F493754

General Info

Members Datasets Scaffolds Average Seq Length
1411 568 1394 173

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10379334|Ga0207683_103793342
Length 189
Sequence MSRVGKMPLPVPKGVDVTLTGETISVKGSMGTLVRPVNALVTVKNEEGRLLFAPANDSVEADAMSGTMRALVANMVGGVTKGFEKRLALVGVGFRASAQGSKLNLQVGFSHPVSKEMPAGVKVECPSQTEIVIKGSDRQAVGQVAAEVRALRPPEGPQDDPLRDAPPSDGRVPAGCSTQESRAGSADAC

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
13 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221656 Pelomonas sp. Root405 Isolate Unclassified
16 2738541337 Pelomonas sp. BT06 Isolate Unclassified
17 2831864461 Roseateles noduli HZ7 Isolate Nodule
18 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
120 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
136 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
228 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
239 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
244 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
245 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
248 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
249 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
250 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
255 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
261 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
269 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
270 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
271 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
272 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
273 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
274 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
275 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
276 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
277 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
278 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
281 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
282 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
293 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
299 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
304 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
307 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
308 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
309 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
310 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
311 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
312 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
313 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
314 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
315 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
316 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
317 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
318 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
319 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
320 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
321 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
322 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
323 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
324 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
325 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
326 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
327 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
328 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
329 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
330 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
331 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
332 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
333 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
334 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
335 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
336 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
337 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
338 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
339 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
340 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
341 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
342 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
343 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
344 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
345 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
346 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
347 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
348 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
349 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
350 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
351 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
352 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
353 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
354 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
355 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
356 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
357 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
358 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
359 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
360 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
361 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
362 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
363 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
364 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
365 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
366 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
367 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
368 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
369 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
370 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
371 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
372 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
373 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
374 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
375 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
376 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
377 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
378 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
379 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
380 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
381 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
382 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
383 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
384 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
385 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
386 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
387 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
388 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
389 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
390 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
391 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
392 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
393 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
394 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
395 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
396 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
397 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
398 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
399 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
400 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
401 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
402 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
403 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
404 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
405 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
406 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
407 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
408 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
409 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
410 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
415 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
416 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
417 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
418 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
422 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
423 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
424 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
425 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
426 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
427 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
428 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
429 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
430 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
431 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
432 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
433 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
434 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
438 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
439 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
440 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
441 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
442 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
443 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
446 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
447 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
448 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
449 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
450 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
451 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
459 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
460 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
461 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
462 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
488 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
489 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
490 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
491 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
492 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
493 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
494 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
495 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
496 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
497 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
498 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
499 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
500 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
501 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
502 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
503 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
504 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
505 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
506 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
507 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
508 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
509 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
510 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
511 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
512 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
513 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
514 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
515 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
516 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
520 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
521 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
522 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
523 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
524 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
525 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
526 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
527 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
528 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
529 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
530 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
531 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
532 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
533 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
534 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
535 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
536 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
537 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
538 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
539 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
540 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
541 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
542 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
543 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
544 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
545 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
546 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
547 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
548 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
549 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
550 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
551 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
552 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
553 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
554 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
555 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
556 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
557 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
558 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
559 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.58
Metatranscriptomes 9.21
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 0.35
Rhizoplane 3.33
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_690899 2162886007 Bacteria 2794
2 JGI25156J39149_1016366 3300002705 Bacteria 1443
3 JGI25156J39149_1019922 3300002705 Bacteria 1196
4 JGI25150J39212_1003907 3300002774 Bacteria 3415
5 Ga0006765J45826_106373 3300003161 Bacteria 4293
6 Ga0006759J45824_1028038 3300003163 Bacteria 4414
7 JGI25153J46596_10008637 3300003215 Bacteria 4845
8 Ga0006770J48903_1001899 3300003305 Bacteria 11120
9 Ga0006777J48905_1014855 3300003308 Bacteria 5027
10 Ga0007417J51691_1020817 3300003544 Bacteria 4053
11 Ga0007410J51695_1005226 3300003574 Bacteria 5217
12 Ga0007410J51695_1028665 3300003574 Bacteria 3145
13 Ga0007410J51695_1043180 3300003574 Bacteria 4391
14 Ga0007409J51694_1024055 3300003575 Bacteria 9433
15 Ga0007409J51694_1041611 3300003575 Bacteria 1240
16 Ga0007416J51690_1037564 3300003577 Bacteria 4820
17 Ga0007411J51799_109097 3300003611 Bacteria 3946
18 Ga0007415J51800_107261 3300003613 Bacteria 3368
19 Ga0032354_1038503 3300003693 Bacteria 3177
20 Ga0032354_1038952 3300003693 Bacteria 2112
21 Ga0032354_1072421 3300003693 Bacteria 2730
22 Ga0055535_1003662 3300003761 Bacteria 4181
23 Ga0055529_1000322 3300003763 Bacteria 54232
24 Ga0055526_1000791 3300003771 Bacteria 23567
25 Ga0055524_1000140 3300003775 Bacteria 85990
26 Ga0055528_1069011 3300003790 Bacteria 644
27 Ga0055530_10006458 3300003791 Bacteria 5230
28 Ga0055540_1000133 3300003792 Bacteria 75104
29 Ga0055540_1029907 3300003792 Bacteria 1270
30 Ga0055531_10002079 3300003794 Bacteria 13764
31 Ga0055531_10002114 3300003794 Bacteria 13639
32 Ga0065165_1006303 3300005262 Bacteria 6283
33 Ga0065165_1028112 3300005262 Bacteria 1821
34 Ga0065712_10087248 3300005290 Bacteria 2579
35 Ga0065715_10005249 3300005293 Bacteria 3239
36 Ga0065715_10023020 3300005293 Bacteria 1712
37 Ga0065707_10255698 3300005295 Bacteria 1112
38 Ga0070658_10427594 3300005327 Bacteria 1139
39 Ga0070676_10021276 3300005328 Bacteria 3630
40 Ga0070676_10093888 3300005328 Bacteria 1843
41 Ga0070676_10372716 3300005328 Bacteria 986
42 Ga0070676_10916024 3300005328 Bacteria 654
43 Ga0070676_11043051 3300005328 Bacteria 615
44 Ga0070683_100631138 3300005329 Bacteria 1026
45 Ga0070683_100645299 3300005329 Bacteria 1013
46 Ga0070690_100006927 3300005330 Bacteria 6450
47 Ga0070690_100231854 3300005330 Bacteria 1298
48 Ga0070690_100276410 3300005330 Bacteria 1196
49 Ga0070670_100054237 3300005331 Bacteria 3441
50 Ga0070670_100064589 3300005331 Bacteria 3140
51 Ga0070670_100065507 3300005331 Bacteria 3117
52 Ga0070670_100816423 3300005331 Bacteria 843
53 Ga0070670_101131033 3300005331 Bacteria 715
54 Ga0070677_10017315 3300005333 Bacteria 2578
55 Ga0070677_10135253 3300005333 Bacteria 1130
56 Ga0070677_10146542 3300005333 Bacteria 1094
57 Ga0068869_100077114 3300005334 Bacteria 2478
58 Ga0068869_100146255 3300005334 Bacteria 1829
59 Ga0068869_100257683 3300005334 Bacteria 1395
60 Ga0068869_100283533 3300005334 Bacteria 1333
61 Ga0068869_100284560 3300005334 Bacteria 1330
62 Ga0068869_100547670 3300005334 Bacteria 971
63 Ga0070666_10056809 3300005335 Bacteria 2644
64 Ga0070666_10122448 3300005335 Bacteria 1804
65 Ga0070666_10343207 3300005335 Bacteria 1067
66 Ga0070680_100032809 3300005336 Bacteria 4180
67 Ga0070682_100057764 3300005337 Bacteria 2445
68 Ga0070682_100193784 3300005337 Bacteria 1428
69 Ga0068868_100211639 3300005338 Bacteria 1620
70 Ga0068868_100246199 3300005338 Bacteria 1503
71 Ga0068868_100474633 3300005338 Bacteria 1092
72 Ga0068868_100751149 3300005338 Bacteria 876
73 Ga0070660_100190679 3300005339 Bacteria 1660
74 Ga0070660_100910758 3300005339 Bacteria 742
75 Ga0070660_101202805 3300005339 Bacteria 642
76 Ga0070689_100265958 3300005340 Bacteria 1418
77 Ga0070687_100233714 3300005343 Bacteria 1133
78 Ga0070661_100003672 3300005344 Bacteria 10572
79 Ga0070661_100092952 3300005344 Bacteria 2235
80 Ga0070661_100105291 3300005344 Bacteria 2102
81 Ga0070661_100338960 3300005344 Bacteria 1177
82 Ga0070668_100175163 3300005347 Bacteria 1749
83 Ga0070668_100211316 3300005347 Bacteria 1596
84 Ga0070668_100266732 3300005347 Bacteria 1425
85 Ga0070668_100493006 3300005347 Bacteria 1059
86 Ga0070668_100656989 3300005347 Bacteria 922
87 Ga0070669_100017536 3300005353 Bacteria 5107
88 Ga0070669_100075981 3300005353 Bacteria 2492
89 Ga0070669_100077546 3300005353 Bacteria 2469
90 Ga0070669_100555163 3300005353 Bacteria 958
91 Ga0070675_100044665 3300005354 Bacteria 3623
92 Ga0070675_100119785 3300005354 Bacteria 2235
93 Ga0070675_100159250 3300005354 Bacteria 1940
94 Ga0070675_100364619 3300005354 Bacteria 1283
95 Ga0070675_100413240 3300005354 Bacteria 1205
96 Ga0070675_100860171 3300005354 Bacteria 830
97 Ga0070675_101293146 3300005354 Bacteria 672
98 Ga0070671_100019537 3300005355 Bacteria 5516
99 Ga0070671_100030800 3300005355 Bacteria 4428
100 Ga0070671_100040069 3300005355 Bacteria 3889
101 Ga0070671_100151546 3300005355 Bacteria 1958
102 Ga0070671_100251374 3300005355 Bacteria 1502
103 Ga0070671_100342299 3300005355 Bacteria 1276
104 Ga0070671_100412635 3300005355 Bacteria 1156
105 Ga0070674_100039880 3300005356 Bacteria 3174
106 Ga0070674_100056124 3300005356 Bacteria 2730
107 Ga0070674_100120277 3300005356 Bacteria 1943
108 Ga0070674_100181740 3300005356 Bacteria 1611
109 Ga0070674_100242149 3300005356 Bacteria 1413
110 Ga0070674_100310754 3300005356 Bacteria 1260
111 Ga0070674_101517531 3300005356 Bacteria 602
112 Ga0070673_100002927 3300005364 Bacteria 10519
113 Ga0070673_100055764 3300005364 Bacteria 3115
114 Ga0070673_100092283 3300005364 Bacteria 2476
115 Ga0070673_100169356 3300005364 Bacteria 1863
116 Ga0070673_100192497 3300005364 Bacteria 1752
117 Ga0070673_100525545 3300005364 Bacteria 1073
118 Ga0070673_100759012 3300005364 Bacteria 893
119 Ga0070688_100074242 3300005365 Bacteria 2183
120 Ga0070688_100304757 3300005365 Bacteria 1152
121 Ga0070659_100050300 3300005366 Bacteria 3276
122 Ga0070659_100250633 3300005366 Bacteria 1467
123 Ga0070659_100378036 3300005366 Bacteria 1193
124 Ga0070667_100028082 3300005367 Bacteria 4683
125 Ga0070667_100083378 3300005367 Bacteria 2738
126 Ga0070667_100158747 3300005367 Bacteria 1990
127 Ga0070667_100231002 3300005367 Bacteria 1649
128 Ga0070667_100492119 3300005367 Bacteria 1123
129 Ga0070701_10134721 3300005438 Bacteria 1407
130 Ga0070701_10405461 3300005438 Bacteria 865
131 Ga0070708_100348817 3300005445 Bacteria 1395
132 Ga0070663_100003492 3300005455 Bacteria 9070
133 Ga0070663_100130855 3300005455 Bacteria 1905
134 Ga0070678_100025705 3300005456 Bacteria 3967
135 Ga0070678_100076714 3300005456 Bacteria 2518
136 Ga0070678_100104114 3300005456 Bacteria 2206
137 Ga0070678_100195478 3300005456 Bacteria 1666
138 Ga0070678_100382831 3300005456 Bacteria 1218
139 Ga0070678_100639099 3300005456 Bacteria 953
140 Ga0070678_100694884 3300005456 Bacteria 916
141 Ga0070678_100941219 3300005456 Bacteria 792
