F493754
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1411 | 568 | 1394 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10379334|Ga0207683_103793342 |
| Length | 189 |
| Sequence | MSRVGKMPLPVPKGVDVTLTGETISVKGSMGTLVRPVNALVTVKNEEGRLLFAPANDSVEADAMSGTMRALVANMVGGVTKGFEKRLALVGVGFRASAQGSKLNLQVGFSHPVSKEMPAGVKVECPSQTEIVIKGSDRQAVGQVAAEVRALRPPEGPQDDPLRDAPPSDGRVPAGCSTQESRAGSADAC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 10 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 11 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 12 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 13 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 14 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 15 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 16 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 17 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 18 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 21 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 120 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 136 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 250 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 253 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 255 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 261 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 262 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 269 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 270 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 271 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 272 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 273 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 274 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 275 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 276 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 278 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 279 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 286 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 293 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 299 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 304 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 307 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 309 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 310 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 317 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 320 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 321 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 322 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 323 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 324 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 325 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 326 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 327 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 328 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 329 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 330 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 331 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 332 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 333 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 334 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 335 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 336 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 337 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 338 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 339 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 340 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 341 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 342 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 343 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 344 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 345 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 346 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 347 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 348 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 349 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 350 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 351 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 352 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 353 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 354 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 355 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 356 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 357 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 358 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 359 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 360 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 361 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 362 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 363 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 364 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 365 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 366 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 367 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 368 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 369 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 370 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 371 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 372 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 373 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 374 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 375 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 436 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 437 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 438 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 439 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 440 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 441 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 444 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 445 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 446 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 447 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 448 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 449 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 450 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 451 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 459 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 460 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 461 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 462 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 488 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 489 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 490 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 491 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 492 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 493 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 494 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 495 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 496 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 497 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 498 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 499 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 500 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 501 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 502 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 503 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 504 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 505 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 506 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 507 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 508 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 509 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 510 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 511 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 512 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 513 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 514 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 515 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 516 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 520 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 521 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 522 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 523 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 524 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 525 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 526 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 530 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 532 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 533 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 534 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 535 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 536 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 537 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 538 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 539 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 540 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 541 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 542 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 543 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 544 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 545 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 546 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 547 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 548 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 549 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 550 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 551 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 552 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 553 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 554 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 555 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 556 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 557 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 558 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 559 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.58 |
| Metatranscriptomes | 9.21 |
| Isolates | 1.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.89 |
| Nodule | 0.35 |
| Rhizoplane | 3.33 |
| Rhizosphere | 76.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_690899 | 2162886007 | Bacteria | 2794 |
| 2 | JGI25156J39149_1016366 | 3300002705 | Bacteria | 1443 |
| 3 | JGI25156J39149_1019922 | 3300002705 | Bacteria | 1196 |
| 4 | JGI25150J39212_1003907 | 3300002774 | Bacteria | 3415 |
| 5 | Ga0006765J45826_106373 | 3300003161 | Bacteria | 4293 |
| 6 | Ga0006759J45824_1028038 | 3300003163 | Bacteria | 4414 |
| 7 | JGI25153J46596_10008637 | 3300003215 | Bacteria | 4845 |
| 8 | Ga0006770J48903_1001899 | 3300003305 | Bacteria | 11120 |
| 9 | Ga0006777J48905_1014855 | 3300003308 | Bacteria | 5027 |
| 10 | Ga0007417J51691_1020817 | 3300003544 | Bacteria | 4053 |
| 11 | Ga0007410J51695_1005226 | 3300003574 | Bacteria | 5217 |
| 12 | Ga0007410J51695_1028665 | 3300003574 | Bacteria | 3145 |
| 13 | Ga0007410J51695_1043180 | 3300003574 | Bacteria | 4391 |
| 14 | Ga0007409J51694_1024055 | 3300003575 | Bacteria | 9433 |
| 15 | Ga0007409J51694_1041611 | 3300003575 | Bacteria | 1240 |
| 16 | Ga0007416J51690_1037564 | 3300003577 | Bacteria | 4820 |
| 17 | Ga0007411J51799_109097 | 3300003611 | Bacteria | 3946 |
| 18 | Ga0007415J51800_107261 | 3300003613 | Bacteria | 3368 |
| 19 | Ga0032354_1038503 | 3300003693 | Bacteria | 3177 |
| 20 | Ga0032354_1038952 | 3300003693 | Bacteria | 2112 |
| 21 | Ga0032354_1072421 | 3300003693 | Bacteria | 2730 |
| 22 | Ga0055535_1003662 | 3300003761 | Bacteria | 4181 |
| 23 | Ga0055529_1000322 | 3300003763 | Bacteria | 54232 |
| 24 | Ga0055526_1000791 | 3300003771 | Bacteria | 23567 |
| 25 | Ga0055524_1000140 | 3300003775 | Bacteria | 85990 |
| 26 | Ga0055528_1069011 | 3300003790 | Bacteria | 644 |
| 27 | Ga0055530_10006458 | 3300003791 | Bacteria | 5230 |
| 28 | Ga0055540_1000133 | 3300003792 | Bacteria | 75104 |
| 29 | Ga0055540_1029907 | 3300003792 | Bacteria | 1270 |
| 30 | Ga0055531_10002079 | 3300003794 | Bacteria | 13764 |
| 31 | Ga0055531_10002114 | 3300003794 | Bacteria | 13639 |
| 32 | Ga0065165_1006303 | 3300005262 | Bacteria | 6283 |
| 33 | Ga0065165_1028112 | 3300005262 | Bacteria | 1821 |
| 34 | Ga0065712_10087248 | 3300005290 | Bacteria | 2579 |
| 35 | Ga0065715_10005249 | 3300005293 | Bacteria | 3239 |
| 36 | Ga0065715_10023020 | 3300005293 | Bacteria | 1712 |
| 37 | Ga0065707_10255698 | 3300005295 | Bacteria | 1112 |
| 38 | Ga0070658_10427594 | 3300005327 | Bacteria | 1139 |
| 39 | Ga0070676_10021276 | 3300005328 | Bacteria | 3630 |
| 40 | Ga0070676_10093888 | 3300005328 | Bacteria | 1843 |
| 41 | Ga0070676_10372716 | 3300005328 | Bacteria | 986 |
| 42 | Ga0070676_10916024 | 3300005328 | Bacteria | 654 |
| 43 | Ga0070676_11043051 | 3300005328 | Bacteria | 615 |
| 44 | Ga0070683_100631138 | 3300005329 | Bacteria | 1026 |
| 45 | Ga0070683_100645299 | 3300005329 | Bacteria | 1013 |
| 46 | Ga0070690_100006927 | 3300005330 | Bacteria | 6450 |
| 47 | Ga0070690_100231854 | 3300005330 | Bacteria | 1298 |
| 48 | Ga0070690_100276410 | 3300005330 | Bacteria | 1196 |
| 49 | Ga0070670_100054237 | 3300005331 | Bacteria | 3441 |
| 50 | Ga0070670_100064589 | 3300005331 | Bacteria | 3140 |
| 51 | Ga0070670_100065507 | 3300005331 | Bacteria | 3117 |
| 52 | Ga0070670_100816423 | 3300005331 | Bacteria | 843 |
| 53 | Ga0070670_101131033 | 3300005331 | Bacteria | 715 |
| 54 | Ga0070677_10017315 | 3300005333 | Bacteria | 2578 |
| 55 | Ga0070677_10135253 | 3300005333 | Bacteria | 1130 |
| 56 | Ga0070677_10146542 | 3300005333 | Bacteria | 1094 |
| 57 | Ga0068869_100077114 | 3300005334 | Bacteria | 2478 |
| 58 | Ga0068869_100146255 | 3300005334 | Bacteria | 1829 |
| 59 | Ga0068869_100257683 | 3300005334 | Bacteria | 1395 |
| 60 | Ga0068869_100283533 | 3300005334 | Bacteria | 1333 |
| 61 | Ga0068869_100284560 | 3300005334 | Bacteria | 1330 |
| 62 | Ga0068869_100547670 | 3300005334 | Bacteria | 971 |
| 63 | Ga0070666_10056809 | 3300005335 | Bacteria | 2644 |
| 64 | Ga0070666_10122448 | 3300005335 | Bacteria | 1804 |
| 65 | Ga0070666_10343207 | 3300005335 | Bacteria | 1067 |
| 66 | Ga0070680_100032809 | 3300005336 | Bacteria | 4180 |
| 67 | Ga0070682_100057764 | 3300005337 | Bacteria | 2445 |
| 68 | Ga0070682_100193784 | 3300005337 | Bacteria | 1428 |
| 69 | Ga0068868_100211639 | 3300005338 | Bacteria | 1620 |
| 70 | Ga0068868_100246199 | 3300005338 | Bacteria | 1503 |
| 71 | Ga0068868_100474633 | 3300005338 | Bacteria | 1092 |
| 72 | Ga0068868_100751149 | 3300005338 | Bacteria | 876 |
| 73 | Ga0070660_100190679 | 3300005339 | Bacteria | 1660 |
| 74 | Ga0070660_100910758 | 3300005339 | Bacteria | 742 |
| 75 | Ga0070660_101202805 | 3300005339 | Bacteria | 642 |
| 76 | Ga0070689_100265958 | 3300005340 | Bacteria | 1418 |
| 77 | Ga0070687_100233714 | 3300005343 | Bacteria | 1133 |
| 78 | Ga0070661_100003672 | 3300005344 | Bacteria | 10572 |
| 79 | Ga0070661_100092952 | 3300005344 | Bacteria | 2235 |
| 80 | Ga0070661_100105291 | 3300005344 | Bacteria | 2102 |
| 81 | Ga0070661_100338960 | 3300005344 | Bacteria | 1177 |
| 82 | Ga0070668_100175163 | 3300005347 | Bacteria | 1749 |
| 83 | Ga0070668_100211316 | 3300005347 | Bacteria | 1596 |
| 84 | Ga0070668_100266732 | 3300005347 | Bacteria | 1425 |
| 85 | Ga0070668_100493006 | 3300005347 | Bacteria | 1059 |
| 86 | Ga0070668_100656989 | 3300005347 | Bacteria | 922 |
| 87 | Ga0070669_100017536 | 3300005353 | Bacteria | 5107 |
| 88 | Ga0070669_100075981 | 3300005353 | Bacteria | 2492 |
| 89 | Ga0070669_100077546 | 3300005353 | Bacteria | 2469 |
| 90 | Ga0070669_100555163 | 3300005353 | Bacteria | 958 |
| 91 | Ga0070675_100044665 | 3300005354 | Bacteria | 3623 |
| 92 | Ga0070675_100119785 | 3300005354 | Bacteria | 2235 |
| 93 | Ga0070675_100159250 | 3300005354 | Bacteria | 1940 |
| 94 | Ga0070675_100364619 | 3300005354 | Bacteria | 1283 |
| 95 | Ga0070675_100413240 | 3300005354 | Bacteria | 1205 |
| 96 | Ga0070675_100860171 | 3300005354 | Bacteria | 830 |
| 97 | Ga0070675_101293146 | 3300005354 | Bacteria | 672 |
| 98 | Ga0070671_100019537 | 3300005355 | Bacteria | 5516 |
| 99 | Ga0070671_100030800 | 3300005355 | Bacteria | 4428 |
| 100 | Ga0070671_100040069 | 3300005355 | Bacteria | 3889 |
| 101 | Ga0070671_100151546 | 3300005355 | Bacteria | 1958 |
| 102 | Ga0070671_100251374 | 3300005355 | Bacteria | 1502 |
| 103 | Ga0070671_100342299 | 3300005355 | Bacteria | 1276 |
| 104 | Ga0070671_100412635 | 3300005355 | Bacteria | 1156 |
| 105 | Ga0070674_100039880 | 3300005356 | Bacteria | 3174 |
| 106 | Ga0070674_100056124 | 3300005356 | Bacteria | 2730 |
| 107 | Ga0070674_100120277 | 3300005356 | Bacteria | 1943 |
| 108 | Ga0070674_100181740 | 3300005356 | Bacteria | 1611 |
| 109 | Ga0070674_100242149 | 3300005356 | Bacteria | 1413 |
| 110 | Ga0070674_100310754 | 3300005356 | Bacteria | 1260 |
| 111 | Ga0070674_101517531 | 3300005356 | Bacteria | 602 |
| 112 | Ga0070673_100002927 | 3300005364 | Bacteria | 10519 |
| 113 | Ga0070673_100055764 | 3300005364 | Bacteria | 3115 |
| 114 | Ga0070673_100092283 | 3300005364 | Bacteria | 2476 |
| 115 | Ga0070673_100169356 | 3300005364 | Bacteria | 1863 |
| 116 | Ga0070673_100192497 | 3300005364 | Bacteria | 1752 |
| 117 | Ga0070673_100525545 | 3300005364 | Bacteria | 1073 |
| 118 | Ga0070673_100759012 | 3300005364 | Bacteria | 893 |
| 119 | Ga0070688_100074242 | 3300005365 | Bacteria | 2183 |
| 120 | Ga0070688_100304757 | 3300005365 | Bacteria | 1152 |
| 121 | Ga0070659_100050300 | 3300005366 | Bacteria | 3276 |
| 122 | Ga0070659_100250633 | 3300005366 | Bacteria | 1467 |
| 123 | Ga0070659_100378036 | 3300005366 | Bacteria | 1193 |
| 124 | Ga0070667_100028082 | 3300005367 | Bacteria | 4683 |
| 125 | Ga0070667_100083378 | 3300005367 | Bacteria | 2738 |
| 126 | Ga0070667_100158747 | 3300005367 | Bacteria | 1990 |
| 127 | Ga0070667_100231002 | 3300005367 | Bacteria | 1649 |
| 128 | Ga0070667_100492119 | 3300005367 | Bacteria | 1123 |
| 129 | Ga0070701_10134721 | 3300005438 | Bacteria | 1407 |
| 130 | Ga0070701_10405461 | 3300005438 | Bacteria | 865 |
| 131 | Ga0070708_100348817 | 3300005445 | Bacteria | 1395 |
| 132 | Ga0070663_100003492 | 3300005455 | Bacteria | 9070 |
| 133 | Ga0070663_100130855 | 3300005455 | Bacteria | 1905 |
| 134 | Ga0070678_100025705 | 3300005456 | Bacteria | 3967 |
| 135 | Ga0070678_100076714 | 3300005456 | Bacteria | 2518 |
| 136 | Ga0070678_100104114 | 3300005456 | Bacteria | 2206 |
| 137 | Ga0070678_100195478 | 3300005456 | Bacteria | 1666 |
| 138 | Ga0070678_100382831 | 3300005456 | Bacteria | 1218 |
| 139 | Ga0070678_100639099 | 3300005456 | Bacteria | 953 |
| 140 | Ga0070678_100694884 | 3300005456 | Bacteria | 916 |
| 141 | Ga0070678_100941219 | 3300005456 | Bacteria | 792 |
| 142 | Ga0070678_101856688 | 3300005456 | Bacteria | 569 |
| 143 | Ga0070662_100060375 | 3300005457 | Bacteria | 2765 |
| 144 | Ga0070662_100065448 | 3300005457 | Bacteria | 2665 |
| 145 | Ga0070662_100111387 | 3300005457 | Bacteria | 2085 |
| 146 | Ga0070662_100212672 | 3300005457 | Bacteria | 1539 |
| 147 | Ga0070662_100322678 | 3300005457 | Bacteria | 1259 |
| 148 | Ga0070662_100351011 | 3300005457 | Bacteria | 1208 |
| 149 | Ga0070681_10088377 | 3300005458 | Bacteria | 3051 |
| 150 | Ga0068867_100000552 | 3300005459 | Bacteria | 24723 |
| 151 | Ga0068867_100002598 | 3300005459 | Bacteria | 12737 |
| 152 | Ga0068867_100011425 | 3300005459 | Bacteria | 6266 |
| 153 | Ga0068867_100087646 | 3300005459 | Bacteria | 2357 |
| 154 | Ga0068867_100117646 | 3300005459 | Bacteria | 2049 |
| 155 | Ga0068867_100223813 | 3300005459 | Bacteria | 1517 |
| 156 | Ga0068867_100276422 | 3300005459 | Bacteria | 1375 |
| 157 | Ga0068867_100336428 | 3300005459 | Bacteria | 1255 |
| 158 | Ga0068867_100411856 | 3300005459 | Bacteria | 1143 |
| 159 | Ga0070706_100025301 | 3300005467 | Bacteria | 5463 |
| 160 | Ga0070707_100035242 | 3300005468 | Bacteria | 4774 |
| 161 | Ga0070679_100007565 | 3300005530 | Bacteria | 10160 |
| 162 | Ga0070684_100178663 | 3300005535 | Bacteria | 1929 |
| 163 | Ga0070684_100565789 | 3300005535 | Bacteria | 1055 |
| 164 | Ga0068853_100428379 | 3300005539 | Bacteria | 1242 |
| 165 | Ga0068853_101387344 | 3300005539 | Bacteria | 679 |
| 166 | Ga0070672_100006187 | 3300005543 | Bacteria | 8016 |
| 167 | Ga0070672_100044598 | 3300005543 | Bacteria | 3426 |
| 168 | Ga0070672_100110140 | 3300005543 | Bacteria | 2243 |
| 169 | Ga0070672_100170362 | 3300005543 | Bacteria | 1810 |
| 170 | Ga0070672_100197483 | 3300005543 | Bacteria | 1681 |
| 171 | Ga0070672_100198587 | 3300005543 | Bacteria | 1677 |
| 172 | Ga0070672_100380405 | 3300005543 | Bacteria | 1207 |
| 173 | Ga0070686_100146015 | 3300005544 | Bacteria | 1652 |
| 174 | Ga0070686_100205477 | 3300005544 | Bacteria | 1415 |
| 175 | Ga0070695_100538265 | 3300005545 | Bacteria | 909 |
| 176 | Ga0070693_100023342 | 3300005547 | Bacteria | 3305 |
| 177 | Ga0070693_100069686 | 3300005547 | Bacteria | 2067 |
| 178 | Ga0070665_100538419 | 3300005548 | Bacteria | 1180 |
| 179 | Ga0068855_100040434 | 3300005563 | Bacteria | 5534 |
| 180 | Ga0068855_100300591 | 3300005563 | Bacteria | 1777 |
| 181 | Ga0070664_100040179 | 3300005564 | Bacteria | 3943 |
| 182 | Ga0070664_100238231 | 3300005564 | Bacteria | 1633 |
| 183 | Ga0070664_100273368 | 3300005564 | Bacteria | 1522 |
| 184 | Ga0070664_100284562 | 3300005564 | Bacteria | 1491 |
| 185 | Ga0070664_100363954 | 3300005564 | Bacteria | 1317 |
| 186 | Ga0070664_101181621 | 3300005564 | Bacteria | 721 |
| 187 | Ga0068857_100040688 | 3300005577 | Bacteria | 4122 |
| 188 | Ga0068857_100209439 | 3300005577 | Bacteria | 1778 |
| 189 | Ga0068857_100442265 | 3300005577 | Bacteria | 1214 |
| 190 | Ga0068854_100044785 | 3300005578 | Bacteria | 3143 |
| 191 | Ga0068854_100352180 | 3300005578 | Bacteria | 1205 |
