10000061 Ga0207690_1000006142 182
1374 3300025986 Ga0207658_10193319 Ga0207658_101933192 182
1375 3300027252 Ga0209973_1003226 Ga0209973_10032262 182
1376 3300027424 Ga0209984_1001727 Ga0209984_10017273 182
1377 3300027543 Ga0209999_1000442 Ga0209999_10004423 182
1378 3300027552 Ga0209982_1001040 Ga0209982_10010402 182
1379 3300027614 Ga0209970_1008325 Ga0209970_10083252 182
1380 3300027682 Ga0209971_1001367 Ga0209971_10013676 182
1381 3300027876 Ga0209974_10001896 Ga0209974_100018963 182
1382 3300041512 Ga0451853_1645120 Ga0451853_1645120_278_841 182
1383 3300047320 Ga0495672_0000544 Ga0495672_0000544_40293_40844 182
1384 3300049568 Ga0501031_0076103 Ga0501031_0076103_1149_1709 182
1385 3300049570 Ga0501033_0004295 Ga0501033_0004295_4402_4962 182
1386 3300049571 Ga0501034_0356522 Ga0501034_0356522_622_1182 182
1387 iso_pu_bacteria 2599185359 2600225624 182
1388 iso_pu_bacteria 2818991448 2819613378 182
1389 iso_pu_bacteria 2837678835 2837680697 182
1390 iso_pu_bacteria 2894817345 2894819112 182
1391 3300005367 Ga0070667_100831502 Ga0070667_1008315021 183
1392 3300039437 Ga0436365_0324168 Ga0436365_0324168_2413_2976 183
1393 3300039453 Ga0436362_0657356 Ga0436362_0657356_771_1334 183
1394 3300046525 Ga0495663_0122884 Ga0495663_0122884_52_624 183
1395 3300048929 Ga0496126_1012005 Ga0496126_1012005_47_613 183
1396 3300049823 Ga0501044_0075598 Ga0501044_0075598_2334_2894 183
1397 3300053087 Ga0500643_001605 Ga0500643_001605_3650_4210 183
1398 3300053142 Ga0500577_0003758 Ga0500577_0003758_1006_1578 183
1399 iso_pu_bacteria 2643221607 2644049895 183
1400 iso_pu_bacteria 2643221636 2644203319 183
1401 iso_pu_bacteria 2643221689 2644497671 183
1402 iso_pu_bacteria 2989771324 2989774652 183
1403 3300005356 Ga0070674_100169478 Ga0070674_1001694782 184
1404 3300005455 Ga0070663_100289513 Ga0070663_1002895132 184
1405 3300005618 Ga0068864_100874382 Ga0068864_1008743821 184
1406 3300006195 Ga0075366_10016389 Ga0075366_100163893 184
1407 3300014325 Ga0163163_10284699 Ga0163163_102846992 184
1408 3300017792 Ga0163161_10012090 Ga0163161_100120907 184
1409 3300025931 Ga0207644_10166416 Ga0207644_101664162 184
1410 3300025940 Ga0207691_10007374 Ga0207691_1000737412 184
1411 3300026041 Ga0207639_10210802 Ga0207639_102108022 184
1412 3300026095 Ga0207676_10562303 Ga0207676_105623032 184
1413 3300027876 Ga0209974_10006797 Ga0209974_100067974 184
1414 3300031548 Ga0307408_100798105 Ga0307408_1007981052 184
1415 3300031731 Ga0307405_10204962 Ga0307405_102049622 184
1416 3300031852 Ga0307410_10151037 Ga0307410_101510372 184
1417 3300031903 Ga0307407_10010967 Ga0307407_100109674 184
1418 3300031911 Ga0307412_10031558 Ga0307412_100315583 184
1419 3300032002 Ga0307416_100243197 Ga0307416_1002431972 184
1420 3300035725 Ga0373947_0456849 Ga0373947_0456849_244_837 184
1421 3300039450 Ga0436363_0359992 Ga0436363_0359992_196_756 184
1422 3300042007 Ga0439449_0127096 Ga0439449_0127096_118_672 184
1423 3300048088 Ga0495602_0158386 Ga0495602_0158386_1199_1756 184
1424 3300048910 Ga0496107_0035157 Ga0496107_0035157_1083_1637 184
1425 3300048911 Ga0496108_0724804 Ga0496108_0724804_52_606 184
1426 3300048917 Ga0496114_0006408 Ga0496114_0006408_5784_6338 184
1427 3300049571 Ga0501034_0056437 Ga0501034_0056437_772_1335 184
1428 3300049581 Ga0501047_0412210 Ga0501047_0412210_551_1111 184
1429 3300049823 Ga0501044_0400469 Ga0501044_0400469_385_1041 184
1430 3300005616 Ga0068852_101337712 Ga0068852_1013377122 185
1431 3300006844 Ga0075428_100371580 Ga0075428_1003715802 185
1432 3300006880 Ga0075429_100333234 Ga0075429_1003332342 185
1433 3300009147 Ga0114129_10035130 Ga0114129_100351304 185
1434 3300009551 Ga0105238_10097896 Ga0105238_100978962 185
1435 3300010375 Ga0105239_11489580 Ga0105239_114895802 185
1436 3300021388 Ga0213875_10120439 Ga0213875_101204392 185
1437 3300025924 Ga0207694_10269754 Ga0207694_102697542 185
1438 3300031824 Ga0307413_10776646 Ga0307413_107766461 185
1439 3300037853 Ga0436364_0095944 Ga0436364_0095944_504_1064 185
1440 3300041413 Ga0439465_0000006 Ga0439465_0000006_18073_18639 185
1441 3300041997 Ga0439431_0002900 Ga0439431_0002900_603_1169 185
1442 3300042004 Ga0439445_0000142 Ga0439445_0000142_10848_11414 185
1443 3300047470 Ga0495681_0015144 Ga0495681_0015144_2374_2940 185
1444 3300050507 nmdc:mga05p37_32385_c1 nmdc:mga05p37_32385_c1_3151_3711 185
1445 3300050508 nmdc:mga09592_180455_c1 nmdc:mga09592_180455_c1_178_738 185
1446 3300053085 Ga0495619_0081142 Ga0495619_0081142_20_583 185
1447 3300053087 Ga0500643_008552 Ga0500643_008552_981_1547 185
1448 3300053096 Ga0500641_0017442 Ga0500641_0017442_1925_2491 185
1449 3300053134 Ga0500658_0005949 Ga0500658_0005949_1490_2056 185
1450 3300053153 Ga0500616_0044457 Ga0500616_0044457_1574_2140 185
1451 3300001979 JGI24740J21852_10000320 JGI24740J21852_1000032014 186
1452 3300006051 Ga0075364_10015606 Ga0075364_100156063 186
1453 3300046660 Ga0495625_0047054 Ga0495625_0047054_2307_2885 186
1454 3300046674 Ga0495588_0153472 Ga0495588_0153472_225_803 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

19

190

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9803 1 176
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9798 2 179
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9735 2 179
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9693 1 176
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9681 2 180
ID Description Score Start End Superfamily
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9596 2 179 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9595 3 179 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9591 1 177 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9523 3 180 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9492 12 180 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2P5LJ26-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9958 2 143 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A435TQB2-F1-model_v4 deleted 0.9953 1 159
AF-A0A2T0RTK2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9931 2 186 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A069E616-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.993 1 186 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7W6WAL4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9926 3 186 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Feature Viewer

pLDDT pTM Quality
97.6 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map