142 Ga0070678_101856688 3300005456 Bacteria 569
143 Ga0070662_100060375 3300005457 Bacteria 2765
144 Ga0070662_100065448 3300005457 Bacteria 2665
145 Ga0070662_100111387 3300005457 Bacteria 2085
146 Ga0070662_100212672 3300005457 Bacteria 1539
147 Ga0070662_100322678 3300005457 Bacteria 1259
148 Ga0070662_100351011 3300005457 Bacteria 1208
149 Ga0070681_10088377 3300005458 Bacteria 3051
150 Ga0068867_100000552 3300005459 Bacteria 24723
151 Ga0068867_100002598 3300005459 Bacteria 12737
152 Ga0068867_100011425 3300005459 Bacteria 6266
153 Ga0068867_100087646 3300005459 Bacteria 2357
154 Ga0068867_100117646 3300005459 Bacteria 2049
155 Ga0068867_100223813 3300005459 Bacteria 1517
156 Ga0068867_100276422 3300005459 Bacteria 1375
157 Ga0068867_100336428 3300005459 Bacteria 1255
158 Ga0068867_100411856 3300005459 Bacteria 1143
159 Ga0070706_100025301 3300005467 Bacteria 5463
160 Ga0070707_100035242 3300005468 Bacteria 4774
161 Ga0070679_100007565 3300005530 Bacteria 10160
162 Ga0070684_100178663 3300005535 Bacteria 1929
163 Ga0070684_100565789 3300005535 Bacteria 1055
164 Ga0068853_100428379 3300005539 Bacteria 1242
165 Ga0068853_101387344 3300005539 Bacteria 679
166 Ga0070672_100006187 3300005543 Bacteria 8016
167 Ga0070672_100044598 3300005543 Bacteria 3426
168 Ga0070672_100110140 3300005543 Bacteria 2243
169 Ga0070672_100170362 3300005543 Bacteria 1810
170 Ga0070672_100197483 3300005543 Bacteria 1681
171 Ga0070672_100198587 3300005543 Bacteria 1677
172 Ga0070672_100380405 3300005543 Bacteria 1207
173 Ga0070686_100146015 3300005544 Bacteria 1652
174 Ga0070686_100205477 3300005544 Bacteria 1415
175 Ga0070695_100538265 3300005545 Bacteria 909
176 Ga0070693_100023342 3300005547 Bacteria 3305
177 Ga0070693_100069686 3300005547 Bacteria 2067
178 Ga0070665_100538419 3300005548 Bacteria 1180
179 Ga0068855_100040434 3300005563 Bacteria 5534
180 Ga0068855_100300591 3300005563 Bacteria 1777
181 Ga0070664_100040179 3300005564 Bacteria 3943
182 Ga0070664_100238231 3300005564 Bacteria 1633
183 Ga0070664_100273368 3300005564 Bacteria 1522
184 Ga0070664_100284562 3300005564 Bacteria 1491
185 Ga0070664_100363954 3300005564 Bacteria 1317
186 Ga0070664_101181621 3300005564 Bacteria 721
187 Ga0068857_100040688 3300005577 Bacteria 4122
188 Ga0068857_100209439 3300005577 Bacteria 1778
189 Ga0068857_100442265 3300005577 Bacteria 1214
190 Ga0068854_100044785 3300005578 Bacteria 3143
191 Ga0068854_100352180 3300005578 Bacteria 1205
192 Ga0068854_100392378 3300005578 Bacteria 1146
193 Ga0068854_100559167 3300005578 Bacteria 971
194 Ga0068856_100183859 3300005614 Bacteria 2104
195 Ga0068856_100244565 3300005614 Bacteria 1809
196 Ga0068856_100345416 3300005614 Bacteria 1507
197 Ga0068856_100463129 3300005614 Bacteria 1288
198 Ga0068856_100477988 3300005614 Bacteria 1267
199 Ga0068856_100596350 3300005614 Bacteria 1126
200 Ga0070702_100692109 3300005615 Bacteria 776
201 Ga0068852_100022501 3300005616 Bacteria 5056
202 Ga0068852_100102229 3300005616 Bacteria 2589
203 Ga0068852_100307390 3300005616 Bacteria 1536
204 Ga0068852_100315873 3300005616 Bacteria 1516
205 Ga0068852_100362674 3300005616 Bacteria 1418
206 Ga0068852_100413864 3300005616 Bacteria 1328
207 Ga0068852_100519932 3300005616 Bacteria 1187
208 Ga0068852_100688915 3300005616 Bacteria 1031
209 Ga0068852_101527673 3300005616 Bacteria 690
210 Ga0068852_101974945 3300005616 Bacteria 605
211 Ga0068859_100130187 3300005617 Bacteria 2587
212 Ga0068859_100176605 3300005617 Bacteria 2218
213 Ga0068859_100454844 3300005617 Bacteria 1376
214 Ga0068859_100768856 3300005617 Bacteria 1052
215 Ga0068864_100018772 3300005618 Bacteria 5779
216 Ga0068864_100066476 3300005618 Bacteria 3129
217 Ga0068864_100103544 3300005618 Bacteria 2527
218 Ga0068864_100353670 3300005618 Bacteria 1387
219 Ga0068864_100403474 3300005618 Bacteria 1299
220 Ga0068864_101289846 3300005618 Bacteria 730
221 Ga0068864_101947844 3300005618 Bacteria 593
222 Ga0068866_10061825 3300005718 Bacteria 1946
223 Ga0068866_10091328 3300005718 Bacteria 1659
224 Ga0068861_100004770 3300005719 Bacteria 9115
225 Ga0068861_100016735 3300005719 Bacteria 5194
226 Ga0068861_100021676 3300005719 Bacteria 4620
227 Ga0068861_100170807 3300005719 Bacteria 1802
228 Ga0068861_100247833 3300005719 Bacteria 1518
229 Ga0068851_10109854 3300005834 Bacteria 1471
230 Ga0068851_10143693 3300005834 Bacteria 1299
231 Ga0068851_10206879 3300005834 Bacteria 1097
232 Ga0068851_10263194 3300005834 Bacteria 981
233 Ga0068851_10347902 3300005834 Bacteria 862
234 Ga0068870_10231402 3300005840 Bacteria 1136
235 Ga0068870_10276128 3300005840 Bacteria 1052
236 Ga0068870_10398683 3300005840 Bacteria 895
237 Ga0068863_100043166 3300005841 Bacteria 4281
238 Ga0068863_100104362 3300005841 Bacteria 2696
239 Ga0068863_100257362 3300005841 Bacteria 1687
240 Ga0068863_100338312 3300005841 Bacteria 1464
241 Ga0068863_100410223 3300005841 Bacteria 1326
242 Ga0068858_100008125 3300005842 Bacteria 10091
243 Ga0068858_100030753 3300005842 Bacteria 4986
244 Ga0068858_100194536 3300005842 Bacteria 1916
245 Ga0068860_100008442 3300005843 Bacteria 10260
246 Ga0068860_100065679 3300005843 Bacteria 3445
247 Ga0068860_100210653 3300005843 Bacteria 1885
248 Ga0068860_100446321 3300005843 Bacteria 1286
249 Ga0068860_100633821 3300005843 Bacteria 1076
250 Ga0068862_100103203 3300005844 Bacteria 2497
251 Ga0068862_100335247 3300005844 Bacteria 1400
252 Ga0068862_101115400 3300005844 Bacteria 784
253 Ga0075363_100005889 3300006048 Bacteria 5519
254 Ga0075363_100049841 3300006048 Bacteria 2230
255 Ga0075363_100186191 3300006048 Bacteria 1183
256 Ga0075363_100204317 3300006048 Bacteria 1129
257 Ga0075363_100787507 3300006048 Bacteria 578
258 Ga0075364_10032491 3300006051 Bacteria 3355
259 Ga0075364_10142234 3300006051 Bacteria 1614
260 Ga0075364_10304148 3300006051 Bacteria 1086
261 Ga0075432_10216901 3300006058 Bacteria 764
262 Ga0070715_10025469 3300006163 Bacteria 2344
263 Ga0070716_100069303 3300006173 Bacteria 2066
264 Ga0075362_10000222 3300006177 Bacteria 15765
265 Ga0075362_10060918 3300006177 Bacteria 1706
266 Ga0075362_10090390 3300006177 Bacteria 1421
267 Ga0075362_10313389 3300006177 Bacteria 780
268 Ga0075362_10380970 3300006177 Bacteria 709
269 Ga0075367_10000855 3300006178 Bacteria 12145
270 Ga0075367_10006379 3300006178 Bacteria 5953
271 Ga0075367_10092185 3300006178 Bacteria 1844
272 Ga0075367_10295173 3300006178 Bacteria 1020
273 Ga0075367_10347911 3300006178 Bacteria 935
274 Ga0075369_10005325 3300006186 Bacteria 4797
275 Ga0075369_10159851 3300006186 Bacteria 1032
276 Ga0075369_10410384 3300006186 Bacteria 639
277 Ga0075366_10000776 3300006195 Bacteria 15228
278 Ga0075366_10016473 3300006195 Bacteria 4249
279 Ga0075366_10018148 3300006195 Bacteria 4062
280 Ga0075366_10033848 3300006195 Bacteria 3011
281 Ga0075366_10054228 3300006195 Bacteria 2381
282 Ga0075366_10055751 3300006195 Bacteria 2347
283 Ga0075366_10081535 3300006195 Bacteria 1932
284 Ga0075366_10115763 3300006195 Bacteria 1614
285 Ga0075366_10140745 3300006195 Bacteria 1458
286 Ga0075366_10159590 3300006195 Bacteria 1366
287 Ga0075366_10163686 3300006195 Bacteria 1348
288 Ga0075366_10196478 3300006195 Bacteria 1226
289 Ga0075366_10210884 3300006195 Bacteria 1182
290 Ga0075366_10213318 3300006195 Bacteria 1175
291 Ga0075366_10216952 3300006195 Bacteria 1165
292 Ga0075366_10243514 3300006195 Bacteria 1096
293 Ga0075366_10274182 3300006195 Bacteria 1030
294 Ga0075366_10550230 3300006195 Bacteria 714
295 Ga0075366_10767148 3300006195 Bacteria 599
296 Ga0097621_100047739 3300006237 Bacteria 3470
297 Ga0097621_100115517 3300006237 Bacteria 2272
298 Ga0097621_100612946 3300006237 Bacteria 996
299 Ga0075370_10001150 3300006353 Bacteria 11110
300 Ga0075370_10002824 3300006353 Bacteria 8149
301 Ga0075370_10023630 3300006353 Bacteria 3387
302 Ga0075370_10040903 3300006353 Bacteria 2616
303 Ga0075370_10243310 3300006353 Bacteria 1065
304 Ga0075370_10345440 3300006353 Bacteria 888
305 Ga0075370_10432241 3300006353 Bacteria 791
306 Ga0075370_10643447 3300006353 Bacteria 643
307 Ga0068871_100019288 3300006358 Bacteria 5206
308 Ga0068871_100337306 3300006358 Bacteria 1330
309 Ga0068871_100609286 3300006358 Bacteria 994
310 Ga0075430_100233239 3300006846 Bacteria 1526
311 Ga0075429_100123917 3300006880 Bacteria 2259
312 Ga0068865_100004060 3300006881 Bacteria 8794
313 Ga0068865_100057885 3300006881 Bacteria 2705
314 Ga0068865_100182643 3300006881 Bacteria 1616
315 Ga0097620_100130185 3300006931 Bacteria 2587
316 Ga0097620_100176599 3300006931 Bacteria 2218
317 Ga0097620_100454839 3300006931 Bacteria 1376
318 Ga0097620_100768879 3300006931 Bacteria 1052
319 Ga0099823_1000064 3300006944 Bacteria 50328
320 Ga0079104_1000053 3300006946 Bacteria 168604
321 Ga0105240_10018079 3300009093 Bacteria 9478
322 Ga0105240_10144746 3300009093 Bacteria 2837
323 Ga0105240_11574043 3300009093 Bacteria 688
324 Ga0111539_10581878 3300009094 Bacteria 1304
325 Ga0111539_12836621 3300009094 Bacteria 561
326 Ga0105245_10300472 3300009098 Bacteria 1575
327 Ga0105245_10412159 3300009098 Bacteria 1353
328 Ga0105245_10531521 3300009098 Bacteria 1196
329 Ga0105245_11103815 3300009098 Bacteria 840
330 Ga0105245_11338826 3300009098 Bacteria 765
331 Ga0105247_10612908 3300009101 Bacteria 809
332 Ga0114129_10176739 3300009147 Bacteria 2908
333 Ga0105243_10001789 3300009148 Bacteria 18454
334 Ga0105243_10230579 3300009148 Bacteria 1643
335 Ga0105243_10381139 3300009148 Bacteria 1304
336 Ga0105241_10082907 3300009174 Bacteria 2514
337 Ga0105242_10114272 3300009176 Bacteria 2306
338 Ga0105242_10778232 3300009176 Bacteria 945
339 Ga0105248_10006768 3300009177 Bacteria 12569
340 Ga0105248_10028458 3300009177 Bacteria 6225
341 Ga0105248_10325115 3300009177 Bacteria 1732
342 Ga0105248_10531205 3300009177 Bacteria 1327
343 Ga0105248_11033484 3300009177 Bacteria 928
344 Ga0105248_11063951 3300009177 Bacteria 914
345 Ga0105248_11291431 3300009177 Bacteria 825
346 Ga0105248_12109404 3300009177 Bacteria 641
347 Ga0105237_10000668 3300009545 Bacteria 47303
348 Ga0105237_10020609 3300009545 Bacteria 6794
349 Ga0105237_10393453 3300009545 Bacteria 1391
350 Ga0105237_11251531 3300009545 Bacteria 748
351 Ga0105238_10003926 3300009551 Bacteria 14752
352 Ga0105238_10064333 3300009551 Bacteria 3668
353 Ga0105238_10956536 3300009551 Bacteria 876
354 Ga0105238_12712190 3300009551 Bacteria 532
355 Ga0105249_10300940 3300009553 Bacteria 1609
356 Ga0105249_10309743 3300009553 Bacteria 1587
357 Ga0105249_10567220 3300009553 Bacteria 1187
358 Ga0105249_10629006 3300009553 Bacteria 1130
359 Ga0105239_10001255 3300010375 Bacteria 34466
360 Ga0105239_10444502 3300010375 Bacteria 1470
361 Ga0105239_11064166 3300010375 Bacteria 931
362 Ga0105246_10310875 3300011119 Bacteria 1276
363 Ga0157319_1000005 3300012497 Bacteria 372810
364 Ga0157326_1009237 3300012513 Bacteria 1083
365 Ga0157373_10040286 3300013100 Bacteria 3343
366 Ga0157371_10096460 3300013102 Bacteria 2095
367 Ga0157370_11295331 3300013104 Bacteria 657
368 Ga0157369_10115967 3300013105 Bacteria 2844
369 Ga0157369_10254222 3300013105 Bacteria 1833
370 Ga0157369_10753158 3300013105 Bacteria 1002
371 Ga0157374_10009298 3300013296 Bacteria 8429
372 Ga0157374_10093529 3300013296 Bacteria 2871
373 Ga0157374_10156204 3300013296 Bacteria 2220
374 Ga0157374_10261841 3300013296 Bacteria 1703
375 Ga0157374_10375271 3300013296 Bacteria 1416
376 Ga0157374_10383146 3300013296 Bacteria 1401
377 Ga0157374_10766115 3300013296 Bacteria 980
378 Ga0157378_10008661 3300013297 Bacteria 8856
379 Ga0157378_10328899 3300013297 Bacteria 1487
380 Ga0157378_10379246 3300013297 Bacteria 1388
381 Ga0157378_10415154 3300013297 Bacteria 1329
382 Ga0157378_10458589 3300013297 Bacteria 1266
383 Ga0157378_10787609 3300013297 Bacteria 976
384 Ga0163162_10004148 3300013306 Bacteria 13915
385 Ga0163162_10241802 3300013306 Bacteria 1936
386 Ga0163162_10424477 3300013306 Bacteria 1462
387 Ga0157372_10023087 3300013307 Bacteria 6740
388 Ga0157372_10500446 3300013307 Bacteria 1417
389 Ga0157375_10041626 3300013308 Bacteria 4438
390 Ga0157375_10151438 3300013308 Bacteria 2455
391 Ga0157375_10239233 3300013308 Bacteria 1975
392 Ga0157375_10296051 3300013308 Bacteria 1781
393 Ga0157375_10390226 3300013308 Bacteria 1559
394 Ga0157375_10411974 3300013308 Bacteria 1518
395 Ga0157375_10694323 3300013308 Bacteria 1172
396 Ga0157375_11035597 3300013308 Bacteria 959
397 Ga0157375_11752266 3300013308 Bacteria 736
398 Ga0157375_12669695 3300013308 Bacteria 597
399 Ga0157380_10220443 3300014326 Bacteria 1697
400 Ga0157380_10220567 3300014326 Bacteria 1696
401 Ga0157380_10765256 3300014326 Bacteria 979
402 Ga0157380_10865730 3300014326 Bacteria 927
403 Ga0157380_10896934 3300014326 Bacteria 912
404 Ga0157377_10000368 3300014745 Bacteria 20109
405 Ga0157377_10426448 3300014745 Bacteria 910
406 Ga0157379_10040412 3300014968 Bacteria 4162
407 Ga0157379_10061342 3300014968 Bacteria 3362
408 Ga0157379_10069525 3300014968 Bacteria 3149
409 Ga0157379_10075171 3300014968 Bacteria 3025
410 Ga0157379_10144632 3300014968 Bacteria 2144
411 Ga0157379_10423030 3300014968 Bacteria 1227
412 Ga0157376_10085443 3300014969 Bacteria 2719
413 Ga0157376_10934967 3300014969 Bacteria 887
414 Ga0157376_11159846 3300014969 Bacteria 800
415 Ga0157376_11568433 3300014969 Bacteria 692
416 Ga0182005_1057908 3300015265 Bacteria 1057
417 Ga0163161_10009049 3300017792 Bacteria 6888
418 Ga0163161_10021239 3300017792 Bacteria 4564
419 Ga0163161_10057420 3300017792 Bacteria 2828
420 Ga0163161_10118069 3300017792 Bacteria 1990
421 Ga0163161_10378130 3300017792 Bacteria 1131
422 Ga0206352_11007505 3300020078 Bacteria 3567
423 Ga0209672_106318 3300025228 Bacteria 1938
424 Ga0209563_100088 3300025230 Bacteria 175375
425 Ga0209258_102113 3300025242 Bacteria 5574
426 Ga0207425_1000680 3300025245 Bacteria 18554
427 Ga0209148_1002904 3300025254 Bacteria 5228
428 Ga0209759_1003759 3300025256 Bacteria 5926
429 Ga0209759_1020002 3300025256 Bacteria 1568
430 Ga0209129_1000158 3300025258 Bacteria 103711
431 Ga0209129_1034916 3300025258 Bacteria 820
432 Ga0207666_1002377 3300025271 Bacteria 2265
433 Ga0209455_1000083 3300025272 Bacteria 255660
434 Ga0209673_1004093 3300025273 Bacteria 8026
435 Ga0209673_1024595 3300025273 Bacteria 2019
436 Ga0209673_1032334 3300025273 Bacteria 1613
437 Ga0209675_1038432 3300025291 Bacteria 1066
438 Ga0209564_1000282 3300025295 Bacteria 103837
439 Ga0209758_1000910 3300025297 Bacteria 40059
440 Ga0209758_1011080 3300025297 Bacteria 5275
441 Ga0209050_1000223 3300025298 Bacteria 125465
442 Ga0209050_1001097 3300025298 Bacteria 32856
443 Ga0209050_1004273 3300025298 Bacteria 9808
444 Ga0209050_1013102 3300025298 Bacteria 3724
445 Ga0209256_1000045 3300025299 Bacteria 325506
446 Ga0209256_1008928 3300025299 Bacteria 4516
447 Ga0209256_1009680 3300025299 Bacteria 4174
448 Ga0209256_1051545 3300025299 Bacteria 992
449 Ga0209051_1000004 3300025303 Bacteria 1155596
450 Ga0209051_1000938 3300025303 Bacteria 28786
451 Ga0209051_1005321 3300025303 Bacteria 7574
452 Ga0209051_1018074 3300025303 Bacteria 3132
453 Ga0209257_1000047 3300025304 Bacteria 460507
454 Ga0209257_1000315 3300025304 Bacteria 102293
455 Ga0209257_1019529 3300025304 Bacteria 2547
456 Ga0209257_1061640 3300025304 Bacteria 1017
457 Ga0209257_1061925 3300025304 Bacteria 1014
458 Ga0209257_1108456 3300025304 Bacteria 666
459 Ga0207697_10029574 3300025315 Bacteria 2242
460 Ga0207656_10020792 3300025321 Bacteria 2612
461 Ga0207656_10143536 3300025321 Bacteria 1126
462 Ga0207656_10148077 3300025321 Bacteria 1110
463 Ga0207656_10184172 3300025321 Bacteria 1003
464 Ga0207656_10300398 3300025321 Bacteria 795
465 Ga0207682_10002147 3300025893 Bacteria 8941
466 Ga0207682_10021887 3300025893 Bacteria 2516
467 Ga0207682_10053083 3300025893 Bacteria 1680
468 Ga0207682_10117103 3300025893 Bacteria 1178
469 Ga0207642_10040268 3300025899 Bacteria 2037
470 Ga0207642_10092854 3300025899 Bacteria 1495
471 Ga0207642_10146240 3300025899 Bacteria 1252
472 Ga0207688_10037622 3300025901 Bacteria 2684
473 Ga0207688_10063302 3300025901 Bacteria 2086
474 Ga0207688_10338749 3300025901 Bacteria 925
475 Ga0207680_10014229 3300025903 Bacteria 4110
476 Ga0207680_10183316 3300025903 Bacteria 1417
477 Ga0207680_10187572 3300025903 Bacteria 1402
478 Ga0207680_10276263 3300025903 Bacteria 1166
479 Ga0207680_10373861 3300025903 Bacteria 1004
480 Ga0207680_10487411 3300025903 Bacteria 877
481 Ga0207645_10009972 3300025907 Bacteria 6544
482 Ga0207645_10012543 3300025907 Bacteria 5748
483 Ga0207645_10047232 3300025907 Bacteria 2749
484 Ga0207645_10048474 3300025907 Bacteria 2713
485 Ga0207645_10086402 3300025907 Bacteria 2015
486 Ga0207645_10139657 3300025907 Bacteria 1578
487 Ga0207645_10226543 3300025907 Bacteria 1233
488 Ga0207645_10356540 3300025907 Bacteria 979
489 Ga0207643_10146766 3300025908 Bacteria 1412
490 Ga0207643_10340502 3300025908 Bacteria 940
491 Ga0207705_10850984 3300025909 Bacteria 707
492 Ga0207684_10124693 3300025910 Bacteria 2209
493 Ga0207654_10056380 3300025911 Bacteria 2279
494 Ga0207654_10187962 3300025911 Bacteria 1352
495 Ga0207707_10231795 3300025912 Bacteria 1606
496 Ga0207695_10010589 3300025913 Bacteria 11272
497 Ga0207695_10190969 3300025913 Bacteria 1966
498 Ga0207671_10019707 3300025914 Bacteria 5152
499 Ga0207671_10036592 3300025914 Bacteria 3641
500 Ga0207671_10571855 3300025914 Bacteria 901
501 Ga0207660_10046145 3300025917 Bacteria 3073
502 Ga0207662_10034330 3300025918 Bacteria 2960
503 Ga0207662_10808995 3300025918 Bacteria 661
504 Ga0207657_10092779 3300025919 Bacteria 2516
505 Ga0207657_10350616 3300025919 Bacteria 1164
506 Ga0207657_10566625 3300025919 Bacteria 887
507 Ga0207657_10956381 3300025919 Bacteria 658
508 Ga0207649_10001794 3300025920 Bacteria 12285
509 Ga0207649_10004699 3300025920 Bacteria 7389
510 Ga0207649_10137933 3300025920 Bacteria 1665
511 Ga0207649_10240920 3300025920 Bacteria 1298
512 Ga0207649_10384119 3300025920 Bacteria 1047
513 Ga0207652_10002940 3300025921 Bacteria 14249
514 Ga0207646_10033831 3300025922 Bacteria 4620
515 Ga0207681_10005925 3300025923 Bacteria 7494
516 Ga0207681_10021332 3300025923 Bacteria 4116
517 Ga0207681_10083993 3300025923 Bacteria 2255
518 Ga0207681_10111387 3300025923 Bacteria 1991
519 Ga0207681_10139757 3300025923 Bacteria 1802
520 Ga0207681_10593692 3300025923 Bacteria 914
521 Ga0207681_11287919 3300025923 Bacteria 614
522 Ga0207694_10004619 3300025924 Bacteria 10727
523 Ga0207694_10034844 3300025924 Bacteria 3861
524 Ga0207694_10310362 3300025924 Bacteria 1300
525 Ga0207694_10735795 3300025924 Bacteria 832
526 Ga0207650_10002454 3300025925 Bacteria 12900
527 Ga0207650_10022053 3300025925 Bacteria 4507
528 Ga0207650_10242099 3300025925 Bacteria 1458
529 Ga0207650_10302708 3300025925 Bacteria 1306
530 Ga0207650_10515056 3300025925 Bacteria 1001
531 Ga0207650_10706362 3300025925 Bacteria 852
532 Ga0207659_10003025 3300025926 Bacteria 10030
533 Ga0207659_10056531 3300025926 Bacteria 2811
534 Ga0207659_10072814 3300025926 Bacteria 2513
535 Ga0207659_10229273 3300025926 Bacteria 1497
536 Ga0207659_10338491 3300025926 Bacteria 1245
537 Ga0207659_10381945 3300025926 Bacteria 1175
538 Ga0207659_10454645 3300025926 Bacteria 1079
539 Ga0207659_10617259 3300025926 Bacteria 925
540 Ga0207659_11452594 3300025926 Bacteria 587
541 Ga0207687_10108511 3300025927 Bacteria 2055
542 Ga0207644_10015416 3300025931 Bacteria 5129
543 Ga0207644_10024978 3300025931 Bacteria 4105
544 Ga0207644_10027492 3300025931 Bacteria 3929
545 Ga0207644_10184530 3300025931 Bacteria 1637
546 Ga0207644_10246131 3300025931 Bacteria 1425
547 Ga0207644_10256867 3300025931 Bacteria 1396
548 Ga0207644_10692643 3300025931 Bacteria 849
549 Ga0207644_10909750 3300025931 Bacteria 737
550 Ga0207690_10001731 3300025932 Bacteria 13411
551 Ga0207690_10039856 3300025932 Bacteria 3067
552 Ga0207690_10056794 3300025932 Bacteria 2642
553 Ga0207690_10475284 3300025932 Bacteria 1008
554 Ga0207706_10079225 3300025933 Bacteria 2889
555 Ga0207706_10116108 3300025933 Bacteria 2354
556 Ga0207706_10150050 3300025933 Bacteria 2050
557 Ga0207706_10247137 3300025933 Bacteria 1559
558 Ga0207706_10265491 3300025933 Bacteria 1498
559 Ga0207706_10274953 3300025933 Bacteria 1470
560 Ga0207686_10048318 3300025934 Bacteria 2635
561 Ga0207709_10001005 3300025935 Bacteria 20902
562 Ga0207709_10020689 3300025935 Bacteria 3715
563 Ga0207709_10092231 3300025935 Bacteria 1983
564 Ga0207709_10146045 3300025935 Bacteria 1632
565 Ga0207709_10457789 3300025935 Bacteria 987
566 Ga0207709_10499485 3300025935 Bacteria 949
567 Ga0207669_10027395 3300025937 Bacteria 3119
568 Ga0207669_10115067 3300025937 Bacteria 1812
569 Ga0207669_10124757 3300025937 Bacteria 1756
570 Ga0207669_10149676 3300025937 Bacteria 1633
571 Ga0207669_10192156 3300025937 Bacteria 1473
572 Ga0207669_10810425 3300025937 Bacteria 777
573 Ga0207704_10006606 3300025938 Bacteria 5426
574 Ga0207704_10044043 3300025938 Bacteria 2640
575 Ga0207704_10940374 3300025938 Bacteria 729
576 Ga0207704_11165024 3300025938 Bacteria 656
577 Ga0207665_10131977 3300025939 Bacteria 1774
578 Ga0207691_10002550 3300025940 Bacteria 17799
579 Ga0207691_10071477 3300025940 Bacteria 3131