| 192 | Ga0068854_100392378 | 3300005578 | Bacteria | 1146 |
| 193 | Ga0068854_100559167 | 3300005578 | Bacteria | 971 |
| 194 | Ga0068856_100183859 | 3300005614 | Bacteria | 2104 |
| 195 | Ga0068856_100244565 | 3300005614 | Bacteria | 1809 |
| 196 | Ga0068856_100345416 | 3300005614 | Bacteria | 1507 |
| 197 | Ga0068856_100463129 | 3300005614 | Bacteria | 1288 |
| 198 | Ga0068856_100477988 | 3300005614 | Bacteria | 1267 |
| 199 | Ga0068856_100596350 | 3300005614 | Bacteria | 1126 |
| 200 | Ga0070702_100692109 | 3300005615 | Bacteria | 776 |
| 201 | Ga0068852_100022501 | 3300005616 | Bacteria | 5056 |
| 202 | Ga0068852_100102229 | 3300005616 | Bacteria | 2589 |
| 203 | Ga0068852_100307390 | 3300005616 | Bacteria | 1536 |
| 204 | Ga0068852_100315873 | 3300005616 | Bacteria | 1516 |
| 205 | Ga0068852_100362674 | 3300005616 | Bacteria | 1418 |
| 206 | Ga0068852_100413864 | 3300005616 | Bacteria | 1328 |
| 207 | Ga0068852_100519932 | 3300005616 | Bacteria | 1187 |
| 208 | Ga0068852_100688915 | 3300005616 | Bacteria | 1031 |
| 209 | Ga0068852_101527673 | 3300005616 | Bacteria | 690 |
| 210 | Ga0068852_101974945 | 3300005616 | Bacteria | 605 |
| 211 | Ga0068859_100130187 | 3300005617 | Bacteria | 2587 |
| 212 | Ga0068859_100176605 | 3300005617 | Bacteria | 2218 |
| 213 | Ga0068859_100454844 | 3300005617 | Bacteria | 1376 |
| 214 | Ga0068859_100768856 | 3300005617 | Bacteria | 1052 |
| 215 | Ga0068864_100018772 | 3300005618 | Bacteria | 5779 |
| 216 | Ga0068864_100066476 | 3300005618 | Bacteria | 3129 |
| 217 | Ga0068864_100103544 | 3300005618 | Bacteria | 2527 |
| 218 | Ga0068864_100353670 | 3300005618 | Bacteria | 1387 |
| 219 | Ga0068864_100403474 | 3300005618 | Bacteria | 1299 |
| 220 | Ga0068864_101289846 | 3300005618 | Bacteria | 730 |
| 221 | Ga0068864_101947844 | 3300005618 | Bacteria | 593 |
| 222 | Ga0068866_10061825 | 3300005718 | Bacteria | 1946 |
| 223 | Ga0068866_10091328 | 3300005718 | Bacteria | 1659 |
| 224 | Ga0068861_100004770 | 3300005719 | Bacteria | 9115 |
| 225 | Ga0068861_100016735 | 3300005719 | Bacteria | 5194 |
| 226 | Ga0068861_100021676 | 3300005719 | Bacteria | 4620 |
| 227 | Ga0068861_100170807 | 3300005719 | Bacteria | 1802 |
| 228 | Ga0068861_100247833 | 3300005719 | Bacteria | 1518 |
| 229 | Ga0068851_10109854 | 3300005834 | Bacteria | 1471 |
| 230 | Ga0068851_10143693 | 3300005834 | Bacteria | 1299 |
| 231 | Ga0068851_10206879 | 3300005834 | Bacteria | 1097 |
| 232 | Ga0068851_10263194 | 3300005834 | Bacteria | 981 |
| 233 | Ga0068851_10347902 | 3300005834 | Bacteria | 862 |
| 234 | Ga0068870_10231402 | 3300005840 | Bacteria | 1136 |
| 235 | Ga0068870_10276128 | 3300005840 | Bacteria | 1052 |
| 236 | Ga0068870_10398683 | 3300005840 | Bacteria | 895 |
| 237 | Ga0068863_100043166 | 3300005841 | Bacteria | 4281 |
| 238 | Ga0068863_100104362 | 3300005841 | Bacteria | 2696 |
| 239 | Ga0068863_100257362 | 3300005841 | Bacteria | 1687 |
| 240 | Ga0068863_100338312 | 3300005841 | Bacteria | 1464 |
| 241 | Ga0068863_100410223 | 3300005841 | Bacteria | 1326 |
| 242 | Ga0068858_100008125 | 3300005842 | Bacteria | 10091 |
| 243 | Ga0068858_100030753 | 3300005842 | Bacteria | 4986 |
| 244 | Ga0068858_100194536 | 3300005842 | Bacteria | 1916 |
| 245 | Ga0068860_100008442 | 3300005843 | Bacteria | 10260 |
| 246 | Ga0068860_100065679 | 3300005843 | Bacteria | 3445 |
| 247 | Ga0068860_100210653 | 3300005843 | Bacteria | 1885 |
| 248 | Ga0068860_100446321 | 3300005843 | Bacteria | 1286 |
| 249 | Ga0068860_100633821 | 3300005843 | Bacteria | 1076 |
| 250 | Ga0068862_100103203 | 3300005844 | Bacteria | 2497 |
| 251 | Ga0068862_100335247 | 3300005844 | Bacteria | 1400 |
| 252 | Ga0068862_101115400 | 3300005844 | Bacteria | 784 |
| 253 | Ga0075363_100005889 | 3300006048 | Bacteria | 5519 |
| 254 | Ga0075363_100049841 | 3300006048 | Bacteria | 2230 |
| 255 | Ga0075363_100186191 | 3300006048 | Bacteria | 1183 |
| 256 | Ga0075363_100204317 | 3300006048 | Bacteria | 1129 |
| 257 | Ga0075363_100787507 | 3300006048 | Bacteria | 578 |
| 258 | Ga0075364_10032491 | 3300006051 | Bacteria | 3355 |
| 259 | Ga0075364_10142234 | 3300006051 | Bacteria | 1614 |
| 260 | Ga0075364_10304148 | 3300006051 | Bacteria | 1086 |
| 261 | Ga0075432_10216901 | 3300006058 | Bacteria | 764 |
| 262 | Ga0070715_10025469 | 3300006163 | Bacteria | 2344 |
| 263 | Ga0070716_100069303 | 3300006173 | Bacteria | 2066 |
| 264 | Ga0075362_10000222 | 3300006177 | Bacteria | 15765 |
| 265 | Ga0075362_10060918 | 3300006177 | Bacteria | 1706 |
| 266 | Ga0075362_10090390 | 3300006177 | Bacteria | 1421 |
| 267 | Ga0075362_10313389 | 3300006177 | Bacteria | 780 |
| 268 | Ga0075362_10380970 | 3300006177 | Bacteria | 709 |
| 269 | Ga0075367_10000855 | 3300006178 | Bacteria | 12145 |
| 270 | Ga0075367_10006379 | 3300006178 | Bacteria | 5953 |
| 271 | Ga0075367_10092185 | 3300006178 | Bacteria | 1844 |
| 272 | Ga0075367_10295173 | 3300006178 | Bacteria | 1020 |
| 273 | Ga0075367_10347911 | 3300006178 | Bacteria | 935 |
| 274 | Ga0075369_10005325 | 3300006186 | Bacteria | 4797 |
| 275 | Ga0075369_10159851 | 3300006186 | Bacteria | 1032 |
| 276 | Ga0075369_10410384 | 3300006186 | Bacteria | 639 |
| 277 | Ga0075366_10000776 | 3300006195 | Bacteria | 15228 |
| 278 | Ga0075366_10016473 | 3300006195 | Bacteria | 4249 |
| 279 | Ga0075366_10018148 | 3300006195 | Bacteria | 4062 |
| 280 | Ga0075366_10033848 | 3300006195 | Bacteria | 3011 |
| 281 | Ga0075366_10054228 | 3300006195 | Bacteria | 2381 |
| 282 | Ga0075366_10055751 | 3300006195 | Bacteria | 2347 |
| 283 | Ga0075366_10081535 | 3300006195 | Bacteria | 1932 |
| 284 | Ga0075366_10115763 | 3300006195 | Bacteria | 1614 |
| 285 | Ga0075366_10140745 | 3300006195 | Bacteria | 1458 |
| 286 | Ga0075366_10159590 | 3300006195 | Bacteria | 1366 |
| 287 | Ga0075366_10163686 | 3300006195 | Bacteria | 1348 |
| 288 | Ga0075366_10196478 | 3300006195 | Bacteria | 1226 |
| 289 | Ga0075366_10210884 | 3300006195 | Bacteria | 1182 |
| 290 | Ga0075366_10213318 | 3300006195 | Bacteria | 1175 |
| 291 | Ga0075366_10216952 | 3300006195 | Bacteria | 1165 |
| 292 | Ga0075366_10243514 | 3300006195 | Bacteria | 1096 |
| 293 | Ga0075366_10274182 | 3300006195 | Bacteria | 1030 |
| 294 | Ga0075366_10550230 | 3300006195 | Bacteria | 714 |
| 295 | Ga0075366_10767148 | 3300006195 | Bacteria | 599 |
| 296 | Ga0097621_100047739 | 3300006237 | Bacteria | 3470 |
| 297 | Ga0097621_100115517 | 3300006237 | Bacteria | 2272 |
| 298 | Ga0097621_100612946 | 3300006237 | Bacteria | 996 |
| 299 | Ga0075370_10001150 | 3300006353 | Bacteria | 11110 |
| 300 | Ga0075370_10002824 | 3300006353 | Bacteria | 8149 |
| 301 | Ga0075370_10023630 | 3300006353 | Bacteria | 3387 |
| 302 | Ga0075370_10040903 | 3300006353 | Bacteria | 2616 |
| 303 | Ga0075370_10243310 | 3300006353 | Bacteria | 1065 |
| 304 | Ga0075370_10345440 | 3300006353 | Bacteria | 888 |
| 305 | Ga0075370_10432241 | 3300006353 | Bacteria | 791 |
| 306 | Ga0075370_10643447 | 3300006353 | Bacteria | 643 |
| 307 | Ga0068871_100019288 | 3300006358 | Bacteria | 5206 |
| 308 | Ga0068871_100337306 | 3300006358 | Bacteria | 1330 |
| 309 | Ga0068871_100609286 | 3300006358 | Bacteria | 994 |
| 310 | Ga0075430_100233239 | 3300006846 | Bacteria | 1526 |
| 311 | Ga0075429_100123917 | 3300006880 | Bacteria | 2259 |
| 312 | Ga0068865_100004060 | 3300006881 | Bacteria | 8794 |
| 313 | Ga0068865_100057885 | 3300006881 | Bacteria | 2705 |
| 314 | Ga0068865_100182643 | 3300006881 | Bacteria | 1616 |
| 315 | Ga0097620_100130185 | 3300006931 | Bacteria | 2587 |
| 316 | Ga0097620_100176599 | 3300006931 | Bacteria | 2218 |
| 317 | Ga0097620_100454839 | 3300006931 | Bacteria | 1376 |
| 318 | Ga0097620_100768879 | 3300006931 | Bacteria | 1052 |
| 319 | Ga0099823_1000064 | 3300006944 | Bacteria | 50328 |
| 320 | Ga0079104_1000053 | 3300006946 | Bacteria | 168604 |
| 321 | Ga0105240_10018079 | 3300009093 | Bacteria | 9478 |
| 322 | Ga0105240_10144746 | 3300009093 | Bacteria | 2837 |
| 323 | Ga0105240_11574043 | 3300009093 | Bacteria | 688 |
| 324 | Ga0111539_10581878 | 3300009094 | Bacteria | 1304 |
| 325 | Ga0111539_12836621 | 3300009094 | Bacteria | 561 |
| 326 | Ga0105245_10300472 | 3300009098 | Bacteria | 1575 |
| 327 | Ga0105245_10412159 | 3300009098 | Bacteria | 1353 |
| 328 | Ga0105245_10531521 | 3300009098 | Bacteria | 1196 |
| 329 | Ga0105245_11103815 | 3300009098 | Bacteria | 840 |
| 330 | Ga0105245_11338826 | 3300009098 | Bacteria | 765 |
| 331 | Ga0105247_10612908 | 3300009101 | Bacteria | 809 |
| 332 | Ga0114129_10176739 | 3300009147 | Bacteria | 2908 |
| 333 | Ga0105243_10001789 | 3300009148 | Bacteria | 18454 |
| 334 | Ga0105243_10230579 | 3300009148 | Bacteria | 1643 |
| 335 | Ga0105243_10381139 | 3300009148 | Bacteria | 1304 |
| 336 | Ga0105241_10082907 | 3300009174 | Bacteria | 2514 |
| 337 | Ga0105242_10114272 | 3300009176 | Bacteria | 2306 |
| 338 | Ga0105242_10778232 | 3300009176 | Bacteria | 945 |
| 339 | Ga0105248_10006768 | 3300009177 | Bacteria | 12569 |
| 340 | Ga0105248_10028458 | 3300009177 | Bacteria | 6225 |
| 341 | Ga0105248_10325115 | 3300009177 | Bacteria | 1732 |
| 342 | Ga0105248_10531205 | 3300009177 | Bacteria | 1327 |
| 343 | Ga0105248_11033484 | 3300009177 | Bacteria | 928 |
| 344 | Ga0105248_11063951 | 3300009177 | Bacteria | 914 |
| 345 | Ga0105248_11291431 | 3300009177 | Bacteria | 825 |
| 346 | Ga0105248_12109404 | 3300009177 | Bacteria | 641 |
| 347 | Ga0105237_10000668 | 3300009545 | Bacteria | 47303 |
| 348 | Ga0105237_10020609 | 3300009545 | Bacteria | 6794 |
| 349 | Ga0105237_10393453 | 3300009545 | Bacteria | 1391 |
| 350 | Ga0105237_11251531 | 3300009545 | Bacteria | 748 |
| 351 | Ga0105238_10003926 | 3300009551 | Bacteria | 14752 |
| 352 | Ga0105238_10064333 | 3300009551 | Bacteria | 3668 |
| 353 | Ga0105238_10956536 | 3300009551 | Bacteria | 876 |
| 354 | Ga0105238_12712190 | 3300009551 | Bacteria | 532 |
| 355 | Ga0105249_10300940 | 3300009553 | Bacteria | 1609 |
| 356 | Ga0105249_10309743 | 3300009553 | Bacteria | 1587 |
| 357 | Ga0105249_10567220 | 3300009553 | Bacteria | 1187 |
| 358 | Ga0105249_10629006 | 3300009553 | Bacteria | 1130 |
| 359 | Ga0105239_10001255 | 3300010375 | Bacteria | 34466 |
| 360 | Ga0105239_10444502 | 3300010375 | Bacteria | 1470 |
| 361 | Ga0105239_11064166 | 3300010375 | Bacteria | 931 |
| 362 | Ga0105246_10310875 | 3300011119 | Bacteria | 1276 |
| 363 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 364 | Ga0157326_1009237 | 3300012513 | Bacteria | 1083 |
| 365 | Ga0157373_10040286 | 3300013100 | Bacteria | 3343 |
| 366 | Ga0157371_10096460 | 3300013102 | Bacteria | 2095 |
| 367 | Ga0157370_11295331 | 3300013104 | Bacteria | 657 |
| 368 | Ga0157369_10115967 | 3300013105 | Bacteria | 2844 |
| 369 | Ga0157369_10254222 | 3300013105 | Bacteria | 1833 |
| 370 | Ga0157369_10753158 | 3300013105 | Bacteria | 1002 |
| 371 | Ga0157374_10009298 | 3300013296 | Bacteria | 8429 |
| 372 | Ga0157374_10093529 | 3300013296 | Bacteria | 2871 |
| 373 | Ga0157374_10156204 | 3300013296 | Bacteria | 2220 |
| 374 | Ga0157374_10261841 | 3300013296 | Bacteria | 1703 |
| 375 | Ga0157374_10375271 | 3300013296 | Bacteria | 1416 |
| 376 | Ga0157374_10383146 | 3300013296 | Bacteria | 1401 |
| 377 | Ga0157374_10766115 | 3300013296 | Bacteria | 980 |
| 378 | Ga0157378_10008661 | 3300013297 | Bacteria | 8856 |
| 379 | Ga0157378_10328899 | 3300013297 | Bacteria | 1487 |
| 380 | Ga0157378_10379246 | 3300013297 | Bacteria | 1388 |
| 381 | Ga0157378_10415154 | 3300013297 | Bacteria | 1329 |
| 382 | Ga0157378_10458589 | 3300013297 | Bacteria | 1266 |
| 383 | Ga0157378_10787609 | 3300013297 | Bacteria | 976 |
| 384 | Ga0163162_10004148 | 3300013306 | Bacteria | 13915 |
| 385 | Ga0163162_10241802 | 3300013306 | Bacteria | 1936 |
| 386 | Ga0163162_10424477 | 3300013306 | Bacteria | 1462 |
| 387 | Ga0157372_10023087 | 3300013307 | Bacteria | 6740 |
| 388 | Ga0157372_10500446 | 3300013307 | Bacteria | 1417 |
| 389 | Ga0157375_10041626 | 3300013308 | Bacteria | 4438 |
| 390 | Ga0157375_10151438 | 3300013308 | Bacteria | 2455 |
| 391 | Ga0157375_10239233 | 3300013308 | Bacteria | 1975 |
| 392 | Ga0157375_10296051 | 3300013308 | Bacteria | 1781 |
| 393 | Ga0157375_10390226 | 3300013308 | Bacteria | 1559 |
| 394 | Ga0157375_10411974 | 3300013308 | Bacteria | 1518 |
| 395 | Ga0157375_10694323 | 3300013308 | Bacteria | 1172 |
| 396 | Ga0157375_11035597 | 3300013308 | Bacteria | 959 |
| 397 | Ga0157375_11752266 | 3300013308 | Bacteria | 736 |
| 398 | Ga0157375_12669695 | 3300013308 | Bacteria | 597 |
| 399 | Ga0157380_10220443 | 3300014326 | Bacteria | 1697 |
| 400 | Ga0157380_10220567 | 3300014326 | Bacteria | 1696 |
| 401 | Ga0157380_10765256 | 3300014326 | Bacteria | 979 |
| 402 | Ga0157380_10865730 | 3300014326 | Bacteria | 927 |
| 403 | Ga0157380_10896934 | 3300014326 | Bacteria | 912 |
| 404 | Ga0157377_10000368 | 3300014745 | Bacteria | 20109 |
| 405 | Ga0157377_10426448 | 3300014745 | Bacteria | 910 |
| 406 | Ga0157379_10040412 | 3300014968 | Bacteria | 4162 |
| 407 | Ga0157379_10061342 | 3300014968 | Bacteria | 3362 |
| 408 | Ga0157379_10069525 | 3300014968 | Bacteria | 3149 |
| 409 | Ga0157379_10075171 | 3300014968 | Bacteria | 3025 |
| 410 | Ga0157379_10144632 | 3300014968 | Bacteria | 2144 |
| 411 | Ga0157379_10423030 | 3300014968 | Bacteria | 1227 |
| 412 | Ga0157376_10085443 | 3300014969 | Bacteria | 2719 |
| 413 | Ga0157376_10934967 | 3300014969 | Bacteria | 887 |
| 414 | Ga0157376_11159846 | 3300014969 | Bacteria | 800 |
| 415 | Ga0157376_11568433 | 3300014969 | Bacteria | 692 |
| 416 | Ga0182005_1057908 | 3300015265 | Bacteria | 1057 |
| 417 | Ga0163161_10009049 | 3300017792 | Bacteria | 6888 |
| 418 | Ga0163161_10021239 | 3300017792 | Bacteria | 4564 |
| 419 | Ga0163161_10057420 | 3300017792 | Bacteria | 2828 |
| 420 | Ga0163161_10118069 | 3300017792 | Bacteria | 1990 |
| 421 | Ga0163161_10378130 | 3300017792 | Bacteria | 1131 |
| 422 | Ga0206352_11007505 | 3300020078 | Bacteria | 3567 |
| 423 | Ga0209672_106318 | 3300025228 | Bacteria | 1938 |
| 424 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 425 | Ga0209258_102113 | 3300025242 | Bacteria | 5574 |
| 426 | Ga0207425_1000680 | 3300025245 | Bacteria | 18554 |
| 427 | Ga0209148_1002904 | 3300025254 | Bacteria | 5228 |
| 428 | Ga0209759_1003759 | 3300025256 | Bacteria | 5926 |
| 429 | Ga0209759_1020002 | 3300025256 | Bacteria | 1568 |
| 430 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 431 | Ga0209129_1034916 | 3300025258 | Bacteria | 820 |
| 432 | Ga0207666_1002377 | 3300025271 | Bacteria | 2265 |
| 433 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 434 | Ga0209673_1004093 | 3300025273 | Bacteria | 8026 |
| 435 | Ga0209673_1024595 | 3300025273 | Bacteria | 2019 |
| 436 | Ga0209673_1032334 | 3300025273 | Bacteria | 1613 |
| 437 | Ga0209675_1038432 | 3300025291 | Bacteria | 1066 |
| 438 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 439 | Ga0209758_1000910 | 3300025297 | Bacteria | 40059 |
| 440 | Ga0209758_1011080 | 3300025297 | Bacteria | 5275 |
| 441 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 442 | Ga0209050_1001097 | 3300025298 | Bacteria | 32856 |
| 443 | Ga0209050_1004273 | 3300025298 | Bacteria | 9808 |
| 444 | Ga0209050_1013102 | 3300025298 | Bacteria | 3724 |
| 445 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 446 | Ga0209256_1008928 | 3300025299 | Bacteria | 4516 |
| 447 | Ga0209256_1009680 | 3300025299 | Bacteria | 4174 |
| 448 | Ga0209256_1051545 | 3300025299 | Bacteria | 992 |
| 449 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 450 | Ga0209051_1000938 | 3300025303 | Bacteria | 28786 |
| 451 | Ga0209051_1005321 | 3300025303 | Bacteria | 7574 |
| 452 | Ga0209051_1018074 | 3300025303 | Bacteria | 3132 |
| 453 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 454 | Ga0209257_1000315 | 3300025304 | Bacteria | 102293 |
| 455 | Ga0209257_1019529 | 3300025304 | Bacteria | 2547 |
| 456 | Ga0209257_1061640 | 3300025304 | Bacteria | 1017 |
| 457 | Ga0209257_1061925 | 3300025304 | Bacteria | 1014 |
| 458 | Ga0209257_1108456 | 3300025304 | Bacteria | 666 |
| 459 | Ga0207697_10029574 | 3300025315 | Bacteria | 2242 |
| 460 | Ga0207656_10020792 | 3300025321 | Bacteria | 2612 |
| 461 | Ga0207656_10143536 | 3300025321 | Bacteria | 1126 |
| 462 | Ga0207656_10148077 | 3300025321 | Bacteria | 1110 |
| 463 | Ga0207656_10184172 | 3300025321 | Bacteria | 1003 |
| 464 | Ga0207656_10300398 | 3300025321 | Bacteria | 795 |
| 465 | Ga0207682_10002147 | 3300025893 | Bacteria | 8941 |
| 466 | Ga0207682_10021887 | 3300025893 | Bacteria | 2516 |
| 467 | Ga0207682_10053083 | 3300025893 | Bacteria | 1680 |
| 468 | Ga0207682_10117103 | 3300025893 | Bacteria | 1178 |
| 469 | Ga0207642_10040268 | 3300025899 | Bacteria | 2037 |
| 470 | Ga0207642_10092854 | 3300025899 | Bacteria | 1495 |
| 471 | Ga0207642_10146240 | 3300025899 | Bacteria | 1252 |
| 472 | Ga0207688_10037622 | 3300025901 | Bacteria | 2684 |
| 473 | Ga0207688_10063302 | 3300025901 | Bacteria | 2086 |
| 474 | Ga0207688_10338749 | 3300025901 | Bacteria | 925 |
| 475 | Ga0207680_10014229 | 3300025903 | Bacteria | 4110 |
| 476 | Ga0207680_10183316 | 3300025903 | Bacteria | 1417 |
| 477 | Ga0207680_10187572 | 3300025903 | Bacteria | 1402 |
| 478 | Ga0207680_10276263 | 3300025903 | Bacteria | 1166 |
| 479 | Ga0207680_10373861 | 3300025903 | Bacteria | 1004 |
| 480 | Ga0207680_10487411 | 3300025903 | Bacteria | 877 |
| 481 | Ga0207645_10009972 | 3300025907 | Bacteria | 6544 |
| 482 | Ga0207645_10012543 | 3300025907 | Bacteria | 5748 |
| 483 | Ga0207645_10047232 | 3300025907 | Bacteria | 2749 |
| 484 | Ga0207645_10048474 | 3300025907 | Bacteria | 2713 |
| 485 | Ga0207645_10086402 | 3300025907 | Bacteria | 2015 |
| 486 | Ga0207645_10139657 | 3300025907 | Bacteria | 1578 |
| 487 | Ga0207645_10226543 | 3300025907 | Bacteria | 1233 |
| 488 | Ga0207645_10356540 | 3300025907 | Bacteria | 979 |
| 489 | Ga0207643_10146766 | 3300025908 | Bacteria | 1412 |
| 490 | Ga0207643_10340502 | 3300025908 | Bacteria | 940 |
| 491 | Ga0207705_10850984 | 3300025909 | Bacteria | 707 |
| 492 | Ga0207684_10124693 | 3300025910 | Bacteria | 2209 |
| 493 | Ga0207654_10056380 | 3300025911 | Bacteria | 2279 |
| 494 | Ga0207654_10187962 | 3300025911 | Bacteria | 1352 |
| 495 | Ga0207707_10231795 | 3300025912 | Bacteria | 1606 |
| 496 | Ga0207695_10010589 | 3300025913 | Bacteria | 11272 |
| 497 | Ga0207695_10190969 | 3300025913 | Bacteria | 1966 |
| 498 | Ga0207671_10019707 | 3300025914 | Bacteria | 5152 |
| 499 | Ga0207671_10036592 | 3300025914 | Bacteria | 3641 |
| 500 | Ga0207671_10571855 | 3300025914 | Bacteria | 901 |
| 501 | Ga0207660_10046145 | 3300025917 | Bacteria | 3073 |
| 502 | Ga0207662_10034330 | 3300025918 | Bacteria | 2960 |
| 503 | Ga0207662_10808995 | 3300025918 | Bacteria | 661 |
| 504 | Ga0207657_10092779 | 3300025919 | Bacteria | 2516 |
| 505 | Ga0207657_10350616 | 3300025919 | Bacteria | 1164 |
| 506 | Ga0207657_10566625 | 3300025919 | Bacteria | 887 |
| 507 | Ga0207657_10956381 | 3300025919 | Bacteria | 658 |
| 508 | Ga0207649_10001794 | 3300025920 | Bacteria | 12285 |
| 509 | Ga0207649_10004699 | 3300025920 | Bacteria | 7389 |
| 510 | Ga0207649_10137933 | 3300025920 | Bacteria | 1665 |
| 511 | Ga0207649_10240920 | 3300025920 | Bacteria | 1298 |
| 512 | Ga0207649_10384119 | 3300025920 | Bacteria | 1047 |
| 513 | Ga0207652_10002940 | 3300025921 | Bacteria | 14249 |
| 514 | Ga0207646_10033831 | 3300025922 | Bacteria | 4620 |
| 515 | Ga0207681_10005925 | 3300025923 | Bacteria | 7494 |
| 516 | Ga0207681_10021332 | 3300025923 | Bacteria | 4116 |
| 517 | Ga0207681_10083993 | 3300025923 | Bacteria | 2255 |
| 518 | Ga0207681_10111387 | 3300025923 | Bacteria | 1991 |
| 519 | Ga0207681_10139757 | 3300025923 | Bacteria | 1802 |
| 520 | Ga0207681_10593692 | 3300025923 | Bacteria | 914 |
| 521 | Ga0207681_11287919 | 3300025923 | Bacteria | 614 |
| 522 | Ga0207694_10004619 | 3300025924 | Bacteria | 10727 |
| 523 | Ga0207694_10034844 | 3300025924 | Bacteria | 3861 |
| 524 | Ga0207694_10310362 | 3300025924 | Bacteria | 1300 |
| 525 | Ga0207694_10735795 | 3300025924 | Bacteria | 832 |
| 526 | Ga0207650_10002454 | 3300025925 | Bacteria | 12900 |
| 527 | Ga0207650_10022053 | 3300025925 | Bacteria | 4507 |
| 528 | Ga0207650_10242099 | 3300025925 | Bacteria | 1458 |
| 529 | Ga0207650_10302708 | 3300025925 | Bacteria | 1306 |
| 530 | Ga0207650_10515056 | 3300025925 | Bacteria | 1001 |
| 531 | Ga0207650_10706362 | 3300025925 | Bacteria | 852 |
| 532 | Ga0207659_10003025 | 3300025926 | Bacteria | 10030 |
| 533 | Ga0207659_10056531 | 3300025926 | Bacteria | 2811 |
| 534 | Ga0207659_10072814 | 3300025926 | Bacteria | 2513 |
| 535 | Ga0207659_10229273 | 3300025926 | Bacteria | 1497 |
| 536 | Ga0207659_10338491 | 3300025926 | Bacteria | 1245 |
| 537 | Ga0207659_10381945 | 3300025926 | Bacteria | 1175 |
| 538 | Ga0207659_10454645 | 3300025926 | Bacteria | 1079 |
| 539 | Ga0207659_10617259 | 3300025926 | Bacteria | 925 |
| 540 | Ga0207659_11452594 | 3300025926 | Bacteria | 587 |
| 541 | Ga0207687_10108511 | 3300025927 | Bacteria | 2055 |
| 542 | Ga0207644_10015416 | 3300025931 | Bacteria | 5129 |
| 543 | Ga0207644_10024978 | 3300025931 | Bacteria | 4105 |
| 544 | Ga0207644_10027492 | 3300025931 | Bacteria | 3929 |
| 545 | Ga0207644_10184530 | 3300025931 | Bacteria | 1637 |
| 546 | Ga0207644_10246131 | 3300025931 | Bacteria | 1425 |
| 547 | Ga0207644_10256867 | 3300025931 | Bacteria | 1396 |
| 548 | Ga0207644_10692643 | 3300025931 | Bacteria | 849 |
| 549 | Ga0207644_10909750 | 3300025931 | Bacteria | 737 |
| 550 | Ga0207690_10001731 | 3300025932 | Bacteria | 13411 |
| 551 | Ga0207690_10039856 | 3300025932 | Bacteria | 3067 |
| 552 | Ga0207690_10056794 | 3300025932 | Bacteria | 2642 |
| 553 | Ga0207690_10475284 | 3300025932 | Bacteria | 1008 |
| 554 | Ga0207706_10079225 | 3300025933 | Bacteria | 2889 |
| 555 | Ga0207706_10116108 | 3300025933 | Bacteria | 2354 |
| 556 | Ga0207706_10150050 | 3300025933 | Bacteria | 2050 |
| 557 | Ga0207706_10247137 | 3300025933 | Bacteria | 1559 |
| 558 | Ga0207706_10265491 | 3300025933 | Bacteria | 1498 |
| 559 | Ga0207706_10274953 | 3300025933 | Bacteria | 1470 |
| 560 | Ga0207686_10048318 | 3300025934 | Bacteria | 2635 |
| 561 | Ga0207709_10001005 | 3300025935 | Bacteria | 20902 |
| 562 | Ga0207709_10020689 | 3300025935 | Bacteria | 3715 |
| 563 | Ga0207709_10092231 | 3300025935 | Bacteria | 1983 |
| 564 | Ga0207709_10146045 | 3300025935 | Bacteria | 1632 |
| 565 | Ga0207709_10457789 | 3300025935 | Bacteria | 987 |
| 566 | Ga0207709_10499485 | 3300025935 | Bacteria | 949 |
| 567 | Ga0207669_10027395 | 3300025937 | Bacteria | 3119 |
| 568 | Ga0207669_10115067 | 3300025937 | Bacteria | 1812 |
| 569 | Ga0207669_10124757 | 3300025937 | Bacteria | 1756 |
| 570 | Ga0207669_10149676 | 3300025937 | Bacteria | 1633 |
| 571 | Ga0207669_10192156 | 3300025937 | Bacteria | 1473 |
| 572 | Ga0207669_10810425 | 3300025937 | Bacteria | 777 |
| 573 | Ga0207704_10006606 | 3300025938 | Bacteria | 5426 |
| 574 | Ga0207704_10044043 | 3300025938 | Bacteria | 2640 |
| 575 | Ga0207704_10940374 | 3300025938 | Bacteria | 729 |
| 576 | Ga0207704_11165024 | 3300025938 | Bacteria | 656 |
| 577 | Ga0207665_10131977 | 3300025939 | Bacteria | 1774 |
| 578 | Ga0207691_10002550 | 3300025940 | Bacteria | 17799 |
| 579 | Ga0207691_10071477 | 3300025940 | Bacteria | 3131 |
| 580 | Ga0207691_10102749 | 3300025940 | Bacteria | 2549 |
| 581 | Ga0207691_10126451 | 3300025940 | Bacteria | 2261 |
| 582 | Ga0207691_10214431 | 3300025940 | Bacteria | 1671 |
| 583 | Ga0207691_10413729 | 3300025940 | Bacteria | 1149 |
| 584 | Ga0207691_10421854 | 3300025940 | Bacteria | 1137 |
| 585 | Ga0207691_10455132 | 3300025940 | Bacteria | 1089 |
| 586 | Ga0207711_10009785 | 3300025941 | Bacteria | 7972 |
| 587 | Ga0207711_10023140 | 3300025941 | Bacteria | 5200 |
| 588 | Ga0207711_10072285 | 3300025941 | Bacteria | 2996 |
| 589 | Ga0207711_10465174 | 3300025941 | Bacteria | 1178 |
| 590 | Ga0207711_10589696 | 3300025941 | Bacteria | 1037 |
| 591 | Ga0207711_10659613 | 3300025941 | Bacteria | 976 |
| 592 | Ga0207711_10763481 | 3300025941 | Bacteria | 901 |
| 593 | Ga0207711_11243660 | 3300025941 | Bacteria | 686 |
| 594 | Ga0207689_10015223 | 3300025942 | Bacteria | 6512 |
| 595 | Ga0207689_10033146 | 3300025942 | Bacteria | 4292 |
| 596 | Ga0207689_10038004 | 3300025942 | Bacteria | 3989 |
| 597 | Ga0207689_10117050 | 3300025942 | Bacteria | 2191 |
| 598 | Ga0207689_10348642 | 3300025942 | Bacteria | 1231 |
| 599 | Ga0207661_10026944 | 3300025944 | Bacteria | 4386 |
| 600 | Ga0207661_10710796 | 3300025944 | Bacteria | 924 |
| 601 | Ga0207679_10001498 | 3300025945 | Bacteria | 14638 |
| 602 | Ga0207679_10016048 | 3300025945 | Bacteria | 4965 |
| 603 | Ga0207679_10796798 | 3300025945 | Bacteria | 861 |
| 604 | Ga0207679_11154867 | 3300025945 | Bacteria | 711 |
| 605 | Ga0207667_10188077 | 3300025949 | Bacteria | 2119 |
| 606 | Ga0207651_10004839 | 3300025960 | Bacteria | 6859 |
| 607 | Ga0207651_10043195 | 3300025960 | Bacteria | 3006 |
| 608 | Ga0207651_10059456 | 3300025960 | Bacteria | 2648 |
| 609 | Ga0207651_10063480 | 3300025960 | Bacteria | 2579 |
| 610 | Ga0207651_10163749 | 3300025960 | Bacteria | 1746 |
| 611 | Ga0207651_10249829 | 3300025960 | Bacteria | 1450 |
| 612 | Ga0207651_10315833 | 3300025960 | Bacteria | 1304 |
| 613 | Ga0207651_10477293 | 3300025960 | Bacteria | 1074 |
| 614 | Ga0207651_10840667 | 3300025960 | Bacteria | 815 |
| 615 | Ga0207712_10040645 | 3300025961 | Bacteria | 3193 |
| 616 | Ga0207712_10063392 | 3300025961 | Bacteria | 2632 |
| 617 | Ga0207712_10129841 | 3300025961 | Bacteria | 1918 |
| 618 | Ga0207712_10258983 | 3300025961 | Bacteria | 1410 |
| 619 | Ga0207668_10008000 | 3300025972 | Bacteria | 6291 |
| 620 | Ga0207668_10211665 | 3300025972 | Bacteria | 1551 |
| 621 | Ga0207668_10283658 | 3300025972 | Bacteria | 1359 |
| 622 | Ga0207668_10374285 | 3300025972 | Bacteria | 1197 |
| 623 | Ga0207640_10014813 | 3300025981 | Bacteria | 4497 |
| 624 | Ga0207640_10130332 | 3300025981 | Bacteria | 1817 |
| 625 | Ga0207640_10146361 | 3300025981 | Bacteria | 1729 |
| 626 | Ga0207658_10002481 | 3300025986 | Bacteria | 13444 |
| 627 | Ga0207658_10019932 | 3300025986 | Bacteria | 4641 |
| 628 | Ga0207658_10186325 | 3300025986 | Bacteria | 1721 |
| 629 | Ga0207658_10204295 | 3300025986 | Bacteria | 1651 |
| 630 | Ga0207658_10253878 | 3300025986 | Bacteria | 1495 |
| 631 | Ga0207658_10308286 | 3300025986 | Bacteria | 1366 |
| 632 | Ga0207658_10515759 | 3300025986 | Bacteria | 1066 |
| 633 | Ga0207677_10158539 | 3300026023 | Bacteria | 1755 |
| 634 | Ga0207677_10222318 | 3300026023 | Bacteria | 1515 |
| 635 | Ga0207677_10493235 | 3300026023 | Bacteria | 1057 |
| 636 | Ga0207677_10652352 | 3300026023 | Bacteria | 929 |
| 637 | Ga0207677_10874039 | 3300026023 | Bacteria | 809 |
| 638 | Ga0207703_10002613 | 3300026035 | Bacteria | 15539 |
| 639 | Ga0207703_10027342 | 3300026035 | Bacteria | 4492 |
| 640 | Ga0207703_10030166 | 3300026035 | Bacteria | 4283 |
| 641 | Ga0207703_10139551 | 3300026035 | Bacteria | 2102 |
| 642 | Ga0207639_10244159 | 3300026041 | Bacteria | 1563 |
| 643 | Ga0207639_10376167 | 3300026041 | Bacteria | 1274 |
| 644 | Ga0207639_10407530 | 3300026041 | Bacteria | 1226 |
| 645 | Ga0207639_10601595 | 3300026041 | Bacteria | 1014 |
| 646 | Ga0207639_10718737 | 3300026041 | Bacteria | 927 |
| 647 | Ga0207678_10008286 | 3300026067 | Bacteria | 9159 |
| 648 | Ga0207678_10087396 | 3300026067 | Bacteria | 2664 |
| 649 | Ga0207678_10099481 | 3300026067 | Bacteria | 2484 |
| 650 | Ga0207678_11077997 | 3300026067 | Bacteria | 711 |
| 651 | Ga0207708_10168085 | 3300026075 | Bacteria | 1735 |
| 652 | Ga0207702_10004993 | 3300026078 | Bacteria | 11656 |
| 653 | Ga0207702_10150760 | 3300026078 | Bacteria | 2115 |
| 654 | Ga0207702_10415921 | 3300026078 | Bacteria | 1299 |
| 655 | Ga0207702_10429607 | 3300026078 | Bacteria | 1278 |
| 656 | Ga0207702_10655235 | 3300026078 | Bacteria | 1033 |
| 657 | Ga0207641_10028453 | 3300026088 | Bacteria | 4618 |
| 658 | Ga0207641_10346817 | 3300026088 | Bacteria | 1414 |
| 659 | Ga0207648_10002176 | 3300026089 | Bacteria | 21281 |
| 660 | Ga0207648_10005939 | 3300026089 | Bacteria | 12211 |
| 661 | Ga0207648_10015751 | 3300026089 | Bacteria | 6936 |
| 662 | Ga0207648_10017221 | 3300026089 | Bacteria | 6586 |
| 663 | Ga0207648_10084574 | 3300026089 | Bacteria | 2767 |
| 664 | Ga0207648_10087281 | 3300026089 | Bacteria | 2722 |
| 665 | Ga0207648_10159685 | 3300026089 | Bacteria | 1991 |
| 666 | Ga0207648_10173287 | 3300026089 | Bacteria | 1908 |
| 667 | Ga0207648_10735211 | 3300026089 | Bacteria | 916 |
| 668 | Ga0207676_10011142 | 3300026095 | Bacteria | 6420 |
| 669 | Ga0207676_10083692 | 3300026095 | Bacteria | 2599 |
| 670 | Ga0207676_10432909 | 3300026095 | Bacteria | 1236 |
| 671 | Ga0207676_10663401 | 3300026095 | Bacteria | 1007 |
| 672 | Ga0207676_11735979 | 3300026095 | Bacteria | 622 |
| 673 | Ga0207674_10123860 | 3300026116 | Bacteria | 2551 |
| 674 | Ga0207674_10171993 | 3300026116 | Bacteria | 2119 |
| 675 | Ga0207674_10380168 | 3300026116 | Bacteria | 1365 |
| 676 | Ga0207674_10441964 | 3300026116 | Bacteria | 1257 |
| 677 | Ga0207674_11239639 | 3300026116 | Bacteria | 715 |
| 678 | Ga0207674_11328406 | 3300026116 | Bacteria | 688 |
| 679 | Ga0207675_100006663 | 3300026118 | Bacteria | 10927 |
| 680 | Ga0207675_100039987 | 3300026118 | Bacteria | 4376 |
| 681 | Ga0207675_100255531 | 3300026118 | Bacteria | 1697 |
| 682 | Ga0207675_100373676 | 3300026118 | Bacteria | 1401 |
| 683 | Ga0207683_10005923 | 3300026121 | Bacteria | 10474 |
| 684 | Ga0207683_10119357 | 3300026121 | Bacteria | 2366 |
| 685 | Ga0207683_10124519 | 3300026121 | Bacteria | 2316 |
| 686 | Ga0207683_10276638 | 3300026121 | Bacteria | 1534 |
| 687 | Ga0207683_10379334 | 3300026121 | Bacteria | 1299 |
| 688 | Ga0207683_10677579 | 3300026121 | Bacteria | 956 |
| 689 | Ga0207683_10967815 | 3300026121 | Bacteria | 790 |
| 690 | Ga0207683_11336775 | 3300026121 | Bacteria | 663 |
| 691 | Ga0207698_10017410 | 3300026142 | Bacteria | 4874 |
| 692 | Ga0207698_10137421 | 3300026142 | Bacteria | 2099 |
| 693 | Ga0207698_10171946 | 3300026142 | Bacteria | 1909 |
| 694 | Ga0207698_10224392 | 3300026142 | Bacteria | 1701 |
| 695 | Ga0207698_10232611 | 3300026142 | Bacteria | 1674 |
| 696 | Ga0207698_10278355 | 3300026142 | Bacteria | 1546 |
| 697 | Ga0207698_10582075 | 3300026142 | Bacteria | 1101 |
| 698 | Ga0207698_10912475 | 3300026142 | Bacteria | 886 |
| 699 | Ga0209281_1000147 | 3300027111 | Bacteria | 168586 |
| 700 | Ga0209389_1000305 | 3300027296 | Bacteria | 30534 |
| 701 | Ga0209371_1008392 | 3300027312 | Bacteria | 3443 |
| 702 | Ga0209981_1003413 | 3300027378 | Bacteria | 2063 |
| 703 | Ga0209996_1000729 | 3300027395 | Bacteria | 3938 |
| 704 | Ga0209995_1000242 | 3300027471 | Bacteria | 8706 |
| 705 | Ga0209968_1000130 | 3300027526 | Bacteria | 13315 |
| 706 | Ga0209970_1026685 | 3300027614 | Bacteria | 993 |
| 707 | Ga0209971_1072576 | 3300027682 | Bacteria | 836 |
| 708 | Ga0209966_1000117 | 3300027695 | Bacteria | 35145 |
| 709 | Ga0209998_10002530 | 3300027717 | Bacteria | 4163 |
| 710 | Ga0209813_10018964 | 3300027866 | Bacteria | 1907 |
| 711 | Ga0209813_10215862 | 3300027866 | Bacteria | 716 |
| 712 | Ga0209974_10000149 | 3300027876 | Bacteria | 21195 |
| 713 | Ga0207428_10650266 | 3300027907 | Bacteria | 757 |
| 714 | Ga0268265_10029280 | 3300028380 | Bacteria | 3951 |
| 715 | Ga0268265_10186906 | 3300028380 | Bacteria | 1785 |
| 716 | Ga0268265_10241678 | 3300028380 | Bacteria | 1594 |
| 717 | Ga0268264_10002070 | 3300028381 | Bacteria | 17906 |
| 718 | Ga0268264_10002318 | 3300028381 | Bacteria | 16843 |
| 719 | Ga0268264_10053634 | 3300028381 | Bacteria | 3364 |
| 720 | Ga0268264_10057251 | 3300028381 | Bacteria | 3260 |
| 721 | Ga0268264_10324135 | 3300028381 | Bacteria | 1458 |
| 722 | Ga0265334_10119748 | 3300028573 | Bacteria | 941 |
| 723 | Ga0265336_10000028 | 3300028666 | Bacteria | 179201 |
| 724 | Ga0307517_10014561 | 3300028786 | Bacteria | 10553 |
| 725 | Ga0307517_10110559 | 3300028786 | Bacteria | 2094 |
| 726 | Ga0307517_10314484 | 3300028786 | Bacteria | 870 |
| 727 | Ga0307517_10447661 | 3300028786 | Bacteria | 670 |
| 728 | Ga0307517_10475582 | 3300028786 | Bacteria | 641 |
| 729 | Ga0307515_10000096 | 3300028794 | Bacteria | 206366 |
| 730 | Ga0307515_10012540 | 3300028794 | Bacteria | 15942 |
| 731 | Ga0307515_10021273 | 3300028794 | Bacteria | 11511 |
| 732 | Ga0307515_10053115 | 3300028794 | Bacteria | 5987 |
| 733 | Ga0307515_10095676 | 3300028794 | Bacteria | 3652 |
| 734 | Ga0307515_10108460 | 3300028794 | Bacteria | 3271 |
| 735 | Ga0307515_10124094 | 3300028794 | Bacteria | 2899 |
| 736 | Ga0307515_10186828 | 3300028794 | Bacteria | 1998 |
| 737 | Ga0307515_10314400 | 3300028794 | Bacteria | 1238 |
| 738 | Ga0307515_10489385 | 3300028794 | Bacteria | 841 |
| 739 | Ga0265324_10000286 | 3300029957 | Bacteria | 37420 |
| 740 | Ga0265324_10017152 | 3300029957 | Bacteria | 2635 |
| 741 | Ga0268256_1008739 | 3300030500 | Bacteria | 3443 |
| 742 | Ga0307512_10045873 | 3300030522 | Bacteria | 3571 |
| 743 | Ga0307512_10091067 | 3300030522 | Bacteria | 2123 |
| 744 | Ga0265766_1000558 | 3300030863 | Bacteria | 1656 |
| 745 | Ga0265769_100669 | 3300030888 | Bacteria | 1460 |
| 746 | Ga0265328_10046852 | 3300031239 | Bacteria | 1589 |
| 747 | Ga0265331_10028635 | 3300031250 | Bacteria | 2784 |
| 748 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 749 | Ga0265316_10000201 | 3300031344 | Bacteria | 69415 |
| 750 | Ga0307513_10004080 | 3300031456 | Bacteria | 19563 |
| 751 | Ga0307513_10019109 | 3300031456 | Bacteria | 8167 |
| 752 | Ga0307513_10034953 | 3300031456 | Bacteria | 5631 |
| 753 | Ga0307513_10063852 | 3300031456 | Bacteria | 3884 |
| 754 | Ga0307513_10299705 | 3300031456 | Bacteria | 1375 |
| 755 | Ga0307513_10461469 | 3300031456 | Bacteria | 993 |
| 756 | Ga0307513_10613605 | 3300031456 | Bacteria | 796 |
| 757 | Ga0307509_10111735 | 3300031507 | Bacteria | 2734 |
| 758 | Ga0307509_10147814 | 3300031507 | Bacteria | 2271 |
| 759 | Ga0307509_10422082 | 3300031507 | Bacteria | 1034 |
| 760 | Ga0307509_10538122 | 3300031507 | Bacteria | 847 |
| 761 | Ga0307408_100000089 | 3300031548 | Bacteria | 100712 |
| 762 | Ga0307408_100013705 | 3300031548 | Bacteria | 5383 |
| 763 | Ga0307408_100041917 | 3300031548 | Bacteria | 3248 |
| 764 | Ga0307408_100255715 | 3300031548 | Bacteria | 1447 |
| 765 | Ga0307408_100299160 | 3300031548 | Bacteria | 1347 |
| 766 | Ga0307408_100345201 | 3300031548 | Bacteria | 1261 |
| 767 | Ga0307508_10000392 | 3300031616 | Bacteria | 52650 |
| 768 | Ga0307508_10103635 | 3300031616 | Bacteria | 2441 |
| 769 | Ga0307508_10335419 | 3300031616 | Bacteria | 1103 |
| 770 | Ga0307508_10529775 | 3300031616 | Bacteria | 775 |
| 771 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 772 | Ga0307514_10034392 | 3300031649 | Bacteria | 4039 |
| 773 | Ga0307514_10181649 | 3300031649 | Bacteria | 1355 |
| 774 | Ga0307516_10011689 | 3300031730 | Bacteria | 9527 |
| 775 | Ga0307516_10019197 | 3300031730 | Bacteria | 7085 |
| 776 | Ga0307516_10026535 | 3300031730 | Bacteria | 5881 |
| 777 | Ga0307516_10027941 | 3300031730 | Bacteria | 5714 |
| 778 | Ga0307516_10357568 | 3300031730 | Bacteria | 1125 |
| 779 | Ga0307516_10435876 | 3300031730 | Bacteria | 967 |
| 780 | Ga0307405_10012091 | 3300031731 | Bacteria | 4554 |
| 781 | Ga0307405_10046436 | 3300031731 | Bacteria | 2668 |
| 782 | Ga0307405_10089073 | 3300031731 | Bacteria | 2038 |
| 783 | Ga0307405_10114216 | 3300031731 | Bacteria | 1835 |
| 784 | Ga0307405_10423167 | 3300031731 | Bacteria | 1049 |
| 785 | Ga0307405_10425456 | 3300031731 | Bacteria | 1046 |
| 786 | Ga0307405_10997327 | 3300031731 | Bacteria | 714 |
| 787 | Ga0307413_10032313 | 3300031824 | Bacteria | 2965 |
| 788 | Ga0307413_10400822 | 3300031824 | Bacteria | 1075 |
| 789 | Ga0307410_10063849 | 3300031852 | Bacteria | 2528 |
| 790 | Ga0307410_10073323 | 3300031852 | Bacteria | 2380 |
| 791 | Ga0307410_10140307 | 3300031852 | Bacteria | 1787 |
| 792 | Ga0307410_10351464 | 3300031852 | Bacteria | 1178 |
| 793 | Ga0307410_10480325 | 3300031852 | Bacteria | 1019 |
| 794 | Ga0307410_10516423 | 3300031852 | Bacteria | 985 |
| 795 | Ga0307406_10004866 | 3300031901 | Bacteria | 7314 |
| 796 | Ga0307406_10163268 | 3300031901 | Bacteria | 1604 |
| 797 | Ga0307406_10919022 | 3300031901 | Bacteria | 746 |
| 798 | Ga0307406_10926733 | 3300031901 | Bacteria | 743 |
| 799 | Ga0307407_10061462 | 3300031903 | Bacteria | 2196 |
| 800 | Ga0307407_10150436 | 3300031903 | Bacteria | 1512 |
| 801 | Ga0307407_10168478 | 3300031903 | Bacteria | 1440 |
| 802 | Ga0307412_10011559 | 3300031911 | Bacteria | 5119 |
| 803 | Ga0307412_10074922 | 3300031911 | Bacteria | 2320 |
| 804 | Ga0307412_10263875 | 3300031911 | Bacteria | 1344 |
| 805 | Ga0307412_10288983 | 3300031911 | Bacteria | 1291 |
| 806 | Ga0307412_10475873 | 3300031911 | Bacteria | 1035 |
| 807 | Ga0307412_10705923 | 3300031911 | Bacteria | 866 |
| 808 | Ga0307409_100000577 | 3300031995 | Bacteria | 15970 |
| 809 | Ga0307409_100077436 | 3300031995 | Bacteria | 2671 |
| 810 | Ga0307409_100330064 | 3300031995 | Bacteria | 1431 |
| 811 | Ga0307409_100676297 | 3300031995 | Bacteria | 1029 |
| 812 | Ga0307416_100028404 | 3300032002 | Bacteria | 4159 |
| 813 | Ga0307416_100043561 | 3300032002 | Bacteria | 3515 |
| 814 | Ga0307416_100231430 | 3300032002 | Bacteria | 1782 |
| 815 | Ga0307416_102038128 | 3300032002 | Bacteria | 676 |
| 816 | Ga0307414_10315494 | 3300032004 | Bacteria | 1328 |
| 817 | Ga0307414_10482787 | 3300032004 | Bacteria | 1093 |
| 818 | Ga0307414_10614971 | 3300032004 | Bacteria | 976 |
| 819 | Ga0307414_11034159 | 3300032004 | Bacteria | 757 |
| 820 | Ga0307414_11529907 | 3300032004 | Bacteria | 621 |
| 821 | Ga0307411_10000085 | 3300032005 | Bacteria | 28904 |
| 822 | Ga0307411_10059434 | 3300032005 | Bacteria | 2534 |
| 823 | Ga0307411_10249959 | 3300032005 | Bacteria | 1393 |
| 824 | Ga0307411_10330148 | 3300032005 | Bacteria | 1235 |
| 825 | Ga0307411_10372291 | 3300032005 | Bacteria | 1172 |
| 826 | Ga0307411_10417309 | 3300032005 | Bacteria | 1114 |
| 827 | Ga0307411_11428424 | 3300032005 | Bacteria | 634 |
| 828 | Ga0307415_100034663 | 3300032126 | Bacteria | 3289 |
| 829 | Ga0307415_100039097 | 3300032126 | Bacteria | 3132 |
| 830 | Ga0307415_101345605 | 3300032126 | Bacteria | 678 |
| 831 | Ga0307507_10308226 | 3300033179 | Bacteria | 964 |
| 832 | Ga0307507_10375329 | 3300033179 | Bacteria | 822 |
| 833 | Ga0307510_10053339 | 3300033180 | Bacteria | 4251 |
| 834 | Ga0307510_10168701 | 3300033180 | Bacteria | 1771 |
| 835 | Ga0307510_10262217 | 3300033180 | Bacteria | 1209 |
| 836 | Ga0307510_10511068 | 3300033180 | Bacteria | 644 |
| 837 | Ga0373948_0007447 | 3300034817 | Bacteria | 1841 |
| 838 | Ga0373950_0010768 | 3300034818 | Bacteria | 1484 |
| 839 | Ga0373950_0061099 | 3300034818 | Bacteria | 757 |
| 840 | Ga0373938_0017777 | 3300034957 | Bacteria | 1403 |
| 841 | Ga0373929_0047280 | 3300035085 | Bacteria | 974 |
| 842 | Ga0373940_0013603 | 3300035088 | Bacteria | 1973 |
| 843 | Ga0373944_0037967 | 3300035089 | Bacteria | 1478 |
| 844 | Ga0373949_0102832 | 3300035090 | Bacteria | 785 |
| 845 | Ga0373952_0009457 | 3300035092 | Bacteria | 1867 |
| 846 | Ga0373923_0045641 | 3300035111 | Bacteria | 1820 |
| 847 | Ga0373932_0032954 | 3300035112 | Bacteria | 1452 |
| 848 | Ga0373939_0000348 | 3300035114 | Bacteria | 11798 |
| 849 | Ga0373939_0042737 | 3300035114 | Bacteria | 1372 |
| 850 | Ga0373939_0091802 | 3300035114 | Bacteria | 1027 |
| 851 | Ga0373941_0041755 | 3300035115 | Bacteria | 1421 |
| 852 | Ga0373960_0000482 | 3300035121 | Bacteria | 7922 |
| 853 | Ga0373943_0291532 | 3300035170 | Bacteria | 925 |
| 854 | Ga0373943_0633540 | 3300035170 | Bacteria | 631 |
| 855 | Ga0373946_0150156 | 3300035171 | Bacteria | 1086 |
| 856 | Ga0373946_0225040 | 3300035171 | Bacteria | 907 |
| 857 | Ga0373955_0081524 | 3300035172 | Bacteria | 1829 |
| 858 | Ga0373955_0325970 | 3300035172 | Bacteria | 928 |
| 859 | Ga0373942_0048831 | 3300035207 | Bacteria | 1180 |
| 860 | Ga0373942_0119221 | 3300035207 | Bacteria | 823 |
| 861 | Ga0373962_0023573 | 3300035242 | Bacteria | 1640 |
| 862 | Ga0373962_0036659 | 3300035242 | Bacteria | 1366 |
| 863 | Ga0373924_0230272 | 3300035410 | Bacteria | 819 |
| 864 | Ga0373931_0000535 | 3300035691 | Bacteria | 15604 |
| 865 | Ga0373931_0001474 | 3300035691 | Bacteria | 10131 |
| 866 | Ga0373931_0008660 | 3300035691 | Bacteria | 4836 |
| 867 | Ga0373931_0022499 | 3300035691 | Bacteria | 3173 |
| 868 | Ga0373931_0226087 | 3300035691 | Bacteria | 1129 |
| 869 | Ga0373931_0244172 | 3300035691 | Bacteria | 1090 |
| 870 | Ga0373935_0144534 | 3300035692 | Bacteria | 1609 |
| 871 | Ga0373927_0108327 | 3300035695 | Bacteria | 1810 |
| 872 | Ga0373927_0167679 | 3300035695 | Bacteria | 1439 |
| 873 | Ga0373927_0264990 | 3300035695 | Bacteria | 1130 |
| 874 | Ga0373933_0068855 | 3300035724 | Bacteria | 2150 |
| 875 | Ga0373947_0114560 | 3300035725 | Bacteria | 1707 |
| 876 | Ga0373937_0072024 | 3300036401 | Bacteria | 3187 |
| 877 | Ga0373937_0458717 | 3300036401 | Bacteria | 1210 |
| 878 | Ga0373925_0226591 | 3300037068 | Bacteria | 1493 |
| 879 | Ga0395899_0100034 | 3300037312 | Bacteria | 2094 |
| 880 | Ga0395905_0002507 | 3300037471 | Bacteria | 20284 |
| 881 | Ga0395905_0013480 | 3300037471 | Bacteria | 7832 |
| 882 | Ga0395905_0023115 | 3300037471 | Bacteria | 5877 |
| 883 | Ga0395905_0024456 | 3300037471 | Bacteria | 5700 |
| 884 | Ga0395905_0038305 | 3300037471 | Bacteria | 4498 |
| 885 | Ga0395905_0272105 | 3300037471 | Bacteria | 1580 |
| 886 | Ga0395905_0959727 | 3300037471 | Bacteria | 758 |
| 887 | Ga0436364_1085432 | 3300037853 | Bacteria | 707 |
| 888 | Ga0436365_0827710 | 3300039437 | Bacteria | 778 |
| 889 | Ga0436365_1357722 | 3300039437 | Bacteria | 3127 |
| 890 | Ga0436361_0405071 | 3300039447 | Bacteria | 13061 |
| 891 | Ga0436361_0570086 | 3300039447 | Bacteria | 6186 |
| 892 | Ga0436361_0714431 | 3300039447 | Bacteria | 79592 |
| 893 | Ga0439465_0010171 | 3300041413 | Bacteria | 2956 |
| 894 | Ga0451789_0781745 | 3300041443 | Bacteria | 1292 |
| 895 | Ga0451790_23378 | 3300041444 | Bacteria | 1442 |
| 896 | Ga0451794_49191 | 3300041446 | Bacteria | 744 |
| 897 | Ga0451793_0637995 | 3300041452 | Bacteria | 1739 |
| 898 | Ga0451793_1712280 | 3300041452 | Bacteria | 819 |
| 899 | Ga0451797_1076999 | 3300041453 | Bacteria | 986 |
| 900 | Ga0451795_0329779 | 3300041456 | Bacteria | 758 |
| 901 | Ga0451795_0389599 | 3300041456 | Bacteria | 1427 |
| 902 | Ga0451798_0083945 | 3300041458 | Bacteria | 1744 |
| 903 | Ga0451798_0656124 | 3300041458 | Bacteria | 1531 |
| 904 | Ga0451800_0747462 | 3300041459 | Bacteria | 962 |
| 905 | Ga0451800_1167133 | 3300041459 | Bacteria | 975 |
| 906 | Ga0451800_1232355 | 3300041459 | Bacteria | 2467 |
| 907 | Ga0451802_1098612 | 3300041460 | Bacteria | 1461 |
| 908 | Ga0451802_1810119 | 3300041460 | Bacteria | 1370 |
| 909 | Ga0451805_010137 | 3300041461 | Bacteria | 1322 |
| 910 | Ga0451805_034079 | 3300041461 | Bacteria | 3003 |
| 911 | Ga0451804_0962788 | 3300041463 | Bacteria | 984 |
| 912 | Ga0451807_1114302 | 3300041486 | Bacteria | 738 |
| 913 | Ga0451835_0381887 | 3300041492 | Bacteria | 734 |
| 914 | Ga0451839_0941153 | 3300041496 | Bacteria | 997 |
| 915 | Ga0451839_1495449 | 3300041496 | Bacteria | 1324 |
| 916 | Ga0451849_0242308 | 3300041505 | Bacteria | 747 |
| 917 | Ga0451850_38052 | 3300041506 | Bacteria | 1183 |
| 918 | Ga0451851_1360765 | 3300041507 | Bacteria | 920 |
| 919 | Ga0451843_0687955 | 3300041509 | Bacteria | 1690 |
| 920 | Ga0451843_1071877 | 3300041509 | Bacteria | 631 |
| 921 | Ga0451855_0043459 | 3300041511 | Bacteria | 1949 |
| 922 | Ga0451855_0262815 | 3300041511 | Bacteria | 1037 |
| 923 | Ga0451853_1066481 | 3300041512 | Bacteria | 2648 |
| 924 | Ga0451853_3108740 | 3300041512 | Bacteria | 917 |
| 925 | Ga0439431_0002412 | 3300041997 | Bacteria | 4137 |
| 926 | Ga0439448_0042059 | 3300042005 | Bacteria | 1481 |
| 927 | Ga0439450_082887 | 3300042008 | Bacteria | 799 |
| 928 | Ga0439455_0002630 | 3300042012 | Bacteria | 3302 |
| 929 | Ga0439455_0037486 | 3300042012 | Bacteria | 1230 |
| 930 | Ga0439455_0097345 | 3300042012 | Bacteria | 810 |
| 931 | Ga0450917_000001 | 3300042120 | Bacteria | 12228 |
| 932 | Ga0450919_000025 | 3300042121 | Bacteria | 12249 |
| 933 | Ga0450922_012581 | 3300042124 | Bacteria | 822 |
| 934 | Ga0450888_000936 | 3300042126 | Bacteria | 2776 |
| 935 | Ga0450888_024474 | 3300042126 | Bacteria | 785 |
| 936 | Ga0450890_000549 | 3300042127 | Bacteria | 5493 |
| 937 | Ga0450890_000550 | 3300042127 | Bacteria | 5489 |
| 938 | Ga0450897_024059 | 3300042128 | Bacteria | 666 |