580 Ga0207691_10102749 3300025940 Bacteria 2549
581 Ga0207691_10126451 3300025940 Bacteria 2261
582 Ga0207691_10214431 3300025940 Bacteria 1671
583 Ga0207691_10413729 3300025940 Bacteria 1149
584 Ga0207691_10421854 3300025940 Bacteria 1137
585 Ga0207691_10455132 3300025940 Bacteria 1089
586 Ga0207711_10009785 3300025941 Bacteria 7972
587 Ga0207711_10023140 3300025941 Bacteria 5200
588 Ga0207711_10072285 3300025941 Bacteria 2996
589 Ga0207711_10465174 3300025941 Bacteria 1178
590 Ga0207711_10589696 3300025941 Bacteria 1037
591 Ga0207711_10659613 3300025941 Bacteria 976
592 Ga0207711_10763481 3300025941 Bacteria 901
593 Ga0207711_11243660 3300025941 Bacteria 686
594 Ga0207689_10015223 3300025942 Bacteria 6512
595 Ga0207689_10033146 3300025942 Bacteria 4292
596 Ga0207689_10038004 3300025942 Bacteria 3989
597 Ga0207689_10117050 3300025942 Bacteria 2191
598 Ga0207689_10348642 3300025942 Bacteria 1231
599 Ga0207661_10026944 3300025944 Bacteria 4386
600 Ga0207661_10710796 3300025944 Bacteria 924
601 Ga0207679_10001498 3300025945 Bacteria 14638
602 Ga0207679_10016048 3300025945 Bacteria 4965
603 Ga0207679_10796798 3300025945 Bacteria 861
604 Ga0207679_11154867 3300025945 Bacteria 711
605 Ga0207667_10188077 3300025949 Bacteria 2119
606 Ga0207651_10004839 3300025960 Bacteria 6859
607 Ga0207651_10043195 3300025960 Bacteria 3006
608 Ga0207651_10059456 3300025960 Bacteria 2648
609 Ga0207651_10063480 3300025960 Bacteria 2579
610 Ga0207651_10163749 3300025960 Bacteria 1746
611 Ga0207651_10249829 3300025960 Bacteria 1450
612 Ga0207651_10315833 3300025960 Bacteria 1304
613 Ga0207651_10477293 3300025960 Bacteria 1074
614 Ga0207651_10840667 3300025960 Bacteria 815
615 Ga0207712_10040645 3300025961 Bacteria 3193
616 Ga0207712_10063392 3300025961 Bacteria 2632
617 Ga0207712_10129841 3300025961 Bacteria 1918
618 Ga0207712_10258983 3300025961 Bacteria 1410
619 Ga0207668_10008000 3300025972 Bacteria 6291
620 Ga0207668_10211665 3300025972 Bacteria 1551
621 Ga0207668_10283658 3300025972 Bacteria 1359
622 Ga0207668_10374285 3300025972 Bacteria 1197
623 Ga0207640_10014813 3300025981 Bacteria 4497
624 Ga0207640_10130332 3300025981 Bacteria 1817
625 Ga0207640_10146361 3300025981 Bacteria 1729
626 Ga0207658_10002481 3300025986 Bacteria 13444
627 Ga0207658_10019932 3300025986 Bacteria 4641
628 Ga0207658_10186325 3300025986 Bacteria 1721
629 Ga0207658_10204295 3300025986 Bacteria 1651
630 Ga0207658_10253878 3300025986 Bacteria 1495
631 Ga0207658_10308286 3300025986 Bacteria 1366
632 Ga0207658_10515759 3300025986 Bacteria 1066
633 Ga0207677_10158539 3300026023 Bacteria 1755
634 Ga0207677_10222318 3300026023 Bacteria 1515
635 Ga0207677_10493235 3300026023 Bacteria 1057
636 Ga0207677_10652352 3300026023 Bacteria 929
637 Ga0207677_10874039 3300026023 Bacteria 809
638 Ga0207703_10002613 3300026035 Bacteria 15539
639 Ga0207703_10027342 3300026035 Bacteria 4492
640 Ga0207703_10030166 3300026035 Bacteria 4283
641 Ga0207703_10139551 3300026035 Bacteria 2102
642 Ga0207639_10244159 3300026041 Bacteria 1563
643 Ga0207639_10376167 3300026041 Bacteria 1274
644 Ga0207639_10407530 3300026041 Bacteria 1226
645 Ga0207639_10601595 3300026041 Bacteria 1014
646 Ga0207639_10718737 3300026041 Bacteria 927
647 Ga0207678_10008286 3300026067 Bacteria 9159
648 Ga0207678_10087396 3300026067 Bacteria 2664
649 Ga0207678_10099481 3300026067 Bacteria 2484
650 Ga0207678_11077997 3300026067 Bacteria 711
651 Ga0207708_10168085 3300026075 Bacteria 1735
652 Ga0207702_10004993 3300026078 Bacteria 11656
653 Ga0207702_10150760 3300026078 Bacteria 2115
654 Ga0207702_10415921 3300026078 Bacteria 1299
655 Ga0207702_10429607 3300026078 Bacteria 1278
656 Ga0207702_10655235 3300026078 Bacteria 1033
657 Ga0207641_10028453 3300026088 Bacteria 4618
658 Ga0207641_10346817 3300026088 Bacteria 1414
659 Ga0207648_10002176 3300026089 Bacteria 21281
660 Ga0207648_10005939 3300026089 Bacteria 12211
661 Ga0207648_10015751 3300026089 Bacteria 6936
662 Ga0207648_10017221 3300026089 Bacteria 6586
663 Ga0207648_10084574 3300026089 Bacteria 2767
664 Ga0207648_10087281 3300026089 Bacteria 2722
665 Ga0207648_10159685 3300026089 Bacteria 1991
666 Ga0207648_10173287 3300026089 Bacteria 1908
667 Ga0207648_10735211 3300026089 Bacteria 916
668 Ga0207676_10011142 3300026095 Bacteria 6420
669 Ga0207676_10083692 3300026095 Bacteria 2599
670 Ga0207676_10432909 3300026095 Bacteria 1236
671 Ga0207676_10663401 3300026095 Bacteria 1007
672 Ga0207676_11735979 3300026095 Bacteria 622
673 Ga0207674_10123860 3300026116 Bacteria 2551
674 Ga0207674_10171993 3300026116 Bacteria 2119
675 Ga0207674_10380168 3300026116 Bacteria 1365
676 Ga0207674_10441964 3300026116 Bacteria 1257
677 Ga0207674_11239639 3300026116 Bacteria 715
678 Ga0207674_11328406 3300026116 Bacteria 688
679 Ga0207675_100006663 3300026118 Bacteria 10927
680 Ga0207675_100039987 3300026118 Bacteria 4376
681 Ga0207675_100255531 3300026118 Bacteria 1697
682 Ga0207675_100373676 3300026118 Bacteria 1401
683 Ga0207683_10005923 3300026121 Bacteria 10474
684 Ga0207683_10119357 3300026121 Bacteria 2366
685 Ga0207683_10124519 3300026121 Bacteria 2316
686 Ga0207683_10276638 3300026121 Bacteria 1534
687 Ga0207683_10379334 3300026121 Bacteria 1299
688 Ga0207683_10677579 3300026121 Bacteria 956
689 Ga0207683_10967815 3300026121 Bacteria 790
690 Ga0207683_11336775 3300026121 Bacteria 663
691 Ga0207698_10017410 3300026142 Bacteria 4874
692 Ga0207698_10137421 3300026142 Bacteria 2099
693 Ga0207698_10171946 3300026142 Bacteria 1909
694 Ga0207698_10224392 3300026142 Bacteria 1701
695 Ga0207698_10232611 3300026142 Bacteria 1674
696 Ga0207698_10278355 3300026142 Bacteria 1546
697 Ga0207698_10582075 3300026142 Bacteria 1101
698 Ga0207698_10912475 3300026142 Bacteria 886
699 Ga0209281_1000147 3300027111 Bacteria 168586
700 Ga0209389_1000305 3300027296 Bacteria 30534
701 Ga0209371_1008392 3300027312 Bacteria 3443
702 Ga0209981_1003413 3300027378 Bacteria 2063
703 Ga0209996_1000729 3300027395 Bacteria 3938
704 Ga0209995_1000242 3300027471 Bacteria 8706
705 Ga0209968_1000130 3300027526 Bacteria 13315
706 Ga0209970_1026685 3300027614 Bacteria 993
707 Ga0209971_1072576 3300027682 Bacteria 836
708 Ga0209966_1000117 3300027695 Bacteria 35145
709 Ga0209998_10002530 3300027717 Bacteria 4163
710 Ga0209813_10018964 3300027866 Bacteria 1907
711 Ga0209813_10215862 3300027866 Bacteria 716
712 Ga0209974_10000149 3300027876 Bacteria 21195
713 Ga0207428_10650266 3300027907 Bacteria 757
714 Ga0268265_10029280 3300028380 Bacteria 3951
715 Ga0268265_10186906 3300028380 Bacteria 1785
716 Ga0268265_10241678 3300028380 Bacteria 1594
717 Ga0268264_10002070 3300028381 Bacteria 17906
718 Ga0268264_10002318 3300028381 Bacteria 16843
719 Ga0268264_10053634 3300028381 Bacteria 3364
720 Ga0268264_10057251 3300028381 Bacteria 3260
721 Ga0268264_10324135 3300028381 Bacteria 1458
722 Ga0265334_10119748 3300028573 Bacteria 941
723 Ga0265336_10000028 3300028666 Bacteria 179201
724 Ga0307517_10014561 3300028786 Bacteria 10553
725 Ga0307517_10110559 3300028786 Bacteria 2094
726 Ga0307517_10314484 3300028786 Bacteria 870
727 Ga0307517_10447661 3300028786 Bacteria 670
728 Ga0307517_10475582 3300028786 Bacteria 641
729 Ga0307515_10000096 3300028794 Bacteria 206366
730 Ga0307515_10012540 3300028794 Bacteria 15942
731 Ga0307515_10021273 3300028794 Bacteria 11511
732 Ga0307515_10053115 3300028794 Bacteria 5987
733 Ga0307515_10095676 3300028794 Bacteria 3652
734 Ga0307515_10108460 3300028794 Bacteria 3271
735 Ga0307515_10124094 3300028794 Bacteria 2899
736 Ga0307515_10186828 3300028794 Bacteria 1998
737 Ga0307515_10314400 3300028794 Bacteria 1238
738 Ga0307515_10489385 3300028794 Bacteria 841
739 Ga0265324_10000286 3300029957 Bacteria 37420
740 Ga0265324_10017152 3300029957 Bacteria 2635
741 Ga0268256_1008739 3300030500 Bacteria 3443
742 Ga0307512_10045873 3300030522 Bacteria 3571
743 Ga0307512_10091067 3300030522 Bacteria 2123
744 Ga0265766_1000558 3300030863 Bacteria 1656
745 Ga0265769_100669 3300030888 Bacteria 1460
746 Ga0265328_10046852 3300031239 Bacteria 1589
747 Ga0265331_10028635 3300031250 Bacteria 2784
748 Ga0265327_10000020 3300031251 Bacteria 424552
749 Ga0265316_10000201 3300031344 Bacteria 69415
750 Ga0307513_10004080 3300031456 Bacteria 19563
751 Ga0307513_10019109 3300031456 Bacteria 8167
752 Ga0307513_10034953 3300031456 Bacteria 5631
753 Ga0307513_10063852 3300031456 Bacteria 3884
754 Ga0307513_10299705 3300031456 Bacteria 1375
755 Ga0307513_10461469 3300031456 Bacteria 993
756 Ga0307513_10613605 3300031456 Bacteria 796
757 Ga0307509_10111735 3300031507 Bacteria 2734
758 Ga0307509_10147814 3300031507 Bacteria 2271
759 Ga0307509_10422082 3300031507 Bacteria 1034
760 Ga0307509_10538122 3300031507 Bacteria 847
761 Ga0307408_100000089 3300031548 Bacteria 100712
762 Ga0307408_100013705 3300031548 Bacteria 5383
763 Ga0307408_100041917 3300031548 Bacteria 3248
764 Ga0307408_100255715 3300031548 Bacteria 1447
765 Ga0307408_100299160 3300031548 Bacteria 1347
766 Ga0307408_100345201 3300031548 Bacteria 1261
767 Ga0307508_10000392 3300031616 Bacteria 52650
768 Ga0307508_10103635 3300031616 Bacteria 2441
769 Ga0307508_10335419 3300031616 Bacteria 1103
770 Ga0307508_10529775 3300031616 Bacteria 775
771 Ga0307514_10000339 3300031649 Bacteria 111130
772 Ga0307514_10034392 3300031649 Bacteria 4039
773 Ga0307514_10181649 3300031649 Bacteria 1355
774 Ga0307516_10011689 3300031730 Bacteria 9527
775 Ga0307516_10019197 3300031730 Bacteria 7085
776 Ga0307516_10026535 3300031730 Bacteria 5881
777 Ga0307516_10027941 3300031730 Bacteria 5714
778 Ga0307516_10357568 3300031730 Bacteria 1125
779 Ga0307516_10435876 3300031730 Bacteria 967
780 Ga0307405_10012091 3300031731 Bacteria 4554
781 Ga0307405_10046436 3300031731 Bacteria 2668
782 Ga0307405_10089073 3300031731 Bacteria 2038
783 Ga0307405_10114216 3300031731 Bacteria 1835
784 Ga0307405_10423167 3300031731 Bacteria 1049
785 Ga0307405_10425456 3300031731 Bacteria 1046
786 Ga0307405_10997327 3300031731 Bacteria 714
787 Ga0307413_10032313 3300031824 Bacteria 2965
788 Ga0307413_10400822 3300031824 Bacteria 1075
789 Ga0307410_10063849 3300031852 Bacteria 2528
790 Ga0307410_10073323 3300031852 Bacteria 2380
791 Ga0307410_10140307 3300031852 Bacteria 1787
792 Ga0307410_10351464 3300031852 Bacteria 1178
793 Ga0307410_10480325 3300031852 Bacteria 1019
794 Ga0307410_10516423 3300031852 Bacteria 985
795 Ga0307406_10004866 3300031901 Bacteria 7314
796 Ga0307406_10163268 3300031901 Bacteria 1604
797 Ga0307406_10919022 3300031901 Bacteria 746
798 Ga0307406_10926733 3300031901 Bacteria 743
799 Ga0307407_10061462 3300031903 Bacteria 2196
800 Ga0307407_10150436 3300031903 Bacteria 1512
801 Ga0307407_10168478 3300031903 Bacteria 1440
802 Ga0307412_10011559 3300031911 Bacteria 5119
803 Ga0307412_10074922 3300031911 Bacteria 2320
804 Ga0307412_10263875 3300031911 Bacteria 1344
805 Ga0307412_10288983 3300031911 Bacteria 1291
806 Ga0307412_10475873 3300031911 Bacteria 1035
807 Ga0307412_10705923 3300031911 Bacteria 866
808 Ga0307409_100000577 3300031995 Bacteria 15970
809 Ga0307409_100077436 3300031995 Bacteria 2671
810 Ga0307409_100330064 3300031995 Bacteria 1431
811 Ga0307409_100676297 3300031995 Bacteria 1029
812 Ga0307416_100028404 3300032002 Bacteria 4159
813 Ga0307416_100043561 3300032002 Bacteria 3515
814 Ga0307416_100231430 3300032002 Bacteria 1782
815 Ga0307416_102038128 3300032002 Bacteria 676
816 Ga0307414_10315494 3300032004 Bacteria 1328
817 Ga0307414_10482787 3300032004 Bacteria 1093
818 Ga0307414_10614971 3300032004 Bacteria 976
819 Ga0307414_11034159 3300032004 Bacteria 757
820 Ga0307414_11529907 3300032004 Bacteria 621
821 Ga0307411_10000085 3300032005 Bacteria 28904
822 Ga0307411_10059434 3300032005 Bacteria 2534
823 Ga0307411_10249959 3300032005 Bacteria 1393
824 Ga0307411_10330148 3300032005 Bacteria 1235
825 Ga0307411_10372291 3300032005 Bacteria 1172
826 Ga0307411_10417309 3300032005 Bacteria 1114
827 Ga0307411_11428424 3300032005 Bacteria 634
828 Ga0307415_100034663 3300032126 Bacteria 3289
829 Ga0307415_100039097 3300032126 Bacteria 3132
830 Ga0307415_101345605 3300032126 Bacteria 678
831 Ga0307507_10308226 3300033179 Bacteria 964
832 Ga0307507_10375329 3300033179 Bacteria 822
833 Ga0307510_10053339 3300033180 Bacteria 4251
834 Ga0307510_10168701 3300033180 Bacteria 1771
835 Ga0307510_10262217 3300033180 Bacteria 1209
836 Ga0307510_10511068 3300033180 Bacteria 644
837 Ga0373948_0007447 3300034817 Bacteria 1841
838 Ga0373950_0010768 3300034818 Bacteria 1484
839 Ga0373950_0061099 3300034818 Bacteria 757
840 Ga0373938_0017777 3300034957 Bacteria 1403
841 Ga0373929_0047280 3300035085 Bacteria 974
842 Ga0373940_0013603 3300035088 Bacteria 1973
843 Ga0373944_0037967 3300035089 Bacteria 1478
844 Ga0373949_0102832 3300035090 Bacteria 785
845 Ga0373952_0009457 3300035092 Bacteria 1867
846 Ga0373923_0045641 3300035111 Bacteria 1820
847 Ga0373932_0032954 3300035112 Bacteria 1452
848 Ga0373939_0000348 3300035114 Bacteria 11798
849 Ga0373939_0042737 3300035114 Bacteria 1372
850 Ga0373939_0091802 3300035114 Bacteria 1027
851 Ga0373941_0041755 3300035115 Bacteria 1421
852 Ga0373960_0000482 3300035121 Bacteria 7922
853 Ga0373943_0291532 3300035170 Bacteria 925
854 Ga0373943_0633540 3300035170 Bacteria 631
855 Ga0373946_0150156 3300035171 Bacteria 1086
856 Ga0373946_0225040 3300035171 Bacteria 907
857 Ga0373955_0081524 3300035172 Bacteria 1829
858 Ga0373955_0325970 3300035172 Bacteria 928
859 Ga0373942_0048831 3300035207 Bacteria 1180
860 Ga0373942_0119221 3300035207 Bacteria 823
861 Ga0373962_0023573 3300035242 Bacteria 1640
862 Ga0373962_0036659 3300035242 Bacteria 1366
863 Ga0373924_0230272 3300035410 Bacteria 819
864 Ga0373931_0000535 3300035691 Bacteria 15604
865 Ga0373931_0001474 3300035691 Bacteria 10131
866 Ga0373931_0008660 3300035691 Bacteria 4836
867 Ga0373931_0022499 3300035691 Bacteria 3173
868 Ga0373931_0226087 3300035691 Bacteria 1129
869 Ga0373931_0244172 3300035691 Bacteria 1090
870 Ga0373935_0144534 3300035692 Bacteria 1609
871 Ga0373927_0108327 3300035695 Bacteria 1810
872 Ga0373927_0167679 3300035695 Bacteria 1439
873 Ga0373927_0264990 3300035695 Bacteria 1130
874 Ga0373933_0068855 3300035724 Bacteria 2150
875 Ga0373947_0114560 3300035725 Bacteria 1707
876 Ga0373937_0072024 3300036401 Bacteria 3187
877 Ga0373937_0458717 3300036401 Bacteria 1210
878 Ga0373925_0226591 3300037068 Bacteria 1493
879 Ga0395899_0100034 3300037312 Bacteria 2094
880 Ga0395905_0002507 3300037471 Bacteria 20284
881 Ga0395905_0013480 3300037471 Bacteria 7832
882 Ga0395905_0023115 3300037471 Bacteria 5877
883 Ga0395905_0024456 3300037471 Bacteria 5700
884 Ga0395905_0038305 3300037471 Bacteria 4498
885 Ga0395905_0272105 3300037471 Bacteria 1580
886 Ga0395905_0959727 3300037471 Bacteria 758
887 Ga0436364_1085432 3300037853 Bacteria 707
888 Ga0436365_0827710 3300039437 Bacteria 778
889 Ga0436365_1357722 3300039437 Bacteria 3127
890 Ga0436361_0405071 3300039447 Bacteria 13061
891 Ga0436361_0570086 3300039447 Bacteria 6186
892 Ga0436361_0714431 3300039447 Bacteria 79592
893 Ga0439465_0010171 3300041413 Bacteria 2956
894 Ga0451789_0781745 3300041443 Bacteria 1292
895 Ga0451790_23378 3300041444 Bacteria 1442
896 Ga0451794_49191 3300041446 Bacteria 744
897 Ga0451793_0637995 3300041452 Bacteria 1739
898 Ga0451793_1712280 3300041452 Bacteria 819
899 Ga0451797_1076999 3300041453 Bacteria 986
900 Ga0451795_0329779 3300041456 Bacteria 758
901 Ga0451795_0389599 3300041456 Bacteria 1427
902 Ga0451798_0083945 3300041458 Bacteria 1744
903 Ga0451798_0656124 3300041458 Bacteria 1531
904 Ga0451800_0747462 3300041459 Bacteria 962
905 Ga0451800_1167133 3300041459 Bacteria 975
906 Ga0451800_1232355 3300041459 Bacteria 2467
907 Ga0451802_1098612 3300041460 Bacteria 1461
908 Ga0451802_1810119 3300041460 Bacteria 1370
909 Ga0451805_010137 3300041461 Bacteria 1322
910 Ga0451805_034079 3300041461 Bacteria 3003
911 Ga0451804_0962788 3300041463 Bacteria 984
912 Ga0451807_1114302 3300041486 Bacteria 738
913 Ga0451835_0381887 3300041492 Bacteria 734
914 Ga0451839_0941153 3300041496 Bacteria 997
915 Ga0451839_1495449 3300041496 Bacteria 1324
916 Ga0451849_0242308 3300041505 Bacteria 747
917 Ga0451850_38052 3300041506 Bacteria 1183
918 Ga0451851_1360765 3300041507 Bacteria 920
919 Ga0451843_0687955 3300041509 Bacteria 1690
920 Ga0451843_1071877 3300041509 Bacteria 631
921 Ga0451855_0043459 3300041511 Bacteria 1949
922 Ga0451855_0262815 3300041511 Bacteria 1037
923 Ga0451853_1066481 3300041512 Bacteria 2648
924 Ga0451853_3108740 3300041512 Bacteria 917
925 Ga0439431_0002412 3300041997 Bacteria 4137
926 Ga0439448_0042059 3300042005 Bacteria 1481
927 Ga0439450_082887 3300042008 Bacteria 799
928 Ga0439455_0002630 3300042012 Bacteria 3302
929 Ga0439455_0037486 3300042012 Bacteria 1230
930 Ga0439455_0097345 3300042012 Bacteria 810
931 Ga0450917_000001 3300042120 Bacteria 12228
932 Ga0450919_000025 3300042121 Bacteria 12249
933 Ga0450922_012581 3300042124 Bacteria 822
934 Ga0450888_000936 3300042126 Bacteria 2776
935 Ga0450888_024474 3300042126 Bacteria 785
936 Ga0450890_000549 3300042127 Bacteria 5493
937 Ga0450890_000550 3300042127 Bacteria 5489
938 Ga0450897_024059 3300042128 Bacteria 666
939 Ga0450891_000262 3300042129 Bacteria 5316
940 Ga0450892_001360 3300042130 Bacteria 2438
941 Ga0450895_001799 3300042132 Bacteria 1535
942 Ga0450898_024700 3300042134 Bacteria 1075
943 Ga0450899_002878 3300042135 Bacteria 1862
944 Ga0450902_009473 3300042137 Bacteria 1533
945 Ga0450903_004499 3300042138 Bacteria 2377
946 Ga0450904_002939 3300042139 Bacteria 1920
947 Ga0450889_000161 3300042144 Bacteria 6993
948 Ga0450910_028757 3300042147 Bacteria 866
949 Ga0439446_0028867 3300042156 Bacteria 1599
950 Ga0439446_0055533 3300042156 Bacteria 1189
951 Ga0439446_0094388 3300042156 Bacteria 940
952 Ga0439446_0097753 3300042156 Bacteria 925
953 Ga0439458_0032711 3300042157 Bacteria 1244
954 Ga0439458_0069996 3300042157 Bacteria 885
955 Ga0439434_0007708 3300042435 Bacteria 3155
956 Ga0439434_0015184 3300042435 Bacteria 2296
957 Ga0439434_0177712 3300042435 Bacteria 712
958 Ga0439459_0000309 3300042438 Bacteria 5891
959 Ga0439464_0057110 3300042439 Bacteria 1138
960 Ga0439460_0002749 3300042461 Bacteria 4235
961 Ga0450918_000123 3300042531 Bacteria 16624
962 Ga0450893_0002428 3300042532 Bacteria 2901
963 Ga0451577_0004247 3300042876 Bacteria 15249
964 Ga0451577_0004524 3300042876 Bacteria 14637
965 Ga0451577_0069675 3300042876 Bacteria 3136
966 Ga0451577_0090029 3300042876 Bacteria 2738
967 Ga0439440_0072256 3300042993 Bacteria 900
968 Ga0466969_0000018 3300044656 Bacteria 102911
969 Ga0466969_0002589 3300044656 Bacteria 9661
970 Ga0466969_0012551 3300044656 Bacteria 4465
971 Ga0466972_0026175 3300044658 Bacteria 2890
972 Ga0453683_0310561 3300044673 Bacteria 1009
973 Ga0466965_0008031 3300044683 Bacteria 4871
974 Ga0466965_0018301 3300044683 Bacteria 3357
975 Ga0466965_0125518 3300044683 Bacteria 1327
976 Ga0466966_0009766 3300044684 Bacteria 6359
977 Ga0466966_0021693 3300044684 Bacteria 4215
978 Ga0466961_0005561 3300044693 Bacteria 7954
979 Ga0466961_0026432 3300044693 Bacteria 3731
980 Ga0466963_0028896 3300044694 Bacteria 3564
981 Ga0466963_0537847 3300044694 Bacteria 825
982 Ga0466964_0000637 3300044706 Bacteria 11177
983 Ga0466964_0003200 3300044706 Bacteria 5954
984 Ga0453684_0000516 3300044712 Bacteria 147788
985 Ga0453684_0040166 3300044712 Bacteria 6361
986 Ga0453684_0261576 3300044712 Bacteria 1981
987 Ga0453684_0328109 3300044712 Bacteria 1731
988 Ga0453684_0472317 3300044712 Bacteria 1393
989 Ga0453684_0941811 3300044712 Bacteria 922
990 Ga0453684_1311760 3300044712 Bacteria 755
991 Ga0453684_1631963 3300044712 Bacteria 661
992 Ga0466971_0001482 3300044719 Bacteria 9910
993 Ga0466968_0012515 3300044735 Bacteria 3324
994 Ga0466970_0025081 3300044765 Bacteria 3120
995 Ga0466970_0030706 3300044765 Bacteria 2834
996 Ga0466970_0164426 3300044765 Bacteria 1228
997 Ga0466970_0180749 3300044765 Bacteria 1170
998 Ga0466957_0006128 3300044842 Bacteria 6786
999 Ga0466957_0167035 3300044842 Bacteria 1431
1000 Ga0466960_0076355 3300044901 Bacteria 1678
1001 Ga0466959_0000855 3300045049 Bacteria 17985
1002 Ga0466959_0014533 3300045049 Bacteria 5725
1003 Ga0451576_0003595 3300045051 Bacteria 21077
1004 Ga0451576_0075129 3300045051 Bacteria 3516
1005 Ga0451576_0106671 3300045051 Bacteria 2915
1006 Ga0451576_0168870 3300045051 Bacteria 2283
1007 Ga0451576_0224308 3300045051 Bacteria 1962
1008 Ga0451576_0815101 3300045051 Bacteria 980
1009 Ga0451576_0955282 3300045051 Bacteria 899
1010 Ga0466958_0002207 3300045836 Bacteria 9697
1011 Ga0466958_0022101 3300045836 Bacteria 3722
1012 Ga0466967_0003037 3300045976 Bacteria 10770
1013 Ga0466967_0397643 3300045976 Bacteria 1340
1014 Ga0495592_0000203 3300046454 Bacteria 50733
1015 Ga0495592_0114305 3300046454 Bacteria 1907
1016 Ga0495590_0004188 3300046457 Bacteria 5838
1017 Ga0495590_0011864 3300046457 Bacteria 3248
1018 Ga0495629_0602559 3300046459 Bacteria 735
1019 Ga0495638_0050878 3300046460 Bacteria 2587
1020 Ga0495651_0117098 3300046462 Bacteria 1962
1021 Ga0495651_0418407 3300046462 Bacteria 872
1022 Ga0495650_0007879 3300046471 Bacteria 6324
1023 Ga0495580_0304712 3300046472 Bacteria 1084
1024 Ga0495639_0020558 3300046475 Bacteria 2885
1025 Ga0495639_0103968 3300046475 Bacteria 1343
1026 Ga0495664_0318737 3300046477 Bacteria 938
1027 Ga0495585_0010449 3300046492 Bacteria 5520
1028 Ga0495585_0268620 3300046492 Bacteria 846
1029 Ga0495594_0207607 3300046499 Bacteria 1117
1030 Ga0495606_0368524 3300046507 Bacteria 757
1031 Ga0495608_0083536 3300046511 Bacteria 2073
1032 Ga0495610_0007369 3300046512 Bacteria 7341
1033 Ga0495616_0074407 3300046513 Bacteria 1637
1034 Ga0495620_0021563 3300046515 Bacteria 3126
1035 Ga0495620_0048760 3300046515 Bacteria 1816
1036 Ga0495620_0072683 3300046515 Bacteria 1404
1037 Ga0495620_0083017 3300046515 Bacteria 1294
1038 Ga0495620_0133376 3300046515 Bacteria 974
1039 Ga0495628_0102358 3300046516 Bacteria 2210
1040 Ga0495630_0118838 3300046517 Bacteria 2005
1041 Ga0495631_0022122 3300046518 Bacteria 2957
1042 Ga0495632_0014757 3300046519 Bacteria 4407
1043 Ga0495632_0023097 3300046519 Bacteria 3325
1044 Ga0495632_0046599 3300046519 Bacteria 2153
1045 Ga0495632_0065630 3300046519 Bacteria 1753
1046 Ga0495643_0019121 3300046522 Bacteria 3966
1047 Ga0495643_0279924 3300046522 Bacteria 768
1048 Ga0495648_0268843 3300046524 Bacteria 814
1049 Ga0495666_0154415 3300046526 Bacteria 1066
1050 Ga0495642_0053512 3300046528 Bacteria 1664
1051 Ga0495652_0528558 3300046529 Bacteria 814
1052 Ga0495654_0056414 3300046530 Bacteria 1899
1053 Ga0495654_0129002 3300046530 Bacteria 1137
1054 Ga0495598_0020184 3300046537 Bacteria 1756
1055 Ga0495598_0026107 3300046537 Bacteria 1598
1056 Ga0495598_0063178 3300046537 Bacteria 1147
1057 Ga0495609_0127993 3300046538 Bacteria 1089
1058 Ga0495621_0012556 3300046539 Bacteria 2642
1059 Ga0495621_0019298 3300046539 Bacteria 2225
1060 Ga0495597_0092274 3300046542 Bacteria 1284
1061 Ga0495645_0034282 3300046543 Bacteria 3704
1062 Ga0495622_0022381 3300046557 Bacteria 2945
1063 Ga0495633_0048161 3300046558 Bacteria 2013
1064 Ga0495633_0222627 3300046558 Bacteria 864
1065 Ga0495667_0115936 3300046559 Bacteria 1731
1066 Ga0495656_0056918 3300046615 Bacteria 1691
1067 Ga0495634_0205692 3300046642 Bacteria 1221
1068 Ga0495611_0033426 3300046648 Bacteria 2269
1069 Ga0495625_0006868 3300046660 Bacteria 10052
1070 Ga0495625_0039878 3300046660 Bacteria 3427
1071 Ga0495635_0287125 3300046663 Bacteria 1105
1072 Ga0495657_0288855 3300046675 Bacteria 980
1073 Ga0495646_0061137 3300046680 Bacteria 2244
1074 Ga0495646_0198957 3300046680 Bacteria 1092
1075 Ga0495658_0085813 3300046683 Bacteria 1856
1076 Ga0495658_0097472 3300046683 Bacteria 1750
1077 Ga0495613_0091108 3300046689 Bacteria 2208
1078 Ga0495613_0120251 3300046689 Bacteria 1886
1079 Ga0495624_0074135 3300046690 Bacteria 2115
1080 Ga0495670_0342235 3300046691 Bacteria 804
1081 Ga0495671_0161447 3300046692 Bacteria 1090
1082 Ga0495671_0186886 3300046692 Bacteria 1006
1083 Ga0495649_0006057 3300046694 Bacteria 7562
1084 Ga0495589_0074447 3300046794 Bacteria 1657
1085 Ga0495660_0092909 3300046810 Bacteria 1565
1086 Ga0495604_0436213 3300047317 Bacteria 858
1087 Ga0495676_0010234 3300047321 Bacteria 8515
1088 Ga0495676_0140426 3300047321 Bacteria 1732
1089 Ga0495680_0296214 3300047322 Bacteria 1137
1090 Ga0495687_019359 3300047443 Bacteria 3344
1091 Ga0495687_036928 3300047443 Bacteria 2180
1092 Ga0495673_0084126 3300047469 Bacteria 1312
1093 Ga0495681_0051412 3300047470 Bacteria 1938
1094 Ga0495686_0004619 3300047472 Bacteria 11207
1095 Ga0495686_0066900 3300047472 Bacteria 2219
1096 Ga0495593_0038039 3300047673 Bacteria 2600
1097 Ga0495602_0235589 3300048088 Bacteria 1372
1098 Ga0495615_0017661 3300048090 Bacteria 1558
1099 Ga0495626_0074338 3300048091 Bacteria 1521
1100 Ga0496102_0047306 3300048905 Bacteria 3908
1101 Ga0496102_0060302 3300048905 Bacteria 3470
1102 Ga0496102_0381564 3300048905 Bacteria 1326
1103 Ga0496102_0536484 3300048905 Bacteria 1093
1104 Ga0496103_0130430 3300048906 Bacteria 1605
1105 Ga0496104_0042754 3300048907 Bacteria 4254
1106 Ga0496104_0104722 3300048907 Bacteria 2711
1107 Ga0496104_0579646 3300048907 Bacteria 1032
1108 Ga0496105_0187486 3300048908 Bacteria 1692
1109 Ga0496105_0259562 3300048908 Bacteria 1405
1110 Ga0496105_0786714 3300048908 Bacteria 724
1111 Ga0496106_0745569 3300048909 Bacteria 779
1112 Ga0496107_0171958 3300048910 Bacteria 1608
1113 Ga0496107_0429419 3300048910 Bacteria 982
1114 Ga0496108_0005999 3300048911 Bacteria 9840
1115 Ga0496108_0009350 3300048911 Bacteria 7937
1116 Ga0496108_0042133 3300048911 Bacteria 3811
1117 Ga0496108_0089279 3300048911 Bacteria 2619
1118 Ga0496108_0097580 3300048911 Bacteria 2504
1119 Ga0496109_0084426 3300048912 Bacteria 2930
1120 Ga0496110_0199440 3300048913 Bacteria 1818
1121 Ga0496110_1047933 3300048913 Bacteria 723
1122 Ga0496110_1077670 3300048913 Bacteria 711
1123 Ga0496112_0018422 3300048915 Bacteria 6573
1124 Ga0496113_0391549 3300048916 Bacteria 1115
1125 Ga0496113_0910699 3300048916 Bacteria 695
1126 Ga0496114_0010053 3300048917 Bacteria 7523
1127 Ga0496115_0030230 3300048918 Bacteria 4260
1128 Ga0496121_0042385 3300048924 Bacteria 3960
1129 Ga0496124_0001830 3300048927 Bacteria 29398
1130 Ga0496124_0030272 3300048927 Bacteria 4807
1131 Ga0496125_0013937 3300048928 Bacteria 7862
1132 Ga0496125_0448023 3300048928 Bacteria 740
1133 Ga0501306_000061 3300049127 Bacteria 5674
1134 Ga0501306_001910 3300049127 Bacteria 2048
1135 Ga0501306_011445 3300049127 Bacteria 1132
1136 Ga0501306_021046 3300049127 Bacteria 910
1137 Ga0501308_000386 3300049128 Bacteria 2793
1138 Ga0501308_008278 3300049128 Bacteria 1109
1139 Ga0501308_008957 3300049128 Bacteria 1083
1140 Ga0501308_009824 3300049128 Bacteria 1052
1141 Ga0501309_000014 3300049129 Bacteria 8867
1142 Ga0501309_001211 3300049129 Bacteria 2453
1143 Ga0501309_007735 3300049129 Bacteria 1338
1144 Ga0501309_013195 3300049129 Bacteria 1097
1145 Ga0501309_018814 3300049129 Bacteria 957
1146 Ga0501309_036132 3300049129 Bacteria 743
1147 Ga0501310_000059 3300049130 Bacteria 10166
1148 Ga0501310_002446 3300049130 Bacteria 1764
1149 Ga0501310_004096 3300049130 Bacteria 1450
1150 Ga0501304_000014 3300049160 Bacteria 8417
1151 Ga0501304_000512 3300049160 Bacteria 2059
1152 Ga0501304_000572 3300049160 Bacteria 1989
1153 Ga0501304_004750 3300049160 Bacteria 1040
1154 Ga0501304_009452 3300049160 Bacteria 837
1155 Ga0501304_017098 3300049160 Bacteria 691
1156 Ga0501304_022028 3300049160 Bacteria 637
1157 Ga0501305_000004 3300049161 Bacteria 13267
1158 Ga0501305_002640 3300049161 Bacteria 1956
1159 Ga0501305_002660 3300049161 Bacteria 1951
1160 Ga0501305_007431 3300049161 Bacteria 1392
1161 Ga0501305_009585 3300049161 Bacteria 1276
1162 Ga0501305_013714 3300049161 Bacteria 1124
1163 Ga0501305_018025 3300049161 Bacteria 1019
1164 Ga0501307_000029 3300049162 Bacteria 5210
1165 Ga0501307_001704 3300049162 Bacteria 1920
1166 Ga0501307_009557 3300049162 Bacteria 1110
1167 Ga0501307_032343 3300049162 Bacteria 731
1168 Ga0501307_048365 3300049162 Bacteria 634
1169 Ga0501307_063429 3300049162 Bacteria 577
1170 Ga0501294_004126 3300049517 Bacteria 1369
1171 Ga0501298_007474 3300049521 Bacteria 1813
1172 Ga0501300_000354 3300049523 Bacteria 6950
1173 Ga0501303_013116 3300049526 Bacteria 806
1174 Ga0501311_000038 3300049527 Bacteria 5334
1175 Ga0501311_007764 3300049527 Bacteria 1242
1176 Ga0501311_014890 3300049527 Bacteria 998
1177 Ga0501311_037544 3300049527 Bacteria 724
1178 Ga0501311_049772 3300049527 Bacteria 654
1179 Ga0501312_000016 3300049528 Bacteria 9244
1180 Ga0501312_002743 3300049528 Bacteria 1929
1181 Ga0501312_003126 3300049528 Bacteria 1852
1182 Ga0501312_050778 3300049528 Bacteria 699
1183 Ga0501312_063524 3300049528 Bacteria 643
1184 Ga0501314_000017 3300049530 Bacteria 8558
1185 Ga0501314_002966 3300049530 Bacteria 1344
1186 Ga0501314_007260 3300049530 Bacteria 980
1187 Ga0501314_019295 3300049530 Bacteria 699
1188 Ga0501314_026681 3300049530 Bacteria 626
1189 Ga0501315_000346 3300049531 Bacteria 3048
1190 Ga0501315_003778 3300049531 Bacteria 1539
1191 Ga0501315_014533 3300049531 Bacteria 998
1192 Ga0501315_023950 3300049531 Bacteria 841
1193 Ga0501315_050534 3300049531 Bacteria 652
1194 Ga0501316_001021 3300049532 Bacteria 2235
1195 Ga0501316_001567 3300049532 Bacteria 1971
1196 Ga0501316_008894 3300049532 Bacteria 1117
1197 Ga0501317_000290 3300049533 Bacteria 3266
1198 Ga0501317_001329 3300049533 Bacteria 2109
1199 Ga0501318_000131 3300049534 Bacteria 3541
1200 Ga0501318_000548 3300049534 Bacteria 2463
1201 Ga0501318_000712 3300049534 Bacteria 2277
1202 Ga0501318_036014 3300049534 Bacteria 691
1203 Ga0501319_000082 3300049535 Bacteria 3272
1204 Ga0501319_000240 3300049535 Bacteria 2323
1205 Ga0501320_000131 3300049536 Bacteria 3444
1206 Ga0501320_000368 3300049536 Bacteria 2523
1207 Ga0501320_000489 3300049536 Bacteria 2338
1208 Ga0501320_002265 3300049536 Bacteria 1522
1209 Ga0501320_025278 3300049536 Bacteria 711
1210 Ga0501321_007872 3300049537 Bacteria 1117
1211 Ga0501322_000402 3300049538 Bacteria 1998
1212 Ga0501322_000422 3300049538 Bacteria 1970
1213 Ga0501322_013354 3300049538 Bacteria 662
1214 Ga0501323_000187 3300049539 Bacteria 3964
1215 Ga0501323_000627 3300049539 Bacteria 2715
1216 Ga0501323_000789 3300049539 Bacteria 2528
1217 Ga0501323_008377 3300049539 Bacteria 1199
1218 Ga0501323_044417 3300049539 Bacteria 660
1219 Ga0501324_000208 3300049540 Bacteria 2763
1220 Ga0501325_000034 3300049541 Bacteria 3949
1221 Ga0501325_007278 3300049541 Bacteria 933
1222 Ga0501325_007305 3300049541 Bacteria 932
1223 Ga0501327_04826 3300049543 Bacteria 782
1224 Ga0501327_04896 3300049543 Bacteria 778
1225 Ga0501328_00214 3300049544 Bacteria 1696
1226 Ga0501329_02964 3300049545 Bacteria 841
1227 Ga0501333_001525 3300049549 Bacteria 1264
1228 Ga0501335_007840 3300049551 Bacteria 994
1229 Ga0501336_001307 3300049552 Bacteria 1463
1230 Ga0501340_002905 3300049556 Bacteria 1013
1231 Ga0501043_0000090 3300049579 Bacteria 81336
1232 Ga0501046_0000126 3300049580 Bacteria 81334
1233 Ga0501046_0557944 3300049580 Bacteria 816
1234 Ga0501047_0000160 3300049581 Bacteria 81946
1235 Ga0501048_0003429 3300049582 Bacteria 12039
1236 Ga0501198_000043 3300049649 Bacteria 44170
1237 Ga0501202_000808 3300049652 Bacteria 4708
1238 Ga0501206_001476 3300049653 Bacteria 2936
1239 Ga0501206_015309 3300049653 Bacteria 1061
1240 Ga0501207_023110 3300049654 Bacteria 1008
1241 Ga0501211_000022 3300049658 Bacteria 11753
1242 Ga0501222_000051 3300049662 Bacteria 43800
1243 Ga0501222_001695 3300049662 Bacteria 3064
1244 Ga0501222_002355 3300049662 Bacteria 2622
1245 Ga0501223_013997 3300049663 Bacteria 1593
1246 Ga0501227_003969 3300049665 Bacteria 3187
1247 Ga0501228_000607 3300049666 Bacteria 2339
1248 Ga0501233_042034 3300049668 Bacteria 1078
1249 Ga0501235_001228 3300049669 Bacteria 5397
1250 Ga0501236_005248 3300049670 Bacteria 1561
1251 Ga0501249_003813 3300049679 Bacteria 3043
1252 Ga0501249_163704 3300049679 Bacteria 566
1253 Ga0501252_006049 3300049682 Bacteria 1335
1254 Ga0501253_000109 3300049683 Bacteria 5987
1255 Ga0501253_023370 3300049683 Bacteria 1111
1256 Ga0501257_022365 3300049686 Bacteria 1496
1257 Ga0501258_000137 3300049687 Bacteria 4092
1258 Ga0501221_001094 3300049704 Bacteria 4449
1259 Ga0501225_0006245 3300049705 Bacteria 3481
1260 Ga0501229_001006 3300049706 Bacteria 3217
1261 Ga0501234_011220 3300049707 Bacteria 1400
1262 Ga0501232_001247 3300049757 Bacteria 1976
1263 Ga0501262_000590 3300049759 Bacteria 4309
1264 Ga0501262_009254 3300049759 Bacteria 1216
1265 Ga0501267_004614 3300049764 Bacteria 1286
1266 Ga0501271_001925 3300049768 Bacteria 1811
1267 Ga0501272_000140 3300049769 Bacteria 5782
1268 Ga0501273_023893 3300049770 Bacteria 841
1269 Ga0501282_018464 3300049778 Bacteria 761
1270 Ga0501283_012253 3300049779 Bacteria 1287
1271 Ga0501035_0044369 3300049822 Bacteria 4004
1272 Ga0501035_1171299 3300049822 Bacteria 597
1273 Ga0501044_0057237 3300049823 Bacteria 4001
1274 Ga0501045_0000882 3300049824 Bacteria 19499
1275 Ga0501226_002381 3300049853 Bacteria 2305
1276 nmdc:mga03683_107933_c1 3300050489 Bacteria 1228
1277 nmdc:mga03683_133365_c1 3300050489 Bacteria 1113
1278 nmdc:mga03683_177263_c1 3300050489 Bacteria 971
1279 nmdc:mga03683_18745_c1 3300050489 Bacteria 2635
1280 nmdc:mga03683_63522_c2 3300050489 Bacteria 1225
1281 nmdc:mga03683_77659_c1 3300050489 Bacteria 1429
1282 nmdc:mga03n38_356243_c1 3300050490 Bacteria 797
1283 nmdc:mga03n38_375198_c1 3300050490 Bacteria 778
1284 nmdc:mga03n38_4851_c1 3300050490 Bacteria 4507
1285 nmdc:mga00v17_103467_c1 3300050491 Bacteria 1800
1286 nmdc:mga00v17_113515_c1 3300050491 Bacteria 1720
1287 nmdc:mga00v17_17620_c1 3300050491 Bacteria 4047
1288 nmdc:mga00v17_325496_c1 3300050491 Bacteria 999
1289 nmdc:mga0k408_1021_c1 3300050493 Bacteria 15347
1290 nmdc:mga0k408_117826_c1 3300050493 Bacteria 1572
1291 nmdc:mga0k408_12806_c1 3300050493 Bacteria 4590
1292 nmdc:mga0k408_137955_c1 3300050493 Bacteria 1450
1293 nmdc:mga0k408_153215_c1 3300050493 Bacteria 1373
1294 nmdc:mga0k408_165490_c1 3300050493 Bacteria 1318
1295 nmdc:mga0k408_17134_c1 3300050493 Bacteria 4032
1296 nmdc:mga0k408_172222_c1 3300050493 Bacteria 1291
1297 nmdc:mga0k408_173647_c1 3300050493 Bacteria 1285
1298 nmdc:mga0k408_214738_c1 3300050493 Bacteria 1149
1299 nmdc:mga0k408_219_c1 3300050493 Bacteria 23656
1300 nmdc:mga0k408_22144_c1 3300050493 Bacteria 3577
1301 nmdc:mga0k408_23422_c1 3300050493 Bacteria 3483
1302 nmdc:mga0k408_23786_c1 3300050493 Bacteria 3460
1303 nmdc:mga0k408_249623_c1 3300050493 Bacteria 1060
1304 nmdc:mga0k408_256246_c1 3300050493 Bacteria 1045
1305 nmdc:mga0k408_28249_c1 3300050493 Bacteria 3190
1306 nmdc:mga0k408_34347_c1 3300050493 Bacteria 2903
1307 nmdc:mga0k408_43703_c1 3300050493 Bacteria 2583
1308 nmdc:mga0k408_46982_c1 3300050493 Bacteria 2494
1309 nmdc:mga0k408_49108_c1 3300050493 Bacteria 2443
1310 nmdc:mga0k408_497415_c1 3300050493 Bacteria 723
1311 nmdc:mga0k408_57150_c1 3300050493 Bacteria 2265
1312 nmdc:mga0k408_59396_c1 3300050493 Bacteria 2222
1313 nmdc:mga0k408_59597_c1 3300050493 Bacteria 2218
1314 nmdc:mga0k408_61835_c1 3300050493 Bacteria 2177
1315 nmdc:mga0k408_678497_c1 3300050493 Bacteria 605
1316 nmdc:mga0k408_6946_c1 3300050493 Bacteria 6039
1317 nmdc:mga06z11_11386_c1 3300050494 Bacteria 3834
1318 nmdc:mga06z11_229350_c1 3300050494 Bacteria 1088
1319 nmdc:mga06z11_3023_c1 3300050494 Bacteria 6473
1320 nmdc:mga06z11_880689_c1 3300050494 Bacteria 546
1321 nmdc:mga07m45_13904_c1 3300050496 Bacteria 4278
1322 nmdc:mga07m45_15127_c1 3300050496 Bacteria 4120
1323 nmdc:mga07m45_196968_c1 3300050496 Bacteria 1172
1324 nmdc:mga07m45_20386_c1 3300050496 Bacteria 3601
1325 nmdc:mga07m45_250451_c1 3300050496 Bacteria 1031
1326 nmdc:mga07m45_2931_c1 3300050496 Bacteria 8100
1327 nmdc:mga07m45_69529_c1 3300050496 Bacteria 2002
1328 nmdc:mga07m45_71727_c1 3300050496 Bacteria 1971
1329 nmdc:mga07m45_72406_c1 3300050496 Bacteria 1962
1330 nmdc:mga07m45_74068_c1 3300050496 Bacteria 1940
1331 nmdc:mga07m45_74708_c1 3300050496 Bacteria 1631
1332 nmdc:mga05p37_180274_c1 3300050507 Bacteria 2570
1333 nmdc:mga0qj67_50093_c1 3300050509 Bacteria 3301
1334 nmdc:mga08y16_636309_c1 3300050511 Bacteria 1072
1335 nmdc:mga0sz30_183925_c1 3300050516 Bacteria 928
1336 nmdc:mga0sz30_23261_c1 3300050516 Bacteria 2520
1337 nmdc:mga0sz30_3989_c1 3300050516 Bacteria 5314
1338 Ga0495619_0475112 3300053085 Bacteria 861
1339 Ga0500578_0000292 3300053086 Bacteria 61943
1340 Ga0500578_0201137 3300053086 Bacteria 1219
1341 Ga0500644_0003475 3300053088 Bacteria 3899
1342 Ga0500644_0232343 3300053088 Bacteria 772
1343 Ga0500646_0014216 3300053090 Bacteria 2064
1344 Ga0500646_0221856 3300053090 Bacteria 656
1345 Ga0500651_0000274 3300053093 Bacteria 30518
1346 Ga0500651_0129786 3300053093 Bacteria 1525
1347 Ga0500650_0256249 3300053098 Bacteria 783
1348 Ga0500562_019007 3300053108 Bacteria 1775
1349 Ga0500593_000235 3300053117 Bacteria 22775
1350 Ga0500594_0013014 3300053118 Bacteria 1970
1351 Ga0500621_142333 3300053126 Bacteria 908
1352 Ga0500628_006199 3300053129 Bacteria 2015
1353 Ga0500642_0007842 3300053130 Bacteria 3612
1354 Ga0500652_000400 3300053131 Bacteria 15538
1355 Ga0500652_069558 3300053131 Bacteria 1457
1356 Ga0500652_135627 3300053131 Bacteria 1026
1357 Ga0500655_012927 3300053133 Bacteria 1520
1358 Ga0500655_016385 3300053133 Bacteria 1364
1359 Ga0500658_0026976 3300053134 Bacteria 2217
1360 Ga0500559_0000097 3300053136 Bacteria 70124
1361 Ga0500568_0015583 3300053139 Bacteria 3401
1362 Ga0500568_0065376 3300053139 Bacteria 1400
1363 Ga0500568_0179181 3300053139 Bacteria 779
1364 Ga0500577_0017376 3300053142 Bacteria 2289
1365 Ga0500590_007064 3300053148 Bacteria 5517
1366 Ga0500604_0040251 3300053151 Bacteria 1408
1367 Ga0500619_000012 3300053154 Bacteria 57280
1368 Ga0500620_057705 3300053155 Bacteria 1316
1369 Ga0500622_0000198 3300053156 Bacteria 63633
1370 Ga0500622_0000978 3300053156 Bacteria 24237
1371 Ga0500622_0001316 3300053156 Bacteria 20204
1372 Ga0500622_0071046 3300053156 Bacteria 1759
1373 Ga0500633_0085745 3300053160 Bacteria 1145
1374 Ga0500599_015505 3300053736 Bacteria 1047
1375 Ga0500587_000541 3300053739 Bacteria 4638
1376 Ga0500587_006132 3300053739 Bacteria 1604
1377 Ga0500661_007894 3300055283 Bacteria 1962
1378 Ga0500661_024419 3300055283 Bacteria 1069
1379 Ga0590071_001831 3300059421 Bacteria 5489
1380 Ga0590075_011325 3300059424 Bacteria 2155
1381 Ga0587084_012022 3300059477 Bacteria 1164
1382 Ga0587084_034985 3300059477 Bacteria 827
1383 Ga0587070_007134 3300059491 Bacteria 1537
1384 Ga0587070_098543 3300059491 Bacteria 669
1385 Ga0587083_0017882 3300059505 Bacteria 1274
1386 Ga0587086_016978 3300059507 Bacteria 956
1387 Ga0587101_001008 3300059623 Bacteria 2281
1388 Ga0587062_008101 3300059639 Bacteria 1246
1389 Ga0587068_001309 3300059641 Bacteria 2740
1390 Ga0587108_002956 3300059653 Bacteria 1174
1391 Ga0587111_0005177 3300060346 Bacteria 1991
1392 Ga0587111_0104287 3300060346 Bacteria 710
1393 Ga0466962_0000718 3300061719 Bacteria 14786
1394 Ga0466962_0014522 3300061719 Bacteria 3795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10381139 Ga0105243_103811393 149
2 3300009176 Ga0105242_10778232 Ga0105242_107782322 149
3 3300009553 Ga0105249_10309743 Ga0105249_103097433 149
4 3300013297 Ga0157378_10008661 Ga0157378_100086617 149
5 3300013306 Ga0163162_10004148 Ga0163162_1000414815 149
6 3300013308 Ga0157375_10041626 Ga0157375_100416266 149
7 3300014968 Ga0157379_10069525 Ga0157379_100695256 149
8 3300050493 nmdc:mga0k408_23422_c1 nmdc:mga0k408_23422_c1_1562_2077 149
9 3300025937 Ga0207669_10027395 Ga0207669_100273954 152
10 3300026121 Ga0207683_10967815 Ga0207683_109678151 152
11 3300031911 Ga0307412_10475873 Ga0307412_104758732 152
12 3300042156 Ga0439446_0094388 Ga0439446_0094388_18_533 153
13 3300044712 Ga0453684_1631963 Ga0453684_1631963_132_593 153
14 3300009551 Ga0105238_12712190 Ga0105238_127121901 154
15 3300005333 Ga0070677_10135253 Ga0070677_101352532 155
16 3300005353 Ga0070669_100555163 Ga0070669_1005551631 155
17 3300005355 Ga0070671_100412635 Ga0070671_1004126351 155
18 3300005356 Ga0070674_100039880 Ga0070674_1000398805 155
19 3300005459 Ga0068867_100002598 Ga0068867_10000259810 155
20 3300005543 Ga0070672_100198587 Ga0070672_1001985874 155
21 3300005616 Ga0068852_100315873 Ga0068852_1003158734 155
22 3300005718 Ga0068866_10091328 Ga0068866_100913282 155
23 3300005719 Ga0068861_100016735 Ga0068861_1000167356 155
24 3300005843 Ga0068860_100008442 Ga0068860_10000844210 155
25 3300005844 Ga0068862_100103203 Ga0068862_1001032032 155
26 3300006881 Ga0068865_100004060 Ga0068865_1000040606 155
27 3300017792 Ga0163161_10021239 Ga0163161_100212397 155
28 3300025899 Ga0207642_10092854 Ga0207642_100928542 155
29 3300025903 Ga0207680_10373861 Ga0207680_103738611 155
30 3300025923 Ga0207681_10021332 Ga0207681_100213328 155
31 3300025931 Ga0207644_10256867 Ga0207644_102568673 155
32 3300025935 Ga0207709_10146045 Ga0207709_101460453 155
33 3300025938 Ga0207704_10006606 Ga0207704_100066062 155
34 3300025940 Ga0207691_10214431 Ga0207691_102144312 155
35 3300025960 Ga0207651_10840667 Ga0207651_108406672 155
36 3300025961 Ga0207712_10040645 Ga0207712_100406456 155
37 3300026035 Ga0207703_10027342 Ga0207703_100273426 155
38 3300026075 Ga0207708_10168085 Ga0207708_101680854 155
39 3300026089 Ga0207648_10005939 Ga0207648_1000593916 155
40 3300026118 Ga0207675_100006663 Ga0207675_10000666312 155
41 3300026142 Ga0207698_10171946 Ga0207698_101719463 155
42 3300028380 Ga0268265_10029280 Ga0268265_100292807 155
43 3300028381 Ga0268264_10002318 Ga0268264_1000231817 155
44 3300049128 Ga0501308_009824 Ga0501308_009824_486_1001 155
45 3300049160 Ga0501304_000512 Ga0501304_000512_607_1122 155
46 3300049161 Ga0501305_002660 Ga0501305_002660_83_598 155
47 3300049531 Ga0501315_023950 Ga0501315_023950_241_756 155
48 3300049662 Ga0501222_002355 Ga0501222_002355_2044_2559 155
49 3300035691 Ga0373931_0022499 Ga0373931_0022499_1340_1855 157
50 3300005539 Ga0068853_100428379 Ga0068853_1004283791 158
51 3300044656 Ga0466969_0000018 Ga0466969_0000018_2991_3506 158
52 3300044684 Ga0466966_0009766 Ga0466966_0009766_4746_5261 158
53 3300044765 Ga0466970_0180749 Ga0466970_0180749_235_750 158