| 939 | Ga0450891_000262 | 3300042129 | Bacteria | 5316 |
| 940 | Ga0450892_001360 | 3300042130 | Bacteria | 2438 |
| 941 | Ga0450895_001799 | 3300042132 | Bacteria | 1535 |
| 942 | Ga0450898_024700 | 3300042134 | Bacteria | 1075 |
| 943 | Ga0450899_002878 | 3300042135 | Bacteria | 1862 |
| 944 | Ga0450902_009473 | 3300042137 | Bacteria | 1533 |
| 945 | Ga0450903_004499 | 3300042138 | Bacteria | 2377 |
| 946 | Ga0450904_002939 | 3300042139 | Bacteria | 1920 |
| 947 | Ga0450889_000161 | 3300042144 | Bacteria | 6993 |
| 948 | Ga0450910_028757 | 3300042147 | Bacteria | 866 |
| 949 | Ga0439446_0028867 | 3300042156 | Bacteria | 1599 |
| 950 | Ga0439446_0055533 | 3300042156 | Bacteria | 1189 |
| 951 | Ga0439446_0094388 | 3300042156 | Bacteria | 940 |
| 952 | Ga0439446_0097753 | 3300042156 | Bacteria | 925 |
| 953 | Ga0439458_0032711 | 3300042157 | Bacteria | 1244 |
| 954 | Ga0439458_0069996 | 3300042157 | Bacteria | 885 |
| 955 | Ga0439434_0007708 | 3300042435 | Bacteria | 3155 |
| 956 | Ga0439434_0015184 | 3300042435 | Bacteria | 2296 |
| 957 | Ga0439434_0177712 | 3300042435 | Bacteria | 712 |
| 958 | Ga0439459_0000309 | 3300042438 | Bacteria | 5891 |
| 959 | Ga0439464_0057110 | 3300042439 | Bacteria | 1138 |
| 960 | Ga0439460_0002749 | 3300042461 | Bacteria | 4235 |
| 961 | Ga0450918_000123 | 3300042531 | Bacteria | 16624 |
| 962 | Ga0450893_0002428 | 3300042532 | Bacteria | 2901 |
| 963 | Ga0451577_0004247 | 3300042876 | Bacteria | 15249 |
| 964 | Ga0451577_0004524 | 3300042876 | Bacteria | 14637 |
| 965 | Ga0451577_0069675 | 3300042876 | Bacteria | 3136 |
| 966 | Ga0451577_0090029 | 3300042876 | Bacteria | 2738 |
| 967 | Ga0439440_0072256 | 3300042993 | Bacteria | 900 |
| 968 | Ga0466969_0000018 | 3300044656 | Bacteria | 102911 |
| 969 | Ga0466969_0002589 | 3300044656 | Bacteria | 9661 |
| 970 | Ga0466969_0012551 | 3300044656 | Bacteria | 4465 |
| 971 | Ga0466972_0026175 | 3300044658 | Bacteria | 2890 |
| 972 | Ga0453683_0310561 | 3300044673 | Bacteria | 1009 |
| 973 | Ga0466965_0008031 | 3300044683 | Bacteria | 4871 |
| 974 | Ga0466965_0018301 | 3300044683 | Bacteria | 3357 |
| 975 | Ga0466965_0125518 | 3300044683 | Bacteria | 1327 |
| 976 | Ga0466966_0009766 | 3300044684 | Bacteria | 6359 |
| 977 | Ga0466966_0021693 | 3300044684 | Bacteria | 4215 |
| 978 | Ga0466961_0005561 | 3300044693 | Bacteria | 7954 |
| 979 | Ga0466961_0026432 | 3300044693 | Bacteria | 3731 |
| 980 | Ga0466963_0028896 | 3300044694 | Bacteria | 3564 |
| 981 | Ga0466963_0537847 | 3300044694 | Bacteria | 825 |
| 982 | Ga0466964_0000637 | 3300044706 | Bacteria | 11177 |
| 983 | Ga0466964_0003200 | 3300044706 | Bacteria | 5954 |
| 984 | Ga0453684_0000516 | 3300044712 | Bacteria | 147788 |
| 985 | Ga0453684_0040166 | 3300044712 | Bacteria | 6361 |
| 986 | Ga0453684_0261576 | 3300044712 | Bacteria | 1981 |
| 987 | Ga0453684_0328109 | 3300044712 | Bacteria | 1731 |
| 988 | Ga0453684_0472317 | 3300044712 | Bacteria | 1393 |
| 989 | Ga0453684_0941811 | 3300044712 | Bacteria | 922 |
| 990 | Ga0453684_1311760 | 3300044712 | Bacteria | 755 |
| 991 | Ga0453684_1631963 | 3300044712 | Bacteria | 661 |
| 992 | Ga0466971_0001482 | 3300044719 | Bacteria | 9910 |
| 993 | Ga0466968_0012515 | 3300044735 | Bacteria | 3324 |
| 994 | Ga0466970_0025081 | 3300044765 | Bacteria | 3120 |
| 995 | Ga0466970_0030706 | 3300044765 | Bacteria | 2834 |
| 996 | Ga0466970_0164426 | 3300044765 | Bacteria | 1228 |
| 997 | Ga0466970_0180749 | 3300044765 | Bacteria | 1170 |
| 998 | Ga0466957_0006128 | 3300044842 | Bacteria | 6786 |
| 999 | Ga0466957_0167035 | 3300044842 | Bacteria | 1431 |
| 1000 | Ga0466960_0076355 | 3300044901 | Bacteria | 1678 |
| 1001 | Ga0466959_0000855 | 3300045049 | Bacteria | 17985 |
| 1002 | Ga0466959_0014533 | 3300045049 | Bacteria | 5725 |
| 1003 | Ga0451576_0003595 | 3300045051 | Bacteria | 21077 |
| 1004 | Ga0451576_0075129 | 3300045051 | Bacteria | 3516 |
| 1005 | Ga0451576_0106671 | 3300045051 | Bacteria | 2915 |
| 1006 | Ga0451576_0168870 | 3300045051 | Bacteria | 2283 |
| 1007 | Ga0451576_0224308 | 3300045051 | Bacteria | 1962 |
| 1008 | Ga0451576_0815101 | 3300045051 | Bacteria | 980 |
| 1009 | Ga0451576_0955282 | 3300045051 | Bacteria | 899 |
| 1010 | Ga0466958_0002207 | 3300045836 | Bacteria | 9697 |
| 1011 | Ga0466958_0022101 | 3300045836 | Bacteria | 3722 |
| 1012 | Ga0466967_0003037 | 3300045976 | Bacteria | 10770 |
| 1013 | Ga0466967_0397643 | 3300045976 | Bacteria | 1340 |
| 1014 | Ga0495592_0000203 | 3300046454 | Bacteria | 50733 |
| 1015 | Ga0495592_0114305 | 3300046454 | Bacteria | 1907 |
| 1016 | Ga0495590_0004188 | 3300046457 | Bacteria | 5838 |
| 1017 | Ga0495590_0011864 | 3300046457 | Bacteria | 3248 |
| 1018 | Ga0495629_0602559 | 3300046459 | Bacteria | 735 |
| 1019 | Ga0495638_0050878 | 3300046460 | Bacteria | 2587 |
| 1020 | Ga0495651_0117098 | 3300046462 | Bacteria | 1962 |
| 1021 | Ga0495651_0418407 | 3300046462 | Bacteria | 872 |
| 1022 | Ga0495650_0007879 | 3300046471 | Bacteria | 6324 |
| 1023 | Ga0495580_0304712 | 3300046472 | Bacteria | 1084 |
| 1024 | Ga0495639_0020558 | 3300046475 | Bacteria | 2885 |
| 1025 | Ga0495639_0103968 | 3300046475 | Bacteria | 1343 |
| 1026 | Ga0495664_0318737 | 3300046477 | Bacteria | 938 |
| 1027 | Ga0495585_0010449 | 3300046492 | Bacteria | 5520 |
| 1028 | Ga0495585_0268620 | 3300046492 | Bacteria | 846 |
| 1029 | Ga0495594_0207607 | 3300046499 | Bacteria | 1117 |
| 1030 | Ga0495606_0368524 | 3300046507 | Bacteria | 757 |
| 1031 | Ga0495608_0083536 | 3300046511 | Bacteria | 2073 |
| 1032 | Ga0495610_0007369 | 3300046512 | Bacteria | 7341 |
| 1033 | Ga0495616_0074407 | 3300046513 | Bacteria | 1637 |
| 1034 | Ga0495620_0021563 | 3300046515 | Bacteria | 3126 |
| 1035 | Ga0495620_0048760 | 3300046515 | Bacteria | 1816 |
| 1036 | Ga0495620_0072683 | 3300046515 | Bacteria | 1404 |
| 1037 | Ga0495620_0083017 | 3300046515 | Bacteria | 1294 |
| 1038 | Ga0495620_0133376 | 3300046515 | Bacteria | 974 |
| 1039 | Ga0495628_0102358 | 3300046516 | Bacteria | 2210 |
| 1040 | Ga0495630_0118838 | 3300046517 | Bacteria | 2005 |
| 1041 | Ga0495631_0022122 | 3300046518 | Bacteria | 2957 |
| 1042 | Ga0495632_0014757 | 3300046519 | Bacteria | 4407 |
| 1043 | Ga0495632_0023097 | 3300046519 | Bacteria | 3325 |
| 1044 | Ga0495632_0046599 | 3300046519 | Bacteria | 2153 |
| 1045 | Ga0495632_0065630 | 3300046519 | Bacteria | 1753 |
| 1046 | Ga0495643_0019121 | 3300046522 | Bacteria | 3966 |
| 1047 | Ga0495643_0279924 | 3300046522 | Bacteria | 768 |
| 1048 | Ga0495648_0268843 | 3300046524 | Bacteria | 814 |
| 1049 | Ga0495666_0154415 | 3300046526 | Bacteria | 1066 |
| 1050 | Ga0495642_0053512 | 3300046528 | Bacteria | 1664 |
| 1051 | Ga0495652_0528558 | 3300046529 | Bacteria | 814 |
| 1052 | Ga0495654_0056414 | 3300046530 | Bacteria | 1899 |
| 1053 | Ga0495654_0129002 | 3300046530 | Bacteria | 1137 |
| 1054 | Ga0495598_0020184 | 3300046537 | Bacteria | 1756 |
| 1055 | Ga0495598_0026107 | 3300046537 | Bacteria | 1598 |
| 1056 | Ga0495598_0063178 | 3300046537 | Bacteria | 1147 |
| 1057 | Ga0495609_0127993 | 3300046538 | Bacteria | 1089 |
| 1058 | Ga0495621_0012556 | 3300046539 | Bacteria | 2642 |
| 1059 | Ga0495621_0019298 | 3300046539 | Bacteria | 2225 |
| 1060 | Ga0495597_0092274 | 3300046542 | Bacteria | 1284 |
| 1061 | Ga0495645_0034282 | 3300046543 | Bacteria | 3704 |
| 1062 | Ga0495622_0022381 | 3300046557 | Bacteria | 2945 |
| 1063 | Ga0495633_0048161 | 3300046558 | Bacteria | 2013 |
| 1064 | Ga0495633_0222627 | 3300046558 | Bacteria | 864 |
| 1065 | Ga0495667_0115936 | 3300046559 | Bacteria | 1731 |
| 1066 | Ga0495656_0056918 | 3300046615 | Bacteria | 1691 |
| 1067 | Ga0495634_0205692 | 3300046642 | Bacteria | 1221 |
| 1068 | Ga0495611_0033426 | 3300046648 | Bacteria | 2269 |
| 1069 | Ga0495625_0006868 | 3300046660 | Bacteria | 10052 |
| 1070 | Ga0495625_0039878 | 3300046660 | Bacteria | 3427 |
| 1071 | Ga0495635_0287125 | 3300046663 | Bacteria | 1105 |
| 1072 | Ga0495657_0288855 | 3300046675 | Bacteria | 980 |
| 1073 | Ga0495646_0061137 | 3300046680 | Bacteria | 2244 |
| 1074 | Ga0495646_0198957 | 3300046680 | Bacteria | 1092 |
| 1075 | Ga0495658_0085813 | 3300046683 | Bacteria | 1856 |
| 1076 | Ga0495658_0097472 | 3300046683 | Bacteria | 1750 |
| 1077 | Ga0495613_0091108 | 3300046689 | Bacteria | 2208 |
| 1078 | Ga0495613_0120251 | 3300046689 | Bacteria | 1886 |
| 1079 | Ga0495624_0074135 | 3300046690 | Bacteria | 2115 |
| 1080 | Ga0495670_0342235 | 3300046691 | Bacteria | 804 |
| 1081 | Ga0495671_0161447 | 3300046692 | Bacteria | 1090 |
| 1082 | Ga0495671_0186886 | 3300046692 | Bacteria | 1006 |
| 1083 | Ga0495649_0006057 | 3300046694 | Bacteria | 7562 |
| 1084 | Ga0495589_0074447 | 3300046794 | Bacteria | 1657 |
| 1085 | Ga0495660_0092909 | 3300046810 | Bacteria | 1565 |
| 1086 | Ga0495604_0436213 | 3300047317 | Bacteria | 858 |
| 1087 | Ga0495676_0010234 | 3300047321 | Bacteria | 8515 |
| 1088 | Ga0495676_0140426 | 3300047321 | Bacteria | 1732 |
| 1089 | Ga0495680_0296214 | 3300047322 | Bacteria | 1137 |
| 1090 | Ga0495687_019359 | 3300047443 | Bacteria | 3344 |
| 1091 | Ga0495687_036928 | 3300047443 | Bacteria | 2180 |
| 1092 | Ga0495673_0084126 | 3300047469 | Bacteria | 1312 |
| 1093 | Ga0495681_0051412 | 3300047470 | Bacteria | 1938 |
| 1094 | Ga0495686_0004619 | 3300047472 | Bacteria | 11207 |
| 1095 | Ga0495686_0066900 | 3300047472 | Bacteria | 2219 |
| 1096 | Ga0495593_0038039 | 3300047673 | Bacteria | 2600 |
| 1097 | Ga0495602_0235589 | 3300048088 | Bacteria | 1372 |
| 1098 | Ga0495615_0017661 | 3300048090 | Bacteria | 1558 |
| 1099 | Ga0495626_0074338 | 3300048091 | Bacteria | 1521 |
| 1100 | Ga0496102_0047306 | 3300048905 | Bacteria | 3908 |
| 1101 | Ga0496102_0060302 | 3300048905 | Bacteria | 3470 |
| 1102 | Ga0496102_0381564 | 3300048905 | Bacteria | 1326 |
| 1103 | Ga0496102_0536484 | 3300048905 | Bacteria | 1093 |
| 1104 | Ga0496103_0130430 | 3300048906 | Bacteria | 1605 |
| 1105 | Ga0496104_0042754 | 3300048907 | Bacteria | 4254 |
| 1106 | Ga0496104_0104722 | 3300048907 | Bacteria | 2711 |
| 1107 | Ga0496104_0579646 | 3300048907 | Bacteria | 1032 |
| 1108 | Ga0496105_0187486 | 3300048908 | Bacteria | 1692 |
| 1109 | Ga0496105_0259562 | 3300048908 | Bacteria | 1405 |
| 1110 | Ga0496105_0786714 | 3300048908 | Bacteria | 724 |
| 1111 | Ga0496106_0745569 | 3300048909 | Bacteria | 779 |
| 1112 | Ga0496107_0171958 | 3300048910 | Bacteria | 1608 |
| 1113 | Ga0496107_0429419 | 3300048910 | Bacteria | 982 |
| 1114 | Ga0496108_0005999 | 3300048911 | Bacteria | 9840 |
| 1115 | Ga0496108_0009350 | 3300048911 | Bacteria | 7937 |
| 1116 | Ga0496108_0042133 | 3300048911 | Bacteria | 3811 |
| 1117 | Ga0496108_0089279 | 3300048911 | Bacteria | 2619 |
| 1118 | Ga0496108_0097580 | 3300048911 | Bacteria | 2504 |
| 1119 | Ga0496109_0084426 | 3300048912 | Bacteria | 2930 |
| 1120 | Ga0496110_0199440 | 3300048913 | Bacteria | 1818 |
| 1121 | Ga0496110_1047933 | 3300048913 | Bacteria | 723 |
| 1122 | Ga0496110_1077670 | 3300048913 | Bacteria | 711 |
| 1123 | Ga0496112_0018422 | 3300048915 | Bacteria | 6573 |
| 1124 | Ga0496113_0391549 | 3300048916 | Bacteria | 1115 |
| 1125 | Ga0496113_0910699 | 3300048916 | Bacteria | 695 |
| 1126 | Ga0496114_0010053 | 3300048917 | Bacteria | 7523 |
| 1127 | Ga0496115_0030230 | 3300048918 | Bacteria | 4260 |
| 1128 | Ga0496121_0042385 | 3300048924 | Bacteria | 3960 |
| 1129 | Ga0496124_0001830 | 3300048927 | Bacteria | 29398 |
| 1130 | Ga0496124_0030272 | 3300048927 | Bacteria | 4807 |
| 1131 | Ga0496125_0013937 | 3300048928 | Bacteria | 7862 |
| 1132 | Ga0496125_0448023 | 3300048928 | Bacteria | 740 |
| 1133 | Ga0501306_000061 | 3300049127 | Bacteria | 5674 |
| 1134 | Ga0501306_001910 | 3300049127 | Bacteria | 2048 |
| 1135 | Ga0501306_011445 | 3300049127 | Bacteria | 1132 |
| 1136 | Ga0501306_021046 | 3300049127 | Bacteria | 910 |
| 1137 | Ga0501308_000386 | 3300049128 | Bacteria | 2793 |
| 1138 | Ga0501308_008278 | 3300049128 | Bacteria | 1109 |
| 1139 | Ga0501308_008957 | 3300049128 | Bacteria | 1083 |
| 1140 | Ga0501308_009824 | 3300049128 | Bacteria | 1052 |
| 1141 | Ga0501309_000014 | 3300049129 | Bacteria | 8867 |
| 1142 | Ga0501309_001211 | 3300049129 | Bacteria | 2453 |
| 1143 | Ga0501309_007735 | 3300049129 | Bacteria | 1338 |
| 1144 | Ga0501309_013195 | 3300049129 | Bacteria | 1097 |
| 1145 | Ga0501309_018814 | 3300049129 | Bacteria | 957 |
| 1146 | Ga0501309_036132 | 3300049129 | Bacteria | 743 |
| 1147 | Ga0501310_000059 | 3300049130 | Bacteria | 10166 |
| 1148 | Ga0501310_002446 | 3300049130 | Bacteria | 1764 |
| 1149 | Ga0501310_004096 | 3300049130 | Bacteria | 1450 |
| 1150 | Ga0501304_000014 | 3300049160 | Bacteria | 8417 |
| 1151 | Ga0501304_000512 | 3300049160 | Bacteria | 2059 |
| 1152 | Ga0501304_000572 | 3300049160 | Bacteria | 1989 |
| 1153 | Ga0501304_004750 | 3300049160 | Bacteria | 1040 |
| 1154 | Ga0501304_009452 | 3300049160 | Bacteria | 837 |
| 1155 | Ga0501304_017098 | 3300049160 | Bacteria | 691 |
| 1156 | Ga0501304_022028 | 3300049160 | Bacteria | 637 |
| 1157 | Ga0501305_000004 | 3300049161 | Bacteria | 13267 |
| 1158 | Ga0501305_002640 | 3300049161 | Bacteria | 1956 |
| 1159 | Ga0501305_002660 | 3300049161 | Bacteria | 1951 |
| 1160 | Ga0501305_007431 | 3300049161 | Bacteria | 1392 |
| 1161 | Ga0501305_009585 | 3300049161 | Bacteria | 1276 |
| 1162 | Ga0501305_013714 | 3300049161 | Bacteria | 1124 |
| 1163 | Ga0501305_018025 | 3300049161 | Bacteria | 1019 |
| 1164 | Ga0501307_000029 | 3300049162 | Bacteria | 5210 |
| 1165 | Ga0501307_001704 | 3300049162 | Bacteria | 1920 |
| 1166 | Ga0501307_009557 | 3300049162 | Bacteria | 1110 |
| 1167 | Ga0501307_032343 | 3300049162 | Bacteria | 731 |
| 1168 | Ga0501307_048365 | 3300049162 | Bacteria | 634 |
| 1169 | Ga0501307_063429 | 3300049162 | Bacteria | 577 |
| 1170 | Ga0501294_004126 | 3300049517 | Bacteria | 1369 |
| 1171 | Ga0501298_007474 | 3300049521 | Bacteria | 1813 |
| 1172 | Ga0501300_000354 | 3300049523 | Bacteria | 6950 |
| 1173 | Ga0501303_013116 | 3300049526 | Bacteria | 806 |
| 1174 | Ga0501311_000038 | 3300049527 | Bacteria | 5334 |
| 1175 | Ga0501311_007764 | 3300049527 | Bacteria | 1242 |
| 1176 | Ga0501311_014890 | 3300049527 | Bacteria | 998 |
| 1177 | Ga0501311_037544 | 3300049527 | Bacteria | 724 |
| 1178 | Ga0501311_049772 | 3300049527 | Bacteria | 654 |
| 1179 | Ga0501312_000016 | 3300049528 | Bacteria | 9244 |
| 1180 | Ga0501312_002743 | 3300049528 | Bacteria | 1929 |
| 1181 | Ga0501312_003126 | 3300049528 | Bacteria | 1852 |
| 1182 | Ga0501312_050778 | 3300049528 | Bacteria | 699 |
| 1183 | Ga0501312_063524 | 3300049528 | Bacteria | 643 |
| 1184 | Ga0501314_000017 | 3300049530 | Bacteria | 8558 |
| 1185 | Ga0501314_002966 | 3300049530 | Bacteria | 1344 |
| 1186 | Ga0501314_007260 | 3300049530 | Bacteria | 980 |
| 1187 | Ga0501314_019295 | 3300049530 | Bacteria | 699 |
| 1188 | Ga0501314_026681 | 3300049530 | Bacteria | 626 |
| 1189 | Ga0501315_000346 | 3300049531 | Bacteria | 3048 |
| 1190 | Ga0501315_003778 | 3300049531 | Bacteria | 1539 |
| 1191 | Ga0501315_014533 | 3300049531 | Bacteria | 998 |
| 1192 | Ga0501315_023950 | 3300049531 | Bacteria | 841 |
| 1193 | Ga0501315_050534 | 3300049531 | Bacteria | 652 |
| 1194 | Ga0501316_001021 | 3300049532 | Bacteria | 2235 |
| 1195 | Ga0501316_001567 | 3300049532 | Bacteria | 1971 |
| 1196 | Ga0501316_008894 | 3300049532 | Bacteria | 1117 |
| 1197 | Ga0501317_000290 | 3300049533 | Bacteria | 3266 |
| 1198 | Ga0501317_001329 | 3300049533 | Bacteria | 2109 |
| 1199 | Ga0501318_000131 | 3300049534 | Bacteria | 3541 |
| 1200 | Ga0501318_000548 | 3300049534 | Bacteria | 2463 |
| 1201 | Ga0501318_000712 | 3300049534 | Bacteria | 2277 |
| 1202 | Ga0501318_036014 | 3300049534 | Bacteria | 691 |
| 1203 | Ga0501319_000082 | 3300049535 | Bacteria | 3272 |
| 1204 | Ga0501319_000240 | 3300049535 | Bacteria | 2323 |
| 1205 | Ga0501320_000131 | 3300049536 | Bacteria | 3444 |
| 1206 | Ga0501320_000368 | 3300049536 | Bacteria | 2523 |
| 1207 | Ga0501320_000489 | 3300049536 | Bacteria | 2338 |
| 1208 | Ga0501320_002265 | 3300049536 | Bacteria | 1522 |
| 1209 | Ga0501320_025278 | 3300049536 | Bacteria | 711 |
| 1210 | Ga0501321_007872 | 3300049537 | Bacteria | 1117 |
| 1211 | Ga0501322_000402 | 3300049538 | Bacteria | 1998 |
| 1212 | Ga0501322_000422 | 3300049538 | Bacteria | 1970 |
| 1213 | Ga0501322_013354 | 3300049538 | Bacteria | 662 |
| 1214 | Ga0501323_000187 | 3300049539 | Bacteria | 3964 |
| 1215 | Ga0501323_000627 | 3300049539 | Bacteria | 2715 |
| 1216 | Ga0501323_000789 | 3300049539 | Bacteria | 2528 |
| 1217 | Ga0501323_008377 | 3300049539 | Bacteria | 1199 |
| 1218 | Ga0501323_044417 | 3300049539 | Bacteria | 660 |
| 1219 | Ga0501324_000208 | 3300049540 | Bacteria | 2763 |
| 1220 | Ga0501325_000034 | 3300049541 | Bacteria | 3949 |
| 1221 | Ga0501325_007278 | 3300049541 | Bacteria | 933 |
| 1222 | Ga0501325_007305 | 3300049541 | Bacteria | 932 |
| 1223 | Ga0501327_04826 | 3300049543 | Bacteria | 782 |
| 1224 | Ga0501327_04896 | 3300049543 | Bacteria | 778 |
| 1225 | Ga0501328_00214 | 3300049544 | Bacteria | 1696 |
| 1226 | Ga0501329_02964 | 3300049545 | Bacteria | 841 |
| 1227 | Ga0501333_001525 | 3300049549 | Bacteria | 1264 |
| 1228 | Ga0501335_007840 | 3300049551 | Bacteria | 994 |
| 1229 | Ga0501336_001307 | 3300049552 | Bacteria | 1463 |
| 1230 | Ga0501340_002905 | 3300049556 | Bacteria | 1013 |
| 1231 | Ga0501043_0000090 | 3300049579 | Bacteria | 81336 |
| 1232 | Ga0501046_0000126 | 3300049580 | Bacteria | 81334 |
| 1233 | Ga0501046_0557944 | 3300049580 | Bacteria | 816 |
| 1234 | Ga0501047_0000160 | 3300049581 | Bacteria | 81946 |
| 1235 | Ga0501048_0003429 | 3300049582 | Bacteria | 12039 |
| 1236 | Ga0501198_000043 | 3300049649 | Bacteria | 44170 |
| 1237 | Ga0501202_000808 | 3300049652 | Bacteria | 4708 |
| 1238 | Ga0501206_001476 | 3300049653 | Bacteria | 2936 |
| 1239 | Ga0501206_015309 | 3300049653 | Bacteria | 1061 |
| 1240 | Ga0501207_023110 | 3300049654 | Bacteria | 1008 |
| 1241 | Ga0501211_000022 | 3300049658 | Bacteria | 11753 |
| 1242 | Ga0501222_000051 | 3300049662 | Bacteria | 43800 |
| 1243 | Ga0501222_001695 | 3300049662 | Bacteria | 3064 |
| 1244 | Ga0501222_002355 | 3300049662 | Bacteria | 2622 |
| 1245 | Ga0501223_013997 | 3300049663 | Bacteria | 1593 |
| 1246 | Ga0501227_003969 | 3300049665 | Bacteria | 3187 |
| 1247 | Ga0501228_000607 | 3300049666 | Bacteria | 2339 |
| 1248 | Ga0501233_042034 | 3300049668 | Bacteria | 1078 |
| 1249 | Ga0501235_001228 | 3300049669 | Bacteria | 5397 |
| 1250 | Ga0501236_005248 | 3300049670 | Bacteria | 1561 |
| 1251 | Ga0501249_003813 | 3300049679 | Bacteria | 3043 |
| 1252 | Ga0501249_163704 | 3300049679 | Bacteria | 566 |
| 1253 | Ga0501252_006049 | 3300049682 | Bacteria | 1335 |
| 1254 | Ga0501253_000109 | 3300049683 | Bacteria | 5987 |
| 1255 | Ga0501253_023370 | 3300049683 | Bacteria | 1111 |
| 1256 | Ga0501257_022365 | 3300049686 | Bacteria | 1496 |
| 1257 | Ga0501258_000137 | 3300049687 | Bacteria | 4092 |
| 1258 | Ga0501221_001094 | 3300049704 | Bacteria | 4449 |
| 1259 | Ga0501225_0006245 | 3300049705 | Bacteria | 3481 |
| 1260 | Ga0501229_001006 | 3300049706 | Bacteria | 3217 |
| 1261 | Ga0501234_011220 | 3300049707 | Bacteria | 1400 |
| 1262 | Ga0501232_001247 | 3300049757 | Bacteria | 1976 |
| 1263 | Ga0501262_000590 | 3300049759 | Bacteria | 4309 |
| 1264 | Ga0501262_009254 | 3300049759 | Bacteria | 1216 |
| 1265 | Ga0501267_004614 | 3300049764 | Bacteria | 1286 |
| 1266 | Ga0501271_001925 | 3300049768 | Bacteria | 1811 |
| 1267 | Ga0501272_000140 | 3300049769 | Bacteria | 5782 |
| 1268 | Ga0501273_023893 | 3300049770 | Bacteria | 841 |
| 1269 | Ga0501282_018464 | 3300049778 | Bacteria | 761 |
| 1270 | Ga0501283_012253 | 3300049779 | Bacteria | 1287 |
| 1271 | Ga0501035_0044369 | 3300049822 | Bacteria | 4004 |
| 1272 | Ga0501035_1171299 | 3300049822 | Bacteria | 597 |
| 1273 | Ga0501044_0057237 | 3300049823 | Bacteria | 4001 |
| 1274 | Ga0501045_0000882 | 3300049824 | Bacteria | 19499 |
| 1275 | Ga0501226_002381 | 3300049853 | Bacteria | 2305 |
| 1276 | nmdc:mga03683_107933_c1 | 3300050489 | Bacteria | 1228 |
| 1277 | nmdc:mga03683_133365_c1 | 3300050489 | Bacteria | 1113 |
| 1278 | nmdc:mga03683_177263_c1 | 3300050489 | Bacteria | 971 |
| 1279 | nmdc:mga03683_18745_c1 | 3300050489 | Bacteria | 2635 |
| 1280 | nmdc:mga03683_63522_c2 | 3300050489 | Bacteria | 1225 |
| 1281 | nmdc:mga03683_77659_c1 | 3300050489 | Bacteria | 1429 |
| 1282 | nmdc:mga03n38_356243_c1 | 3300050490 | Bacteria | 797 |
| 1283 | nmdc:mga03n38_375198_c1 | 3300050490 | Bacteria | 778 |
| 1284 | nmdc:mga03n38_4851_c1 | 3300050490 | Bacteria | 4507 |
| 1285 | nmdc:mga00v17_103467_c1 | 3300050491 | Bacteria | 1800 |
| 1286 | nmdc:mga00v17_113515_c1 | 3300050491 | Bacteria | 1720 |
| 1287 | nmdc:mga00v17_17620_c1 | 3300050491 | Bacteria | 4047 |
| 1288 | nmdc:mga00v17_325496_c1 | 3300050491 | Bacteria | 999 |
| 1289 | nmdc:mga0k408_1021_c1 | 3300050493 | Bacteria | 15347 |
| 1290 | nmdc:mga0k408_117826_c1 | 3300050493 | Bacteria | 1572 |
| 1291 | nmdc:mga0k408_12806_c1 | 3300050493 | Bacteria | 4590 |
| 1292 | nmdc:mga0k408_137955_c1 | 3300050493 | Bacteria | 1450 |
| 1293 | nmdc:mga0k408_153215_c1 | 3300050493 | Bacteria | 1373 |
| 1294 | nmdc:mga0k408_165490_c1 | 3300050493 | Bacteria | 1318 |
| 1295 | nmdc:mga0k408_17134_c1 | 3300050493 | Bacteria | 4032 |
| 1296 | nmdc:mga0k408_172222_c1 | 3300050493 | Bacteria | 1291 |
| 1297 | nmdc:mga0k408_173647_c1 | 3300050493 | Bacteria | 1285 |
| 1298 | nmdc:mga0k408_214738_c1 | 3300050493 | Bacteria | 1149 |
| 1299 | nmdc:mga0k408_219_c1 | 3300050493 | Bacteria | 23656 |
| 1300 | nmdc:mga0k408_22144_c1 | 3300050493 | Bacteria | 3577 |
| 1301 | nmdc:mga0k408_23422_c1 | 3300050493 | Bacteria | 3483 |
| 1302 | nmdc:mga0k408_23786_c1 | 3300050493 | Bacteria | 3460 |
| 1303 | nmdc:mga0k408_249623_c1 | 3300050493 | Bacteria | 1060 |
| 1304 | nmdc:mga0k408_256246_c1 | 3300050493 | Bacteria | 1045 |
| 1305 | nmdc:mga0k408_28249_c1 | 3300050493 | Bacteria | 3190 |
| 1306 | nmdc:mga0k408_34347_c1 | 3300050493 | Bacteria | 2903 |
| 1307 | nmdc:mga0k408_43703_c1 | 3300050493 | Bacteria | 2583 |
| 1308 | nmdc:mga0k408_46982_c1 | 3300050493 | Bacteria | 2494 |
| 1309 | nmdc:mga0k408_49108_c1 | 3300050493 | Bacteria | 2443 |
| 1310 | nmdc:mga0k408_497415_c1 | 3300050493 | Bacteria | 723 |
| 1311 | nmdc:mga0k408_57150_c1 | 3300050493 | Bacteria | 2265 |
| 1312 | nmdc:mga0k408_59396_c1 | 3300050493 | Bacteria | 2222 |
| 1313 | nmdc:mga0k408_59597_c1 | 3300050493 | Bacteria | 2218 |
| 1314 | nmdc:mga0k408_61835_c1 | 3300050493 | Bacteria | 2177 |
| 1315 | nmdc:mga0k408_678497_c1 | 3300050493 | Bacteria | 605 |
| 1316 | nmdc:mga0k408_6946_c1 | 3300050493 | Bacteria | 6039 |
| 1317 | nmdc:mga06z11_11386_c1 | 3300050494 | Bacteria | 3834 |
| 1318 | nmdc:mga06z11_229350_c1 | 3300050494 | Bacteria | 1088 |
| 1319 | nmdc:mga06z11_3023_c1 | 3300050494 | Bacteria | 6473 |
| 1320 | nmdc:mga06z11_880689_c1 | 3300050494 | Bacteria | 546 |
| 1321 | nmdc:mga07m45_13904_c1 | 3300050496 | Bacteria | 4278 |
| 1322 | nmdc:mga07m45_15127_c1 | 3300050496 | Bacteria | 4120 |
| 1323 | nmdc:mga07m45_196968_c1 | 3300050496 | Bacteria | 1172 |
| 1324 | nmdc:mga07m45_20386_c1 | 3300050496 | Bacteria | 3601 |
| 1325 | nmdc:mga07m45_250451_c1 | 3300050496 | Bacteria | 1031 |
| 1326 | nmdc:mga07m45_2931_c1 | 3300050496 | Bacteria | 8100 |
| 1327 | nmdc:mga07m45_69529_c1 | 3300050496 | Bacteria | 2002 |
| 1328 | nmdc:mga07m45_71727_c1 | 3300050496 | Bacteria | 1971 |
| 1329 | nmdc:mga07m45_72406_c1 | 3300050496 | Bacteria | 1962 |
| 1330 | nmdc:mga07m45_74068_c1 | 3300050496 | Bacteria | 1940 |
| 1331 | nmdc:mga07m45_74708_c1 | 3300050496 | Bacteria | 1631 |
| 1332 | nmdc:mga05p37_180274_c1 | 3300050507 | Bacteria | 2570 |
| 1333 | nmdc:mga0qj67_50093_c1 | 3300050509 | Bacteria | 3301 |
| 1334 | nmdc:mga08y16_636309_c1 | 3300050511 | Bacteria | 1072 |
| 1335 | nmdc:mga0sz30_183925_c1 | 3300050516 | Bacteria | 928 |
| 1336 | nmdc:mga0sz30_23261_c1 | 3300050516 | Bacteria | 2520 |
| 1337 | nmdc:mga0sz30_3989_c1 | 3300050516 | Bacteria | 5314 |
| 1338 | Ga0495619_0475112 | 3300053085 | Bacteria | 861 |
| 1339 | Ga0500578_0000292 | 3300053086 | Bacteria | 61943 |
| 1340 | Ga0500578_0201137 | 3300053086 | Bacteria | 1219 |
| 1341 | Ga0500644_0003475 | 3300053088 | Bacteria | 3899 |
| 1342 | Ga0500644_0232343 | 3300053088 | Bacteria | 772 |
| 1343 | Ga0500646_0014216 | 3300053090 | Bacteria | 2064 |
| 1344 | Ga0500646_0221856 | 3300053090 | Bacteria | 656 |
| 1345 | Ga0500651_0000274 | 3300053093 | Bacteria | 30518 |
| 1346 | Ga0500651_0129786 | 3300053093 | Bacteria | 1525 |
| 1347 | Ga0500650_0256249 | 3300053098 | Bacteria | 783 |
| 1348 | Ga0500562_019007 | 3300053108 | Bacteria | 1775 |
| 1349 | Ga0500593_000235 | 3300053117 | Bacteria | 22775 |
| 1350 | Ga0500594_0013014 | 3300053118 | Bacteria | 1970 |
| 1351 | Ga0500621_142333 | 3300053126 | Bacteria | 908 |
| 1352 | Ga0500628_006199 | 3300053129 | Bacteria | 2015 |
| 1353 | Ga0500642_0007842 | 3300053130 | Bacteria | 3612 |
| 1354 | Ga0500652_000400 | 3300053131 | Bacteria | 15538 |
| 1355 | Ga0500652_069558 | 3300053131 | Bacteria | 1457 |
| 1356 | Ga0500652_135627 | 3300053131 | Bacteria | 1026 |
| 1357 | Ga0500655_012927 | 3300053133 | Bacteria | 1520 |
| 1358 | Ga0500655_016385 | 3300053133 | Bacteria | 1364 |
| 1359 | Ga0500658_0026976 | 3300053134 | Bacteria | 2217 |
| 1360 | Ga0500559_0000097 | 3300053136 | Bacteria | 70124 |
| 1361 | Ga0500568_0015583 | 3300053139 | Bacteria | 3401 |
| 1362 | Ga0500568_0065376 | 3300053139 | Bacteria | 1400 |
| 1363 | Ga0500568_0179181 | 3300053139 | Bacteria | 779 |
| 1364 | Ga0500577_0017376 | 3300053142 | Bacteria | 2289 |
| 1365 | Ga0500590_007064 | 3300053148 | Bacteria | 5517 |
| 1366 | Ga0500604_0040251 | 3300053151 | Bacteria | 1408 |
| 1367 | Ga0500619_000012 | 3300053154 | Bacteria | 57280 |
| 1368 | Ga0500620_057705 | 3300053155 | Bacteria | 1316 |
| 1369 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 1370 | Ga0500622_0000978 | 3300053156 | Bacteria | 24237 |
| 1371 | Ga0500622_0001316 | 3300053156 | Bacteria | 20204 |
| 1372 | Ga0500622_0071046 | 3300053156 | Bacteria | 1759 |
| 1373 | Ga0500633_0085745 | 3300053160 | Bacteria | 1145 |
| 1374 | Ga0500599_015505 | 3300053736 | Bacteria | 1047 |
| 1375 | Ga0500587_000541 | 3300053739 | Bacteria | 4638 |
| 1376 | Ga0500587_006132 | 3300053739 | Bacteria | 1604 |
| 1377 | Ga0500661_007894 | 3300055283 | Bacteria | 1962 |
| 1378 | Ga0500661_024419 | 3300055283 | Bacteria | 1069 |
| 1379 | Ga0590071_001831 | 3300059421 | Bacteria | 5489 |
| 1380 | Ga0590075_011325 | 3300059424 | Bacteria | 2155 |
| 1381 | Ga0587084_012022 | 3300059477 | Bacteria | 1164 |
| 1382 | Ga0587084_034985 | 3300059477 | Bacteria | 827 |
| 1383 | Ga0587070_007134 | 3300059491 | Bacteria | 1537 |
| 1384 | Ga0587070_098543 | 3300059491 | Bacteria | 669 |
| 1385 | Ga0587083_0017882 | 3300059505 | Bacteria | 1274 |
| 1386 | Ga0587086_016978 | 3300059507 | Bacteria | 956 |
| 1387 | Ga0587101_001008 | 3300059623 | Bacteria | 2281 |
| 1388 | Ga0587062_008101 | 3300059639 | Bacteria | 1246 |
| 1389 | Ga0587068_001309 | 3300059641 | Bacteria | 2740 |
| 1390 | Ga0587108_002956 | 3300059653 | Bacteria | 1174 |
| 1391 | Ga0587111_0005177 | 3300060346 | Bacteria | 1991 |
| 1392 | Ga0587111_0104287 | 3300060346 | Bacteria | 710 |
| 1393 | Ga0466962_0000718 | 3300061719 | Bacteria | 14786 |
| 1394 | Ga0466962_0014522 | 3300061719 | Bacteria | 3795 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10381139 | Ga0105243_103811393 | 149 |
| 2 | 3300009176 | Ga0105242_10778232 | Ga0105242_107782322 | 149 |
| 3 | 3300009553 | Ga0105249_10309743 | Ga0105249_103097433 | 149 |
| 4 | 3300013297 | Ga0157378_10008661 | Ga0157378_100086617 | 149 |
| 5 | 3300013306 | Ga0163162_10004148 | Ga0163162_1000414815 | 149 |
| 6 | 3300013308 | Ga0157375_10041626 | Ga0157375_100416266 | 149 |
| 7 | 3300014968 | Ga0157379_10069525 | Ga0157379_100695256 | 149 |
| 8 | 3300050493 | nmdc:mga0k408_23422_c1 | nmdc:mga0k408_23422_c1_1562_2077 | 149 |
| 9 | 3300025937 | Ga0207669_10027395 | Ga0207669_100273954 | 152 |
| 10 | 3300026121 | Ga0207683_10967815 | Ga0207683_109678151 | 152 |
| 11 | 3300031911 | Ga0307412_10475873 | Ga0307412_104758732 | 152 |
| 12 | 3300042156 | Ga0439446_0094388 | Ga0439446_0094388_18_533 | 153 |
| 13 | 3300044712 | Ga0453684_1631963 | Ga0453684_1631963_132_593 | 153 |
| 14 | 3300009551 | Ga0105238_12712190 | Ga0105238_127121901 | 154 |
| 15 | 3300005333 | Ga0070677_10135253 | Ga0070677_101352532 | 155 |
| 16 | 3300005353 | Ga0070669_100555163 | Ga0070669_1005551631 | 155 |
| 17 | 3300005355 | Ga0070671_100412635 | Ga0070671_1004126351 | 155 |
| 18 | 3300005356 | Ga0070674_100039880 | Ga0070674_1000398805 | 155 |
| 19 | 3300005459 | Ga0068867_100002598 | Ga0068867_10000259810 | 155 |
| 20 | 3300005543 | Ga0070672_100198587 | Ga0070672_1001985874 | 155 |
| 21 | 3300005616 | Ga0068852_100315873 | Ga0068852_1003158734 | 155 |
| 22 | 3300005718 | Ga0068866_10091328 | Ga0068866_100913282 | 155 |
| 23 | 3300005719 | Ga0068861_100016735 | Ga0068861_1000167356 | 155 |
| 24 | 3300005843 | Ga0068860_100008442 | Ga0068860_10000844210 | 155 |
| 25 | 3300005844 | Ga0068862_100103203 | Ga0068862_1001032032 | 155 |
| 26 | 3300006881 | Ga0068865_100004060 | Ga0068865_1000040606 | 155 |
| 27 | 3300017792 | Ga0163161_10021239 | Ga0163161_100212397 | 155 |
| 28 | 3300025899 | Ga0207642_10092854 | Ga0207642_100928542 | 155 |
| 29 | 3300025903 | Ga0207680_10373861 | Ga0207680_103738611 | 155 |
| 30 | 3300025923 | Ga0207681_10021332 | Ga0207681_100213328 | 155 |
| 31 | 3300025931 | Ga0207644_10256867 | Ga0207644_102568673 | 155 |
| 32 | 3300025935 | Ga0207709_10146045 | Ga0207709_101460453 | 155 |
| 33 | 3300025938 | Ga0207704_10006606 | Ga0207704_100066062 | 155 |
| 34 | 3300025940 | Ga0207691_10214431 | Ga0207691_102144312 | 155 |
| 35 | 3300025960 | Ga0207651_10840667 | Ga0207651_108406672 | 155 |
| 36 | 3300025961 | Ga0207712_10040645 | Ga0207712_100406456 | 155 |
| 37 | 3300026035 | Ga0207703_10027342 | Ga0207703_100273426 | 155 |
| 38 | 3300026075 | Ga0207708_10168085 | Ga0207708_101680854 | 155 |
| 39 | 3300026089 | Ga0207648_10005939 | Ga0207648_1000593916 | 155 |
| 40 | 3300026118 | Ga0207675_100006663 | Ga0207675_10000666312 | 155 |
| 41 | 3300026142 | Ga0207698_10171946 | Ga0207698_101719463 | 155 |
| 42 | 3300028380 | Ga0268265_10029280 | Ga0268265_100292807 | 155 |
| 43 | 3300028381 | Ga0268264_10002318 | Ga0268264_1000231817 | 155 |
| 44 | 3300049128 | Ga0501308_009824 | Ga0501308_009824_486_1001 | 155 |
| 45 | 3300049160 | Ga0501304_000512 | Ga0501304_000512_607_1122 | 155 |
| 46 | 3300049161 | Ga0501305_002660 | Ga0501305_002660_83_598 | 155 |
| 47 | 3300049531 | Ga0501315_023950 | Ga0501315_023950_241_756 | 155 |
| 48 | 3300049662 | Ga0501222_002355 | Ga0501222_002355_2044_2559 | 155 |
| 49 | 3300035691 | Ga0373931_0022499 | Ga0373931_0022499_1340_1855 | 157 |
| 50 | 3300005539 | Ga0068853_100428379 | Ga0068853_1004283791 | 158 |
| 51 | 3300044656 | Ga0466969_0000018 | Ga0466969_0000018_2991_3506 | 158 |
| 52 | 3300044684 | Ga0466966_0009766 | Ga0466966_0009766_4746_5261 | 158 |
| 53 | 3300044765 | Ga0466970_0180749 | Ga0466970_0180749_235_750 | 158 |
| 54 | 3300049129 | Ga0501309_001211 | Ga0501309_001211_1374_1889 | 158 |
| 55 | 3300049130 | Ga0501310_002446 | Ga0501310_002446_769_1284 | 158 |
| 56 | 3300049160 | Ga0501304_017098 | Ga0501304_017098_65_580 | 158 |
| 57 | 3300049161 | Ga0501305_002640 | Ga0501305_002640_1320_1835 | 158 |
| 58 | 3300049162 | Ga0501307_001704 | Ga0501307_001704_1284_1799 | 158 |
| 59 | 3300049527 | Ga0501311_007764 | Ga0501311_007764_616_1131 | 158 |
| 60 | 3300049528 | Ga0501312_003126 | Ga0501312_003126_1216_1731 | 158 |
| 61 | 3300049530 | Ga0501314_026681 | Ga0501314_026681_51_566 | 158 |
| 62 | 3300049531 | Ga0501315_003778 | Ga0501315_003778_903_1418 | 158 |
| 63 | 3300049532 | Ga0501316_008894 | Ga0501316_008894_189_704 | 158 |
| 64 | 3300049533 | Ga0501317_001329 | Ga0501317_001329_1246_1761 | 158 |
| 65 | 3300049534 | Ga0501318_000712 | Ga0501318_000712_1651_2166 | 158 |
| 66 | 3300049536 | Ga0501320_025278 | Ga0501320_025278_85_600 | 158 |
| 67 | 3300049537 | Ga0501321_007872 | Ga0501321_007872_36_551 | 158 |
| 68 | 3300049538 | Ga0501322_000422 | Ga0501322_000422_230_745 | 158 |
| 69 | 3300049541 | Ga0501325_007305 | Ga0501325_007305_169_684 | 158 |
| 70 | 3300049683 | Ga0501253_023370 | Ga0501253_023370_581_1096 | 158 |
| 71 | 3300049822 | Ga0501035_0044369 | Ga0501035_0044369_2598_3113 | 161 |
| 72 | 3300034818 | Ga0373950_0061099 | Ga0373950_0061099_94_585 | 163 |
| 73 | 3300048908 | Ga0496105_0786714 | Ga0496105_0786714_11_502 | 163 |
| 74 | 3300048913 | Ga0496110_1047933 | Ga0496110_1047933_216_707 | 163 |
| 75 | 3300049127 | Ga0501306_021046 | Ga0501306_021046_14_505 | 163 |
| 76 | 3300049162 | Ga0501307_048365 | Ga0501307_048365_13_504 | 163 |
| 77 | 3300049162 | Ga0501307_063429 | Ga0501307_063429_18_509 | 163 |
| 78 | 3300053098 | Ga0500650_0256249 | Ga0500650_0256249_18_509 | 163 |
| 79 | 3300028794 | Ga0307515_10314400 | Ga0307515_103144003 | 164 |
| 80 | 3300031456 | Ga0307513_10461469 | Ga0307513_104614691 | 164 |
| 81 | 3300048911 | Ga0496108_0097580 | Ga0496108_0097580_1453_1947 | 164 |
| 82 | 3300029957 | Ga0265324_10017152 | Ga0265324_100171525 | 165 |
| 83 | 3300033179 | Ga0307507_10375329 | Ga0307507_103753292 | 167 |
| 84 | 3300003163 | Ga0006759J45824_1028038 | Ga0006759J45824_10280386 | 171 |
| 85 | 3300003544 | Ga0007417J51691_1020817 | Ga0007417J51691_10208176 | 171 |
| 86 | 3300003574 | Ga0007410J51695_1043180 | Ga0007410J51695_10431806 | 171 |
| 87 | 3300003575 | Ga0007409J51694_1024055 | Ga0007409J51694_10240556 | 171 |
| 88 | 3300003577 | Ga0007416J51690_1037564 | Ga0007416J51690_10375646 | 171 |
| 89 | 3300003611 | Ga0007411J51799_109097 | Ga0007411J51799_1090976 | 171 |
| 90 | 3300003613 | Ga0007415J51800_107261 | Ga0007415J51800_1072616 | 171 |
| 91 | 3300003693 | Ga0032354_1038503 | Ga0032354_10385036 | 171 |
| 92 | 3300005344 | Ga0070661_100003672 | Ga0070661_1000036727 | 171 |
| 93 | 3300005366 | Ga0070659_100050300 | Ga0070659_1000503005 | 171 |
| 94 | 3300005457 | Ga0070662_100065448 | Ga0070662_1000654483 | 171 |
| 95 | 3300009093 | Ga0105240_10018079 | Ga0105240_1001807911 | 171 |
| 96 | 3300009093 | Ga0105240_10144746 | Ga0105240_101447464 | 171 |
| 97 | 3300009093 | Ga0105240_11574043 | Ga0105240_115740432 | 171 |
| 98 | 3300009094 | Ga0111539_10581878 | Ga0111539_105818782 | 171 |
| 99 | 3300009094 | Ga0111539_12836621 | Ga0111539_128366211 | 171 |
| 100 | 3300009098 | Ga0105245_10300472 | Ga0105245_103004723 | 171 |
| 101 | 3300009098 | Ga0105245_10531521 | Ga0105245_105315213 | 171 |
| 102 | 3300009098 | Ga0105245_11103815 | Ga0105245_111038151 | 171 |
| 103 | 3300009098 | Ga0105245_11338826 | Ga0105245_113388261 | 171 |
| 104 | 3300009101 | Ga0105247_10612908 | Ga0105247_106129082 | 171 |
| 105 | 3300009147 | Ga0114129_10176739 | Ga0114129_101767397 | 171 |
| 106 | 3300009148 | Ga0105243_10001789 | Ga0105243_1000178916 | 171 |
| 107 | 3300009148 | Ga0105243_10230579 | Ga0105243_102305793 | 171 |
| 108 | 3300009176 | Ga0105242_10114272 | Ga0105242_101142726 | 171 |
| 109 | 3300009177 | Ga0105248_10006768 | Ga0105248_1000676814 | 171 |
| 110 | 3300009177 | Ga0105248_10325115 | Ga0105248_103251154 | 171 |
| 111 | 3300009177 | Ga0105248_10531205 | Ga0105248_105312052 | 171 |
| 112 | 3300009177 | Ga0105248_11033484 | Ga0105248_110334842 | 171 |
| 113 | 3300009177 | Ga0105248_11063951 | Ga0105248_110639512 | 171 |
| 114 | 3300009177 | Ga0105248_11291431 | Ga0105248_112914312 | 171 |
| 115 | 3300009177 | Ga0105248_12109404 | Ga0105248_121094041 | 171 |
| 116 | 3300009545 | Ga0105237_10000668 | Ga0105237_1000066844 | 171 |
| 117 | 3300009545 | Ga0105237_10020609 | Ga0105237_100206094 | 171 |
| 118 | 3300009545 | Ga0105237_10393453 | Ga0105237_103934532 | 171 |
| 119 | 3300009551 | Ga0105238_10003926 | Ga0105238_1000392612 | 171 |
| 120 | 3300009551 | Ga0105238_10956536 | Ga0105238_109565361 | 171 |
| 121 | 3300009553 | Ga0105249_10300940 | Ga0105249_103009402 | 171 |
| 122 | 3300009553 | Ga0105249_10567220 | Ga0105249_105672201 | 171 |
| 123 | 3300009553 | Ga0105249_10629006 | Ga0105249_106290062 | 171 |
| 124 | 3300010375 | Ga0105239_10001255 | Ga0105239_1000125532 | 171 |
| 125 | 3300010375 | Ga0105239_10444502 | Ga0105239_104445022 | 171 |
| 126 | 3300011119 | Ga0105246_10310875 | Ga0105246_103108752 | 171 |
| 127 | 3300012497 | Ga0157319_1000005 | Ga0157319_100000519 | 171 |
| 128 | 3300012513 | Ga0157326_1009237 | Ga0157326_10092372 | 171 |
| 129 | 3300013104 | Ga0157370_11295331 | Ga0157370_112953311 | 171 |
| 130 | 3300013105 | Ga0157369_10254222 | Ga0157369_102542223 | 171 |
| 131 | 3300013105 | Ga0157369_10753158 | Ga0157369_107531582 | 171 |
| 132 | 3300013296 | Ga0157374_10009298 | Ga0157374_100092987 | 171 |
| 133 | 3300013296 | Ga0157374_10093529 | Ga0157374_100935295 | 171 |
| 134 | 3300013296 | Ga0157374_10156204 | Ga0157374_101562044 | 171 |
| 135 | 3300013296 | Ga0157374_10375271 | Ga0157374_103752713 | 171 |
| 136 | 3300013296 | Ga0157374_10766115 | Ga0157374_107661152 | 171 |
| 137 | 3300013297 | Ga0157378_10328899 | Ga0157378_103288993 | 171 |
| 138 | 3300013297 | Ga0157378_10379246 | Ga0157378_103792463 | 171 |
| 139 | 3300013297 | Ga0157378_10415154 | Ga0157378_104151542 | 171 |
| 140 | 3300013297 | Ga0157378_10458589 | Ga0157378_104585891 | 171 |
| 141 | 3300013297 | Ga0157378_10787609 | Ga0157378_107876091 | 171 |
| 142 | 3300013306 | Ga0163162_10241802 | Ga0163162_102418024 | 171 |
| 143 | 3300013306 | Ga0163162_10424477 | Ga0163162_104244772 | 171 |
| 144 | 3300013308 | Ga0157375_10151438 | Ga0157375_101514383 | 171 |
| 145 | 3300013308 | Ga0157375_10239233 | Ga0157375_102392333 | 171 |
| 146 | 3300013308 | Ga0157375_10296051 | Ga0157375_102960512 | 171 |
| 147 | 3300013308 | Ga0157375_10390226 | Ga0157375_103902263 | 171 |
| 148 | 3300013308 | Ga0157375_10411974 | Ga0157375_104119743 | 171 |
| 149 | 3300013308 | Ga0157375_10694323 | Ga0157375_106943231 | 171 |
| 150 | 3300013308 | Ga0157375_11752266 | Ga0157375_117522662 | 171 |
| 151 | 3300013308 | Ga0157375_12669695 | Ga0157375_126696951 | 171 |
| 152 | 3300014326 | Ga0157380_10220443 | Ga0157380_102204432 | 171 |
| 153 | 3300014326 | Ga0157380_10220567 | Ga0157380_102205673 | 171 |
| 154 | 3300014326 | Ga0157380_10765256 | Ga0157380_107652562 | 171 |
| 155 | 3300014326 | Ga0157380_10865730 | Ga0157380_108657302 | 171 |
| 156 | 3300014326 | Ga0157380_10896934 | Ga0157380_108969342 | 171 |
| 157 | 3300014745 | Ga0157377_10000368 | Ga0157377_1000036817 | 171 |
| 158 | 3300014745 | Ga0157377_10426448 | Ga0157377_104264481 | 171 |
| 159 | 3300014968 | Ga0157379_10040412 | Ga0157379_100404127 | 171 |
| 160 | 3300014968 | Ga0157379_10075171 | Ga0157379_100751716 | 171 |
| 161 | 3300014968 | Ga0157379_10423030 | Ga0157379_104230303 | 171 |
| 162 | 3300014969 | Ga0157376_10085443 | Ga0157376_100854432 | 171 |
| 163 | 3300014969 | Ga0157376_10934967 | Ga0157376_109349671 | 171 |
| 164 | 3300014969 | Ga0157376_11159846 | Ga0157376_111598461 | 171 |
| 165 | 3300014969 | Ga0157376_11568433 | Ga0157376_115684332 | 171 |
| 166 | 3300027614 | Ga0209970_1026685 | Ga0209970_10266851 | 171 |
| 167 | 3300035085 | Ga0373929_0047280 | Ga0373929_0047280_278_793 | 171 |
| 168 | 3300035088 | Ga0373940_0013603 | Ga0373940_0013603_788_1303 | 171 |
| 169 | 3300035089 | Ga0373944_0037967 | Ga0373944_0037967_420_935 | 171 |
| 170 | 3300035090 | Ga0373949_0102832 | Ga0373949_0102832_165_680 | 171 |
| 171 | 3300035111 | Ga0373923_0045641 | Ga0373923_0045641_1204_1719 | 171 |
| 172 | 3300035114 | Ga0373939_0091802 | Ga0373939_0091802_433_948 | 171 |
| 173 | 3300035170 | Ga0373943_0291532 | Ga0373943_0291532_190_705 | 171 |
| 174 | 3300035170 | Ga0373943_0633540 | Ga0373943_0633540_95_610 | 171 |
| 175 | 3300035171 | Ga0373946_0150156 | Ga0373946_0150156_474_989 | 171 |
| 176 | 3300035171 | Ga0373946_0225040 | Ga0373946_0225040_11_526 | 171 |
| 177 | 3300035172 | Ga0373955_0081524 | Ga0373955_0081524_520_1035 | 171 |
| 178 | 3300035207 | Ga0373942_0119221 | Ga0373942_0119221_196_711 | 171 |
| 179 | 3300035410 | Ga0373924_0230272 | Ga0373924_0230272_35_550 | 171 |
| 180 | 3300035691 | Ga0373931_0008660 | Ga0373931_0008660_1859_2374 | 171 |
| 181 | 3300035691 | Ga0373931_0226087 | Ga0373931_0226087_71_586 | 171 |
| 182 | 3300035691 | Ga0373931_0244172 | Ga0373931_0244172_515_1030 | 171 |
| 183 | 3300035692 | Ga0373935_0144534 | Ga0373935_0144534_713_1228 | 171 |
| 184 | 3300035695 | Ga0373927_0108327 | Ga0373927_0108327_115_630 | 171 |
| 185 | 3300035695 | Ga0373927_0167679 | Ga0373927_0167679_184_699 | 171 |
| 186 | 3300035695 | Ga0373927_0264990 | Ga0373927_0264990_309_824 | 171 |
| 187 | 3300035724 | Ga0373933_0068855 | Ga0373933_0068855_1299_1814 | 171 |
| 188 | 3300035725 | Ga0373947_0114560 | Ga0373947_0114560_630_1145 | 171 |
| 189 | 3300036401 | Ga0373937_0072024 | Ga0373937_0072024_630_1145 | 171 |
| 190 | 3300036401 | Ga0373937_0458717 | Ga0373937_0458717_599_1114 | 171 |
| 191 | 3300037068 | Ga0373925_0226591 | Ga0373925_0226591_933_1448 | 171 |
| 192 | 3300037312 | Ga0395899_0100034 | Ga0395899_0100034_1280_1795 | 171 |
| 193 | 3300037471 | Ga0395905_0002507 | Ga0395905_0002507_11260_11775 | 171 |
| 194 | 3300037471 | Ga0395905_0013480 | Ga0395905_0013480_1493_2008 | 171 |
| 195 | 3300037471 | Ga0395905_0023115 | Ga0395905_0023115_503_1018 | 171 |
| 196 | 3300037471 | Ga0395905_0024456 | Ga0395905_0024456_5045_5560 | 171 |
| 197 | 3300037471 | Ga0395905_0038305 | Ga0395905_0038305_1248_1763 | 171 |
| 198 | 3300037471 | Ga0395905_0272105 | Ga0395905_0272105_279_794 | 171 |
| 199 | 3300037471 | Ga0395905_0959727 | Ga0395905_0959727_92_607 | 171 |
| 200 | 3300037853 | Ga0436364_1085432 | Ga0436364_1085432_101_616 | 171 |
| 201 | 3300039437 | Ga0436365_0827710 | Ga0436365_0827710_91_606 | 171 |
| 202 | 3300039437 | Ga0436365_1357722 | Ga0436365_1357722_2246_2761 | 171 |
| 203 | 3300039447 | Ga0436361_0405071 | Ga0436361_0405071_6427_6942 | 171 |
| 204 | 3300039447 | Ga0436361_0570086 | Ga0436361_0570086_5557_6072 | 171 |
| 205 | 3300041413 | Ga0439465_0010171 | Ga0439465_0010171_1825_2340 | 171 |
| 206 | 3300041444 | Ga0451790_23378 | Ga0451790_23378_662_1177 | 171 |
| 207 | 3300041446 | Ga0451794_49191 | Ga0451794_49191_175_690 | 171 |
| 208 | 3300041452 | Ga0451793_0637995 | Ga0451793_0637995_665_1180 | 171 |
| 209 | 3300041452 | Ga0451793_1712280 | Ga0451793_1712280_154_669 | 171 |
| 210 | 3300041453 | Ga0451797_1076999 | Ga0451797_1076999_256_771 | 171 |
| 211 | 3300041456 | Ga0451795_0329779 | Ga0451795_0329779_59_574 | 171 |
| 212 | 3300041456 | Ga0451795_0389599 | Ga0451795_0389599_840_1355 | 171 |
| 213 | 3300041458 | Ga0451798_0083945 | Ga0451798_0083945_240_755 | 171 |
| 214 | 3300041458 | Ga0451798_0656124 | Ga0451798_0656124_582_1097 | 171 |
| 215 | 3300041459 | Ga0451800_0747462 | Ga0451800_0747462_155_670 | 171 |
| 216 | 3300041459 | Ga0451800_1167133 | Ga0451800_1167133_431_946 | 171 |
| 217 | 3300041459 | Ga0451800_1232355 | Ga0451800_1232355_773_1288 | 171 |
| 218 | 3300041460 | Ga0451802_1098612 | Ga0451802_1098612_328_843 | 171 |
| 219 | 3300041460 | Ga0451802_1810119 | Ga0451802_1810119_705_1220 | 171 |
| 220 | 3300041461 | Ga0451805_010137 | Ga0451805_010137_135_650 | 171 |
| 221 | 3300041461 | Ga0451805_034079 | Ga0451805_034079_2262_2777 | 171 |
| 222 | 3300041463 | Ga0451804_0962788 | Ga0451804_0962788_119_634 | 171 |
| 223 | 3300041486 | Ga0451807_1114302 | Ga0451807_1114302_148_663 | 171 |
| 224 | 3300041492 | Ga0451835_0381887 | Ga0451835_0381887_164_679 | 171 |
| 225 | 3300041496 | Ga0451839_0941153 | Ga0451839_0941153_251_775 | 171 |
| 226 | 3300041496 | Ga0451839_1495449 | Ga0451839_1495449_239_754 | 171 |
| 227 | 3300041505 | Ga0451849_0242308 | Ga0451849_0242308_197_712 | 171 |
| 228 | 3300041506 | Ga0451850_38052 | Ga0451850_38052_617_1132 | 171 |
| 229 | 3300041507 | Ga0451851_1360765 | Ga0451851_1360765_336_851 | 171 |
| 230 | 3300041509 | Ga0451843_0687955 | Ga0451843_0687955_366_881 | 171 |
| 231 | 3300041509 | Ga0451843_1071877 | Ga0451843_1071877_104_619 | 171 |
| 232 | 3300041511 | Ga0451855_0043459 | Ga0451855_0043459_1372_1887 | 171 |
| 233 | 3300041511 | Ga0451855_0262815 | Ga0451855_0262815_462_977 | 171 |
| 234 | 3300041512 | Ga0451853_1066481 | Ga0451853_1066481_913_1428 | 171 |
| 235 | 3300041512 | Ga0451853_3108740 | Ga0451853_3108740_145_660 | 171 |
| 236 | 3300041997 | Ga0439431_0002412 | Ga0439431_0002412_2707_3222 | 171 |
| 237 | 3300042005 | Ga0439448_0042059 | Ga0439448_0042059_834_1349 | 171 |