54 3300049129 Ga0501309_001211 Ga0501309_001211_1374_1889 158
55 3300049130 Ga0501310_002446 Ga0501310_002446_769_1284 158
56 3300049160 Ga0501304_017098 Ga0501304_017098_65_580 158
57 3300049161 Ga0501305_002640 Ga0501305_002640_1320_1835 158
58 3300049162 Ga0501307_001704 Ga0501307_001704_1284_1799 158
59 3300049527 Ga0501311_007764 Ga0501311_007764_616_1131 158
60 3300049528 Ga0501312_003126 Ga0501312_003126_1216_1731 158
61 3300049530 Ga0501314_026681 Ga0501314_026681_51_566 158
62 3300049531 Ga0501315_003778 Ga0501315_003778_903_1418 158
63 3300049532 Ga0501316_008894 Ga0501316_008894_189_704 158
64 3300049533 Ga0501317_001329 Ga0501317_001329_1246_1761 158
65 3300049534 Ga0501318_000712 Ga0501318_000712_1651_2166 158
66 3300049536 Ga0501320_025278 Ga0501320_025278_85_600 158
67 3300049537 Ga0501321_007872 Ga0501321_007872_36_551 158
68 3300049538 Ga0501322_000422 Ga0501322_000422_230_745 158
69 3300049541 Ga0501325_007305 Ga0501325_007305_169_684 158
70 3300049683 Ga0501253_023370 Ga0501253_023370_581_1096 158
71 3300049822 Ga0501035_0044369 Ga0501035_0044369_2598_3113 161
72 3300034818 Ga0373950_0061099 Ga0373950_0061099_94_585 163
73 3300048908 Ga0496105_0786714 Ga0496105_0786714_11_502 163
74 3300048913 Ga0496110_1047933 Ga0496110_1047933_216_707 163
75 3300049127 Ga0501306_021046 Ga0501306_021046_14_505 163
76 3300049162 Ga0501307_048365 Ga0501307_048365_13_504 163
77 3300049162 Ga0501307_063429 Ga0501307_063429_18_509 163
78 3300053098 Ga0500650_0256249 Ga0500650_0256249_18_509 163
79 3300028794 Ga0307515_10314400 Ga0307515_103144003 164
80 3300031456 Ga0307513_10461469 Ga0307513_104614691 164
81 3300048911 Ga0496108_0097580 Ga0496108_0097580_1453_1947 164
82 3300029957 Ga0265324_10017152 Ga0265324_100171525 165
83 3300033179 Ga0307507_10375329 Ga0307507_103753292 167
84 3300003163 Ga0006759J45824_1028038 Ga0006759J45824_10280386 171
85 3300003544 Ga0007417J51691_1020817 Ga0007417J51691_10208176 171
86 3300003574 Ga0007410J51695_1043180 Ga0007410J51695_10431806 171
87 3300003575 Ga0007409J51694_1024055 Ga0007409J51694_10240556 171
88 3300003577 Ga0007416J51690_1037564 Ga0007416J51690_10375646 171
89 3300003611 Ga0007411J51799_109097 Ga0007411J51799_1090976 171
90 3300003613 Ga0007415J51800_107261 Ga0007415J51800_1072616 171
91 3300003693 Ga0032354_1038503 Ga0032354_10385036 171
92 3300005344 Ga0070661_100003672 Ga0070661_1000036727 171
93 3300005366 Ga0070659_100050300 Ga0070659_1000503005 171
94 3300005457 Ga0070662_100065448 Ga0070662_1000654483 171
95 3300009093 Ga0105240_10018079 Ga0105240_1001807911 171
96 3300009093 Ga0105240_10144746 Ga0105240_101447464 171
97 3300009093 Ga0105240_11574043 Ga0105240_115740432 171
98 3300009094 Ga0111539_10581878 Ga0111539_105818782 171
99 3300009094 Ga0111539_12836621 Ga0111539_128366211 171
100 3300009098 Ga0105245_10300472 Ga0105245_103004723 171
101 3300009098 Ga0105245_10531521 Ga0105245_105315213 171
102 3300009098 Ga0105245_11103815 Ga0105245_111038151 171
103 3300009098 Ga0105245_11338826 Ga0105245_113388261 171
104 3300009101 Ga0105247_10612908 Ga0105247_106129082 171
105 3300009147 Ga0114129_10176739 Ga0114129_101767397 171
106 3300009148 Ga0105243_10001789 Ga0105243_1000178916 171
107 3300009148 Ga0105243_10230579 Ga0105243_102305793 171
108 3300009176 Ga0105242_10114272 Ga0105242_101142726 171
109 3300009177 Ga0105248_10006768 Ga0105248_1000676814 171
110 3300009177 Ga0105248_10325115 Ga0105248_103251154 171
111 3300009177 Ga0105248_10531205 Ga0105248_105312052 171
112 3300009177 Ga0105248_11033484 Ga0105248_110334842 171
113 3300009177 Ga0105248_11063951 Ga0105248_110639512 171
114 3300009177 Ga0105248_11291431 Ga0105248_112914312 171
115 3300009177 Ga0105248_12109404 Ga0105248_121094041 171
116 3300009545 Ga0105237_10000668 Ga0105237_1000066844 171
117 3300009545 Ga0105237_10020609 Ga0105237_100206094 171
118 3300009545 Ga0105237_10393453 Ga0105237_103934532 171
119 3300009551 Ga0105238_10003926 Ga0105238_1000392612 171
120 3300009551 Ga0105238_10956536 Ga0105238_109565361 171
121 3300009553 Ga0105249_10300940 Ga0105249_103009402 171
122 3300009553 Ga0105249_10567220 Ga0105249_105672201 171
123 3300009553 Ga0105249_10629006 Ga0105249_106290062 171
124 3300010375 Ga0105239_10001255 Ga0105239_1000125532 171
125 3300010375 Ga0105239_10444502 Ga0105239_104445022 171
126 3300011119 Ga0105246_10310875 Ga0105246_103108752 171
127 3300012497 Ga0157319_1000005 Ga0157319_100000519 171
128 3300012513 Ga0157326_1009237 Ga0157326_10092372 171
129 3300013104 Ga0157370_11295331 Ga0157370_112953311 171
130 3300013105 Ga0157369_10254222 Ga0157369_102542223 171
131 3300013105 Ga0157369_10753158 Ga0157369_107531582 171
132 3300013296 Ga0157374_10009298 Ga0157374_100092987 171
133 3300013296 Ga0157374_10093529 Ga0157374_100935295 171
134 3300013296 Ga0157374_10156204 Ga0157374_101562044 171
135 3300013296 Ga0157374_10375271 Ga0157374_103752713 171
136 3300013296 Ga0157374_10766115 Ga0157374_107661152 171
137 3300013297 Ga0157378_10328899 Ga0157378_103288993 171
138 3300013297 Ga0157378_10379246 Ga0157378_103792463 171
139 3300013297 Ga0157378_10415154 Ga0157378_104151542 171
140 3300013297 Ga0157378_10458589 Ga0157378_104585891 171
141 3300013297 Ga0157378_10787609 Ga0157378_107876091 171
142 3300013306 Ga0163162_10241802 Ga0163162_102418024 171
143 3300013306 Ga0163162_10424477 Ga0163162_104244772 171
144 3300013308 Ga0157375_10151438 Ga0157375_101514383 171
145 3300013308 Ga0157375_10239233 Ga0157375_102392333 171
146 3300013308 Ga0157375_10296051 Ga0157375_102960512 171
147 3300013308 Ga0157375_10390226 Ga0157375_103902263 171
148 3300013308 Ga0157375_10411974 Ga0157375_104119743 171
149 3300013308 Ga0157375_10694323 Ga0157375_106943231 171
150 3300013308 Ga0157375_11752266 Ga0157375_117522662 171
151 3300013308 Ga0157375_12669695 Ga0157375_126696951 171
152 3300014326 Ga0157380_10220443 Ga0157380_102204432 171
153 3300014326 Ga0157380_10220567 Ga0157380_102205673 171
154 3300014326 Ga0157380_10765256 Ga0157380_107652562 171
155 3300014326 Ga0157380_10865730 Ga0157380_108657302 171
156 3300014326 Ga0157380_10896934 Ga0157380_108969342 171
157 3300014745 Ga0157377_10000368 Ga0157377_1000036817 171
158 3300014745 Ga0157377_10426448 Ga0157377_104264481 171
159 3300014968 Ga0157379_10040412 Ga0157379_100404127 171
160 3300014968 Ga0157379_10075171 Ga0157379_100751716 171
161 3300014968 Ga0157379_10423030 Ga0157379_104230303 171
162 3300014969 Ga0157376_10085443 Ga0157376_100854432 171
163 3300014969 Ga0157376_10934967 Ga0157376_109349671 171
164 3300014969 Ga0157376_11159846 Ga0157376_111598461 171
165 3300014969 Ga0157376_11568433 Ga0157376_115684332 171
166 3300027614 Ga0209970_1026685 Ga0209970_10266851 171
167 3300035085 Ga0373929_0047280 Ga0373929_0047280_278_793 171
168 3300035088 Ga0373940_0013603 Ga0373940_0013603_788_1303 171
169 3300035089 Ga0373944_0037967 Ga0373944_0037967_420_935 171
170 3300035090 Ga0373949_0102832 Ga0373949_0102832_165_680 171
171 3300035111 Ga0373923_0045641 Ga0373923_0045641_1204_1719 171
172 3300035114 Ga0373939_0091802 Ga0373939_0091802_433_948 171
173 3300035170 Ga0373943_0291532 Ga0373943_0291532_190_705 171
174 3300035170 Ga0373943_0633540 Ga0373943_0633540_95_610 171
175 3300035171 Ga0373946_0150156 Ga0373946_0150156_474_989 171
176 3300035171 Ga0373946_0225040 Ga0373946_0225040_11_526 171
177 3300035172 Ga0373955_0081524 Ga0373955_0081524_520_1035 171
178 3300035207 Ga0373942_0119221 Ga0373942_0119221_196_711 171
179 3300035410 Ga0373924_0230272 Ga0373924_0230272_35_550 171
180 3300035691 Ga0373931_0008660 Ga0373931_0008660_1859_2374 171
181 3300035691 Ga0373931_0226087 Ga0373931_0226087_71_586 171
182 3300035691 Ga0373931_0244172 Ga0373931_0244172_515_1030 171
183 3300035692 Ga0373935_0144534 Ga0373935_0144534_713_1228 171
184 3300035695 Ga0373927_0108327 Ga0373927_0108327_115_630 171
185 3300035695 Ga0373927_0167679 Ga0373927_0167679_184_699 171
186 3300035695 Ga0373927_0264990 Ga0373927_0264990_309_824 171
187 3300035724 Ga0373933_0068855 Ga0373933_0068855_1299_1814 171
188 3300035725 Ga0373947_0114560 Ga0373947_0114560_630_1145 171
189 3300036401 Ga0373937_0072024 Ga0373937_0072024_630_1145 171
190 3300036401 Ga0373937_0458717 Ga0373937_0458717_599_1114 171
191 3300037068 Ga0373925_0226591 Ga0373925_0226591_933_1448 171
192 3300037312 Ga0395899_0100034 Ga0395899_0100034_1280_1795 171
193 3300037471 Ga0395905_0002507 Ga0395905_0002507_11260_11775 171
194 3300037471 Ga0395905_0013480 Ga0395905_0013480_1493_2008 171
195 3300037471 Ga0395905_0023115 Ga0395905_0023115_503_1018 171
196 3300037471 Ga0395905_0024456 Ga0395905_0024456_5045_5560 171
197 3300037471 Ga0395905_0038305 Ga0395905_0038305_1248_1763 171
198 3300037471 Ga0395905_0272105 Ga0395905_0272105_279_794 171
199 3300037471 Ga0395905_0959727 Ga0395905_0959727_92_607 171
200 3300037853 Ga0436364_1085432 Ga0436364_1085432_101_616 171
201 3300039437 Ga0436365_0827710 Ga0436365_0827710_91_606 171
202 3300039437 Ga0436365_1357722 Ga0436365_1357722_2246_2761 171
203 3300039447 Ga0436361_0405071 Ga0436361_0405071_6427_6942 171
204 3300039447 Ga0436361_0570086 Ga0436361_0570086_5557_6072 171
205 3300041413 Ga0439465_0010171 Ga0439465_0010171_1825_2340 171
206 3300041444 Ga0451790_23378 Ga0451790_23378_662_1177 171
207 3300041446 Ga0451794_49191 Ga0451794_49191_175_690 171
208 3300041452 Ga0451793_0637995 Ga0451793_0637995_665_1180 171
209 3300041452 Ga0451793_1712280 Ga0451793_1712280_154_669 171
210 3300041453 Ga0451797_1076999 Ga0451797_1076999_256_771 171
211 3300041456 Ga0451795_0329779 Ga0451795_0329779_59_574 171
212 3300041456 Ga0451795_0389599 Ga0451795_0389599_840_1355 171
213 3300041458 Ga0451798_0083945 Ga0451798_0083945_240_755 171
214 3300041458 Ga0451798_0656124 Ga0451798_0656124_582_1097 171
215 3300041459 Ga0451800_0747462 Ga0451800_0747462_155_670 171
216 3300041459 Ga0451800_1167133 Ga0451800_1167133_431_946 171
217 3300041459 Ga0451800_1232355 Ga0451800_1232355_773_1288 171
218 3300041460 Ga0451802_1098612 Ga0451802_1098612_328_843 171
219 3300041460 Ga0451802_1810119 Ga0451802_1810119_705_1220 171
220 3300041461 Ga0451805_010137 Ga0451805_010137_135_650 171
221 3300041461 Ga0451805_034079 Ga0451805_034079_2262_2777 171
222 3300041463 Ga0451804_0962788 Ga0451804_0962788_119_634 171
223 3300041486 Ga0451807_1114302 Ga0451807_1114302_148_663 171
224 3300041492 Ga0451835_0381887 Ga0451835_0381887_164_679 171
225 3300041496 Ga0451839_0941153 Ga0451839_0941153_251_775 171
226 3300041496 Ga0451839_1495449 Ga0451839_1495449_239_754 171
227 3300041505 Ga0451849_0242308 Ga0451849_0242308_197_712 171
228 3300041506 Ga0451850_38052 Ga0451850_38052_617_1132 171
229 3300041507 Ga0451851_1360765 Ga0451851_1360765_336_851 171
230 3300041509 Ga0451843_0687955 Ga0451843_0687955_366_881 171
231 3300041509 Ga0451843_1071877 Ga0451843_1071877_104_619 171
232 3300041511 Ga0451855_0043459 Ga0451855_0043459_1372_1887 171
233 3300041511 Ga0451855_0262815 Ga0451855_0262815_462_977 171
234 3300041512 Ga0451853_1066481 Ga0451853_1066481_913_1428 171
235 3300041512 Ga0451853_3108740 Ga0451853_3108740_145_660 171
236 3300041997 Ga0439431_0002412 Ga0439431_0002412_2707_3222 171
237 3300042005 Ga0439448_0042059 Ga0439448_0042059_834_1349 171
238 3300042008 Ga0439450_082887 Ga0439450_082887_40_555 171
239 3300042012 Ga0439455_0002630 Ga0439455_0002630_613_1128 171
240 3300042012 Ga0439455_0037486 Ga0439455_0037486_641_1156 171
241 3300042120 Ga0450917_000001 Ga0450917_000001_4560_5075 171
242 3300042121 Ga0450919_000025 Ga0450919_000025_5768_6283 171
243 3300042124 Ga0450922_012581 Ga0450922_012581_105_620 171
244 3300042126 Ga0450888_000936 Ga0450888_000936_425_940 171
245 3300042126 Ga0450888_024474 Ga0450888_024474_34_549 171
246 3300042127 Ga0450890_000549 Ga0450890_000549_2741_3256 171
247 3300042128 Ga0450897_024059 Ga0450897_024059_81_596 171
248 3300042129 Ga0450891_000262 Ga0450891_000262_1227_1742 171
249 3300042130 Ga0450892_001360 Ga0450892_001360_1256_1771 171
250 3300042132 Ga0450895_001799 Ga0450895_001799_482_997 171
251 3300042134 Ga0450898_024700 Ga0450898_024700_406_921 171
252 3300042135 Ga0450899_002878 Ga0450899_002878_77_592 171
253 3300042137 Ga0450902_009473 Ga0450902_009473_21_536 171
254 3300042138 Ga0450903_004499 Ga0450903_004499_1113_1628 171
255 3300042139 Ga0450904_002939 Ga0450904_002939_378_893 171
256 3300042144 Ga0450889_000161 Ga0450889_000161_4908_5423 171
257 3300042147 Ga0450910_028757 Ga0450910_028757_299_814 171
258 3300042156 Ga0439446_0028867 Ga0439446_0028867_783_1298 171
259 3300042156 Ga0439446_0055533 Ga0439446_0055533_100_615 171
260 3300042156 Ga0439446_0097753 Ga0439446_0097753_122_637 171
261 3300042157 Ga0439458_0032711 Ga0439458_0032711_252_767 171
262 3300042157 Ga0439458_0069996 Ga0439458_0069996_259_774 171
263 3300042435 Ga0439434_0007708 Ga0439434_0007708_1641_2156 171
264 3300042435 Ga0439434_0015184 Ga0439434_0015184_789_1304 171
265 3300042435 Ga0439434_0177712 Ga0439434_0177712_137_652 171
266 3300042439 Ga0439464_0057110 Ga0439464_0057110_580_1095 171
267 3300042461 Ga0439460_0002749 Ga0439460_0002749_2207_2722 171
268 3300042531 Ga0450918_000123 Ga0450918_000123_8582_9097 171
269 3300042532 Ga0450893_0002428 Ga0450893_0002428_2090_2605 171
270 3300042876 Ga0451577_0004247 Ga0451577_0004247_7600_8115 171
271 3300042876 Ga0451577_0069675 Ga0451577_0069675_1171_1686 171
272 3300042876 Ga0451577_0090029 Ga0451577_0090029_1361_1876 171
273 3300042993 Ga0439440_0072256 Ga0439440_0072256_164_679 171
274 3300044656 Ga0466969_0002589 Ga0466969_0002589_6235_6750 171
275 3300044656 Ga0466969_0012551 Ga0466969_0012551_880_1395 171
276 3300044658 Ga0466972_0026175 Ga0466972_0026175_1808_2323 171
277 3300044673 Ga0453683_0310561 Ga0453683_0310561_364_879 171
278 3300044683 Ga0466965_0008031 Ga0466965_0008031_2052_2567 171
279 3300044683 Ga0466965_0018301 Ga0466965_0018301_785_1300 171
280 3300044683 Ga0466965_0125518 Ga0466965_0125518_203_718 171
281 3300044684 Ga0466966_0021693 Ga0466966_0021693_588_1103 171
282 3300044693 Ga0466961_0005561 Ga0466961_0005561_3822_4337 171
283 3300044693 Ga0466961_0026432 Ga0466961_0026432_1603_2118 171
284 3300044694 Ga0466963_0537847 Ga0466963_0537847_13_528 171
285 3300044706 Ga0466964_0000637 Ga0466964_0000637_6446_6961 171
286 3300044706 Ga0466964_0003200 Ga0466964_0003200_811_1326 171
287 3300044712 Ga0453684_0040166 Ga0453684_0040166_220_735 171
288 3300044712 Ga0453684_0261576 Ga0453684_0261576_951_1466 171
289 3300044712 Ga0453684_0328109 Ga0453684_0328109_461_976 171
290 3300044712 Ga0453684_0472317 Ga0453684_0472317_267_782 171
291 3300044712 Ga0453684_0941811 Ga0453684_0941811_56_592 171
292 3300044712 Ga0453684_1311760 Ga0453684_1311760_201_722 171
293 3300044719 Ga0466971_0001482 Ga0466971_0001482_1436_1951 171
294 3300044735 Ga0466968_0012515 Ga0466968_0012515_786_1301 171
295 3300044765 Ga0466970_0025081 Ga0466970_0025081_1027_1542 171
296 3300044765 Ga0466970_0030706 Ga0466970_0030706_1810_2325 171
297 3300044765 Ga0466970_0164426 Ga0466970_0164426_631_1146 171
298 3300044842 Ga0466957_0006128 Ga0466957_0006128_1580_2095 171
299 3300044842 Ga0466957_0167035 Ga0466957_0167035_451_966 171
300 3300044901 Ga0466960_0076355 Ga0466960_0076355_205_720 171
301 3300045049 Ga0466959_0000855 Ga0466959_0000855_8505_9020 171
302 3300045049 Ga0466959_0014533 Ga0466959_0014533_4487_5002 171
303 3300045051 Ga0451576_0003595 Ga0451576_0003595_16740_17255 171
304 3300045051 Ga0451576_0075129 Ga0451576_0075129_1523_2038 171
305 3300045051 Ga0451576_0168870 Ga0451576_0168870_934_1449 171
306 3300045051 Ga0451576_0224308 Ga0451576_0224308_47_562 171
307 3300045051 Ga0451576_0815101 Ga0451576_0815101_232_747 171
308 3300045051 Ga0451576_0955282 Ga0451576_0955282_226_741 171
309 3300045836 Ga0466958_0002207 Ga0466958_0002207_1857_2372 171
310 3300045836 Ga0466958_0022101 Ga0466958_0022101_1692_2207 171
311 3300045976 Ga0466967_0003037 Ga0466967_0003037_5915_6430 171
312 3300046454 Ga0495592_0000203 Ga0495592_0000203_41824_42339 171
313 3300046454 Ga0495592_0114305 Ga0495592_0114305_444_959 171
314 3300046457 Ga0495590_0004188 Ga0495590_0004188_3567_4082 171
315 3300046457 Ga0495590_0011864 Ga0495590_0011864_466_981 171
316 3300046459 Ga0495629_0602559 Ga0495629_0602559_24_539 171
317 3300046460 Ga0495638_0050878 Ga0495638_0050878_873_1388 171
318 3300046462 Ga0495651_0117098 Ga0495651_0117098_1115_1630 171
319 3300046462 Ga0495651_0418407 Ga0495651_0418407_297_812 171
320 3300046471 Ga0495650_0007879 Ga0495650_0007879_5050_5565 171
321 3300046472 Ga0495580_0304712 Ga0495580_0304712_246_761 171
322 3300046475 Ga0495639_0020558 Ga0495639_0020558_789_1304 171
323 3300046475 Ga0495639_0103968 Ga0495639_0103968_347_862 171
324 3300046477 Ga0495664_0318737 Ga0495664_0318737_175_690 171
325 3300046492 Ga0495585_0010449 Ga0495585_0010449_2241_2756 171
326 3300046492 Ga0495585_0268620 Ga0495585_0268620_134_649 171
327 3300046499 Ga0495594_0207607 Ga0495594_0207607_255_770 171
328 3300046507 Ga0495606_0368524 Ga0495606_0368524_200_715 171
329 3300046511 Ga0495608_0083536 Ga0495608_0083536_285_800 171
330 3300046512 Ga0495610_0007369 Ga0495610_0007369_2624_3139 171
331 3300046513 Ga0495616_0074407 Ga0495616_0074407_545_1060 171
332 3300046515 Ga0495620_0021563 Ga0495620_0021563_943_1458 171
333 3300046515 Ga0495620_0048760 Ga0495620_0048760_1277_1792 171
334 3300046515 Ga0495620_0072683 Ga0495620_0072683_838_1353 171
335 3300046515 Ga0495620_0083017 Ga0495620_0083017_743_1258 171
336 3300046515 Ga0495620_0133376 Ga0495620_0133376_176_691 171
337 3300046516 Ga0495628_0102358 Ga0495628_0102358_864_1379 171
338 3300046517 Ga0495630_0118838 Ga0495630_0118838_1340_1855 171
339 3300046518 Ga0495631_0022122 Ga0495631_0022122_1641_2156 171
340 3300046519 Ga0495632_0014757 Ga0495632_0014757_2727_3242 171
341 3300046519 Ga0495632_0023097 Ga0495632_0023097_2487_3002 171
342 3300046519 Ga0495632_0046599 Ga0495632_0046599_1453_1968 171
343 3300046519 Ga0495632_0065630 Ga0495632_0065630_242_757 171
344 3300046522 Ga0495643_0019121 Ga0495643_0019121_2678_3193 171
345 3300046522 Ga0495643_0279924 Ga0495643_0279924_146_661 171
346 3300046524 Ga0495648_0268843 Ga0495648_0268843_126_641 171
347 3300046528 Ga0495642_0053512 Ga0495642_0053512_223_738 171
348 3300046529 Ga0495652_0528558 Ga0495652_0528558_123_638 171
349 3300046530 Ga0495654_0056414 Ga0495654_0056414_111_626 171
350 3300046530 Ga0495654_0129002 Ga0495654_0129002_561_1076 171
351 3300046537 Ga0495598_0020184 Ga0495598_0020184_796_1311 171
352 3300046537 Ga0495598_0026107 Ga0495598_0026107_127_642 171
353 3300046537 Ga0495598_0063178 Ga0495598_0063178_244_759 171
354 3300046538 Ga0495609_0127993 Ga0495609_0127993_492_1007 171
355 3300046539 Ga0495621_0012556 Ga0495621_0012556_475_990 171
356 3300046539 Ga0495621_0019298 Ga0495621_0019298_1425_1940 171
357 3300046542 Ga0495597_0092274 Ga0495597_0092274_169_684 171
358 3300046543 Ga0495645_0034282 Ga0495645_0034282_2659_3174 171
359 3300046557 Ga0495622_0022381 Ga0495622_0022381_1418_1933 171
360 3300046558 Ga0495633_0048161 Ga0495633_0048161_668_1183 171
361 3300046558 Ga0495633_0222627 Ga0495633_0222627_330_845 171
362 3300046559 Ga0495667_0115936 Ga0495667_0115936_1152_1667 171
363 3300046615 Ga0495656_0056918 Ga0495656_0056918_461_976 171
364 3300046642 Ga0495634_0205692 Ga0495634_0205692_160_675 171
365 3300046648 Ga0495611_0033426 Ga0495611_0033426_530_1045 171
366 3300046660 Ga0495625_0006868 Ga0495625_0006868_4238_4753 171
367 3300046660 Ga0495625_0039878 Ga0495625_0039878_1888_2403 171
368 3300046663 Ga0495635_0287125 Ga0495635_0287125_218_733 171
369 3300046675 Ga0495657_0288855 Ga0495657_0288855_445_960 171
370 3300046680 Ga0495646_0061137 Ga0495646_0061137_1005_1520 171
371 3300046680 Ga0495646_0198957 Ga0495646_0198957_18_533 171
372 3300046683 Ga0495658_0097472 Ga0495658_0097472_701_1216 171
373 3300046689 Ga0495613_0091108 Ga0495613_0091108_451_966 171
374 3300046689 Ga0495613_0120251 Ga0495613_0120251_912_1427 171
375 3300046690 Ga0495624_0074135 Ga0495624_0074135_1306_1821 171
376 3300046691 Ga0495670_0342235 Ga0495670_0342235_119_634 171
377 3300046692 Ga0495671_0161447 Ga0495671_0161447_165_680 171
378 3300046692 Ga0495671_0186886 Ga0495671_0186886_65_580 171
379 3300046694 Ga0495649_0006057 Ga0495649_0006057_6154_6669 171
380 3300046794 Ga0495589_0074447 Ga0495589_0074447_57_572 171
381 3300046810 Ga0495660_0092909 Ga0495660_0092909_304_819 171
382 3300047317 Ga0495604_0436213 Ga0495604_0436213_284_799 171
383 3300047321 Ga0495676_0010234 Ga0495676_0010234_5554_6069 171
384 3300047321 Ga0495676_0140426 Ga0495676_0140426_549_1064 171
385 3300047322 Ga0495680_0296214 Ga0495680_0296214_477_992 171
386 3300047443 Ga0495687_019359 Ga0495687_019359_178_693 171
387 3300047443 Ga0495687_036928 Ga0495687_036928_537_1052 171
388 3300047469 Ga0495673_0084126 Ga0495673_0084126_120_635 171
389 3300047470 Ga0495681_0051412 Ga0495681_0051412_641_1156 171
390 3300047472 Ga0495686_0004619 Ga0495686_0004619_8990_9505 171
391 3300047472 Ga0495686_0066900 Ga0495686_0066900_1645_2160 171
392 3300047673 Ga0495593_0038039 Ga0495593_0038039_1521_2036 171
393 3300048088 Ga0495602_0235589 Ga0495602_0235589_198_713 171
394 3300048090 Ga0495615_0017661 Ga0495615_0017661_956_1471 171
395 3300048905 Ga0496102_0047306 Ga0496102_0047306_3344_3859 171
396 3300048905 Ga0496102_0060302 Ga0496102_0060302_863_1378 171
397 3300048905 Ga0496102_0536484 Ga0496102_0536484_13_528 171
398 3300048907 Ga0496104_0042754 Ga0496104_0042754_3513_4028 171
399 3300048907 Ga0496104_0579646 Ga0496104_0579646_22_537 171
400 3300048908 Ga0496105_0187486 Ga0496105_0187486_915_1430 171
401 3300048908 Ga0496105_0259562 Ga0496105_0259562_442_957 171
402 3300048909 Ga0496106_0745569 Ga0496106_0745569_139_654 171
403 3300048910 Ga0496107_0171958 Ga0496107_0171958_272_787 171
404 3300048911 Ga0496108_0005999 Ga0496108_0005999_6798_7313 171
405 3300048911 Ga0496108_0009350 Ga0496108_0009350_5861_6376 171
406 3300048911 Ga0496108_0042133 Ga0496108_0042133_944_1459 171
407 3300048911 Ga0496108_0089279 Ga0496108_0089279_514_1029 171
408 3300048912 Ga0496109_0084426 Ga0496109_0084426_588_1103 171
409 3300048915 Ga0496112_0018422 Ga0496112_0018422_4096_4611 171
410 3300048916 Ga0496113_0391549 Ga0496113_0391549_381_896 171
411 3300048917 Ga0496114_0010053 Ga0496114_0010053_2534_3049 171
412 3300048927 Ga0496124_0030272 Ga0496124_0030272_966_1481 171
413 3300048928 Ga0496125_0448023 Ga0496125_0448023_53_568 171
414 3300049127 Ga0501306_000061 Ga0501306_000061_1048_1563 171
415 3300049127 Ga0501306_011445 Ga0501306_011445_130_645 171
416 3300049128 Ga0501308_000386 Ga0501308_000386_2127_2642 171
417 3300049128 Ga0501308_008957 Ga0501308_008957_486_1001 171
418 3300049129 Ga0501309_000014 Ga0501309_000014_5194_5709 171
419 3300049129 Ga0501309_007735 Ga0501309_007735_549_1064 171
420 3300049129 Ga0501309_013195 Ga0501309_013195_70_585 171
421 3300049129 Ga0501309_018814 Ga0501309_018814_127_642 171
422 3300049129 Ga0501309_036132 Ga0501309_036132_131_646 171
423 3300049130 Ga0501310_000059 Ga0501310_000059_6176_6691 171
424 3300049130 Ga0501310_004096 Ga0501310_004096_850_1365 171
425 3300049160 Ga0501304_000014 Ga0501304_000014_2327_2842 171
426 3300049160 Ga0501304_000572 Ga0501304_000572_201_716 171
427 3300049160 Ga0501304_004750 Ga0501304_004750_119_634 171
428 3300049160 Ga0501304_009452 Ga0501304_009452_192_707 171
429 3300049160 Ga0501304_022028 Ga0501304_022028_82_597 171
430 3300049161 Ga0501305_000004 Ga0501305_000004_6023_6538 171
431 3300049161 Ga0501305_007431 Ga0501305_007431_483_998 171
432 3300049161 Ga0501305_009585 Ga0501305_009585_530_1045 171
433 3300049161 Ga0501305_013714 Ga0501305_013714_378_893 171
434 3300049161 Ga0501305_018025 Ga0501305_018025_76_591 171
435 3300049162 Ga0501307_000029 Ga0501307_000029_555_1070 171
436 3300049162 Ga0501307_009557 Ga0501307_009557_83_598 171
437 3300049162 Ga0501307_032343 Ga0501307_032343_38_553 171
438 3300049517 Ga0501294_004126 Ga0501294_004126_222_737 171
439 3300049521 Ga0501298_007474 Ga0501298_007474_1061_1576 171
440 3300049523 Ga0501300_000354 Ga0501300_000354_964_1479 171
441 3300049526 Ga0501303_013116 Ga0501303_013116_126_641 171
442 3300049527 Ga0501311_000038 Ga0501311_000038_2335_2850 171
443 3300049527 Ga0501311_037544 Ga0501311_037544_169_684 171
444 3300049527 Ga0501311_049772 Ga0501311_049772_24_539 171
445 3300049528 Ga0501312_000016 Ga0501312_000016_6890_7405 171
446 3300049528 Ga0501312_002743 Ga0501312_002743_855_1370 171
447 3300049528 Ga0501312_050778 Ga0501312_050778_113_628 171
448 3300049528 Ga0501312_063524 Ga0501312_063524_77_592 171
449 3300049530 Ga0501314_000017 Ga0501314_000017_6024_6539 171
450 3300049530 Ga0501314_007260 Ga0501314_007260_305_820 171
451 3300049530 Ga0501314_019295 Ga0501314_019295_172_687 171
452 3300049531 Ga0501315_000346 Ga0501315_000346_1184_1699 171
453 3300049531 Ga0501315_014533 Ga0501315_014533_69_584 171
454 3300049531 Ga0501315_050534 Ga0501315_050534_83_598 171
455 3300049532 Ga0501316_001567 Ga0501316_001567_1130_1645 171
456 3300049533 Ga0501317_000290 Ga0501317_000290_1592_2107 171
457 3300049534 Ga0501318_000131 Ga0501318_000131_2055_2570 171
458 3300049534 Ga0501318_000548 Ga0501318_000548_1505_2020 171
459 3300049534 Ga0501318_036014 Ga0501318_036014_119_634 171
460 3300049535 Ga0501319_000082 Ga0501319_000082_765_1280 171
461 3300049535 Ga0501319_000240 Ga0501319_000240_1470_1985 171
462 3300049536 Ga0501320_000131 Ga0501320_000131_608_1123 171
463 3300049536 Ga0501320_000368 Ga0501320_000368_886_1401 171
464 3300049536 Ga0501320_000489 Ga0501320_000489_331_846 171
465 3300049536 Ga0501320_002265 Ga0501320_002265_246_761 171
466 3300049538 Ga0501322_013354 Ga0501322_013354_51_566 171
467 3300049539 Ga0501323_000187 Ga0501323_000187_1156_1671 171
468 3300049539 Ga0501323_000627 Ga0501323_000627_220_735 171
469 3300049539 Ga0501323_000789 Ga0501323_000789_855_1370 171
470 3300049539 Ga0501323_008377 Ga0501323_008377_645_1160 171
471 3300049539 Ga0501323_044417 Ga0501323_044417_37_552 171
472 3300049540 Ga0501324_000208 Ga0501324_000208_1947_2462 171
473 3300049541 Ga0501325_000034 Ga0501325_000034_2189_2704 171
474 3300049541 Ga0501325_007278 Ga0501325_007278_290_805 171
475 3300049543 Ga0501327_04826 Ga0501327_04826_204_719 171
476 3300049543 Ga0501327_04896 Ga0501327_04896_214_729 171
477 3300049544 Ga0501328_00214 Ga0501328_00214_558_1073 171
478 3300049545 Ga0501329_02964 Ga0501329_02964_253_768 171
479 3300049549 Ga0501333_001525 Ga0501333_001525_194_709 171
480 3300049551 Ga0501335_007840 Ga0501335_007840_211_726 171
481 3300049552 Ga0501336_001307 Ga0501336_001307_221_736 171
482 3300049556 Ga0501340_002905 Ga0501340_002905_357_872 171
483 3300049579 Ga0501043_0000090 Ga0501043_0000090_72339_72854 171
484 3300049580 Ga0501046_0000126 Ga0501046_0000126_72337_72852 171
485 3300049580 Ga0501046_0557944 Ga0501046_0557944_152_667 171
486 3300049581 Ga0501047_0000160 Ga0501047_0000160_8483_8998 171
487 3300049582 Ga0501048_0003429 Ga0501048_0003429_11040_11555 171
488 3300049652 Ga0501202_000808 Ga0501202_000808_2168_2683 171
489 3300049653 Ga0501206_001476 Ga0501206_001476_191_706 171
490 3300049653 Ga0501206_015309 Ga0501206_015309_413_928 171
491 3300049654 Ga0501207_023110 Ga0501207_023110_128_643 171
492 3300049658 Ga0501211_000022 Ga0501211_000022_5075_5590 171
493 3300049662 Ga0501222_001695 Ga0501222_001695_238_753 171
494 3300049663 Ga0501223_013997 Ga0501223_013997_279_794 171
495 3300049665 Ga0501227_003969 Ga0501227_003969_1027_1542 171
496 3300049666 Ga0501228_000607 Ga0501228_000607_547_1062 171
497 3300049668 Ga0501233_042034 Ga0501233_042034_351_866 171
498 3300049669 Ga0501235_001228 Ga0501235_001228_2262_2777 171
499 3300049670 Ga0501236_005248 Ga0501236_005248_806_1321 171
500 3300049679 Ga0501249_003813 Ga0501249_003813_2104_2619 171
501 3300049679 Ga0501249_163704 Ga0501249_163704_15_530 171
502 3300049682 Ga0501252_006049 Ga0501252_006049_740_1255 171
503 3300049683 Ga0501253_000109 Ga0501253_000109_4656_5171 171
504 3300049686 Ga0501257_022365 Ga0501257_022365_652_1167 171
505 3300049687 Ga0501258_000137 Ga0501258_000137_3453_3968 171
506 3300049704 Ga0501221_001094 Ga0501221_001094_2394_2909 171
507 3300049705 Ga0501225_0006245 Ga0501225_0006245_963_1478 171
508 3300049706 Ga0501229_001006 Ga0501229_001006_284_799 171
509 3300049707 Ga0501234_011220 Ga0501234_011220_609_1124 171
510 3300049757 Ga0501232_001247 Ga0501232_001247_216_731 171
511 3300049759 Ga0501262_000590 Ga0501262_000590_91_606 171
512 3300049759 Ga0501262_009254 Ga0501262_009254_134_649 171
513 3300049764 Ga0501267_004614 Ga0501267_004614_707_1222 171
514 3300049768 Ga0501271_001925 Ga0501271_001925_747_1262 171
515 3300049769 Ga0501272_000140 Ga0501272_000140_1433_1948 171
516 3300049770 Ga0501273_023893 Ga0501273_023893_107_622 171
517 3300049778 Ga0501282_018464 Ga0501282_018464_127_642 171
518 3300049779 Ga0501283_012253 Ga0501283_012253_596_1111 171
519 3300049822 Ga0501035_1171299 Ga0501035_1171299_57_572 171
520 3300049823 Ga0501044_0057237 Ga0501044_0057237_1645_2160 171
521 3300049824 Ga0501045_0000882 Ga0501045_0000882_2964_3479 171
522 3300049853 Ga0501226_002381 Ga0501226_002381_266_781 171
523 3300050489 nmdc:mga03683_107933_c1 nmdc:mga03683_107933_c1_692_1207 171
524 3300050489 nmdc:mga03683_133365_c1 nmdc:mga03683_133365_c1_192_707 171
525 3300050489 nmdc:mga03683_177263_c1 nmdc:mga03683_177263_c1_381_896 171
526 3300050489 nmdc:mga03683_18745_c1 nmdc:mga03683_18745_c1_875_1390 171
527 3300050489 nmdc:mga03683_63522_c2 nmdc:mga03683_63522_c2_179_694 171
528 3300050489 nmdc:mga03683_77659_c1 nmdc:mga03683_77659_c1_20_535 171
529 3300050490 nmdc:mga03n38_356243_c1 nmdc:mga03n38_356243_c1_234_749 171
530 3300050490 nmdc:mga03n38_375198_c1 nmdc:mga03n38_375198_c1_17_532 171
531 3300050490 nmdc:mga03n38_4851_c1 nmdc:mga03n38_4851_c1_2773_3288 171
532 3300050491 nmdc:mga00v17_103467_c1 nmdc:mga00v17_103467_c1_477_992 171
533 3300050491 nmdc:mga00v17_113515_c1 nmdc:mga00v17_113515_c1_291_806 171
534 3300050491 nmdc:mga00v17_17620_c1 nmdc:mga00v17_17620_c1_2160_2675 171
535 3300050491 nmdc:mga00v17_325496_c1 nmdc:mga00v17_325496_c1_314_829 171
536 3300050493 nmdc:mga0k408_1021_c1 nmdc:mga0k408_1021_c1_9578_10093 171
537 3300050493 nmdc:mga0k408_12806_c1 nmdc:mga0k408_12806_c1_2813_3328 171
538 3300050493 nmdc:mga0k408_137955_c1 nmdc:mga0k408_137955_c1_420_935 171
539 3300050493 nmdc:mga0k408_153215_c1 nmdc:mga0k408_153215_c1_439_954 171
540 3300050493 nmdc:mga0k408_165490_c1 nmdc:mga0k408_165490_c1_300_815 171
541 3300050493 nmdc:mga0k408_17134_c1 nmdc:mga0k408_17134_c1_2375_2890 171
542 3300050493 nmdc:mga0k408_172222_c1 nmdc:mga0k408_172222_c1_52_567 171
543 3300050493 nmdc:mga0k408_173647_c1 nmdc:mga0k408_173647_c1_572_1087 171
544 3300050493 nmdc:mga0k408_214738_c1 nmdc:mga0k408_214738_c1_417_932 171
545 3300050493 nmdc:mga0k408_219_c1 nmdc:mga0k408_219_c1_8581_9096 171
546 3300050493 nmdc:mga0k408_22144_c1 nmdc:mga0k408_22144_c1_17_532 171
547 3300050493 nmdc:mga0k408_23786_c1 nmdc:mga0k408_23786_c1_1574_2089 171
548 3300050493 nmdc:mga0k408_249623_c1 nmdc:mga0k408_249623_c1_135_650 171
549 3300050493 nmdc:mga0k408_256246_c1 nmdc:mga0k408_256246_c1_402_917 171
550 3300050493 nmdc:mga0k408_28249_c1 nmdc:mga0k408_28249_c1_991_1506 171
551 3300050493 nmdc:mga0k408_34347_c1 nmdc:mga0k408_34347_c1_2136_2651 171
552 3300050493 nmdc:mga0k408_43703_c1 nmdc:mga0k408_43703_c1_1644_2159 171
553 3300050493 nmdc:mga0k408_46982_c1 nmdc:mga0k408_46982_c1_349_864 171
554 3300050493 nmdc:mga0k408_49108_c1 nmdc:mga0k408_49108_c1_155_670 171
555 3300050493 nmdc:mga0k408_497415_c1 nmdc:mga0k408_497415_c1_57_572 171
556 3300050493 nmdc:mga0k408_57150_c1 nmdc:mga0k408_57150_c1_531_1046 171
557 3300050493 nmdc:mga0k408_59396_c1 nmdc:mga0k408_59396_c1_995_1510 171
558 3300050493 nmdc:mga0k408_59597_c1 nmdc:mga0k408_59597_c1_105_620 171
559 3300050493 nmdc:mga0k408_61835_c1 nmdc:mga0k408_61835_c1_1133_1648 171
560 3300050493 nmdc:mga0k408_678497_c1 nmdc:mga0k408_678497_c1_71_586 171
561 3300050493 nmdc:mga0k408_6946_c1 nmdc:mga0k408_6946_c1_5318_5833 171
562 3300050494 nmdc:mga06z11_11386_c1 nmdc:mga06z11_11386_c1_2351_2866 171
563 3300050494 nmdc:mga06z11_229350_c1 nmdc:mga06z11_229350_c1_483_998 171
564 3300050494 nmdc:mga06z11_3023_c1 nmdc:mga06z11_3023_c1_3317_3832 171
565 3300050494 nmdc:mga06z11_880689_c1 nmdc:mga06z11_880689_c1_12_527 171
566 3300050496 nmdc:mga07m45_15127_c1 nmdc:mga07m45_15127_c1_2232_2747 171
567 3300050496 nmdc:mga07m45_196968_c1 nmdc:mga07m45_196968_c1_631_1146 171
568 3300050496 nmdc:mga07m45_20386_c1 nmdc:mga07m45_20386_c1_2625_3140 171
569 3300050496 nmdc:mga07m45_250451_c1 nmdc:mga07m45_250451_c1_91_606 171
570 3300050496 nmdc:mga07m45_2931_c1 nmdc:mga07m45_2931_c1_2316_2831 171
571 3300050496 nmdc:mga07m45_69529_c1 nmdc:mga07m45_69529_c1_819_1334 171
572 3300050496 nmdc:mga07m45_71727_c1 nmdc:mga07m45_71727_c1_452_967 171
573 3300050496 nmdc:mga07m45_72406_c1 nmdc:mga07m45_72406_c1_426_941 171
574 3300050496 nmdc:mga07m45_74068_c1 nmdc:mga07m45_74068_c1_492_1007 171
575 3300050507 nmdc:mga05p37_180274_c1 nmdc:mga05p37_180274_c1_145_660 171
576 3300050509 nmdc:mga0qj67_50093_c1 nmdc:mga0qj67_50093_c1_631_1146 171
577 3300050511 nmdc:mga08y16_636309_c1 nmdc:mga08y16_636309_c1_356_871 171
578 3300050516 nmdc:mga0sz30_183925_c1 nmdc:mga0sz30_183925_c1_35_550 171
579 3300050516 nmdc:mga0sz30_23261_c1 nmdc:mga0sz30_23261_c1_1726_2241 171
580 3300050516 nmdc:mga0sz30_3989_c1 nmdc:mga0sz30_3989_c1_3306_3821 171
581 3300053085 Ga0495619_0475112 Ga0495619_0475112_185_700 171
582 3300053086 Ga0500578_0000292 Ga0500578_0000292_60552_61067 171
583 3300053086 Ga0500578_0201137 Ga0500578_0201137_472_987 171
584 3300053088 Ga0500644_0003475 Ga0500644_0003475_2757_3272 171
585 3300053088 Ga0500644_0232343 Ga0500644_0232343_33_548 171
586 3300053090 Ga0500646_0014216 Ga0500646_0014216_1331_1846 171
587 3300053090 Ga0500646_0221856 Ga0500646_0221856_101_616 171
588 3300053093 Ga0500651_0000274 Ga0500651_0000274_13167_13682 171
589 3300053093 Ga0500651_0129786 Ga0500651_0129786_841_1356 171
590 3300053108 Ga0500562_019007 Ga0500562_019007_166_681 171
591 3300053117 Ga0500593_000235 Ga0500593_000235_16231_16746 171
592 3300053118 Ga0500594_0013014 Ga0500594_0013014_1290_1805 171
593 3300053126 Ga0500621_142333 Ga0500621_142333_181_696 171
594 3300053129 Ga0500628_006199 Ga0500628_006199_1310_1825 171
595 3300053130 Ga0500642_0007842 Ga0500642_0007842_31_546 171
596 3300053131 Ga0500652_000400 Ga0500652_000400_9579_10094 171
597 3300053131 Ga0500652_069558 Ga0500652_069558_462_977 171
598 3300053131 Ga0500652_135627 Ga0500652_135627_18_533 171
599 3300053133 Ga0500655_012927 Ga0500655_012927_198_713 171
600 3300053133 Ga0500655_016385 Ga0500655_016385_708_1223 171
601 3300053134 Ga0500658_0026976 Ga0500658_0026976_655_1170 171
602 3300053136 Ga0500559_0000097 Ga0500559_0000097_665_1180 171
603 3300053139 Ga0500568_0015583 Ga0500568_0015583_1908_2423 171
604 3300053139 Ga0500568_0065376 Ga0500568_0065376_23_538 171
605 3300053139 Ga0500568_0179181 Ga0500568_0179181_27_542 171
606 3300053142 Ga0500577_0017376 Ga0500577_0017376_758_1273 171
607 3300053148 Ga0500590_007064 Ga0500590_007064_4824_5339 171
608 3300053151 Ga0500604_0040251 Ga0500604_0040251_31_546 171
609 3300053154 Ga0500619_000012 Ga0500619_000012_48670_49185 171
610 3300053155 Ga0500620_057705 Ga0500620_057705_158_673 171
611 3300053156 Ga0500622_0000198 Ga0500622_0000198_36036_36551 171
612 3300053156 Ga0500622_0000978 Ga0500622_0000978_4225_4740 171
613 3300053156 Ga0500622_0001316 Ga0500622_0001316_11038_11553 171
614 3300053156 Ga0500622_0071046 Ga0500622_0071046_865_1380 171
615 3300053160 Ga0500633_0085745 Ga0500633_0085745_132_647 171
616 3300053736 Ga0500599_015505 Ga0500599_015505_438_953 171
617 3300053739 Ga0500587_000541 Ga0500587_000541_3697_4212 171
618 3300053739 Ga0500587_006132 Ga0500587_006132_97_612 171
619 3300055283 Ga0500661_007894 Ga0500661_007894_882_1397 171
620 3300055283 Ga0500661_024419 Ga0500661_024419_165_680 171
621 3300061719 Ga0466962_0000718 Ga0466962_0000718_5713_6228 171
622 3300061719 Ga0466962_0014522 Ga0466962_0014522_637_1152 171
623 iso_pu_bacteria 2585428057 2587725921 173
624 iso_pu_bacteria 2585428058 2587735572 173
625 iso_pu_bacteria 2585428062 2587758989 173
626 iso_pu_bacteria 2588253510 2588292866 173
627 iso_pu_bacteria 2643221544 2643746685 173
628 iso_pu_bacteria 2643221585 2643937423 173
629 iso_pu_bacteria 2643221592 2643967975 173
630 iso_pu_bacteria 2643221625 2644143125 173
631 iso_pu_bacteria 2643221639 2644218751 173
632 iso_pu_bacteria 2643221644 2644247749 173
633 iso_pu_bacteria 2643221646 2644256838 173
634 iso_pu_bacteria 2643221648 2644271787 173
635 iso_pu_bacteria 2643221654 2644305903 173
636 iso_pu_bacteria 2643221656 2644314961 173
637 iso_pu_bacteria 2738541337 2739057974 173
638 iso_pu_bacteria 2831864461 2831867516 173
639 iso_pu_bacteria 2886848708 2886854502 173
640 2162886007 SwRhRL2b_contig_690899 SwRhRL2b_0801.00000520 177
641 3300002705 JGI25156J39149_1016366 JGI25156J39149_10163662 177
642 3300002705 JGI25156J39149_1019922 JGI25156J39149_10199222 177
643 3300002774 JGI25150J39212_1003907 JGI25150J39212_10039073 177
644 3300003161 Ga0006765J45826_106373 Ga0006765J45826_1063737 177
645 3300003215 JGI25153J46596_10008637 JGI25153J46596_100086374 177
646 3300003305 Ga0006770J48903_1001899 Ga0006770J48903_100189910 177
647 3300003308 Ga0006777J48905_1014855 Ga0006777J48905_10148556 177
648 3300003574 Ga0007410J51695_1005226 Ga0007410J51695_10052267 177
649 3300003574 Ga0007410J51695_1028665 Ga0007410J51695_10286656 177
650 3300003575 Ga0007409J51694_1041611 Ga0007409J51694_10416112 177
651 3300003693 Ga0032354_1038952 Ga0032354_10389524 177
652 3300003693 Ga0032354_1072421 Ga0032354_10724212 177
653 3300003761 Ga0055535_1003662 Ga0055535_10036622 177
654 3300003763 Ga0055529_1000322 Ga0055529_100032243 177
655 3300003771 Ga0055526_1000791 Ga0055526_100079114 177
656 3300003775 Ga0055524_1000140 Ga0055524_100014018 177
657 3300003790 Ga0055528_1069011 Ga0055528_10690111 177
658 3300003791 Ga0055530_10006458 Ga0055530_100064587 177
659 3300003792 Ga0055540_1000133 Ga0055540_10001336 177
660 3300003792 Ga0055540_1029907 Ga0055540_10299072 177
661 3300003794 Ga0055531_10002079 Ga0055531_1000207915 177
662 3300003794 Ga0055531_10002114 Ga0055531_1000211415 177
663 3300005262 Ga0065165_1006303 Ga0065165_100630310 177
664 3300005262 Ga0065165_1028112 Ga0065165_10281123 177
665 3300005290 Ga0065712_10087248 Ga0065712_100872482 177
666 3300005293 Ga0065715_10005249 Ga0065715_100052492 177
667 3300005293 Ga0065715_10023020 Ga0065715_100230204 177
668 3300005295 Ga0065707_10255698 Ga0065707_102556982 177
669 3300005327 Ga0070658_10427594 Ga0070658_104275941 177
670 3300005328 Ga0070676_10021276 Ga0070676_100212765 177
671 3300005328 Ga0070676_10093888 Ga0070676_100938882 177
672 3300005328 Ga0070676_10372716 Ga0070676_103727162 177
673 3300005328 Ga0070676_10916024 Ga0070676_109160241 177
674 3300005328 Ga0070676_11043051 Ga0070676_110430511 177
675 3300005329 Ga0070683_100631138 Ga0070683_1006311381 177
676 3300005329 Ga0070683_100645299 Ga0070683_1006452992 177
677 3300005330 Ga0070690_100006927 Ga0070690_1000069278 177
678 3300005330 Ga0070690_100231854 Ga0070690_1002318542 177
679 3300005330 Ga0070690_100276410 Ga0070690_1002764101 177
680 3300005331 Ga0070670_100054237 Ga0070670_1000542373 177
681 3300005331 Ga0070670_100064589 Ga0070670_1000645893 177
682 3300005331 Ga0070670_100065507 Ga0070670_1000655075 177
683 3300005331 Ga0070670_100816423 Ga0070670_1008164232 177
684 3300005331 Ga0070670_101131033 Ga0070670_1011310332 177
685 3300005333 Ga0070677_10017315 Ga0070677_100173154 177
686 3300005333 Ga0070677_10146542 Ga0070677_101465421 177
687 3300005334 Ga0068869_100077114 Ga0068869_1000771144 177
688 3300005334 Ga0068869_100146255 Ga0068869_1001462552 177
689 3300005334 Ga0068869_100257683 Ga0068869_1002576832 177
690 3300005334 Ga0068869_100283533 Ga0068869_1002835332 177
691 3300005334 Ga0068869_100284560 Ga0068869_1002845602 177
692 3300005334 Ga0068869_100547670 Ga0068869_1005476702 177
693 3300005335 Ga0070666_10056809 Ga0070666_100568095 177
694 3300005335 Ga0070666_10122448 Ga0070666_101224483 177
695 3300005335 Ga0070666_10343207 Ga0070666_103432072 177
696 3300005336 Ga0070680_100032809 Ga0070680_1000328098 177
697 3300005337 Ga0070682_100057764 Ga0070682_1000577643 177
698 3300005337 Ga0070682_100193784 Ga0070682_1001937842 177
699 3300005338 Ga0068868_100211639 Ga0068868_1002116392 177
700 3300005338 Ga0068868_100246199 Ga0068868_1002461993 177
701 3300005338 Ga0068868_100474633 Ga0068868_1004746332 177
702 3300005338 Ga0068868_100751149 Ga0068868_1007511492 177
703 3300005339 Ga0070660_100190679 Ga0070660_1001906794 177
704 3300005339 Ga0070660_100910758 Ga0070660_1009107581 177
705 3300005339 Ga0070660_101202805 Ga0070660_1012028051 177
706 3300005340 Ga0070689_100265958 Ga0070689_1002659583 177
707 3300005343 Ga0070687_100233714 Ga0070687_1002337142 177
708 3300005344 Ga0070661_100092952 Ga0070661_1000929523 177
709 3300005344 Ga0070661_100105291 Ga0070661_1001052913 177
710 3300005344 Ga0070661_100338960 Ga0070661_1003389602 177
711 3300005347 Ga0070668_100175163 Ga0070668_1001751633 177
712 3300005347 Ga0070668_100211316 Ga0070668_1002113163 177
713 3300005347 Ga0070668_100266732 Ga0070668_1002667321 177
714 3300005347 Ga0070668_100493006 Ga0070668_1004930061 177
715 3300005347 Ga0070668_100656989 Ga0070668_1006569892 177
716 3300005353 Ga0070669_100017536 Ga0070669_1000175366 177
717 3300005353 Ga0070669_100075981 Ga0070669_1000759811 177
718 3300005353 Ga0070669_100077546 Ga0070669_1000775462 177
719 3300005354 Ga0070675_100044665 Ga0070675_1000446656 177
720 3300005354 Ga0070675_100119785 Ga0070675_1001197853 177
721 3300005354 Ga0070675_100159250 Ga0070675_1001592503 177
722 3300005354 Ga0070675_100364619 Ga0070675_1003646193 177
723 3300005354 Ga0070675_100413240 Ga0070675_1004132401 177
724 3300005354 Ga0070675_100860171 Ga0070675_1008601711 177
725 3300005354 Ga0070675_101293146 Ga0070675_1012931461 177
726 3300005355 Ga0070671_100019537 Ga0070671_1000195378 177
727 3300005355 Ga0070671_100030800 Ga0070671_1000308002 177
728 3300005355 Ga0070671_100040069 Ga0070671_1000400696 177