| 238 | 3300042008 | Ga0439450_082887 | Ga0439450_082887_40_555 | 171 |
| 239 | 3300042012 | Ga0439455_0002630 | Ga0439455_0002630_613_1128 | 171 |
| 240 | 3300042012 | Ga0439455_0037486 | Ga0439455_0037486_641_1156 | 171 |
| 241 | 3300042120 | Ga0450917_000001 | Ga0450917_000001_4560_5075 | 171 |
| 242 | 3300042121 | Ga0450919_000025 | Ga0450919_000025_5768_6283 | 171 |
| 243 | 3300042124 | Ga0450922_012581 | Ga0450922_012581_105_620 | 171 |
| 244 | 3300042126 | Ga0450888_000936 | Ga0450888_000936_425_940 | 171 |
| 245 | 3300042126 | Ga0450888_024474 | Ga0450888_024474_34_549 | 171 |
| 246 | 3300042127 | Ga0450890_000549 | Ga0450890_000549_2741_3256 | 171 |
| 247 | 3300042128 | Ga0450897_024059 | Ga0450897_024059_81_596 | 171 |
| 248 | 3300042129 | Ga0450891_000262 | Ga0450891_000262_1227_1742 | 171 |
| 249 | 3300042130 | Ga0450892_001360 | Ga0450892_001360_1256_1771 | 171 |
| 250 | 3300042132 | Ga0450895_001799 | Ga0450895_001799_482_997 | 171 |
| 251 | 3300042134 | Ga0450898_024700 | Ga0450898_024700_406_921 | 171 |
| 252 | 3300042135 | Ga0450899_002878 | Ga0450899_002878_77_592 | 171 |
| 253 | 3300042137 | Ga0450902_009473 | Ga0450902_009473_21_536 | 171 |
| 254 | 3300042138 | Ga0450903_004499 | Ga0450903_004499_1113_1628 | 171 |
| 255 | 3300042139 | Ga0450904_002939 | Ga0450904_002939_378_893 | 171 |
| 256 | 3300042144 | Ga0450889_000161 | Ga0450889_000161_4908_5423 | 171 |
| 257 | 3300042147 | Ga0450910_028757 | Ga0450910_028757_299_814 | 171 |
| 258 | 3300042156 | Ga0439446_0028867 | Ga0439446_0028867_783_1298 | 171 |
| 259 | 3300042156 | Ga0439446_0055533 | Ga0439446_0055533_100_615 | 171 |
| 260 | 3300042156 | Ga0439446_0097753 | Ga0439446_0097753_122_637 | 171 |
| 261 | 3300042157 | Ga0439458_0032711 | Ga0439458_0032711_252_767 | 171 |
| 262 | 3300042157 | Ga0439458_0069996 | Ga0439458_0069996_259_774 | 171 |
| 263 | 3300042435 | Ga0439434_0007708 | Ga0439434_0007708_1641_2156 | 171 |
| 264 | 3300042435 | Ga0439434_0015184 | Ga0439434_0015184_789_1304 | 171 |
| 265 | 3300042435 | Ga0439434_0177712 | Ga0439434_0177712_137_652 | 171 |
| 266 | 3300042439 | Ga0439464_0057110 | Ga0439464_0057110_580_1095 | 171 |
| 267 | 3300042461 | Ga0439460_0002749 | Ga0439460_0002749_2207_2722 | 171 |
| 268 | 3300042531 | Ga0450918_000123 | Ga0450918_000123_8582_9097 | 171 |
| 269 | 3300042532 | Ga0450893_0002428 | Ga0450893_0002428_2090_2605 | 171 |
| 270 | 3300042876 | Ga0451577_0004247 | Ga0451577_0004247_7600_8115 | 171 |
| 271 | 3300042876 | Ga0451577_0069675 | Ga0451577_0069675_1171_1686 | 171 |
| 272 | 3300042876 | Ga0451577_0090029 | Ga0451577_0090029_1361_1876 | 171 |
| 273 | 3300042993 | Ga0439440_0072256 | Ga0439440_0072256_164_679 | 171 |
| 274 | 3300044656 | Ga0466969_0002589 | Ga0466969_0002589_6235_6750 | 171 |
| 275 | 3300044656 | Ga0466969_0012551 | Ga0466969_0012551_880_1395 | 171 |
| 276 | 3300044658 | Ga0466972_0026175 | Ga0466972_0026175_1808_2323 | 171 |
| 277 | 3300044673 | Ga0453683_0310561 | Ga0453683_0310561_364_879 | 171 |
| 278 | 3300044683 | Ga0466965_0008031 | Ga0466965_0008031_2052_2567 | 171 |
| 279 | 3300044683 | Ga0466965_0018301 | Ga0466965_0018301_785_1300 | 171 |
| 280 | 3300044683 | Ga0466965_0125518 | Ga0466965_0125518_203_718 | 171 |
| 281 | 3300044684 | Ga0466966_0021693 | Ga0466966_0021693_588_1103 | 171 |
| 282 | 3300044693 | Ga0466961_0005561 | Ga0466961_0005561_3822_4337 | 171 |
| 283 | 3300044693 | Ga0466961_0026432 | Ga0466961_0026432_1603_2118 | 171 |
| 284 | 3300044694 | Ga0466963_0537847 | Ga0466963_0537847_13_528 | 171 |
| 285 | 3300044706 | Ga0466964_0000637 | Ga0466964_0000637_6446_6961 | 171 |
| 286 | 3300044706 | Ga0466964_0003200 | Ga0466964_0003200_811_1326 | 171 |
| 287 | 3300044712 | Ga0453684_0040166 | Ga0453684_0040166_220_735 | 171 |
| 288 | 3300044712 | Ga0453684_0261576 | Ga0453684_0261576_951_1466 | 171 |
| 289 | 3300044712 | Ga0453684_0328109 | Ga0453684_0328109_461_976 | 171 |
| 290 | 3300044712 | Ga0453684_0472317 | Ga0453684_0472317_267_782 | 171 |
| 291 | 3300044712 | Ga0453684_0941811 | Ga0453684_0941811_56_592 | 171 |
| 292 | 3300044712 | Ga0453684_1311760 | Ga0453684_1311760_201_722 | 171 |
| 293 | 3300044719 | Ga0466971_0001482 | Ga0466971_0001482_1436_1951 | 171 |
| 294 | 3300044735 | Ga0466968_0012515 | Ga0466968_0012515_786_1301 | 171 |
| 295 | 3300044765 | Ga0466970_0025081 | Ga0466970_0025081_1027_1542 | 171 |
| 296 | 3300044765 | Ga0466970_0030706 | Ga0466970_0030706_1810_2325 | 171 |
| 297 | 3300044765 | Ga0466970_0164426 | Ga0466970_0164426_631_1146 | 171 |
| 298 | 3300044842 | Ga0466957_0006128 | Ga0466957_0006128_1580_2095 | 171 |
| 299 | 3300044842 | Ga0466957_0167035 | Ga0466957_0167035_451_966 | 171 |
| 300 | 3300044901 | Ga0466960_0076355 | Ga0466960_0076355_205_720 | 171 |
| 301 | 3300045049 | Ga0466959_0000855 | Ga0466959_0000855_8505_9020 | 171 |
| 302 | 3300045049 | Ga0466959_0014533 | Ga0466959_0014533_4487_5002 | 171 |
| 303 | 3300045051 | Ga0451576_0003595 | Ga0451576_0003595_16740_17255 | 171 |
| 304 | 3300045051 | Ga0451576_0075129 | Ga0451576_0075129_1523_2038 | 171 |
| 305 | 3300045051 | Ga0451576_0168870 | Ga0451576_0168870_934_1449 | 171 |
| 306 | 3300045051 | Ga0451576_0224308 | Ga0451576_0224308_47_562 | 171 |
| 307 | 3300045051 | Ga0451576_0815101 | Ga0451576_0815101_232_747 | 171 |
| 308 | 3300045051 | Ga0451576_0955282 | Ga0451576_0955282_226_741 | 171 |
| 309 | 3300045836 | Ga0466958_0002207 | Ga0466958_0002207_1857_2372 | 171 |
| 310 | 3300045836 | Ga0466958_0022101 | Ga0466958_0022101_1692_2207 | 171 |
| 311 | 3300045976 | Ga0466967_0003037 | Ga0466967_0003037_5915_6430 | 171 |
| 312 | 3300046454 | Ga0495592_0000203 | Ga0495592_0000203_41824_42339 | 171 |
| 313 | 3300046454 | Ga0495592_0114305 | Ga0495592_0114305_444_959 | 171 |
| 314 | 3300046457 | Ga0495590_0004188 | Ga0495590_0004188_3567_4082 | 171 |
| 315 | 3300046457 | Ga0495590_0011864 | Ga0495590_0011864_466_981 | 171 |
| 316 | 3300046459 | Ga0495629_0602559 | Ga0495629_0602559_24_539 | 171 |
| 317 | 3300046460 | Ga0495638_0050878 | Ga0495638_0050878_873_1388 | 171 |
| 318 | 3300046462 | Ga0495651_0117098 | Ga0495651_0117098_1115_1630 | 171 |
| 319 | 3300046462 | Ga0495651_0418407 | Ga0495651_0418407_297_812 | 171 |
| 320 | 3300046471 | Ga0495650_0007879 | Ga0495650_0007879_5050_5565 | 171 |
| 321 | 3300046472 | Ga0495580_0304712 | Ga0495580_0304712_246_761 | 171 |
| 322 | 3300046475 | Ga0495639_0020558 | Ga0495639_0020558_789_1304 | 171 |
| 323 | 3300046475 | Ga0495639_0103968 | Ga0495639_0103968_347_862 | 171 |
| 324 | 3300046477 | Ga0495664_0318737 | Ga0495664_0318737_175_690 | 171 |
| 325 | 3300046492 | Ga0495585_0010449 | Ga0495585_0010449_2241_2756 | 171 |
| 326 | 3300046492 | Ga0495585_0268620 | Ga0495585_0268620_134_649 | 171 |
| 327 | 3300046499 | Ga0495594_0207607 | Ga0495594_0207607_255_770 | 171 |
| 328 | 3300046507 | Ga0495606_0368524 | Ga0495606_0368524_200_715 | 171 |
| 329 | 3300046511 | Ga0495608_0083536 | Ga0495608_0083536_285_800 | 171 |
| 330 | 3300046512 | Ga0495610_0007369 | Ga0495610_0007369_2624_3139 | 171 |
| 331 | 3300046513 | Ga0495616_0074407 | Ga0495616_0074407_545_1060 | 171 |
| 332 | 3300046515 | Ga0495620_0021563 | Ga0495620_0021563_943_1458 | 171 |
| 333 | 3300046515 | Ga0495620_0048760 | Ga0495620_0048760_1277_1792 | 171 |
| 334 | 3300046515 | Ga0495620_0072683 | Ga0495620_0072683_838_1353 | 171 |
| 335 | 3300046515 | Ga0495620_0083017 | Ga0495620_0083017_743_1258 | 171 |
| 336 | 3300046515 | Ga0495620_0133376 | Ga0495620_0133376_176_691 | 171 |
| 337 | 3300046516 | Ga0495628_0102358 | Ga0495628_0102358_864_1379 | 171 |
| 338 | 3300046517 | Ga0495630_0118838 | Ga0495630_0118838_1340_1855 | 171 |
| 339 | 3300046518 | Ga0495631_0022122 | Ga0495631_0022122_1641_2156 | 171 |
| 340 | 3300046519 | Ga0495632_0014757 | Ga0495632_0014757_2727_3242 | 171 |
| 341 | 3300046519 | Ga0495632_0023097 | Ga0495632_0023097_2487_3002 | 171 |
| 342 | 3300046519 | Ga0495632_0046599 | Ga0495632_0046599_1453_1968 | 171 |
| 343 | 3300046519 | Ga0495632_0065630 | Ga0495632_0065630_242_757 | 171 |
| 344 | 3300046522 | Ga0495643_0019121 | Ga0495643_0019121_2678_3193 | 171 |
| 345 | 3300046522 | Ga0495643_0279924 | Ga0495643_0279924_146_661 | 171 |
| 346 | 3300046524 | Ga0495648_0268843 | Ga0495648_0268843_126_641 | 171 |
| 347 | 3300046528 | Ga0495642_0053512 | Ga0495642_0053512_223_738 | 171 |
| 348 | 3300046529 | Ga0495652_0528558 | Ga0495652_0528558_123_638 | 171 |
| 349 | 3300046530 | Ga0495654_0056414 | Ga0495654_0056414_111_626 | 171 |
| 350 | 3300046530 | Ga0495654_0129002 | Ga0495654_0129002_561_1076 | 171 |
| 351 | 3300046537 | Ga0495598_0020184 | Ga0495598_0020184_796_1311 | 171 |
| 352 | 3300046537 | Ga0495598_0026107 | Ga0495598_0026107_127_642 | 171 |
| 353 | 3300046537 | Ga0495598_0063178 | Ga0495598_0063178_244_759 | 171 |
| 354 | 3300046538 | Ga0495609_0127993 | Ga0495609_0127993_492_1007 | 171 |
| 355 | 3300046539 | Ga0495621_0012556 | Ga0495621_0012556_475_990 | 171 |
| 356 | 3300046539 | Ga0495621_0019298 | Ga0495621_0019298_1425_1940 | 171 |
| 357 | 3300046542 | Ga0495597_0092274 | Ga0495597_0092274_169_684 | 171 |
| 358 | 3300046543 | Ga0495645_0034282 | Ga0495645_0034282_2659_3174 | 171 |
| 359 | 3300046557 | Ga0495622_0022381 | Ga0495622_0022381_1418_1933 | 171 |
| 360 | 3300046558 | Ga0495633_0048161 | Ga0495633_0048161_668_1183 | 171 |
| 361 | 3300046558 | Ga0495633_0222627 | Ga0495633_0222627_330_845 | 171 |
| 362 | 3300046559 | Ga0495667_0115936 | Ga0495667_0115936_1152_1667 | 171 |
| 363 | 3300046615 | Ga0495656_0056918 | Ga0495656_0056918_461_976 | 171 |
| 364 | 3300046642 | Ga0495634_0205692 | Ga0495634_0205692_160_675 | 171 |
| 365 | 3300046648 | Ga0495611_0033426 | Ga0495611_0033426_530_1045 | 171 |
| 366 | 3300046660 | Ga0495625_0006868 | Ga0495625_0006868_4238_4753 | 171 |
| 367 | 3300046660 | Ga0495625_0039878 | Ga0495625_0039878_1888_2403 | 171 |
| 368 | 3300046663 | Ga0495635_0287125 | Ga0495635_0287125_218_733 | 171 |
| 369 | 3300046675 | Ga0495657_0288855 | Ga0495657_0288855_445_960 | 171 |
| 370 | 3300046680 | Ga0495646_0061137 | Ga0495646_0061137_1005_1520 | 171 |
| 371 | 3300046680 | Ga0495646_0198957 | Ga0495646_0198957_18_533 | 171 |
| 372 | 3300046683 | Ga0495658_0097472 | Ga0495658_0097472_701_1216 | 171 |
| 373 | 3300046689 | Ga0495613_0091108 | Ga0495613_0091108_451_966 | 171 |
| 374 | 3300046689 | Ga0495613_0120251 | Ga0495613_0120251_912_1427 | 171 |
| 375 | 3300046690 | Ga0495624_0074135 | Ga0495624_0074135_1306_1821 | 171 |
| 376 | 3300046691 | Ga0495670_0342235 | Ga0495670_0342235_119_634 | 171 |
| 377 | 3300046692 | Ga0495671_0161447 | Ga0495671_0161447_165_680 | 171 |
| 378 | 3300046692 | Ga0495671_0186886 | Ga0495671_0186886_65_580 | 171 |
| 379 | 3300046694 | Ga0495649_0006057 | Ga0495649_0006057_6154_6669 | 171 |
| 380 | 3300046794 | Ga0495589_0074447 | Ga0495589_0074447_57_572 | 171 |
| 381 | 3300046810 | Ga0495660_0092909 | Ga0495660_0092909_304_819 | 171 |
| 382 | 3300047317 | Ga0495604_0436213 | Ga0495604_0436213_284_799 | 171 |
| 383 | 3300047321 | Ga0495676_0010234 | Ga0495676_0010234_5554_6069 | 171 |
| 384 | 3300047321 | Ga0495676_0140426 | Ga0495676_0140426_549_1064 | 171 |
| 385 | 3300047322 | Ga0495680_0296214 | Ga0495680_0296214_477_992 | 171 |
| 386 | 3300047443 | Ga0495687_019359 | Ga0495687_019359_178_693 | 171 |
| 387 | 3300047443 | Ga0495687_036928 | Ga0495687_036928_537_1052 | 171 |
| 388 | 3300047469 | Ga0495673_0084126 | Ga0495673_0084126_120_635 | 171 |
| 389 | 3300047470 | Ga0495681_0051412 | Ga0495681_0051412_641_1156 | 171 |
| 390 | 3300047472 | Ga0495686_0004619 | Ga0495686_0004619_8990_9505 | 171 |
| 391 | 3300047472 | Ga0495686_0066900 | Ga0495686_0066900_1645_2160 | 171 |
| 392 | 3300047673 | Ga0495593_0038039 | Ga0495593_0038039_1521_2036 | 171 |
| 393 | 3300048088 | Ga0495602_0235589 | Ga0495602_0235589_198_713 | 171 |
| 394 | 3300048090 | Ga0495615_0017661 | Ga0495615_0017661_956_1471 | 171 |
| 395 | 3300048905 | Ga0496102_0047306 | Ga0496102_0047306_3344_3859 | 171 |
| 396 | 3300048905 | Ga0496102_0060302 | Ga0496102_0060302_863_1378 | 171 |
| 397 | 3300048905 | Ga0496102_0536484 | Ga0496102_0536484_13_528 | 171 |
| 398 | 3300048907 | Ga0496104_0042754 | Ga0496104_0042754_3513_4028 | 171 |
| 399 | 3300048907 | Ga0496104_0579646 | Ga0496104_0579646_22_537 | 171 |
| 400 | 3300048908 | Ga0496105_0187486 | Ga0496105_0187486_915_1430 | 171 |
| 401 | 3300048908 | Ga0496105_0259562 | Ga0496105_0259562_442_957 | 171 |
| 402 | 3300048909 | Ga0496106_0745569 | Ga0496106_0745569_139_654 | 171 |
| 403 | 3300048910 | Ga0496107_0171958 | Ga0496107_0171958_272_787 | 171 |
| 404 | 3300048911 | Ga0496108_0005999 | Ga0496108_0005999_6798_7313 | 171 |
| 405 | 3300048911 | Ga0496108_0009350 | Ga0496108_0009350_5861_6376 | 171 |
| 406 | 3300048911 | Ga0496108_0042133 | Ga0496108_0042133_944_1459 | 171 |
| 407 | 3300048911 | Ga0496108_0089279 | Ga0496108_0089279_514_1029 | 171 |
| 408 | 3300048912 | Ga0496109_0084426 | Ga0496109_0084426_588_1103 | 171 |
| 409 | 3300048915 | Ga0496112_0018422 | Ga0496112_0018422_4096_4611 | 171 |
| 410 | 3300048916 | Ga0496113_0391549 | Ga0496113_0391549_381_896 | 171 |
| 411 | 3300048917 | Ga0496114_0010053 | Ga0496114_0010053_2534_3049 | 171 |
| 412 | 3300048927 | Ga0496124_0030272 | Ga0496124_0030272_966_1481 | 171 |
| 413 | 3300048928 | Ga0496125_0448023 | Ga0496125_0448023_53_568 | 171 |
| 414 | 3300049127 | Ga0501306_000061 | Ga0501306_000061_1048_1563 | 171 |
| 415 | 3300049127 | Ga0501306_011445 | Ga0501306_011445_130_645 | 171 |
| 416 | 3300049128 | Ga0501308_000386 | Ga0501308_000386_2127_2642 | 171 |
| 417 | 3300049128 | Ga0501308_008957 | Ga0501308_008957_486_1001 | 171 |
| 418 | 3300049129 | Ga0501309_000014 | Ga0501309_000014_5194_5709 | 171 |
| 419 | 3300049129 | Ga0501309_007735 | Ga0501309_007735_549_1064 | 171 |
| 420 | 3300049129 | Ga0501309_013195 | Ga0501309_013195_70_585 | 171 |
| 421 | 3300049129 | Ga0501309_018814 | Ga0501309_018814_127_642 | 171 |
| 422 | 3300049129 | Ga0501309_036132 | Ga0501309_036132_131_646 | 171 |
| 423 | 3300049130 | Ga0501310_000059 | Ga0501310_000059_6176_6691 | 171 |
| 424 | 3300049130 | Ga0501310_004096 | Ga0501310_004096_850_1365 | 171 |
| 425 | 3300049160 | Ga0501304_000014 | Ga0501304_000014_2327_2842 | 171 |
| 426 | 3300049160 | Ga0501304_000572 | Ga0501304_000572_201_716 | 171 |
| 427 | 3300049160 | Ga0501304_004750 | Ga0501304_004750_119_634 | 171 |
| 428 | 3300049160 | Ga0501304_009452 | Ga0501304_009452_192_707 | 171 |
| 429 | 3300049160 | Ga0501304_022028 | Ga0501304_022028_82_597 | 171 |
| 430 | 3300049161 | Ga0501305_000004 | Ga0501305_000004_6023_6538 | 171 |
| 431 | 3300049161 | Ga0501305_007431 | Ga0501305_007431_483_998 | 171 |
| 432 | 3300049161 | Ga0501305_009585 | Ga0501305_009585_530_1045 | 171 |
| 433 | 3300049161 | Ga0501305_013714 | Ga0501305_013714_378_893 | 171 |
| 434 | 3300049161 | Ga0501305_018025 | Ga0501305_018025_76_591 | 171 |
| 435 | 3300049162 | Ga0501307_000029 | Ga0501307_000029_555_1070 | 171 |
| 436 | 3300049162 | Ga0501307_009557 | Ga0501307_009557_83_598 | 171 |
| 437 | 3300049162 | Ga0501307_032343 | Ga0501307_032343_38_553 | 171 |
| 438 | 3300049517 | Ga0501294_004126 | Ga0501294_004126_222_737 | 171 |
| 439 | 3300049521 | Ga0501298_007474 | Ga0501298_007474_1061_1576 | 171 |
| 440 | 3300049523 | Ga0501300_000354 | Ga0501300_000354_964_1479 | 171 |
| 441 | 3300049526 | Ga0501303_013116 | Ga0501303_013116_126_641 | 171 |
| 442 | 3300049527 | Ga0501311_000038 | Ga0501311_000038_2335_2850 | 171 |
| 443 | 3300049527 | Ga0501311_037544 | Ga0501311_037544_169_684 | 171 |
| 444 | 3300049527 | Ga0501311_049772 | Ga0501311_049772_24_539 | 171 |
| 445 | 3300049528 | Ga0501312_000016 | Ga0501312_000016_6890_7405 | 171 |
| 446 | 3300049528 | Ga0501312_002743 | Ga0501312_002743_855_1370 | 171 |
| 447 | 3300049528 | Ga0501312_050778 | Ga0501312_050778_113_628 | 171 |
| 448 | 3300049528 | Ga0501312_063524 | Ga0501312_063524_77_592 | 171 |
| 449 | 3300049530 | Ga0501314_000017 | Ga0501314_000017_6024_6539 | 171 |
| 450 | 3300049530 | Ga0501314_007260 | Ga0501314_007260_305_820 | 171 |
| 451 | 3300049530 | Ga0501314_019295 | Ga0501314_019295_172_687 | 171 |
| 452 | 3300049531 | Ga0501315_000346 | Ga0501315_000346_1184_1699 | 171 |
| 453 | 3300049531 | Ga0501315_014533 | Ga0501315_014533_69_584 | 171 |
| 454 | 3300049531 | Ga0501315_050534 | Ga0501315_050534_83_598 | 171 |
| 455 | 3300049532 | Ga0501316_001567 | Ga0501316_001567_1130_1645 | 171 |
| 456 | 3300049533 | Ga0501317_000290 | Ga0501317_000290_1592_2107 | 171 |
| 457 | 3300049534 | Ga0501318_000131 | Ga0501318_000131_2055_2570 | 171 |
| 458 | 3300049534 | Ga0501318_000548 | Ga0501318_000548_1505_2020 | 171 |
| 459 | 3300049534 | Ga0501318_036014 | Ga0501318_036014_119_634 | 171 |
| 460 | 3300049535 | Ga0501319_000082 | Ga0501319_000082_765_1280 | 171 |
| 461 | 3300049535 | Ga0501319_000240 | Ga0501319_000240_1470_1985 | 171 |
| 462 | 3300049536 | Ga0501320_000131 | Ga0501320_000131_608_1123 | 171 |
| 463 | 3300049536 | Ga0501320_000368 | Ga0501320_000368_886_1401 | 171 |
| 464 | 3300049536 | Ga0501320_000489 | Ga0501320_000489_331_846 | 171 |
| 465 | 3300049536 | Ga0501320_002265 | Ga0501320_002265_246_761 | 171 |
| 466 | 3300049538 | Ga0501322_013354 | Ga0501322_013354_51_566 | 171 |
| 467 | 3300049539 | Ga0501323_000187 | Ga0501323_000187_1156_1671 | 171 |
| 468 | 3300049539 | Ga0501323_000627 | Ga0501323_000627_220_735 | 171 |
| 469 | 3300049539 | Ga0501323_000789 | Ga0501323_000789_855_1370 | 171 |
| 470 | 3300049539 | Ga0501323_008377 | Ga0501323_008377_645_1160 | 171 |
| 471 | 3300049539 | Ga0501323_044417 | Ga0501323_044417_37_552 | 171 |
| 472 | 3300049540 | Ga0501324_000208 | Ga0501324_000208_1947_2462 | 171 |
| 473 | 3300049541 | Ga0501325_000034 | Ga0501325_000034_2189_2704 | 171 |
| 474 | 3300049541 | Ga0501325_007278 | Ga0501325_007278_290_805 | 171 |
| 475 | 3300049543 | Ga0501327_04826 | Ga0501327_04826_204_719 | 171 |
| 476 | 3300049543 | Ga0501327_04896 | Ga0501327_04896_214_729 | 171 |
| 477 | 3300049544 | Ga0501328_00214 | Ga0501328_00214_558_1073 | 171 |
| 478 | 3300049545 | Ga0501329_02964 | Ga0501329_02964_253_768 | 171 |
| 479 | 3300049549 | Ga0501333_001525 | Ga0501333_001525_194_709 | 171 |
| 480 | 3300049551 | Ga0501335_007840 | Ga0501335_007840_211_726 | 171 |
| 481 | 3300049552 | Ga0501336_001307 | Ga0501336_001307_221_736 | 171 |
| 482 | 3300049556 | Ga0501340_002905 | Ga0501340_002905_357_872 | 171 |
| 483 | 3300049579 | Ga0501043_0000090 | Ga0501043_0000090_72339_72854 | 171 |
| 484 | 3300049580 | Ga0501046_0000126 | Ga0501046_0000126_72337_72852 | 171 |
| 485 | 3300049580 | Ga0501046_0557944 | Ga0501046_0557944_152_667 | 171 |
| 486 | 3300049581 | Ga0501047_0000160 | Ga0501047_0000160_8483_8998 | 171 |
| 487 | 3300049582 | Ga0501048_0003429 | Ga0501048_0003429_11040_11555 | 171 |
| 488 | 3300049652 | Ga0501202_000808 | Ga0501202_000808_2168_2683 | 171 |
| 489 | 3300049653 | Ga0501206_001476 | Ga0501206_001476_191_706 | 171 |
| 490 | 3300049653 | Ga0501206_015309 | Ga0501206_015309_413_928 | 171 |
| 491 | 3300049654 | Ga0501207_023110 | Ga0501207_023110_128_643 | 171 |
| 492 | 3300049658 | Ga0501211_000022 | Ga0501211_000022_5075_5590 | 171 |
| 493 | 3300049662 | Ga0501222_001695 | Ga0501222_001695_238_753 | 171 |
| 494 | 3300049663 | Ga0501223_013997 | Ga0501223_013997_279_794 | 171 |
| 495 | 3300049665 | Ga0501227_003969 | Ga0501227_003969_1027_1542 | 171 |
| 496 | 3300049666 | Ga0501228_000607 | Ga0501228_000607_547_1062 | 171 |
| 497 | 3300049668 | Ga0501233_042034 | Ga0501233_042034_351_866 | 171 |
| 498 | 3300049669 | Ga0501235_001228 | Ga0501235_001228_2262_2777 | 171 |
| 499 | 3300049670 | Ga0501236_005248 | Ga0501236_005248_806_1321 | 171 |
| 500 | 3300049679 | Ga0501249_003813 | Ga0501249_003813_2104_2619 | 171 |
| 501 | 3300049679 | Ga0501249_163704 | Ga0501249_163704_15_530 | 171 |
| 502 | 3300049682 | Ga0501252_006049 | Ga0501252_006049_740_1255 | 171 |
| 503 | 3300049683 | Ga0501253_000109 | Ga0501253_000109_4656_5171 | 171 |
| 504 | 3300049686 | Ga0501257_022365 | Ga0501257_022365_652_1167 | 171 |
| 505 | 3300049687 | Ga0501258_000137 | Ga0501258_000137_3453_3968 | 171 |
| 506 | 3300049704 | Ga0501221_001094 | Ga0501221_001094_2394_2909 | 171 |
| 507 | 3300049705 | Ga0501225_0006245 | Ga0501225_0006245_963_1478 | 171 |
| 508 | 3300049706 | Ga0501229_001006 | Ga0501229_001006_284_799 | 171 |
| 509 | 3300049707 | Ga0501234_011220 | Ga0501234_011220_609_1124 | 171 |
| 510 | 3300049757 | Ga0501232_001247 | Ga0501232_001247_216_731 | 171 |
| 511 | 3300049759 | Ga0501262_000590 | Ga0501262_000590_91_606 | 171 |
| 512 | 3300049759 | Ga0501262_009254 | Ga0501262_009254_134_649 | 171 |
| 513 | 3300049764 | Ga0501267_004614 | Ga0501267_004614_707_1222 | 171 |
| 514 | 3300049768 | Ga0501271_001925 | Ga0501271_001925_747_1262 | 171 |
| 515 | 3300049769 | Ga0501272_000140 | Ga0501272_000140_1433_1948 | 171 |
| 516 | 3300049770 | Ga0501273_023893 | Ga0501273_023893_107_622 | 171 |
| 517 | 3300049778 | Ga0501282_018464 | Ga0501282_018464_127_642 | 171 |
| 518 | 3300049779 | Ga0501283_012253 | Ga0501283_012253_596_1111 | 171 |
| 519 | 3300049822 | Ga0501035_1171299 | Ga0501035_1171299_57_572 | 171 |
| 520 | 3300049823 | Ga0501044_0057237 | Ga0501044_0057237_1645_2160 | 171 |
| 521 | 3300049824 | Ga0501045_0000882 | Ga0501045_0000882_2964_3479 | 171 |
| 522 | 3300049853 | Ga0501226_002381 | Ga0501226_002381_266_781 | 171 |
| 523 | 3300050489 | nmdc:mga03683_107933_c1 | nmdc:mga03683_107933_c1_692_1207 | 171 |
| 524 | 3300050489 | nmdc:mga03683_133365_c1 | nmdc:mga03683_133365_c1_192_707 | 171 |
| 525 | 3300050489 | nmdc:mga03683_177263_c1 | nmdc:mga03683_177263_c1_381_896 | 171 |
| 526 | 3300050489 | nmdc:mga03683_18745_c1 | nmdc:mga03683_18745_c1_875_1390 | 171 |
| 527 | 3300050489 | nmdc:mga03683_63522_c2 | nmdc:mga03683_63522_c2_179_694 | 171 |
| 528 | 3300050489 | nmdc:mga03683_77659_c1 | nmdc:mga03683_77659_c1_20_535 | 171 |
| 529 | 3300050490 | nmdc:mga03n38_356243_c1 | nmdc:mga03n38_356243_c1_234_749 | 171 |
| 530 | 3300050490 | nmdc:mga03n38_375198_c1 | nmdc:mga03n38_375198_c1_17_532 | 171 |
| 531 | 3300050490 | nmdc:mga03n38_4851_c1 | nmdc:mga03n38_4851_c1_2773_3288 | 171 |
| 532 | 3300050491 | nmdc:mga00v17_103467_c1 | nmdc:mga00v17_103467_c1_477_992 | 171 |
| 533 | 3300050491 | nmdc:mga00v17_113515_c1 | nmdc:mga00v17_113515_c1_291_806 | 171 |