729 3300005355 Ga0070671_100151546 Ga0070671_1001515463 177
730 3300005355 Ga0070671_100251374 Ga0070671_1002513741 177
731 3300005355 Ga0070671_100342299 Ga0070671_1003422992 177
732 3300005356 Ga0070674_100056124 Ga0070674_1000561246 177
733 3300005356 Ga0070674_100120277 Ga0070674_1001202773 177
734 3300005356 Ga0070674_100181740 Ga0070674_1001817403 177
735 3300005356 Ga0070674_100242149 Ga0070674_1002421492 177
736 3300005356 Ga0070674_100310754 Ga0070674_1003107541 177
737 3300005356 Ga0070674_101517531 Ga0070674_1015175311 177
738 3300005364 Ga0070673_100002927 Ga0070673_10000292717 177
739 3300005364 Ga0070673_100055764 Ga0070673_1000557645 177
740 3300005364 Ga0070673_100092283 Ga0070673_1000922833 177
741 3300005364 Ga0070673_100169356 Ga0070673_1001693563 177
742 3300005364 Ga0070673_100192497 Ga0070673_1001924973 177
743 3300005364 Ga0070673_100525545 Ga0070673_1005255452 177
744 3300005364 Ga0070673_100759012 Ga0070673_1007590122 177
745 3300005365 Ga0070688_100074242 Ga0070688_1000742423 177
746 3300005365 Ga0070688_100304757 Ga0070688_1003047572 177
747 3300005366 Ga0070659_100250633 Ga0070659_1002506332 177
748 3300005366 Ga0070659_100378036 Ga0070659_1003780361 177
749 3300005367 Ga0070667_100028082 Ga0070667_10002808210 177
750 3300005367 Ga0070667_100083378 Ga0070667_1000833785 177
751 3300005367 Ga0070667_100158747 Ga0070667_1001587473 177
752 3300005367 Ga0070667_100231002 Ga0070667_1002310022 177
753 3300005367 Ga0070667_100492119 Ga0070667_1004921192 177
754 3300005438 Ga0070701_10134721 Ga0070701_101347212 177
755 3300005438 Ga0070701_10405461 Ga0070701_104054612 177
756 3300005445 Ga0070708_100348817 Ga0070708_1003488173 177
757 3300005455 Ga0070663_100003492 Ga0070663_1000034922 177
758 3300005455 Ga0070663_100130855 Ga0070663_1001308555 177
759 3300005456 Ga0070678_100025705 Ga0070678_1000257056 177
760 3300005456 Ga0070678_100076714 Ga0070678_1000767145 177
761 3300005456 Ga0070678_100104114 Ga0070678_1001041144 177
762 3300005456 Ga0070678_100195478 Ga0070678_1001954783 177
763 3300005456 Ga0070678_100382831 Ga0070678_1003828312 177
764 3300005456 Ga0070678_100639099 Ga0070678_1006390992 177
765 3300005456 Ga0070678_100694884 Ga0070678_1006948841 177
766 3300005456 Ga0070678_100941219 Ga0070678_1009412191 177
767 3300005456 Ga0070678_101856688 Ga0070678_1018566881 177
768 3300005457 Ga0070662_100060375 Ga0070662_1000603752 177
769 3300005457 Ga0070662_100111387 Ga0070662_1001113873 177
770 3300005457 Ga0070662_100212672 Ga0070662_1002126722 177
771 3300005457 Ga0070662_100322678 Ga0070662_1003226782 177
772 3300005457 Ga0070662_100351011 Ga0070662_1003510113 177
773 3300005458 Ga0070681_10088377 Ga0070681_100883774 177
774 3300005459 Ga0068867_100000552 Ga0068867_10000055222 177
775 3300005459 Ga0068867_100011425 Ga0068867_1000114256 177
776 3300005459 Ga0068867_100087646 Ga0068867_1000876465 177
777 3300005459 Ga0068867_100117646 Ga0068867_1001176464 177
778 3300005459 Ga0068867_100223813 Ga0068867_1002238132 177
779 3300005459 Ga0068867_100276422 Ga0068867_1002764222 177
780 3300005459 Ga0068867_100336428 Ga0068867_1003364282 177
781 3300005459 Ga0068867_100411856 Ga0068867_1004118562 177
782 3300005467 Ga0070706_100025301 Ga0070706_1000253012 177
783 3300005468 Ga0070707_100035242 Ga0070707_1000352424 177
784 3300005530 Ga0070679_100007565 Ga0070679_1000075656 177
785 3300005535 Ga0070684_100178663 Ga0070684_1001786632 177
786 3300005535 Ga0070684_100565789 Ga0070684_1005657892 177
787 3300005539 Ga0068853_101387344 Ga0068853_1013873441 177
788 3300005543 Ga0070672_100006187 Ga0070672_10000618711 177
789 3300005543 Ga0070672_100044598 Ga0070672_1000445986 177
790 3300005543 Ga0070672_100110140 Ga0070672_1001101401 177
791 3300005543 Ga0070672_100170362 Ga0070672_1001703621 177
792 3300005543 Ga0070672_100197483 Ga0070672_1001974833 177
793 3300005543 Ga0070672_100380405 Ga0070672_1003804053 177
794 3300005544 Ga0070686_100146015 Ga0070686_1001460154 177
795 3300005544 Ga0070686_100205477 Ga0070686_1002054772 177
796 3300005545 Ga0070695_100538265 Ga0070695_1005382652 177
797 3300005547 Ga0070693_100023342 Ga0070693_1000233426 177
798 3300005547 Ga0070693_100069686 Ga0070693_1000696864 177
799 3300005548 Ga0070665_100538419 Ga0070665_1005384192 177
800 3300005563 Ga0068855_100040434 Ga0068855_1000404346 177
801 3300005563 Ga0068855_100300591 Ga0068855_1003005914 177
802 3300005564 Ga0070664_100040179 Ga0070664_1000401793 177
803 3300005564 Ga0070664_100238231 Ga0070664_1002382313 177
804 3300005564 Ga0070664_100273368 Ga0070664_1002733682 177
805 3300005564 Ga0070664_100284562 Ga0070664_1002845622 177
806 3300005564 Ga0070664_100363954 Ga0070664_1003639543 177
807 3300005564 Ga0070664_101181621 Ga0070664_1011816212 177
808 3300005577 Ga0068857_100040688 Ga0068857_1000406886 177
809 3300005577 Ga0068857_100209439 Ga0068857_1002094392 177
810 3300005577 Ga0068857_100442265 Ga0068857_1004422652 177
811 3300005578 Ga0068854_100044785 Ga0068854_1000447856 177
812 3300005578 Ga0068854_100352180 Ga0068854_1003521803 177
813 3300005578 Ga0068854_100392378 Ga0068854_1003923782 177
814 3300005578 Ga0068854_100559167 Ga0068854_1005591671 177
815 3300005614 Ga0068856_100183859 Ga0068856_1001838594 177
816 3300005614 Ga0068856_100244565 Ga0068856_1002445653 177
817 3300005614 Ga0068856_100345416 Ga0068856_1003454162 177
818 3300005614 Ga0068856_100463129 Ga0068856_1004631292 177
819 3300005614 Ga0068856_100477988 Ga0068856_1004779882 177
820 3300005614 Ga0068856_100596350 Ga0068856_1005963501 177
821 3300005615 Ga0070702_100692109 Ga0070702_1006921092 177
822 3300005616 Ga0068852_100022501 Ga0068852_10002250110 177
823 3300005616 Ga0068852_100102229 Ga0068852_1001022293 177
824 3300005616 Ga0068852_100307390 Ga0068852_1003073903 177
825 3300005616 Ga0068852_100362674 Ga0068852_1003626743 177
826 3300005616 Ga0068852_100413864 Ga0068852_1004138642 177
827 3300005616 Ga0068852_100519932 Ga0068852_1005199321 177
828 3300005616 Ga0068852_100688915 Ga0068852_1006889151 177
829 3300005616 Ga0068852_101527673 Ga0068852_1015276732 177
830 3300005616 Ga0068852_101974945 Ga0068852_1019749451 177
831 3300005617 Ga0068859_100130187 Ga0068859_1001301872 177
832 3300005617 Ga0068859_100176605 Ga0068859_1001766054 177
833 3300005617 Ga0068859_100454844 Ga0068859_1004548441 177
834 3300005617 Ga0068859_100768856 Ga0068859_1007688562 177
835 3300005618 Ga0068864_100018772 Ga0068864_10001877210 177
836 3300005618 Ga0068864_100066476 Ga0068864_1000664766 177
837 3300005618 Ga0068864_100103544 Ga0068864_1001035443 177
838 3300005618 Ga0068864_100353670 Ga0068864_1003536703 177
839 3300005618 Ga0068864_100403474 Ga0068864_1004034742 177
840 3300005618 Ga0068864_101289846 Ga0068864_1012898462 177
841 3300005618 Ga0068864_101947844 Ga0068864_1019478441 177
842 3300005718 Ga0068866_10061825 Ga0068866_100618251 177
843 3300005719 Ga0068861_100004770 Ga0068861_10000477017 177
844 3300005719 Ga0068861_100021676 Ga0068861_1000216766 177
845 3300005719 Ga0068861_100170807 Ga0068861_1001708073 177
846 3300005719 Ga0068861_100247833 Ga0068861_1002478333 177
847 3300005834 Ga0068851_10109854 Ga0068851_101098543 177
848 3300005834 Ga0068851_10143693 Ga0068851_101436933 177
849 3300005834 Ga0068851_10206879 Ga0068851_102068791 177
850 3300005834 Ga0068851_10263194 Ga0068851_102631941 177
851 3300005834 Ga0068851_10347902 Ga0068851_103479022 177
852 3300005840 Ga0068870_10231402 Ga0068870_102314022 177
853 3300005840 Ga0068870_10276128 Ga0068870_102761282 177
854 3300005840 Ga0068870_10398683 Ga0068870_103986832 177
855 3300005841 Ga0068863_100043166 Ga0068863_1000431668 177
856 3300005841 Ga0068863_100104362 Ga0068863_1001043622 177
857 3300005841 Ga0068863_100257362 Ga0068863_1002573622 177
858 3300005841 Ga0068863_100338312 Ga0068863_1003383123 177
859 3300005841 Ga0068863_100410223 Ga0068863_1004102232 177
860 3300005842 Ga0068858_100008125 Ga0068858_10000812513 177
861 3300005842 Ga0068858_100030753 Ga0068858_1000307536 177
862 3300005842 Ga0068858_100194536 Ga0068858_1001945363 177
863 3300005843 Ga0068860_100065679 Ga0068860_1000656794 177
864 3300005843 Ga0068860_100210653 Ga0068860_1002106533 177
865 3300005843 Ga0068860_100446321 Ga0068860_1004463212 177
866 3300005843 Ga0068860_100633821 Ga0068860_1006338212 177
867 3300005844 Ga0068862_100335247 Ga0068862_1003352473 177
868 3300005844 Ga0068862_101115400 Ga0068862_1011154001 177
869 3300006048 Ga0075363_100005889 Ga0075363_1000058893 177
870 3300006048 Ga0075363_100049841 Ga0075363_1000498414 177
871 3300006048 Ga0075363_100186191 Ga0075363_1001861912 177
872 3300006048 Ga0075363_100204317 Ga0075363_1002043172 177
873 3300006048 Ga0075363_100787507 Ga0075363_1007875071 177
874 3300006051 Ga0075364_10032491 Ga0075364_100324917 177
875 3300006051 Ga0075364_10142234 Ga0075364_101422342 177
876 3300006051 Ga0075364_10304148 Ga0075364_103041482 177
877 3300006058 Ga0075432_10216901 Ga0075432_102169012 177
878 3300006163 Ga0070715_10025469 Ga0070715_100254692 177
879 3300006173 Ga0070716_100069303 Ga0070716_1000693034 177
880 3300006177 Ga0075362_10000222 Ga0075362_1000022216 177
881 3300006177 Ga0075362_10060918 Ga0075362_100609182 177
882 3300006177 Ga0075362_10090390 Ga0075362_100903903 177
883 3300006177 Ga0075362_10313389 Ga0075362_103133891 177
884 3300006177 Ga0075362_10380970 Ga0075362_103809701 177
885 3300006178 Ga0075367_10000855 Ga0075367_1000085512 177
886 3300006178 Ga0075367_10006379 Ga0075367_1000637911 177
887 3300006178 Ga0075367_10092185 Ga0075367_100921852 177
888 3300006178 Ga0075367_10295173 Ga0075367_102951732 177
889 3300006178 Ga0075367_10347911 Ga0075367_103479111 177
890 3300006186 Ga0075369_10005325 Ga0075369_100053258 177
891 3300006186 Ga0075369_10159851 Ga0075369_101598512 177
892 3300006186 Ga0075369_10410384 Ga0075369_104103841 177
893 3300006195 Ga0075366_10000776 Ga0075366_1000077620 177
894 3300006195 Ga0075366_10016473 Ga0075366_100164735 177
895 3300006195 Ga0075366_10018148 Ga0075366_100181488 177
896 3300006195 Ga0075366_10033848 Ga0075366_100338484 177
897 3300006195 Ga0075366_10054228 Ga0075366_100542284 177
898 3300006195 Ga0075366_10055751 Ga0075366_100557515 177
899 3300006195 Ga0075366_10081535 Ga0075366_100815353 177
900 3300006195 Ga0075366_10115763 Ga0075366_101157632 177
901 3300006195 Ga0075366_10140745 Ga0075366_101407453 177
902 3300006195 Ga0075366_10159590 Ga0075366_101595902 177
903 3300006195 Ga0075366_10163686 Ga0075366_101636863 177
904 3300006195 Ga0075366_10196478 Ga0075366_101964783 177
905 3300006195 Ga0075366_10210884 Ga0075366_102108843 177
906 3300006195 Ga0075366_10213318 Ga0075366_102133182 177
907 3300006195 Ga0075366_10216952 Ga0075366_102169523 177
908 3300006195 Ga0075366_10243514 Ga0075366_102435142 177
909 3300006195 Ga0075366_10274182 Ga0075366_102741822 177
910 3300006195 Ga0075366_10550230 Ga0075366_105502301 177
911 3300006195 Ga0075366_10767148 Ga0075366_107671481 177
912 3300006237 Ga0097621_100047739 Ga0097621_1000477394 177
913 3300006237 Ga0097621_100115517 Ga0097621_1001155174 177
914 3300006237 Ga0097621_100612946 Ga0097621_1006129462 177
915 3300006353 Ga0075370_10001150 Ga0075370_1000115011 177
916 3300006353 Ga0075370_10002824 Ga0075370_1000282412 177
917 3300006353 Ga0075370_10023630 Ga0075370_100236306 177
918 3300006353 Ga0075370_10040903 Ga0075370_100409034 177
919 3300006353 Ga0075370_10243310 Ga0075370_102433102 177
920 3300006353 Ga0075370_10345440 Ga0075370_103454402 177
921 3300006353 Ga0075370_10432241 Ga0075370_104322412 177
922 3300006353 Ga0075370_10643447 Ga0075370_106434471 177
923 3300006358 Ga0068871_100019288 Ga0068871_1000192882 177
924 3300006358 Ga0068871_100337306 Ga0068871_1003373062 177
925 3300006358 Ga0068871_100609286 Ga0068871_1006092862 177
926 3300006846 Ga0075430_100233239 Ga0075430_1002332394 177
927 3300006880 Ga0075429_100123917 Ga0075429_1001239173 177
928 3300006881 Ga0068865_100057885 Ga0068865_1000578851 177
929 3300006881 Ga0068865_100182643 Ga0068865_1001826432 177
930 3300006931 Ga0097620_100130185 Ga0097620_1001301852 177
931 3300006931 Ga0097620_100176599 Ga0097620_1001765994 177
932 3300006931 Ga0097620_100454839 Ga0097620_1004548393 177
933 3300006931 Ga0097620_100768879 Ga0097620_1007688792 177
934 3300006944 Ga0099823_1000064 Ga0099823_100006419 177
935 3300006946 Ga0079104_1000053 Ga0079104_100005319 177
936 3300009098 Ga0105245_10412159 Ga0105245_104121592 177
937 3300009174 Ga0105241_10082907 Ga0105241_100829076 177
938 3300009177 Ga0105248_10028458 Ga0105248_1002845814 177
939 3300009545 Ga0105237_11251531 Ga0105237_112515312 177
940 3300009551 Ga0105238_10064333 Ga0105238_100643336 177
941 3300010375 Ga0105239_11064166 Ga0105239_110641662 177
942 3300013100 Ga0157373_10040286 Ga0157373_100402866 177
943 3300013102 Ga0157371_10096460 Ga0157371_100964602 177
944 3300013105 Ga0157369_10115967 Ga0157369_101159675 177
945 3300013296 Ga0157374_10261841 Ga0157374_102618412 177
946 3300013296 Ga0157374_10383146 Ga0157374_103831462 177
947 3300013307 Ga0157372_10023087 Ga0157372_100230872 177
948 3300013307 Ga0157372_10500446 Ga0157372_105004462 177
949 3300013308 Ga0157375_11035597 Ga0157375_110355972 177
950 3300014968 Ga0157379_10061342 Ga0157379_100613427 177
951 3300014968 Ga0157379_10144632 Ga0157379_101446323 177
952 3300015265 Ga0182005_1057908 Ga0182005_10579082 177
953 3300017792 Ga0163161_10009049 Ga0163161_1000904912 177
954 3300017792 Ga0163161_10057420 Ga0163161_100574202 177
955 3300017792 Ga0163161_10118069 Ga0163161_101180693 177
956 3300017792 Ga0163161_10378130 Ga0163161_103781302 177
957 3300020078 Ga0206352_11007505 Ga0206352_110075055 177
958 3300025228 Ga0209672_106318 Ga0209672_1063183 177
959 3300025230 Ga0209563_100088 Ga0209563_10008874 177
960 3300025242 Ga0209258_102113 Ga0209258_1021136 177
961 3300025245 Ga0207425_1000680 Ga0207425_100068012 177
962 3300025254 Ga0209148_1002904 Ga0209148_10029045 177
963 3300025256 Ga0209759_1003759 Ga0209759_10037593 177
964 3300025256 Ga0209759_1020002 Ga0209759_10200024 177
965 3300025258 Ga0209129_1000158 Ga0209129_100015848 177
966 3300025258 Ga0209129_1034916 Ga0209129_10349162 177
967 3300025271 Ga0207666_1002377 Ga0207666_10023772 177
968 3300025272 Ga0209455_1000083 Ga0209455_1000083193 177
969 3300025273 Ga0209673_1004093 Ga0209673_10040936 177
970 3300025273 Ga0209673_1024595 Ga0209673_10245954 177
971 3300025273 Ga0209673_1032334 Ga0209673_10323343 177
972 3300025291 Ga0209675_1038432 Ga0209675_10384321 177
973 3300025295 Ga0209564_1000282 Ga0209564_100028248 177
974 3300025297 Ga0209758_1000910 Ga0209758_10009107 177
975 3300025297 Ga0209758_1011080 Ga0209758_10110805 177
976 3300025298 Ga0209050_1000223 Ga0209050_100022371 177
977 3300025298 Ga0209050_1001097 Ga0209050_100109733 177
978 3300025298 Ga0209050_1004273 Ga0209050_100427310 177
979 3300025298 Ga0209050_1013102 Ga0209050_10131026 177
980 3300025299 Ga0209256_1000045 Ga0209256_1000045232 177
981 3300025299 Ga0209256_1008928 Ga0209256_10089281 177
982 3300025299 Ga0209256_1009680 Ga0209256_10096805 177
983 3300025299 Ga0209256_1051545 Ga0209256_10515451 177
984 3300025303 Ga0209051_1000004 Ga0209051_1000004972 177
985 3300025303 Ga0209051_1000938 Ga0209051_100093833 177
986 3300025303 Ga0209051_1005321 Ga0209051_10053217 177
987 3300025303 Ga0209051_1018074 Ga0209051_10180742 177
988 3300025304 Ga0209257_1000047 Ga0209257_1000047398 177
989 3300025304 Ga0209257_1000315 Ga0209257_1000315101 177
990 3300025304 Ga0209257_1019529 Ga0209257_10195291 177
991 3300025304 Ga0209257_1061640 Ga0209257_10616401 177
992 3300025304 Ga0209257_1061925 Ga0209257_10619252 177
993 3300025304 Ga0209257_1108456 Ga0209257_11084561 177
994 3300025315 Ga0207697_10029574 Ga0207697_100295744 177
995 3300025321 Ga0207656_10020792 Ga0207656_100207921 177
996 3300025321 Ga0207656_10143536 Ga0207656_101435362 177
997 3300025321 Ga0207656_10148077 Ga0207656_101480771 177
998 3300025321 Ga0207656_10184172 Ga0207656_101841722 177
999 3300025321 Ga0207656_10300398 Ga0207656_103003981 177
1000 3300025893 Ga0207682_10002147 Ga0207682_100021475 177
1001 3300025893 Ga0207682_10021887 Ga0207682_100218874 177
1002 3300025893 Ga0207682_10053083 Ga0207682_100530832 177
1003 3300025893 Ga0207682_10117103 Ga0207682_101171032 177
1004 3300025899 Ga0207642_10040268 Ga0207642_100402685 177
1005 3300025899 Ga0207642_10146240 Ga0207642_101462402 177
1006 3300025901 Ga0207688_10037622 Ga0207688_100376223 177
1007 3300025901 Ga0207688_10063302 Ga0207688_100633023 177
1008 3300025901 Ga0207688_10338749 Ga0207688_103387492 177
1009 3300025903 Ga0207680_10014229 Ga0207680_100142296 177
1010 3300025903 Ga0207680_10183316 Ga0207680_101833162 177
1011 3300025903 Ga0207680_10187572 Ga0207680_101875722 177
1012 3300025903 Ga0207680_10276263 Ga0207680_102762632 177
1013 3300025903 Ga0207680_10487411 Ga0207680_104874111 177
1014 3300025907 Ga0207645_10009972 Ga0207645_1000997210 177
1015 3300025907 Ga0207645_10012543 Ga0207645_100125437 177
1016 3300025907 Ga0207645_10047232 Ga0207645_100472325 177
1017 3300025907 Ga0207645_10048474 Ga0207645_100484746 177
1018 3300025907 Ga0207645_10086402 Ga0207645_100864022 177
1019 3300025907 Ga0207645_10139657 Ga0207645_101396573 177
1020 3300025907 Ga0207645_10226543 Ga0207645_102265432 177
1021 3300025907 Ga0207645_10356540 Ga0207645_103565402 177
1022 3300025908 Ga0207643_10146766 Ga0207643_101467663 177
1023 3300025908 Ga0207643_10340502 Ga0207643_103405022 177
1024 3300025909 Ga0207705_10850984 Ga0207705_108509842 177
1025 3300025910 Ga0207684_10124693 Ga0207684_101246932 177
1026 3300025911 Ga0207654_10056380 Ga0207654_100563803 177
1027 3300025911 Ga0207654_10187962 Ga0207654_101879622 177
1028 3300025912 Ga0207707_10231795 Ga0207707_102317952 177
1029 3300025913 Ga0207695_10010589 Ga0207695_1001058913 177
1030 3300025913 Ga0207695_10190969 Ga0207695_101909693 177
1031 3300025914 Ga0207671_10019707 Ga0207671_100197076 177
1032 3300025914 Ga0207671_10036592 Ga0207671_100365922 177
1033 3300025914 Ga0207671_10571855 Ga0207671_105718552 177
1034 3300025917 Ga0207660_10046145 Ga0207660_100461452 177
1035 3300025918 Ga0207662_10034330 Ga0207662_100343306 177
1036 3300025918 Ga0207662_10808995 Ga0207662_108089951 177
1037 3300025919 Ga0207657_10092779 Ga0207657_100927793 177
1038 3300025919 Ga0207657_10350616 Ga0207657_103506162 177
1039 3300025919 Ga0207657_10566625 Ga0207657_105666252 177
1040 3300025919 Ga0207657_10956381 Ga0207657_109563811 177
1041 3300025920 Ga0207649_10001794 Ga0207649_100017948 177
1042 3300025920 Ga0207649_10004699 Ga0207649_100046994 177
1043 3300025920 Ga0207649_10137933 Ga0207649_101379333 177
1044 3300025920 Ga0207649_10240920 Ga0207649_102409202 177
1045 3300025920 Ga0207649_10384119 Ga0207649_103841192 177
1046 3300025921 Ga0207652_10002940 Ga0207652_1000294011 177
1047 3300025922 Ga0207646_10033831 Ga0207646_100338312 177
1048 3300025923 Ga0207681_10005925 Ga0207681_100059256 177
1049 3300025923 Ga0207681_10083993 Ga0207681_100839931 177
1050 3300025923 Ga0207681_10111387 Ga0207681_101113873 177
1051 3300025923 Ga0207681_10139757 Ga0207681_101397572 177
1052 3300025923 Ga0207681_10593692 Ga0207681_105936921 177
1053 3300025923 Ga0207681_11287919 Ga0207681_112879191 177
1054 3300025924 Ga0207694_10004619 Ga0207694_100046197 177
1055 3300025924 Ga0207694_10034844 Ga0207694_100348442 177
1056 3300025924 Ga0207694_10310362 Ga0207694_103103622 177
1057 3300025924 Ga0207694_10735795 Ga0207694_107357952 177
1058 3300025925 Ga0207650_10002454 Ga0207650_1000245419 177
1059 3300025925 Ga0207650_10022053 Ga0207650_100220533 177
1060 3300025925 Ga0207650_10242099 Ga0207650_102420993 177
1061 3300025925 Ga0207650_10302708 Ga0207650_103027082 177
1062 3300025925 Ga0207650_10515056 Ga0207650_105150562 177
1063 3300025925 Ga0207650_10706362 Ga0207650_107063621 177
1064 3300025926 Ga0207659_10003025 Ga0207659_100030253 177
1065 3300025926 Ga0207659_10056531 Ga0207659_100565312 177
1066 3300025926 Ga0207659_10072814 Ga0207659_100728144 177
1067 3300025926 Ga0207659_10229273 Ga0207659_102292732 177
1068 3300025926 Ga0207659_10338491 Ga0207659_103384912 177
1069 3300025926 Ga0207659_10381945 Ga0207659_103819453 177
1070 3300025926 Ga0207659_10454645 Ga0207659_104546452 177
1071 3300025926 Ga0207659_10617259 Ga0207659_106172592 177
1072 3300025926 Ga0207659_11452594 Ga0207659_114525941 177
1073 3300025927 Ga0207687_10108511 Ga0207687_101085114 177
1074 3300025931 Ga0207644_10015416 Ga0207644_100154166 177
1075 3300025931 Ga0207644_10024978 Ga0207644_100249783 177
1076 3300025931 Ga0207644_10027492 Ga0207644_100274926 177
1077 3300025931 Ga0207644_10184530 Ga0207644_101845302 177
1078 3300025931 Ga0207644_10246131 Ga0207644_102461311 177
1079 3300025931 Ga0207644_10692643 Ga0207644_106926431 177
1080 3300025931 Ga0207644_10909750 Ga0207644_109097501 177
1081 3300025932 Ga0207690_10001731 Ga0207690_1000173110 177
1082 3300025932 Ga0207690_10039856 Ga0207690_100398567 177
1083 3300025932 Ga0207690_10056794 Ga0207690_100567944 177
1084 3300025932 Ga0207690_10475284 Ga0207690_104752842 177
1085 3300025933 Ga0207706_10079225 Ga0207706_100792253 177
1086 3300025933 Ga0207706_10116108 Ga0207706_101161084 177