| 534 | 3300050491 | nmdc:mga00v17_17620_c1 | nmdc:mga00v17_17620_c1_2160_2675 | 171 |
| 535 | 3300050491 | nmdc:mga00v17_325496_c1 | nmdc:mga00v17_325496_c1_314_829 | 171 |
| 536 | 3300050493 | nmdc:mga0k408_1021_c1 | nmdc:mga0k408_1021_c1_9578_10093 | 171 |
| 537 | 3300050493 | nmdc:mga0k408_12806_c1 | nmdc:mga0k408_12806_c1_2813_3328 | 171 |
| 538 | 3300050493 | nmdc:mga0k408_137955_c1 | nmdc:mga0k408_137955_c1_420_935 | 171 |
| 539 | 3300050493 | nmdc:mga0k408_153215_c1 | nmdc:mga0k408_153215_c1_439_954 | 171 |
| 540 | 3300050493 | nmdc:mga0k408_165490_c1 | nmdc:mga0k408_165490_c1_300_815 | 171 |
| 541 | 3300050493 | nmdc:mga0k408_17134_c1 | nmdc:mga0k408_17134_c1_2375_2890 | 171 |
| 542 | 3300050493 | nmdc:mga0k408_172222_c1 | nmdc:mga0k408_172222_c1_52_567 | 171 |
| 543 | 3300050493 | nmdc:mga0k408_173647_c1 | nmdc:mga0k408_173647_c1_572_1087 | 171 |
| 544 | 3300050493 | nmdc:mga0k408_214738_c1 | nmdc:mga0k408_214738_c1_417_932 | 171 |
| 545 | 3300050493 | nmdc:mga0k408_219_c1 | nmdc:mga0k408_219_c1_8581_9096 | 171 |
| 546 | 3300050493 | nmdc:mga0k408_22144_c1 | nmdc:mga0k408_22144_c1_17_532 | 171 |
| 547 | 3300050493 | nmdc:mga0k408_23786_c1 | nmdc:mga0k408_23786_c1_1574_2089 | 171 |
| 548 | 3300050493 | nmdc:mga0k408_249623_c1 | nmdc:mga0k408_249623_c1_135_650 | 171 |
| 549 | 3300050493 | nmdc:mga0k408_256246_c1 | nmdc:mga0k408_256246_c1_402_917 | 171 |
| 550 | 3300050493 | nmdc:mga0k408_28249_c1 | nmdc:mga0k408_28249_c1_991_1506 | 171 |
| 551 | 3300050493 | nmdc:mga0k408_34347_c1 | nmdc:mga0k408_34347_c1_2136_2651 | 171 |
| 552 | 3300050493 | nmdc:mga0k408_43703_c1 | nmdc:mga0k408_43703_c1_1644_2159 | 171 |
| 553 | 3300050493 | nmdc:mga0k408_46982_c1 | nmdc:mga0k408_46982_c1_349_864 | 171 |
| 554 | 3300050493 | nmdc:mga0k408_49108_c1 | nmdc:mga0k408_49108_c1_155_670 | 171 |
| 555 | 3300050493 | nmdc:mga0k408_497415_c1 | nmdc:mga0k408_497415_c1_57_572 | 171 |
| 556 | 3300050493 | nmdc:mga0k408_57150_c1 | nmdc:mga0k408_57150_c1_531_1046 | 171 |
| 557 | 3300050493 | nmdc:mga0k408_59396_c1 | nmdc:mga0k408_59396_c1_995_1510 | 171 |
| 558 | 3300050493 | nmdc:mga0k408_59597_c1 | nmdc:mga0k408_59597_c1_105_620 | 171 |
| 559 | 3300050493 | nmdc:mga0k408_61835_c1 | nmdc:mga0k408_61835_c1_1133_1648 | 171 |
| 560 | 3300050493 | nmdc:mga0k408_678497_c1 | nmdc:mga0k408_678497_c1_71_586 | 171 |
| 561 | 3300050493 | nmdc:mga0k408_6946_c1 | nmdc:mga0k408_6946_c1_5318_5833 | 171 |
| 562 | 3300050494 | nmdc:mga06z11_11386_c1 | nmdc:mga06z11_11386_c1_2351_2866 | 171 |
| 563 | 3300050494 | nmdc:mga06z11_229350_c1 | nmdc:mga06z11_229350_c1_483_998 | 171 |
| 564 | 3300050494 | nmdc:mga06z11_3023_c1 | nmdc:mga06z11_3023_c1_3317_3832 | 171 |
| 565 | 3300050494 | nmdc:mga06z11_880689_c1 | nmdc:mga06z11_880689_c1_12_527 | 171 |
| 566 | 3300050496 | nmdc:mga07m45_15127_c1 | nmdc:mga07m45_15127_c1_2232_2747 | 171 |
| 567 | 3300050496 | nmdc:mga07m45_196968_c1 | nmdc:mga07m45_196968_c1_631_1146 | 171 |
| 568 | 3300050496 | nmdc:mga07m45_20386_c1 | nmdc:mga07m45_20386_c1_2625_3140 | 171 |
| 569 | 3300050496 | nmdc:mga07m45_250451_c1 | nmdc:mga07m45_250451_c1_91_606 | 171 |
| 570 | 3300050496 | nmdc:mga07m45_2931_c1 | nmdc:mga07m45_2931_c1_2316_2831 | 171 |
| 571 | 3300050496 | nmdc:mga07m45_69529_c1 | nmdc:mga07m45_69529_c1_819_1334 | 171 |
| 572 | 3300050496 | nmdc:mga07m45_71727_c1 | nmdc:mga07m45_71727_c1_452_967 | 171 |
| 573 | 3300050496 | nmdc:mga07m45_72406_c1 | nmdc:mga07m45_72406_c1_426_941 | 171 |
| 574 | 3300050496 | nmdc:mga07m45_74068_c1 | nmdc:mga07m45_74068_c1_492_1007 | 171 |
| 575 | 3300050507 | nmdc:mga05p37_180274_c1 | nmdc:mga05p37_180274_c1_145_660 | 171 |
| 576 | 3300050509 | nmdc:mga0qj67_50093_c1 | nmdc:mga0qj67_50093_c1_631_1146 | 171 |
| 577 | 3300050511 | nmdc:mga08y16_636309_c1 | nmdc:mga08y16_636309_c1_356_871 | 171 |
| 578 | 3300050516 | nmdc:mga0sz30_183925_c1 | nmdc:mga0sz30_183925_c1_35_550 | 171 |
| 579 | 3300050516 | nmdc:mga0sz30_23261_c1 | nmdc:mga0sz30_23261_c1_1726_2241 | 171 |
| 580 | 3300050516 | nmdc:mga0sz30_3989_c1 | nmdc:mga0sz30_3989_c1_3306_3821 | 171 |
| 581 | 3300053085 | Ga0495619_0475112 | Ga0495619_0475112_185_700 | 171 |
| 582 | 3300053086 | Ga0500578_0000292 | Ga0500578_0000292_60552_61067 | 171 |
| 583 | 3300053086 | Ga0500578_0201137 | Ga0500578_0201137_472_987 | 171 |
| 584 | 3300053088 | Ga0500644_0003475 | Ga0500644_0003475_2757_3272 | 171 |
| 585 | 3300053088 | Ga0500644_0232343 | Ga0500644_0232343_33_548 | 171 |
| 586 | 3300053090 | Ga0500646_0014216 | Ga0500646_0014216_1331_1846 | 171 |
| 587 | 3300053090 | Ga0500646_0221856 | Ga0500646_0221856_101_616 | 171 |
| 588 | 3300053093 | Ga0500651_0000274 | Ga0500651_0000274_13167_13682 | 171 |
| 589 | 3300053093 | Ga0500651_0129786 | Ga0500651_0129786_841_1356 | 171 |
| 590 | 3300053108 | Ga0500562_019007 | Ga0500562_019007_166_681 | 171 |
| 591 | 3300053117 | Ga0500593_000235 | Ga0500593_000235_16231_16746 | 171 |
| 592 | 3300053118 | Ga0500594_0013014 | Ga0500594_0013014_1290_1805 | 171 |
| 593 | 3300053126 | Ga0500621_142333 | Ga0500621_142333_181_696 | 171 |
| 594 | 3300053129 | Ga0500628_006199 | Ga0500628_006199_1310_1825 | 171 |
| 595 | 3300053130 | Ga0500642_0007842 | Ga0500642_0007842_31_546 | 171 |
| 596 | 3300053131 | Ga0500652_000400 | Ga0500652_000400_9579_10094 | 171 |
| 597 | 3300053131 | Ga0500652_069558 | Ga0500652_069558_462_977 | 171 |
| 598 | 3300053131 | Ga0500652_135627 | Ga0500652_135627_18_533 | 171 |
| 599 | 3300053133 | Ga0500655_012927 | Ga0500655_012927_198_713 | 171 |
| 600 | 3300053133 | Ga0500655_016385 | Ga0500655_016385_708_1223 | 171 |
| 601 | 3300053134 | Ga0500658_0026976 | Ga0500658_0026976_655_1170 | 171 |
| 602 | 3300053136 | Ga0500559_0000097 | Ga0500559_0000097_665_1180 | 171 |
| 603 | 3300053139 | Ga0500568_0015583 | Ga0500568_0015583_1908_2423 | 171 |
| 604 | 3300053139 | Ga0500568_0065376 | Ga0500568_0065376_23_538 | 171 |
| 605 | 3300053139 | Ga0500568_0179181 | Ga0500568_0179181_27_542 | 171 |
| 606 | 3300053142 | Ga0500577_0017376 | Ga0500577_0017376_758_1273 | 171 |
| 607 | 3300053148 | Ga0500590_007064 | Ga0500590_007064_4824_5339 | 171 |
| 608 | 3300053151 | Ga0500604_0040251 | Ga0500604_0040251_31_546 | 171 |
| 609 | 3300053154 | Ga0500619_000012 | Ga0500619_000012_48670_49185 | 171 |
| 610 | 3300053155 | Ga0500620_057705 | Ga0500620_057705_158_673 | 171 |
| 611 | 3300053156 | Ga0500622_0000198 | Ga0500622_0000198_36036_36551 | 171 |
| 612 | 3300053156 | Ga0500622_0000978 | Ga0500622_0000978_4225_4740 | 171 |
| 613 | 3300053156 | Ga0500622_0001316 | Ga0500622_0001316_11038_11553 | 171 |
| 614 | 3300053156 | Ga0500622_0071046 | Ga0500622_0071046_865_1380 | 171 |
| 615 | 3300053160 | Ga0500633_0085745 | Ga0500633_0085745_132_647 | 171 |
| 616 | 3300053736 | Ga0500599_015505 | Ga0500599_015505_438_953 | 171 |
| 617 | 3300053739 | Ga0500587_000541 | Ga0500587_000541_3697_4212 | 171 |
| 618 | 3300053739 | Ga0500587_006132 | Ga0500587_006132_97_612 | 171 |
| 619 | 3300055283 | Ga0500661_007894 | Ga0500661_007894_882_1397 | 171 |
| 620 | 3300055283 | Ga0500661_024419 | Ga0500661_024419_165_680 | 171 |
| 621 | 3300061719 | Ga0466962_0000718 | Ga0466962_0000718_5713_6228 | 171 |
| 622 | 3300061719 | Ga0466962_0014522 | Ga0466962_0014522_637_1152 | 171 |
| 623 | iso_pu_bacteria | 2585428057 | 2587725921 | 173 |
| 624 | iso_pu_bacteria | 2585428058 | 2587735572 | 173 |
| 625 | iso_pu_bacteria | 2585428062 | 2587758989 | 173 |
| 626 | iso_pu_bacteria | 2588253510 | 2588292866 | 173 |
| 627 | iso_pu_bacteria | 2643221544 | 2643746685 | 173 |
| 628 | iso_pu_bacteria | 2643221585 | 2643937423 | 173 |
| 629 | iso_pu_bacteria | 2643221592 | 2643967975 | 173 |
| 630 | iso_pu_bacteria | 2643221625 | 2644143125 | 173 |
| 631 | iso_pu_bacteria | 2643221639 | 2644218751 | 173 |
| 632 | iso_pu_bacteria | 2643221644 | 2644247749 | 173 |
| 633 | iso_pu_bacteria | 2643221646 | 2644256838 | 173 |
| 634 | iso_pu_bacteria | 2643221648 | 2644271787 | 173 |
| 635 | iso_pu_bacteria | 2643221654 | 2644305903 | 173 |
| 636 | iso_pu_bacteria | 2643221656 | 2644314961 | 173 |
| 637 | iso_pu_bacteria | 2738541337 | 2739057974 | 173 |
| 638 | iso_pu_bacteria | 2831864461 | 2831867516 | 173 |
| 639 | iso_pu_bacteria | 2886848708 | 2886854502 | 173 |
| 640 | 2162886007 | SwRhRL2b_contig_690899 | SwRhRL2b_0801.00000520 | 177 |
| 641 | 3300002705 | JGI25156J39149_1016366 | JGI25156J39149_10163662 | 177 |
| 642 | 3300002705 | JGI25156J39149_1019922 | JGI25156J39149_10199222 | 177 |
| 643 | 3300002774 | JGI25150J39212_1003907 | JGI25150J39212_10039073 | 177 |
| 644 | 3300003161 | Ga0006765J45826_106373 | Ga0006765J45826_1063737 | 177 |
| 645 | 3300003215 | JGI25153J46596_10008637 | JGI25153J46596_100086374 | 177 |
| 646 | 3300003305 | Ga0006770J48903_1001899 | Ga0006770J48903_100189910 | 177 |
| 647 | 3300003308 | Ga0006777J48905_1014855 | Ga0006777J48905_10148556 | 177 |
| 648 | 3300003574 | Ga0007410J51695_1005226 | Ga0007410J51695_10052267 | 177 |
| 649 | 3300003574 | Ga0007410J51695_1028665 | Ga0007410J51695_10286656 | 177 |
| 650 | 3300003575 | Ga0007409J51694_1041611 | Ga0007409J51694_10416112 | 177 |
| 651 | 3300003693 | Ga0032354_1038952 | Ga0032354_10389524 | 177 |
| 652 | 3300003693 | Ga0032354_1072421 | Ga0032354_10724212 | 177 |
| 653 | 3300003761 | Ga0055535_1003662 | Ga0055535_10036622 | 177 |
| 654 | 3300003763 | Ga0055529_1000322 | Ga0055529_100032243 | 177 |
| 655 | 3300003771 | Ga0055526_1000791 | Ga0055526_100079114 | 177 |
| 656 | 3300003775 | Ga0055524_1000140 | Ga0055524_100014018 | 177 |
| 657 | 3300003790 | Ga0055528_1069011 | Ga0055528_10690111 | 177 |
| 658 | 3300003791 | Ga0055530_10006458 | Ga0055530_100064587 | 177 |
| 659 | 3300003792 | Ga0055540_1000133 | Ga0055540_10001336 | 177 |
| 660 | 3300003792 | Ga0055540_1029907 | Ga0055540_10299072 | 177 |
| 661 | 3300003794 | Ga0055531_10002079 | Ga0055531_1000207915 | 177 |
| 662 | 3300003794 | Ga0055531_10002114 | Ga0055531_1000211415 | 177 |
| 663 | 3300005262 | Ga0065165_1006303 | Ga0065165_100630310 | 177 |
| 664 | 3300005262 | Ga0065165_1028112 | Ga0065165_10281123 | 177 |
| 665 | 3300005290 | Ga0065712_10087248 | Ga0065712_100872482 | 177 |
| 666 | 3300005293 | Ga0065715_10005249 | Ga0065715_100052492 | 177 |
| 667 | 3300005293 | Ga0065715_10023020 | Ga0065715_100230204 | 177 |
| 668 | 3300005295 | Ga0065707_10255698 | Ga0065707_102556982 | 177 |
| 669 | 3300005327 | Ga0070658_10427594 | Ga0070658_104275941 | 177 |
| 670 | 3300005328 | Ga0070676_10021276 | Ga0070676_100212765 | 177 |
| 671 | 3300005328 | Ga0070676_10093888 | Ga0070676_100938882 | 177 |
| 672 | 3300005328 | Ga0070676_10372716 | Ga0070676_103727162 | 177 |
| 673 | 3300005328 | Ga0070676_10916024 | Ga0070676_109160241 | 177 |
| 674 | 3300005328 | Ga0070676_11043051 | Ga0070676_110430511 | 177 |
| 675 | 3300005329 | Ga0070683_100631138 | Ga0070683_1006311381 | 177 |
| 676 | 3300005329 | Ga0070683_100645299 | Ga0070683_1006452992 | 177 |
| 677 | 3300005330 | Ga0070690_100006927 | Ga0070690_1000069278 | 177 |
| 678 | 3300005330 | Ga0070690_100231854 | Ga0070690_1002318542 | 177 |
| 679 | 3300005330 | Ga0070690_100276410 | Ga0070690_1002764101 | 177 |
| 680 | 3300005331 | Ga0070670_100054237 | Ga0070670_1000542373 | 177 |
| 681 | 3300005331 | Ga0070670_100064589 | Ga0070670_1000645893 | 177 |
| 682 | 3300005331 | Ga0070670_100065507 | Ga0070670_1000655075 | 177 |
| 683 | 3300005331 | Ga0070670_100816423 | Ga0070670_1008164232 | 177 |
| 684 | 3300005331 | Ga0070670_101131033 | Ga0070670_1011310332 | 177 |
| 685 | 3300005333 | Ga0070677_10017315 | Ga0070677_100173154 | 177 |
| 686 | 3300005333 | Ga0070677_10146542 | Ga0070677_101465421 | 177 |
| 687 | 3300005334 | Ga0068869_100077114 | Ga0068869_1000771144 | 177 |
| 688 | 3300005334 | Ga0068869_100146255 | Ga0068869_1001462552 | 177 |
| 689 | 3300005334 | Ga0068869_100257683 | Ga0068869_1002576832 | 177 |
| 690 | 3300005334 | Ga0068869_100283533 | Ga0068869_1002835332 | 177 |
| 691 | 3300005334 | Ga0068869_100284560 | Ga0068869_1002845602 | 177 |
| 692 | 3300005334 | Ga0068869_100547670 | Ga0068869_1005476702 | 177 |
| 693 | 3300005335 | Ga0070666_10056809 | Ga0070666_100568095 | 177 |
| 694 | 3300005335 | Ga0070666_10122448 | Ga0070666_101224483 | 177 |
| 695 | 3300005335 | Ga0070666_10343207 | Ga0070666_103432072 | 177 |
| 696 | 3300005336 | Ga0070680_100032809 | Ga0070680_1000328098 | 177 |
| 697 | 3300005337 | Ga0070682_100057764 | Ga0070682_1000577643 | 177 |
| 698 | 3300005337 | Ga0070682_100193784 | Ga0070682_1001937842 | 177 |
| 699 | 3300005338 | Ga0068868_100211639 | Ga0068868_1002116392 | 177 |
| 700 | 3300005338 | Ga0068868_100246199 | Ga0068868_1002461993 | 177 |
| 701 | 3300005338 | Ga0068868_100474633 | Ga0068868_1004746332 | 177 |
| 702 | 3300005338 | Ga0068868_100751149 | Ga0068868_1007511492 | 177 |
| 703 | 3300005339 | Ga0070660_100190679 | Ga0070660_1001906794 | 177 |
| 704 | 3300005339 | Ga0070660_100910758 | Ga0070660_1009107581 | 177 |
| 705 | 3300005339 | Ga0070660_101202805 | Ga0070660_1012028051 | 177 |
| 706 | 3300005340 | Ga0070689_100265958 | Ga0070689_1002659583 | 177 |
| 707 | 3300005343 | Ga0070687_100233714 | Ga0070687_1002337142 | 177 |
| 708 | 3300005344 | Ga0070661_100092952 | Ga0070661_1000929523 | 177 |
| 709 | 3300005344 | Ga0070661_100105291 | Ga0070661_1001052913 | 177 |
| 710 | 3300005344 | Ga0070661_100338960 | Ga0070661_1003389602 | 177 |
| 711 | 3300005347 | Ga0070668_100175163 | Ga0070668_1001751633 | 177 |
| 712 | 3300005347 | Ga0070668_100211316 | Ga0070668_1002113163 | 177 |
| 713 | 3300005347 | Ga0070668_100266732 | Ga0070668_1002667321 | 177 |
| 714 | 3300005347 | Ga0070668_100493006 | Ga0070668_1004930061 | 177 |
| 715 | 3300005347 | Ga0070668_100656989 | Ga0070668_1006569892 | 177 |
| 716 | 3300005353 | Ga0070669_100017536 | Ga0070669_1000175366 | 177 |
| 717 | 3300005353 | Ga0070669_100075981 | Ga0070669_1000759811 | 177 |
| 718 | 3300005353 | Ga0070669_100077546 | Ga0070669_1000775462 | 177 |
| 719 | 3300005354 | Ga0070675_100044665 | Ga0070675_1000446656 | 177 |
| 720 | 3300005354 | Ga0070675_100119785 | Ga0070675_1001197853 | 177 |
| 721 | 3300005354 | Ga0070675_100159250 | Ga0070675_1001592503 | 177 |
| 722 | 3300005354 | Ga0070675_100364619 | Ga0070675_1003646193 | 177 |
| 723 | 3300005354 | Ga0070675_100413240 | Ga0070675_1004132401 | 177 |
| 724 | 3300005354 | Ga0070675_100860171 | Ga0070675_1008601711 | 177 |
| 725 | 3300005354 | Ga0070675_101293146 | Ga0070675_1012931461 | 177 |
| 726 | 3300005355 | Ga0070671_100019537 | Ga0070671_1000195378 | 177 |
| 727 | 3300005355 | Ga0070671_100030800 | Ga0070671_1000308002 | 177 |
| 728 | 3300005355 | Ga0070671_100040069 | Ga0070671_1000400696 | 177 |
| 729 | 3300005355 | Ga0070671_100151546 | Ga0070671_1001515463 | 177 |
| 730 | 3300005355 | Ga0070671_100251374 | Ga0070671_1002513741 | 177 |
| 731 | 3300005355 | Ga0070671_100342299 | Ga0070671_1003422992 | 177 |
| 732 | 3300005356 | Ga0070674_100056124 | Ga0070674_1000561246 | 177 |
| 733 | 3300005356 | Ga0070674_100120277 | Ga0070674_1001202773 | 177 |
| 734 | 3300005356 | Ga0070674_100181740 | Ga0070674_1001817403 | 177 |
| 735 | 3300005356 | Ga0070674_100242149 | Ga0070674_1002421492 | 177 |
| 736 | 3300005356 | Ga0070674_100310754 | Ga0070674_1003107541 | 177 |
| 737 | 3300005356 | Ga0070674_101517531 | Ga0070674_1015175311 | 177 |
| 738 | 3300005364 | Ga0070673_100002927 | Ga0070673_10000292717 | 177 |
| 739 | 3300005364 | Ga0070673_100055764 | Ga0070673_1000557645 | 177 |
| 740 | 3300005364 | Ga0070673_100092283 | Ga0070673_1000922833 | 177 |
| 741 | 3300005364 | Ga0070673_100169356 | Ga0070673_1001693563 | 177 |
| 742 | 3300005364 | Ga0070673_100192497 | Ga0070673_1001924973 | 177 |
| 743 | 3300005364 | Ga0070673_100525545 | Ga0070673_1005255452 | 177 |
| 744 | 3300005364 | Ga0070673_100759012 | Ga0070673_1007590122 | 177 |
| 745 | 3300005365 | Ga0070688_100074242 | Ga0070688_1000742423 | 177 |
| 746 | 3300005365 | Ga0070688_100304757 | Ga0070688_1003047572 | 177 |
| 747 | 3300005366 | Ga0070659_100250633 | Ga0070659_1002506332 | 177 |
| 748 | 3300005366 | Ga0070659_100378036 | Ga0070659_1003780361 | 177 |
| 749 | 3300005367 | Ga0070667_100028082 | Ga0070667_10002808210 | 177 |
| 750 | 3300005367 | Ga0070667_100083378 | Ga0070667_1000833785 | 177 |
| 751 | 3300005367 | Ga0070667_100158747 | Ga0070667_1001587473 | 177 |
| 752 | 3300005367 | Ga0070667_100231002 | Ga0070667_1002310022 | 177 |
| 753 | 3300005367 | Ga0070667_100492119 | Ga0070667_1004921192 | 177 |
| 754 | 3300005438 | Ga0070701_10134721 | Ga0070701_101347212 | 177 |
| 755 | 3300005438 | Ga0070701_10405461 | Ga0070701_104054612 | 177 |
| 756 | 3300005445 | Ga0070708_100348817 | Ga0070708_1003488173 | 177 |
| 757 | 3300005455 | Ga0070663_100003492 | Ga0070663_1000034922 | 177 |
| 758 | 3300005455 | Ga0070663_100130855 | Ga0070663_1001308555 | 177 |
| 759 | 3300005456 | Ga0070678_100025705 | Ga0070678_1000257056 | 177 |
| 760 | 3300005456 | Ga0070678_100076714 | Ga0070678_1000767145 | 177 |
| 761 | 3300005456 | Ga0070678_100104114 | Ga0070678_1001041144 | 177 |
| 762 | 3300005456 | Ga0070678_100195478 | Ga0070678_1001954783 | 177 |
| 763 | 3300005456 | Ga0070678_100382831 | Ga0070678_1003828312 | 177 |
| 764 | 3300005456 | Ga0070678_100639099 | Ga0070678_1006390992 | 177 |
| 765 | 3300005456 | Ga0070678_100694884 | Ga0070678_1006948841 | 177 |
| 766 | 3300005456 | Ga0070678_100941219 | Ga0070678_1009412191 | 177 |
| 767 | 3300005456 | Ga0070678_101856688 | Ga0070678_1018566881 | 177 |
| 768 | 3300005457 | Ga0070662_100060375 | Ga0070662_1000603752 | 177 |
| 769 | 3300005457 | Ga0070662_100111387 | Ga0070662_1001113873 | 177 |
| 770 | 3300005457 | Ga0070662_100212672 | Ga0070662_1002126722 | 177 |
| 771 | 3300005457 | Ga0070662_100322678 | Ga0070662_1003226782 | 177 |
| 772 | 3300005457 | Ga0070662_100351011 | Ga0070662_1003510113 | 177 |
| 773 | 3300005458 | Ga0070681_10088377 | Ga0070681_100883774 | 177 |
| 774 | 3300005459 | Ga0068867_100000552 | Ga0068867_10000055222 | 177 |
| 775 | 3300005459 | Ga0068867_100011425 | Ga0068867_1000114256 | 177 |
| 776 | 3300005459 | Ga0068867_100087646 | Ga0068867_1000876465 | 177 |
| 777 | 3300005459 | Ga0068867_100117646 | Ga0068867_1001176464 | 177 |
| 778 | 3300005459 | Ga0068867_100223813 | Ga0068867_1002238132 | 177 |
| 779 | 3300005459 | Ga0068867_100276422 | Ga0068867_1002764222 | 177 |
| 780 | 3300005459 | Ga0068867_100336428 | Ga0068867_1003364282 | 177 |
| 781 | 3300005459 | Ga0068867_100411856 | Ga0068867_1004118562 | 177 |
| 782 | 3300005467 | Ga0070706_100025301 | Ga0070706_1000253012 | 177 |
| 783 | 3300005468 | Ga0070707_100035242 | Ga0070707_1000352424 | 177 |
| 784 | 3300005530 | Ga0070679_100007565 | Ga0070679_1000075656 | 177 |
| 785 | 3300005535 | Ga0070684_100178663 | Ga0070684_1001786632 | 177 |
| 786 | 3300005535 | Ga0070684_100565789 | Ga0070684_1005657892 | 177 |
| 787 | 3300005539 | Ga0068853_101387344 | Ga0068853_1013873441 | 177 |
| 788 | 3300005543 | Ga0070672_100006187 | Ga0070672_10000618711 | 177 |
| 789 | 3300005543 | Ga0070672_100044598 | Ga0070672_1000445986 | 177 |
| 790 | 3300005543 | Ga0070672_100110140 | Ga0070672_1001101401 | 177 |
| 791 | 3300005543 | Ga0070672_100170362 | Ga0070672_1001703621 | 177 |
| 792 | 3300005543 | Ga0070672_100197483 | Ga0070672_1001974833 | 177 |
| 793 | 3300005543 | Ga0070672_100380405 | Ga0070672_1003804053 | 177 |
| 794 | 3300005544 | Ga0070686_100146015 | Ga0070686_1001460154 | 177 |
| 795 | 3300005544 | Ga0070686_100205477 | Ga0070686_1002054772 | 177 |
| 796 | 3300005545 | Ga0070695_100538265 | Ga0070695_1005382652 | 177 |
| 797 | 3300005547 | Ga0070693_100023342 | Ga0070693_1000233426 | 177 |
| 798 | 3300005547 | Ga0070693_100069686 | Ga0070693_1000696864 | 177 |
| 799 | 3300005548 | Ga0070665_100538419 | Ga0070665_1005384192 | 177 |
| 800 | 3300005563 | Ga0068855_100040434 | Ga0068855_1000404346 | 177 |
| 801 | 3300005563 | Ga0068855_100300591 | Ga0068855_1003005914 | 177 |
| 802 | 3300005564 | Ga0070664_100040179 | Ga0070664_1000401793 | 177 |
| 803 | 3300005564 | Ga0070664_100238231 | Ga0070664_1002382313 | 177 |
| 804 | 3300005564 | Ga0070664_100273368 | Ga0070664_1002733682 | 177 |
| 805 | 3300005564 | Ga0070664_100284562 | Ga0070664_1002845622 | 177 |
| 806 | 3300005564 | Ga0070664_100363954 | Ga0070664_1003639543 | 177 |
| 807 | 3300005564 | Ga0070664_101181621 | Ga0070664_1011816212 | 177 |
| 808 | 3300005577 | Ga0068857_100040688 | Ga0068857_1000406886 | 177 |
| 809 | 3300005577 | Ga0068857_100209439 | Ga0068857_1002094392 | 177 |
| 810 | 3300005577 | Ga0068857_100442265 | Ga0068857_1004422652 | 177 |
| 811 | 3300005578 | Ga0068854_100044785 | Ga0068854_1000447856 | 177 |
| 812 | 3300005578 | Ga0068854_100352180 | Ga0068854_1003521803 | 177 |
| 813 | 3300005578 | Ga0068854_100392378 | Ga0068854_1003923782 | 177 |
| 814 | 3300005578 | Ga0068854_100559167 | Ga0068854_1005591671 | 177 |
| 815 | 3300005614 | Ga0068856_100183859 | Ga0068856_1001838594 | 177 |
| 816 | 3300005614 | Ga0068856_100244565 | Ga0068856_1002445653 | 177 |
| 817 | 3300005614 | Ga0068856_100345416 | Ga0068856_1003454162 | 177 |
| 818 | 3300005614 | Ga0068856_100463129 | Ga0068856_1004631292 | 177 |
| 819 | 3300005614 | Ga0068856_100477988 | Ga0068856_1004779882 | 177 |
| 820 | 3300005614 | Ga0068856_100596350 | Ga0068856_1005963501 | 177 |
| 821 | 3300005615 | Ga0070702_100692109 | Ga0070702_1006921092 | 177 |
| 822 | 3300005616 | Ga0068852_100022501 | Ga0068852_10002250110 | 177 |
| 823 | 3300005616 | Ga0068852_100102229 | Ga0068852_1001022293 | 177 |
| 824 | 3300005616 | Ga0068852_100307390 | Ga0068852_1003073903 | 177 |
| 825 | 3300005616 | Ga0068852_100362674 | Ga0068852_1003626743 | 177 |
| 826 | 3300005616 | Ga0068852_100413864 | Ga0068852_1004138642 | 177 |
| 827 | 3300005616 | Ga0068852_100519932 | Ga0068852_1005199321 | 177 |
| 828 | 3300005616 | Ga0068852_100688915 | Ga0068852_1006889151 | 177 |
| 829 | 3300005616 | Ga0068852_101527673 | Ga0068852_1015276732 | 177 |
| 830 | 3300005616 | Ga0068852_101974945 | Ga0068852_1019749451 | 177 |
| 831 | 3300005617 | Ga0068859_100130187 | Ga0068859_1001301872 | 177 |
| 832 | 3300005617 | Ga0068859_100176605 | Ga0068859_1001766054 | 177 |
| 833 | 3300005617 | Ga0068859_100454844 | Ga0068859_1004548441 | 177 |
| 834 | 3300005617 | Ga0068859_100768856 | Ga0068859_1007688562 | 177 |
| 835 | 3300005618 | Ga0068864_100018772 | Ga0068864_10001877210 | 177 |