1087 3300025933 Ga0207706_10150050 Ga0207706_101500503 177
1088 3300025933 Ga0207706_10247137 Ga0207706_102471372 177
1089 3300025933 Ga0207706_10265491 Ga0207706_102654913 177
1090 3300025933 Ga0207706_10274953 Ga0207706_102749533 177
1091 3300025934 Ga0207686_10048318 Ga0207686_100483181 177
1092 3300025935 Ga0207709_10001005 Ga0207709_1000100520 177
1093 3300025935 Ga0207709_10020689 Ga0207709_100206894 177
1094 3300025935 Ga0207709_10092231 Ga0207709_100922311 177
1095 3300025935 Ga0207709_10457789 Ga0207709_104577892 177
1096 3300025935 Ga0207709_10499485 Ga0207709_104994852 177
1097 3300025937 Ga0207669_10115067 Ga0207669_101150674 177
1098 3300025937 Ga0207669_10124757 Ga0207669_101247573 177
1099 3300025937 Ga0207669_10149676 Ga0207669_101496763 177
1100 3300025937 Ga0207669_10192156 Ga0207669_101921562 177
1101 3300025937 Ga0207669_10810425 Ga0207669_108104252 177
1102 3300025938 Ga0207704_10044043 Ga0207704_100440431 177
1103 3300025938 Ga0207704_10940374 Ga0207704_109403742 177
1104 3300025938 Ga0207704_11165024 Ga0207704_111650241 177
1105 3300025939 Ga0207665_10131977 Ga0207665_101319774 177
1106 3300025940 Ga0207691_10002550 Ga0207691_1000255015 177
1107 3300025940 Ga0207691_10071477 Ga0207691_100714776 177
1108 3300025940 Ga0207691_10102749 Ga0207691_101027493 177
1109 3300025940 Ga0207691_10126451 Ga0207691_101264513 177
1110 3300025940 Ga0207691_10413729 Ga0207691_104137293 177
1111 3300025940 Ga0207691_10421854 Ga0207691_104218543 177
1112 3300025940 Ga0207691_10455132 Ga0207691_104551322 177
1113 3300025941 Ga0207711_10009785 Ga0207711_100097853 177
1114 3300025941 Ga0207711_10023140 Ga0207711_100231403 177
1115 3300025941 Ga0207711_10072285 Ga0207711_100722853 177
1116 3300025941 Ga0207711_10465174 Ga0207711_104651743 177
1117 3300025941 Ga0207711_10589696 Ga0207711_105896962 177
1118 3300025941 Ga0207711_10659613 Ga0207711_106596132 177
1119 3300025941 Ga0207711_10763481 Ga0207711_107634811 177
1120 3300025941 Ga0207711_11243660 Ga0207711_112436601 177
1121 3300025942 Ga0207689_10015223 Ga0207689_100152232 177
1122 3300025942 Ga0207689_10033146 Ga0207689_100331468 177
1123 3300025942 Ga0207689_10038004 Ga0207689_100380045 177
1124 3300025942 Ga0207689_10117050 Ga0207689_101170503 177
1125 3300025942 Ga0207689_10348642 Ga0207689_103486422 177
1126 3300025944 Ga0207661_10026944 Ga0207661_100269443 177
1127 3300025944 Ga0207661_10710796 Ga0207661_107107961 177
1128 3300025945 Ga0207679_10001498 Ga0207679_1000149811 177
1129 3300025945 Ga0207679_10016048 Ga0207679_100160486 177
1130 3300025945 Ga0207679_10796798 Ga0207679_107967981 177
1131 3300025945 Ga0207679_11154867 Ga0207679_111548671 177
1132 3300025949 Ga0207667_10188077 Ga0207667_101880775 177
1133 3300025960 Ga0207651_10004839 Ga0207651_1000483912 177
1134 3300025960 Ga0207651_10043195 Ga0207651_100431954 177
1135 3300025960 Ga0207651_10059456 Ga0207651_100594565 177
1136 3300025960 Ga0207651_10063480 Ga0207651_100634805 177
1137 3300025960 Ga0207651_10163749 Ga0207651_101637494 177
1138 3300025960 Ga0207651_10249829 Ga0207651_102498293 177
1139 3300025960 Ga0207651_10315833 Ga0207651_103158333 177
1140 3300025960 Ga0207651_10477293 Ga0207651_104772932 177
1141 3300025961 Ga0207712_10063392 Ga0207712_100633926 177
1142 3300025961 Ga0207712_10129841 Ga0207712_101298413 177
1143 3300025961 Ga0207712_10258983 Ga0207712_102589833 177
1144 3300025972 Ga0207668_10008000 Ga0207668_100080005 177
1145 3300025972 Ga0207668_10211665 Ga0207668_102116653 177
1146 3300025972 Ga0207668_10283658 Ga0207668_102836583 177
1147 3300025972 Ga0207668_10374285 Ga0207668_103742852 177
1148 3300025981 Ga0207640_10014813 Ga0207640_100148134 177
1149 3300025981 Ga0207640_10130332 Ga0207640_101303322 177
1150 3300025981 Ga0207640_10146361 Ga0207640_101463611 177
1151 3300025986 Ga0207658_10002481 Ga0207658_100024818 177
1152 3300025986 Ga0207658_10019932 Ga0207658_100199327 177
1153 3300025986 Ga0207658_10186325 Ga0207658_101863253 177
1154 3300025986 Ga0207658_10204295 Ga0207658_102042952 177
1155 3300025986 Ga0207658_10253878 Ga0207658_102538783 177
1156 3300025986 Ga0207658_10308286 Ga0207658_103082863 177
1157 3300025986 Ga0207658_10515759 Ga0207658_105157592 177
1158 3300026023 Ga0207677_10158539 Ga0207677_101585392 177
1159 3300026023 Ga0207677_10222318 Ga0207677_102223183 177
1160 3300026023 Ga0207677_10493235 Ga0207677_104932352 177
1161 3300026023 Ga0207677_10652352 Ga0207677_106523522 177
1162 3300026023 Ga0207677_10874039 Ga0207677_108740392 177
1163 3300026035 Ga0207703_10002613 Ga0207703_100026133 177
1164 3300026035 Ga0207703_10030166 Ga0207703_100301666 177
1165 3300026035 Ga0207703_10139551 Ga0207703_101395513 177
1166 3300026041 Ga0207639_10244159 Ga0207639_102441592 177
1167 3300026041 Ga0207639_10376167 Ga0207639_103761672 177
1168 3300026041 Ga0207639_10407530 Ga0207639_104075302 177
1169 3300026041 Ga0207639_10601595 Ga0207639_106015952 177
1170 3300026041 Ga0207639_10718737 Ga0207639_107187372 177
1171 3300026067 Ga0207678_10008286 Ga0207678_1000828618 177
1172 3300026067 Ga0207678_10087396 Ga0207678_100873966 177
1173 3300026067 Ga0207678_10099481 Ga0207678_100994813 177
1174 3300026067 Ga0207678_11077997 Ga0207678_110779972 177
1175 3300026078 Ga0207702_10004993 Ga0207702_1000499314 177
1176 3300026078 Ga0207702_10150760 Ga0207702_101507602 177
1177 3300026078 Ga0207702_10415921 Ga0207702_104159213 177
1178 3300026078 Ga0207702_10429607 Ga0207702_104296072 177
1179 3300026078 Ga0207702_10655235 Ga0207702_106552352 177
1180 3300026088 Ga0207641_10028453 Ga0207641_100284533 177
1181 3300026088 Ga0207641_10346817 Ga0207641_103468172 177
1182 3300026089 Ga0207648_10002176 Ga0207648_1000217619 177
1183 3300026089 Ga0207648_10015751 Ga0207648_1001575111 177
1184 3300026089 Ga0207648_10017221 Ga0207648_100172212 177
1185 3300026089 Ga0207648_10084574 Ga0207648_100845742 177
1186 3300026089 Ga0207648_10087281 Ga0207648_100872815 177
1187 3300026089 Ga0207648_10159685 Ga0207648_101596854 177
1188 3300026089 Ga0207648_10173287 Ga0207648_101732872 177
1189 3300026089 Ga0207648_10735211 Ga0207648_107352112 177
1190 3300026095 Ga0207676_10011142 Ga0207676_100111423 177
1191 3300026095 Ga0207676_10083692 Ga0207676_100836925 177
1192 3300026095 Ga0207676_10432909 Ga0207676_104329092 177
1193 3300026095 Ga0207676_10663401 Ga0207676_106634012 177
1194 3300026095 Ga0207676_11735979 Ga0207676_117359791 177
1195 3300026116 Ga0207674_10123860 Ga0207674_101238602 177
1196 3300026116 Ga0207674_10171993 Ga0207674_101719932 177
1197 3300026116 Ga0207674_10380168 Ga0207674_103801682 177
1198 3300026116 Ga0207674_10441964 Ga0207674_104419643 177
1199 3300026116 Ga0207674_11239639 Ga0207674_112396391 177
1200 3300026116 Ga0207674_11328406 Ga0207674_113284062 177
1201 3300026118 Ga0207675_100039987 Ga0207675_1000399876 177
1202 3300026118 Ga0207675_100255531 Ga0207675_1002555312 177
1203 3300026118 Ga0207675_100373676 Ga0207675_1003736763 177
1204 3300026121 Ga0207683_10005923 Ga0207683_100059236 177
1205 3300026121 Ga0207683_10119357 Ga0207683_101193573 177
1206 3300026121 Ga0207683_10124519 Ga0207683_101245194 177
1207 3300026121 Ga0207683_10276638 Ga0207683_102766382 177
1208 3300026121 Ga0207683_10379334 Ga0207683_103793342 177
1209 3300026121 Ga0207683_10677579 Ga0207683_106775792 177
1210 3300026121 Ga0207683_11336775 Ga0207683_113367751 177
1211 3300026142 Ga0207698_10017410 Ga0207698_1001741010 177
1212 3300026142 Ga0207698_10137421 Ga0207698_101374213 177
1213 3300026142 Ga0207698_10224392 Ga0207698_102243922 177
1214 3300026142 Ga0207698_10232611 Ga0207698_102326113 177
1215 3300026142 Ga0207698_10278355 Ga0207698_102783552 177
1216 3300026142 Ga0207698_10582075 Ga0207698_105820751 177
1217 3300026142 Ga0207698_10912475 Ga0207698_109124752 177
1218 3300027111 Ga0209281_1000147 Ga0209281_100014719 177
1219 3300027296 Ga0209389_1000305 Ga0209389_100030529 177
1220 3300027312 Ga0209371_1008392 Ga0209371_10083925 177
1221 3300027378 Ga0209981_1003413 Ga0209981_10034132 177
1222 3300027395 Ga0209996_1000729 Ga0209996_10007297 177
1223 3300027471 Ga0209995_1000242 Ga0209995_100024210 177
1224 3300027526 Ga0209968_1000130 Ga0209968_100013016 177
1225 3300027682 Ga0209971_1072576 Ga0209971_10725762 177
1226 3300027695 Ga0209966_1000117 Ga0209966_100011734 177
1227 3300027717 Ga0209998_10002530 Ga0209998_1000253010 177
1228 3300027866 Ga0209813_10018964 Ga0209813_100189645 177
1229 3300027866 Ga0209813_10215862 Ga0209813_102158622 177
1230 3300027876 Ga0209974_10000149 Ga0209974_1000014919 177
1231 3300027907 Ga0207428_10650266 Ga0207428_106502662 177
1232 3300028380 Ga0268265_10186906 Ga0268265_101869063 177
1233 3300028380 Ga0268265_10241678 Ga0268265_102416782 177
1234 3300028381 Ga0268264_10002070 Ga0268264_1000207019 177
1235 3300028381 Ga0268264_10053634 Ga0268264_100536344 177
1236 3300028381 Ga0268264_10057251 Ga0268264_100572516 177
1237 3300028381 Ga0268264_10324135 Ga0268264_103241353 177
1238 3300028573 Ga0265334_10119748 Ga0265334_101197482 177
1239 3300028666 Ga0265336_10000028 Ga0265336_1000002821 177
1240 3300028786 Ga0307517_10014561 Ga0307517_100145617 177
1241 3300028786 Ga0307517_10110559 Ga0307517_101105592 177
1242 3300028786 Ga0307517_10314484 Ga0307517_103144841 177
1243 3300028786 Ga0307517_10447661 Ga0307517_104476612 177
1244 3300028786 Ga0307517_10475582 Ga0307517_104755821 177
1245 3300028794 Ga0307515_10000096 Ga0307515_10000096185 177
1246 3300028794 Ga0307515_10012540 Ga0307515_1001254012 177
1247 3300028794 Ga0307515_10021273 Ga0307515_1002127319 177
1248 3300028794 Ga0307515_10053115 Ga0307515_100531157 177
1249 3300028794 Ga0307515_10095676 Ga0307515_100956763 177
1250 3300028794 Ga0307515_10108460 Ga0307515_101084607 177
1251 3300028794 Ga0307515_10124094 Ga0307515_101240943 177
1252 3300028794 Ga0307515_10186828 Ga0307515_101868284 177
1253 3300028794 Ga0307515_10489385 Ga0307515_104893852 177
1254 3300029957 Ga0265324_10000286 Ga0265324_1000028631 177
1255 3300030500 Ga0268256_1008739 Ga0268256_10087395 177
1256 3300030522 Ga0307512_10045873 Ga0307512_100458736 177
1257 3300030522 Ga0307512_10091067 Ga0307512_100910672 177
1258 3300030863 Ga0265766_1000558 Ga0265766_10005583 177
1259 3300030888 Ga0265769_100669 Ga0265769_1006693 177
1260 3300031239 Ga0265328_10046852 Ga0265328_100468523 177
1261 3300031250 Ga0265331_10028635 Ga0265331_100286354 177
1262 3300031251 Ga0265327_10000020 Ga0265327_10000020383 177
1263 3300031344 Ga0265316_10000201 Ga0265316_1000020112 177
1264 3300031456 Ga0307513_10004080 Ga0307513_1000408026 177
1265 3300031456 Ga0307513_10019109 Ga0307513_1001910913 177
1266 3300031456 Ga0307513_10034953 Ga0307513_100349531 177
1267 3300031456 Ga0307513_10063852 Ga0307513_100638526 177
1268 3300031456 Ga0307513_10299705 Ga0307513_102997052 177
1269 3300031456 Ga0307513_10613605 Ga0307513_106136051 177
1270 3300031507 Ga0307509_10111735 Ga0307509_101117355 177
1271 3300031507 Ga0307509_10147814 Ga0307509_101478143 177
1272 3300031507 Ga0307509_10422082 Ga0307509_104220822 177
1273 3300031507 Ga0307509_10538122 Ga0307509_105381222 177
1274 3300031548 Ga0307408_100000089 Ga0307408_10000008933 177
1275 3300031548 Ga0307408_100013705 Ga0307408_1000137056 177
1276 3300031548 Ga0307408_100041917 Ga0307408_1000419176 177
1277 3300031548 Ga0307408_100255715 Ga0307408_1002557151 177
1278 3300031548 Ga0307408_100299160 Ga0307408_1002991602 177
1279 3300031548 Ga0307408_100345201 Ga0307408_1003452011 177
1280 3300031616 Ga0307508_10000392 Ga0307508_1000039241 177
1281 3300031616 Ga0307508_10103635 Ga0307508_101036352 177
1282 3300031616 Ga0307508_10335419 Ga0307508_103354192 177
1283 3300031616 Ga0307508_10529775 Ga0307508_105297751 177
1284 3300031649 Ga0307514_10000339 Ga0307514_1000033957 177
1285 3300031649 Ga0307514_10034392 Ga0307514_100343926 177
1286 3300031649 Ga0307514_10181649 Ga0307514_101816492 177
1287 3300031730 Ga0307516_10011689 Ga0307516_1001168919 177
1288 3300031730 Ga0307516_10019197 Ga0307516_1001919711 177
1289 3300031730 Ga0307516_10026535 Ga0307516_100265356 177
1290 3300031730 Ga0307516_10027941 Ga0307516_1002794113 177
1291 3300031730 Ga0307516_10357568 Ga0307516_103575682 177
1292 3300031730 Ga0307516_10435876 Ga0307516_104358761 177
1293 3300031731 Ga0307405_10012091 Ga0307405_100120915 177
1294 3300031731 Ga0307405_10046436 Ga0307405_100464363 177
1295 3300031731 Ga0307405_10089073 Ga0307405_100890731 177
1296 3300031731 Ga0307405_10114216 Ga0307405_101142162 177
1297 3300031731 Ga0307405_10423167 Ga0307405_104231672 177
1298 3300031731 Ga0307405_10425456 Ga0307405_104254562 177
1299 3300031731 Ga0307405_10997327 Ga0307405_109973272 177
1300 3300031824 Ga0307413_10032313 Ga0307413_100323135 177
1301 3300031824 Ga0307413_10400822 Ga0307413_104008222 177
1302 3300031852 Ga0307410_10063849 Ga0307410_100638491 177
1303 3300031852 Ga0307410_10073323 Ga0307410_100733233 177
1304 3300031852 Ga0307410_10140307 Ga0307410_101403072 177
1305 3300031852 Ga0307410_10351464 Ga0307410_103514642 177
1306 3300031852 Ga0307410_10480325 Ga0307410_104803252 177
1307 3300031852 Ga0307410_10516423 Ga0307410_105164231 177
1308 3300031901 Ga0307406_10004866 Ga0307406_1000486610 177
1309 3300031901 Ga0307406_10163268 Ga0307406_101632683 177
1310 3300031901 Ga0307406_10919022 Ga0307406_109190221 177
1311 3300031901 Ga0307406_10926733 Ga0307406_109267332 177
1312 3300031903 Ga0307407_10061462 Ga0307407_100614623 177
1313 3300031903 Ga0307407_10150436 Ga0307407_101504363 177
1314 3300031903 Ga0307407_10168478 Ga0307407_101684783 177
1315 3300031911 Ga0307412_10011559 Ga0307412_100115594 177
1316 3300031911 Ga0307412_10074922 Ga0307412_100749224 177
1317 3300031911 Ga0307412_10263875 Ga0307412_102638752 177
1318 3300031911 Ga0307412_10288983 Ga0307412_102889833 177
1319 3300031911 Ga0307412_10705923 Ga0307412_107059232 177
1320 3300031995 Ga0307409_100000577 Ga0307409_10000057721 177
1321 3300031995 Ga0307409_100077436 Ga0307409_1000774362 177
1322 3300031995 Ga0307409_100330064 Ga0307409_1003300641 177
1323 3300031995 Ga0307409_100676297 Ga0307409_1006762972 177
1324 3300032002 Ga0307416_100028404 Ga0307416_1000284046 177
1325 3300032002 Ga0307416_100043561 Ga0307416_1000435613 177
1326 3300032002 Ga0307416_100231430 Ga0307416_1002314304 177
1327 3300032002 Ga0307416_102038128 Ga0307416_1020381281 177
1328 3300032004 Ga0307414_10315494 Ga0307414_103154942 177
1329 3300032004 Ga0307414_10482787 Ga0307414_104827872 177
1330 3300032004 Ga0307414_10614971 Ga0307414_106149712 177
1331 3300032004 Ga0307414_11034159 Ga0307414_110341591 177
1332 3300032004 Ga0307414_11529907 Ga0307414_115299071 177
1333 3300032005 Ga0307411_10000085 Ga0307411_1000008528 177
1334 3300032005 Ga0307411_10059434 Ga0307411_100594345 177
1335 3300032005 Ga0307411_10249959 Ga0307411_102499591 177
1336 3300032005 Ga0307411_10330148 Ga0307411_103301482 177
1337 3300032005 Ga0307411_10372291 Ga0307411_103722912 177
1338 3300032005 Ga0307411_10417309 Ga0307411_104173092 177
1339 3300032005 Ga0307411_11428424 Ga0307411_114284241 177
1340 3300032126 Ga0307415_100034663 Ga0307415_1000346633 177
1341 3300032126 Ga0307415_100039097 Ga0307415_1000390977 177
1342 3300032126 Ga0307415_101345605 Ga0307415_1013456051 177
1343 3300033179 Ga0307507_10308226 Ga0307507_103082261 177
1344 3300033180 Ga0307510_10053339 Ga0307510_100533392 177
1345 3300033180 Ga0307510_10168701 Ga0307510_101687012 177
1346 3300033180 Ga0307510_10262217 Ga0307510_102622171 177
1347 3300033180 Ga0307510_10511068 Ga0307510_105110681 177
1348 3300034817 Ga0373948_0007447 Ga0373948_0007447_1091_1624 177
1349 3300034818 Ga0373950_0010768 Ga0373950_0010768_614_1147 177
1350 3300034957 Ga0373938_0017777 Ga0373938_0017777_810_1343 177
1351 3300035092 Ga0373952_0009457 Ga0373952_0009457_847_1380 177
1352 3300035112 Ga0373932_0032954 Ga0373932_0032954_437_970 177
1353 3300035114 Ga0373939_0000348 Ga0373939_0000348_2739_3272 177
1354 3300035114 Ga0373939_0042737 Ga0373939_0042737_90_623 177
1355 3300035115 Ga0373941_0041755 Ga0373941_0041755_479_1012 177
1356 3300035121 Ga0373960_0000482 Ga0373960_0000482_6697_7230 177
1357 3300035172 Ga0373955_0325970 Ga0373955_0325970_39_572 177
1358 3300035207 Ga0373942_0048831 Ga0373942_0048831_44_577 177
1359 3300035242 Ga0373962_0023573 Ga0373962_0023573_371_904 177
1360 3300035242 Ga0373962_0036659 Ga0373962_0036659_367_900 177
1361 3300035691 Ga0373931_0000535 Ga0373931_0000535_3726_4259 177
1362 3300035691 Ga0373931_0001474 Ga0373931_0001474_5065_5598 177
1363 3300039447 Ga0436361_0714431 Ga0436361_0714431_7085_7618 177
1364 3300041443 Ga0451789_0781745 Ga0451789_0781745_238_771 177
1365 3300042012 Ga0439455_0097345 Ga0439455_0097345_247_780 177
1366 3300042127 Ga0450890_000550 Ga0450890_000550_789_1322 177
1367 3300042438 Ga0439459_0000309 Ga0439459_0000309_2637_3170 177
1368 3300042876 Ga0451577_0004524 Ga0451577_0004524_4703_5236 177
1369 3300044694 Ga0466963_0028896 Ga0466963_0028896_819_1352 177
1370 3300044712 Ga0453684_0000516 Ga0453684_0000516_22307_22870 177
1371 3300045051 Ga0451576_0106671 Ga0451576_0106671_1810_2343 177
1372 3300045976 Ga0466967_0397643 Ga0466967_0397643_650_1183 177
1373 3300046526 Ga0495666_0154415 Ga0495666_0154415_507_1040 177
1374 3300046683 Ga0495658_0085813 Ga0495658_0085813_496_1029 177
1375 3300048091 Ga0495626_0074338 Ga0495626_0074338_820_1353 177
1376 3300048905 Ga0496102_0381564 Ga0496102_0381564_293_826 177
1377 3300048906 Ga0496103_0130430 Ga0496103_0130430_260_793 177
1378 3300048907 Ga0496104_0104722 Ga0496104_0104722_1663_2196 177
1379 3300048910 Ga0496107_0429419 Ga0496107_0429419_13_546 177
1380 3300048913 Ga0496110_0199440 Ga0496110_0199440_221_754 177
1381 3300048913 Ga0496110_1077670 Ga0496110_1077670_164_697 177
1382 3300048916 Ga0496113_0910699 Ga0496113_0910699_120_653 177
1383 3300048918 Ga0496115_0030230 Ga0496115_0030230_2226_2759 177
1384 3300048924 Ga0496121_0042385 Ga0496121_0042385_46_579 177
1385 3300048927 Ga0496124_0001830 Ga0496124_0001830_20635_21168 177
1386 3300048928 Ga0496125_0013937 Ga0496125_0013937_2415_2948 177
1387 3300049127 Ga0501306_001910 Ga0501306_001910_129_662 177
1388 3300049128 Ga0501308_008278 Ga0501308_008278_83_616 177
1389 3300049527 Ga0501311_014890 Ga0501311_014890_354_887 177
1390 3300049530 Ga0501314_002966 Ga0501314_002966_700_1233 177
1391 3300049532 Ga0501316_001021 Ga0501316_001021_567_1100 177
1392 3300049538 Ga0501322_000402 Ga0501322_000402_1332_1865 177
1393 3300049649 Ga0501198_000043 Ga0501198_000043_35659_36192 177
1394 3300049662 Ga0501222_000051 Ga0501222_000051_7979_8512 177
1395 3300050493 nmdc:mga0k408_117826_c1 nmdc:mga0k408_117826_c1_427_960 177
1396 3300050496 nmdc:mga07m45_13904_c1 nmdc:mga07m45_13904_c1_2955_3488 177
1397 3300050496 nmdc:mga07m45_74708_c1 nmdc:mga07m45_74708_c1_913_1446 177
1398 3300059421 Ga0590071_001831 Ga0590071_001831_4096_4629 177
1399 3300059424 Ga0590075_011325 Ga0590075_011325_231_764 177
1400 3300059477 Ga0587084_012022 Ga0587084_012022_23_556 177
1401 3300059477 Ga0587084_034985 Ga0587084_034985_204_737 177
1402 3300059491 Ga0587070_007134 Ga0587070_007134_645_1178 177
1403 3300059491 Ga0587070_098543 Ga0587070_098543_29_562 177
1404 3300059505 Ga0587083_0017882 Ga0587083_0017882_94_627 177
1405 3300059507 Ga0587086_016978 Ga0587086_016978_191_724 177
1406 3300059623 Ga0587101_001008 Ga0587101_001008_423_956 177
1407 3300059639 Ga0587062_008101 Ga0587062_008101_236_769 177
1408 3300059641 Ga0587068_001309 Ga0587068_001309_1742_2275 177
1409 3300059653 Ga0587108_002956 Ga0587108_002956_522_1055 177
1410 3300060346 Ga0587111_0005177 Ga0587111_0005177_961_1494 177
1411 3300060346 Ga0587111_0104287 Ga0587111_0104287_31_564 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

90

157

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

11

82

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9175 9 167
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9163 2 167
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9147 9 167
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9121 2 167
487d-assembly1.cif.gz_J seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution 0.912 9 167
ID Description Score Start End Superfamily
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9257 3 82 3.90.930.12
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9043 3 82 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.8968 2 82 3.90.930.12
2zjqE01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.8949 8 79 3.90.930.12
1vs8G01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.8932 2 82 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A1G0LBH2-F1-model_v4 50S ribosomal protein L6 0.9876 8 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4P9I807-F1-model_v4 50S ribosomal protein L6 0.9756 9 150 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A1V4GKA1-F1-model_v4 deleted 0.9646 78 146
AF-A0A4P9I807-F1-model_v4 50S ribosomal protein L6 0.9623 9 150 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6B3I972-F1-model_v4 50S ribosomal protein L6 0.9546 70 142 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
80.24 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map