| 836 | 3300005618 | Ga0068864_100066476 | Ga0068864_1000664766 | 177 |
| 837 | 3300005618 | Ga0068864_100103544 | Ga0068864_1001035443 | 177 |
| 838 | 3300005618 | Ga0068864_100353670 | Ga0068864_1003536703 | 177 |
| 839 | 3300005618 | Ga0068864_100403474 | Ga0068864_1004034742 | 177 |
| 840 | 3300005618 | Ga0068864_101289846 | Ga0068864_1012898462 | 177 |
| 841 | 3300005618 | Ga0068864_101947844 | Ga0068864_1019478441 | 177 |
| 842 | 3300005718 | Ga0068866_10061825 | Ga0068866_100618251 | 177 |
| 843 | 3300005719 | Ga0068861_100004770 | Ga0068861_10000477017 | 177 |
| 844 | 3300005719 | Ga0068861_100021676 | Ga0068861_1000216766 | 177 |
| 845 | 3300005719 | Ga0068861_100170807 | Ga0068861_1001708073 | 177 |
| 846 | 3300005719 | Ga0068861_100247833 | Ga0068861_1002478333 | 177 |
| 847 | 3300005834 | Ga0068851_10109854 | Ga0068851_101098543 | 177 |
| 848 | 3300005834 | Ga0068851_10143693 | Ga0068851_101436933 | 177 |
| 849 | 3300005834 | Ga0068851_10206879 | Ga0068851_102068791 | 177 |
| 850 | 3300005834 | Ga0068851_10263194 | Ga0068851_102631941 | 177 |
| 851 | 3300005834 | Ga0068851_10347902 | Ga0068851_103479022 | 177 |
| 852 | 3300005840 | Ga0068870_10231402 | Ga0068870_102314022 | 177 |
| 853 | 3300005840 | Ga0068870_10276128 | Ga0068870_102761282 | 177 |
| 854 | 3300005840 | Ga0068870_10398683 | Ga0068870_103986832 | 177 |
| 855 | 3300005841 | Ga0068863_100043166 | Ga0068863_1000431668 | 177 |
| 856 | 3300005841 | Ga0068863_100104362 | Ga0068863_1001043622 | 177 |
| 857 | 3300005841 | Ga0068863_100257362 | Ga0068863_1002573622 | 177 |
| 858 | 3300005841 | Ga0068863_100338312 | Ga0068863_1003383123 | 177 |
| 859 | 3300005841 | Ga0068863_100410223 | Ga0068863_1004102232 | 177 |
| 860 | 3300005842 | Ga0068858_100008125 | Ga0068858_10000812513 | 177 |
| 861 | 3300005842 | Ga0068858_100030753 | Ga0068858_1000307536 | 177 |
| 862 | 3300005842 | Ga0068858_100194536 | Ga0068858_1001945363 | 177 |
| 863 | 3300005843 | Ga0068860_100065679 | Ga0068860_1000656794 | 177 |
| 864 | 3300005843 | Ga0068860_100210653 | Ga0068860_1002106533 | 177 |
| 865 | 3300005843 | Ga0068860_100446321 | Ga0068860_1004463212 | 177 |
| 866 | 3300005843 | Ga0068860_100633821 | Ga0068860_1006338212 | 177 |
| 867 | 3300005844 | Ga0068862_100335247 | Ga0068862_1003352473 | 177 |
| 868 | 3300005844 | Ga0068862_101115400 | Ga0068862_1011154001 | 177 |
| 869 | 3300006048 | Ga0075363_100005889 | Ga0075363_1000058893 | 177 |
| 870 | 3300006048 | Ga0075363_100049841 | Ga0075363_1000498414 | 177 |
| 871 | 3300006048 | Ga0075363_100186191 | Ga0075363_1001861912 | 177 |
| 872 | 3300006048 | Ga0075363_100204317 | Ga0075363_1002043172 | 177 |
| 873 | 3300006048 | Ga0075363_100787507 | Ga0075363_1007875071 | 177 |
| 874 | 3300006051 | Ga0075364_10032491 | Ga0075364_100324917 | 177 |
| 875 | 3300006051 | Ga0075364_10142234 | Ga0075364_101422342 | 177 |
| 876 | 3300006051 | Ga0075364_10304148 | Ga0075364_103041482 | 177 |
| 877 | 3300006058 | Ga0075432_10216901 | Ga0075432_102169012 | 177 |
| 878 | 3300006163 | Ga0070715_10025469 | Ga0070715_100254692 | 177 |
| 879 | 3300006173 | Ga0070716_100069303 | Ga0070716_1000693034 | 177 |
| 880 | 3300006177 | Ga0075362_10000222 | Ga0075362_1000022216 | 177 |
| 881 | 3300006177 | Ga0075362_10060918 | Ga0075362_100609182 | 177 |
| 882 | 3300006177 | Ga0075362_10090390 | Ga0075362_100903903 | 177 |
| 883 | 3300006177 | Ga0075362_10313389 | Ga0075362_103133891 | 177 |
| 884 | 3300006177 | Ga0075362_10380970 | Ga0075362_103809701 | 177 |
| 885 | 3300006178 | Ga0075367_10000855 | Ga0075367_1000085512 | 177 |
| 886 | 3300006178 | Ga0075367_10006379 | Ga0075367_1000637911 | 177 |
| 887 | 3300006178 | Ga0075367_10092185 | Ga0075367_100921852 | 177 |
| 888 | 3300006178 | Ga0075367_10295173 | Ga0075367_102951732 | 177 |
| 889 | 3300006178 | Ga0075367_10347911 | Ga0075367_103479111 | 177 |
| 890 | 3300006186 | Ga0075369_10005325 | Ga0075369_100053258 | 177 |
| 891 | 3300006186 | Ga0075369_10159851 | Ga0075369_101598512 | 177 |
| 892 | 3300006186 | Ga0075369_10410384 | Ga0075369_104103841 | 177 |
| 893 | 3300006195 | Ga0075366_10000776 | Ga0075366_1000077620 | 177 |
| 894 | 3300006195 | Ga0075366_10016473 | Ga0075366_100164735 | 177 |
| 895 | 3300006195 | Ga0075366_10018148 | Ga0075366_100181488 | 177 |
| 896 | 3300006195 | Ga0075366_10033848 | Ga0075366_100338484 | 177 |
| 897 | 3300006195 | Ga0075366_10054228 | Ga0075366_100542284 | 177 |
| 898 | 3300006195 | Ga0075366_10055751 | Ga0075366_100557515 | 177 |
| 899 | 3300006195 | Ga0075366_10081535 | Ga0075366_100815353 | 177 |
| 900 | 3300006195 | Ga0075366_10115763 | Ga0075366_101157632 | 177 |
| 901 | 3300006195 | Ga0075366_10140745 | Ga0075366_101407453 | 177 |
| 902 | 3300006195 | Ga0075366_10159590 | Ga0075366_101595902 | 177 |
| 903 | 3300006195 | Ga0075366_10163686 | Ga0075366_101636863 | 177 |
| 904 | 3300006195 | Ga0075366_10196478 | Ga0075366_101964783 | 177 |
| 905 | 3300006195 | Ga0075366_10210884 | Ga0075366_102108843 | 177 |
| 906 | 3300006195 | Ga0075366_10213318 | Ga0075366_102133182 | 177 |
| 907 | 3300006195 | Ga0075366_10216952 | Ga0075366_102169523 | 177 |
| 908 | 3300006195 | Ga0075366_10243514 | Ga0075366_102435142 | 177 |
| 909 | 3300006195 | Ga0075366_10274182 | Ga0075366_102741822 | 177 |
| 910 | 3300006195 | Ga0075366_10550230 | Ga0075366_105502301 | 177 |
| 911 | 3300006195 | Ga0075366_10767148 | Ga0075366_107671481 | 177 |
| 912 | 3300006237 | Ga0097621_100047739 | Ga0097621_1000477394 | 177 |
| 913 | 3300006237 | Ga0097621_100115517 | Ga0097621_1001155174 | 177 |
| 914 | 3300006237 | Ga0097621_100612946 | Ga0097621_1006129462 | 177 |
| 915 | 3300006353 | Ga0075370_10001150 | Ga0075370_1000115011 | 177 |
| 916 | 3300006353 | Ga0075370_10002824 | Ga0075370_1000282412 | 177 |
| 917 | 3300006353 | Ga0075370_10023630 | Ga0075370_100236306 | 177 |
| 918 | 3300006353 | Ga0075370_10040903 | Ga0075370_100409034 | 177 |
| 919 | 3300006353 | Ga0075370_10243310 | Ga0075370_102433102 | 177 |
| 920 | 3300006353 | Ga0075370_10345440 | Ga0075370_103454402 | 177 |
| 921 | 3300006353 | Ga0075370_10432241 | Ga0075370_104322412 | 177 |
| 922 | 3300006353 | Ga0075370_10643447 | Ga0075370_106434471 | 177 |
| 923 | 3300006358 | Ga0068871_100019288 | Ga0068871_1000192882 | 177 |
| 924 | 3300006358 | Ga0068871_100337306 | Ga0068871_1003373062 | 177 |
| 925 | 3300006358 | Ga0068871_100609286 | Ga0068871_1006092862 | 177 |
| 926 | 3300006846 | Ga0075430_100233239 | Ga0075430_1002332394 | 177 |
| 927 | 3300006880 | Ga0075429_100123917 | Ga0075429_1001239173 | 177 |
| 928 | 3300006881 | Ga0068865_100057885 | Ga0068865_1000578851 | 177 |
| 929 | 3300006881 | Ga0068865_100182643 | Ga0068865_1001826432 | 177 |
| 930 | 3300006931 | Ga0097620_100130185 | Ga0097620_1001301852 | 177 |
| 931 | 3300006931 | Ga0097620_100176599 | Ga0097620_1001765994 | 177 |
| 932 | 3300006931 | Ga0097620_100454839 | Ga0097620_1004548393 | 177 |
| 933 | 3300006931 | Ga0097620_100768879 | Ga0097620_1007688792 | 177 |
| 934 | 3300006944 | Ga0099823_1000064 | Ga0099823_100006419 | 177 |
| 935 | 3300006946 | Ga0079104_1000053 | Ga0079104_100005319 | 177 |
| 936 | 3300009098 | Ga0105245_10412159 | Ga0105245_104121592 | 177 |
| 937 | 3300009174 | Ga0105241_10082907 | Ga0105241_100829076 | 177 |
| 938 | 3300009177 | Ga0105248_10028458 | Ga0105248_1002845814 | 177 |
| 939 | 3300009545 | Ga0105237_11251531 | Ga0105237_112515312 | 177 |
| 940 | 3300009551 | Ga0105238_10064333 | Ga0105238_100643336 | 177 |
| 941 | 3300010375 | Ga0105239_11064166 | Ga0105239_110641662 | 177 |
| 942 | 3300013100 | Ga0157373_10040286 | Ga0157373_100402866 | 177 |
| 943 | 3300013102 | Ga0157371_10096460 | Ga0157371_100964602 | 177 |
| 944 | 3300013105 | Ga0157369_10115967 | Ga0157369_101159675 | 177 |
| 945 | 3300013296 | Ga0157374_10261841 | Ga0157374_102618412 | 177 |
| 946 | 3300013296 | Ga0157374_10383146 | Ga0157374_103831462 | 177 |
| 947 | 3300013307 | Ga0157372_10023087 | Ga0157372_100230872 | 177 |
| 948 | 3300013307 | Ga0157372_10500446 | Ga0157372_105004462 | 177 |
| 949 | 3300013308 | Ga0157375_11035597 | Ga0157375_110355972 | 177 |
| 950 | 3300014968 | Ga0157379_10061342 | Ga0157379_100613427 | 177 |
| 951 | 3300014968 | Ga0157379_10144632 | Ga0157379_101446323 | 177 |
| 952 | 3300015265 | Ga0182005_1057908 | Ga0182005_10579082 | 177 |
| 953 | 3300017792 | Ga0163161_10009049 | Ga0163161_1000904912 | 177 |
| 954 | 3300017792 | Ga0163161_10057420 | Ga0163161_100574202 | 177 |
| 955 | 3300017792 | Ga0163161_10118069 | Ga0163161_101180693 | 177 |
| 956 | 3300017792 | Ga0163161_10378130 | Ga0163161_103781302 | 177 |
| 957 | 3300020078 | Ga0206352_11007505 | Ga0206352_110075055 | 177 |
| 958 | 3300025228 | Ga0209672_106318 | Ga0209672_1063183 | 177 |
| 959 | 3300025230 | Ga0209563_100088 | Ga0209563_10008874 | 177 |
| 960 | 3300025242 | Ga0209258_102113 | Ga0209258_1021136 | 177 |
| 961 | 3300025245 | Ga0207425_1000680 | Ga0207425_100068012 | 177 |
| 962 | 3300025254 | Ga0209148_1002904 | Ga0209148_10029045 | 177 |
| 963 | 3300025256 | Ga0209759_1003759 | Ga0209759_10037593 | 177 |
| 964 | 3300025256 | Ga0209759_1020002 | Ga0209759_10200024 | 177 |
| 965 | 3300025258 | Ga0209129_1000158 | Ga0209129_100015848 | 177 |
| 966 | 3300025258 | Ga0209129_1034916 | Ga0209129_10349162 | 177 |
| 967 | 3300025271 | Ga0207666_1002377 | Ga0207666_10023772 | 177 |
| 968 | 3300025272 | Ga0209455_1000083 | Ga0209455_1000083193 | 177 |
| 969 | 3300025273 | Ga0209673_1004093 | Ga0209673_10040936 | 177 |
| 970 | 3300025273 | Ga0209673_1024595 | Ga0209673_10245954 | 177 |
| 971 | 3300025273 | Ga0209673_1032334 | Ga0209673_10323343 | 177 |
| 972 | 3300025291 | Ga0209675_1038432 | Ga0209675_10384321 | 177 |
| 973 | 3300025295 | Ga0209564_1000282 | Ga0209564_100028248 | 177 |
| 974 | 3300025297 | Ga0209758_1000910 | Ga0209758_10009107 | 177 |
| 975 | 3300025297 | Ga0209758_1011080 | Ga0209758_10110805 | 177 |
| 976 | 3300025298 | Ga0209050_1000223 | Ga0209050_100022371 | 177 |
| 977 | 3300025298 | Ga0209050_1001097 | Ga0209050_100109733 | 177 |
| 978 | 3300025298 | Ga0209050_1004273 | Ga0209050_100427310 | 177 |
| 979 | 3300025298 | Ga0209050_1013102 | Ga0209050_10131026 | 177 |
| 980 | 3300025299 | Ga0209256_1000045 | Ga0209256_1000045232 | 177 |
| 981 | 3300025299 | Ga0209256_1008928 | Ga0209256_10089281 | 177 |
| 982 | 3300025299 | Ga0209256_1009680 | Ga0209256_10096805 | 177 |
| 983 | 3300025299 | Ga0209256_1051545 | Ga0209256_10515451 | 177 |
| 984 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004972 | 177 |
| 985 | 3300025303 | Ga0209051_1000938 | Ga0209051_100093833 | 177 |
| 986 | 3300025303 | Ga0209051_1005321 | Ga0209051_10053217 | 177 |
| 987 | 3300025303 | Ga0209051_1018074 | Ga0209051_10180742 | 177 |
| 988 | 3300025304 | Ga0209257_1000047 | Ga0209257_1000047398 | 177 |
| 989 | 3300025304 | Ga0209257_1000315 | Ga0209257_1000315101 | 177 |
| 990 | 3300025304 | Ga0209257_1019529 | Ga0209257_10195291 | 177 |
| 991 | 3300025304 | Ga0209257_1061640 | Ga0209257_10616401 | 177 |
| 992 | 3300025304 | Ga0209257_1061925 | Ga0209257_10619252 | 177 |
| 993 | 3300025304 | Ga0209257_1108456 | Ga0209257_11084561 | 177 |
| 994 | 3300025315 | Ga0207697_10029574 | Ga0207697_100295744 | 177 |
| 995 | 3300025321 | Ga0207656_10020792 | Ga0207656_100207921 | 177 |
| 996 | 3300025321 | Ga0207656_10143536 | Ga0207656_101435362 | 177 |
| 997 | 3300025321 | Ga0207656_10148077 | Ga0207656_101480771 | 177 |
| 998 | 3300025321 | Ga0207656_10184172 | Ga0207656_101841722 | 177 |
| 999 | 3300025321 | Ga0207656_10300398 | Ga0207656_103003981 | 177 |
| 1000 | 3300025893 | Ga0207682_10002147 | Ga0207682_100021475 | 177 |
| 1001 | 3300025893 | Ga0207682_10021887 | Ga0207682_100218874 | 177 |
| 1002 | 3300025893 | Ga0207682_10053083 | Ga0207682_100530832 | 177 |
| 1003 | 3300025893 | Ga0207682_10117103 | Ga0207682_101171032 | 177 |
| 1004 | 3300025899 | Ga0207642_10040268 | Ga0207642_100402685 | 177 |
| 1005 | 3300025899 | Ga0207642_10146240 | Ga0207642_101462402 | 177 |
| 1006 | 3300025901 | Ga0207688_10037622 | Ga0207688_100376223 | 177 |
| 1007 | 3300025901 | Ga0207688_10063302 | Ga0207688_100633023 | 177 |
| 1008 | 3300025901 | Ga0207688_10338749 | Ga0207688_103387492 | 177 |
| 1009 | 3300025903 | Ga0207680_10014229 | Ga0207680_100142296 | 177 |
| 1010 | 3300025903 | Ga0207680_10183316 | Ga0207680_101833162 | 177 |
| 1011 | 3300025903 | Ga0207680_10187572 | Ga0207680_101875722 | 177 |
| 1012 | 3300025903 | Ga0207680_10276263 | Ga0207680_102762632 | 177 |
| 1013 | 3300025903 | Ga0207680_10487411 | Ga0207680_104874111 | 177 |
| 1014 | 3300025907 | Ga0207645_10009972 | Ga0207645_1000997210 | 177 |
| 1015 | 3300025907 | Ga0207645_10012543 | Ga0207645_100125437 | 177 |
| 1016 | 3300025907 | Ga0207645_10047232 | Ga0207645_100472325 | 177 |
| 1017 | 3300025907 | Ga0207645_10048474 | Ga0207645_100484746 | 177 |
| 1018 | 3300025907 | Ga0207645_10086402 | Ga0207645_100864022 | 177 |
| 1019 | 3300025907 | Ga0207645_10139657 | Ga0207645_101396573 | 177 |
| 1020 | 3300025907 | Ga0207645_10226543 | Ga0207645_102265432 | 177 |
| 1021 | 3300025907 | Ga0207645_10356540 | Ga0207645_103565402 | 177 |
| 1022 | 3300025908 | Ga0207643_10146766 | Ga0207643_101467663 | 177 |
| 1023 | 3300025908 | Ga0207643_10340502 | Ga0207643_103405022 | 177 |
| 1024 | 3300025909 | Ga0207705_10850984 | Ga0207705_108509842 | 177 |
| 1025 | 3300025910 | Ga0207684_10124693 | Ga0207684_101246932 | 177 |
| 1026 | 3300025911 | Ga0207654_10056380 | Ga0207654_100563803 | 177 |
| 1027 | 3300025911 | Ga0207654_10187962 | Ga0207654_101879622 | 177 |
| 1028 | 3300025912 | Ga0207707_10231795 | Ga0207707_102317952 | 177 |
| 1029 | 3300025913 | Ga0207695_10010589 | Ga0207695_1001058913 | 177 |
| 1030 | 3300025913 | Ga0207695_10190969 | Ga0207695_101909693 | 177 |
| 1031 | 3300025914 | Ga0207671_10019707 | Ga0207671_100197076 | 177 |
| 1032 | 3300025914 | Ga0207671_10036592 | Ga0207671_100365922 | 177 |
| 1033 | 3300025914 | Ga0207671_10571855 | Ga0207671_105718552 | 177 |
| 1034 | 3300025917 | Ga0207660_10046145 | Ga0207660_100461452 | 177 |
| 1035 | 3300025918 | Ga0207662_10034330 | Ga0207662_100343306 | 177 |
| 1036 | 3300025918 | Ga0207662_10808995 | Ga0207662_108089951 | 177 |
| 1037 | 3300025919 | Ga0207657_10092779 | Ga0207657_100927793 | 177 |
| 1038 | 3300025919 | Ga0207657_10350616 | Ga0207657_103506162 | 177 |
| 1039 | 3300025919 | Ga0207657_10566625 | Ga0207657_105666252 | 177 |
| 1040 | 3300025919 | Ga0207657_10956381 | Ga0207657_109563811 | 177 |
| 1041 | 3300025920 | Ga0207649_10001794 | Ga0207649_100017948 | 177 |
| 1042 | 3300025920 | Ga0207649_10004699 | Ga0207649_100046994 | 177 |
| 1043 | 3300025920 | Ga0207649_10137933 | Ga0207649_101379333 | 177 |
| 1044 | 3300025920 | Ga0207649_10240920 | Ga0207649_102409202 | 177 |
| 1045 | 3300025920 | Ga0207649_10384119 | Ga0207649_103841192 | 177 |
| 1046 | 3300025921 | Ga0207652_10002940 | Ga0207652_1000294011 | 177 |
| 1047 | 3300025922 | Ga0207646_10033831 | Ga0207646_100338312 | 177 |
| 1048 | 3300025923 | Ga0207681_10005925 | Ga0207681_100059256 | 177 |
| 1049 | 3300025923 | Ga0207681_10083993 | Ga0207681_100839931 | 177 |
| 1050 | 3300025923 | Ga0207681_10111387 | Ga0207681_101113873 | 177 |
| 1051 | 3300025923 | Ga0207681_10139757 | Ga0207681_101397572 | 177 |
| 1052 | 3300025923 | Ga0207681_10593692 | Ga0207681_105936921 | 177 |
| 1053 | 3300025923 | Ga0207681_11287919 | Ga0207681_112879191 | 177 |
| 1054 | 3300025924 | Ga0207694_10004619 | Ga0207694_100046197 | 177 |
| 1055 | 3300025924 | Ga0207694_10034844 | Ga0207694_100348442 | 177 |
| 1056 | 3300025924 | Ga0207694_10310362 | Ga0207694_103103622 | 177 |
| 1057 | 3300025924 | Ga0207694_10735795 | Ga0207694_107357952 | 177 |
| 1058 | 3300025925 | Ga0207650_10002454 | Ga0207650_1000245419 | 177 |
| 1059 | 3300025925 | Ga0207650_10022053 | Ga0207650_100220533 | 177 |
| 1060 | 3300025925 | Ga0207650_10242099 | Ga0207650_102420993 | 177 |
| 1061 | 3300025925 | Ga0207650_10302708 | Ga0207650_103027082 | 177 |
| 1062 | 3300025925 | Ga0207650_10515056 | Ga0207650_105150562 | 177 |
| 1063 | 3300025925 | Ga0207650_10706362 | Ga0207650_107063621 | 177 |
| 1064 | 3300025926 | Ga0207659_10003025 | Ga0207659_100030253 | 177 |
| 1065 | 3300025926 | Ga0207659_10056531 | Ga0207659_100565312 | 177 |
| 1066 | 3300025926 | Ga0207659_10072814 | Ga0207659_100728144 | 177 |
| 1067 | 3300025926 | Ga0207659_10229273 | Ga0207659_102292732 | 177 |
| 1068 | 3300025926 | Ga0207659_10338491 | Ga0207659_103384912 | 177 |
| 1069 | 3300025926 | Ga0207659_10381945 | Ga0207659_103819453 | 177 |
| 1070 | 3300025926 | Ga0207659_10454645 | Ga0207659_104546452 | 177 |
| 1071 | 3300025926 | Ga0207659_10617259 | Ga0207659_106172592 | 177 |
| 1072 | 3300025926 | Ga0207659_11452594 | Ga0207659_114525941 | 177 |
| 1073 | 3300025927 | Ga0207687_10108511 | Ga0207687_101085114 | 177 |
| 1074 | 3300025931 | Ga0207644_10015416 | Ga0207644_100154166 | 177 |
| 1075 | 3300025931 | Ga0207644_10024978 | Ga0207644_100249783 | 177 |
| 1076 | 3300025931 | Ga0207644_10027492 | Ga0207644_100274926 | 177 |
| 1077 | 3300025931 | Ga0207644_10184530 | Ga0207644_101845302 | 177 |
| 1078 | 3300025931 | Ga0207644_10246131 | Ga0207644_102461311 | 177 |
| 1079 | 3300025931 | Ga0207644_10692643 | Ga0207644_106926431 | 177 |
| 1080 | 3300025931 | Ga0207644_10909750 | Ga0207644_109097501 | 177 |
| 1081 | 3300025932 | Ga0207690_10001731 | Ga0207690_1000173110 | 177 |
| 1082 | 3300025932 | Ga0207690_10039856 | Ga0207690_100398567 | 177 |
| 1083 | 3300025932 | Ga0207690_10056794 | Ga0207690_100567944 | 177 |
| 1084 | 3300025932 | Ga0207690_10475284 | Ga0207690_104752842 | 177 |
| 1085 | 3300025933 | Ga0207706_10079225 | Ga0207706_100792253 | 177 |
| 1086 | 3300025933 | Ga0207706_10116108 | Ga0207706_101161084 | 177 |
| 1087 | 3300025933 | Ga0207706_10150050 | Ga0207706_101500503 | 177 |
| 1088 | 3300025933 | Ga0207706_10247137 | Ga0207706_102471372 | 177 |
| 1089 | 3300025933 | Ga0207706_10265491 | Ga0207706_102654913 | 177 |
| 1090 | 3300025933 | Ga0207706_10274953 | Ga0207706_102749533 | 177 |
| 1091 | 3300025934 | Ga0207686_10048318 | Ga0207686_100483181 | 177 |
| 1092 | 3300025935 | Ga0207709_10001005 | Ga0207709_1000100520 | 177 |
| 1093 | 3300025935 | Ga0207709_10020689 | Ga0207709_100206894 | 177 |
| 1094 | 3300025935 | Ga0207709_10092231 | Ga0207709_100922311 | 177 |
| 1095 | 3300025935 | Ga0207709_10457789 | Ga0207709_104577892 | 177 |
| 1096 | 3300025935 | Ga0207709_10499485 | Ga0207709_104994852 | 177 |
| 1097 | 3300025937 | Ga0207669_10115067 | Ga0207669_101150674 | 177 |
| 1098 | 3300025937 | Ga0207669_10124757 | Ga0207669_101247573 | 177 |
| 1099 | 3300025937 | Ga0207669_10149676 | Ga0207669_101496763 | 177 |
| 1100 | 3300025937 | Ga0207669_10192156 | Ga0207669_101921562 | 177 |
| 1101 | 3300025937 | Ga0207669_10810425 | Ga0207669_108104252 | 177 |
| 1102 | 3300025938 | Ga0207704_10044043 | Ga0207704_100440431 | 177 |
| 1103 | 3300025938 | Ga0207704_10940374 | Ga0207704_109403742 | 177 |
| 1104 | 3300025938 | Ga0207704_11165024 | Ga0207704_111650241 | 177 |
| 1105 | 3300025939 | Ga0207665_10131977 | Ga0207665_101319774 | 177 |
| 1106 | 3300025940 | Ga0207691_10002550 | Ga0207691_1000255015 | 177 |
| 1107 | 3300025940 | Ga0207691_10071477 | Ga0207691_100714776 | 177 |
| 1108 | 3300025940 | Ga0207691_10102749 | Ga0207691_101027493 | 177 |
| 1109 | 3300025940 | Ga0207691_10126451 | Ga0207691_101264513 | 177 |
| 1110 | 3300025940 | Ga0207691_10413729 | Ga0207691_104137293 | 177 |
| 1111 | 3300025940 | Ga0207691_10421854 | Ga0207691_104218543 | 177 |
| 1112 | 3300025940 | Ga0207691_10455132 | Ga0207691_104551322 | 177 |
| 1113 | 3300025941 | Ga0207711_10009785 | Ga0207711_100097853 | 177 |
| 1114 | 3300025941 | Ga0207711_10023140 | Ga0207711_100231403 | 177 |
| 1115 | 3300025941 | Ga0207711_10072285 | Ga0207711_100722853 | 177 |
| 1116 | 3300025941 | Ga0207711_10465174 | Ga0207711_104651743 | 177 |
| 1117 | 3300025941 | Ga0207711_10589696 | Ga0207711_105896962 | 177 |
| 1118 | 3300025941 | Ga0207711_10659613 | Ga0207711_106596132 | 177 |
| 1119 | 3300025941 | Ga0207711_10763481 | Ga0207711_107634811 | 177 |
| 1120 | 3300025941 | Ga0207711_11243660 | Ga0207711_112436601 | 177 |
| 1121 | 3300025942 | Ga0207689_10015223 | Ga0207689_100152232 | 177 |
| 1122 | 3300025942 | Ga0207689_10033146 | Ga0207689_100331468 | 177 |
| 1123 | 3300025942 | Ga0207689_10038004 | Ga0207689_100380045 | 177 |
| 1124 | 3300025942 | Ga0207689_10117050 | Ga0207689_101170503 | 177 |
| 1125 | 3300025942 | Ga0207689_10348642 | Ga0207689_103486422 | 177 |
| 1126 | 3300025944 | Ga0207661_10026944 | Ga0207661_100269443 | 177 |
| 1127 | 3300025944 | Ga0207661_10710796 | Ga0207661_107107961 | 177 |
| 1128 | 3300025945 | Ga0207679_10001498 | Ga0207679_1000149811 | 177 |
| 1129 | 3300025945 | Ga0207679_10016048 | Ga0207679_100160486 | 177 |
| 1130 | 3300025945 | Ga0207679_10796798 | Ga0207679_107967981 | 177 |
| 1131 | 3300025945 | Ga0207679_11154867 | Ga0207679_111548671 | 177 |
| 1132 | 3300025949 | Ga0207667_10188077 | Ga0207667_101880775 | 177 |
| 1133 | 3300025960 | Ga0207651_10004839 | Ga0207651_1000483912 | 177 |
| 1134 | 3300025960 | Ga0207651_10043195 | Ga0207651_100431954 | 177 |
| 1135 | 3300025960 | Ga0207651_10059456 | Ga0207651_100594565 | 177 |
| 1136 | 3300025960 | Ga0207651_10063480 | Ga0207651_100634805 | 177 |
| 1137 | 3300025960 | Ga0207651_10163749 | Ga0207651_101637494 | 177 |
| 1138 | 3300025960 | Ga0207651_10249829 | Ga0207651_102498293 | 177 |
| 1139 | 3300025960 | Ga0207651_10315833 | Ga0207651_103158333 | 177 |
| 1140 | 3300025960 | Ga0207651_10477293 | Ga0207651_104772932 | 177 |
| 1141 | 3300025961 | Ga0207712_10063392 | Ga0207712_100633926 | 177 |
| 1142 | 3300025961 | Ga0207712_10129841 | Ga0207712_101298413 | 177 |
| 1143 | 3300025961 | Ga0207712_10258983 | Ga0207712_102589833 | 177 |
| 1144 | 3300025972 | Ga0207668_10008000 | Ga0207668_100080005 | 177 |
| 1145 | 3300025972 | Ga0207668_10211665 | Ga0207668_102116653 | 177 |
| 1146 | 3300025972 | Ga0207668_10283658 | Ga0207668_102836583 | 177 |
| 1147 | 3300025972 | Ga0207668_10374285 | Ga0207668_103742852 | 177 |
| 1148 | 3300025981 | Ga0207640_10014813 | Ga0207640_100148134 | 177 |
| 1149 | 3300025981 | Ga0207640_10130332 | Ga0207640_101303322 | 177 |
| 1150 | 3300025981 | Ga0207640_10146361 | Ga0207640_101463611 | 177 |
| 1151 | 3300025986 | Ga0207658_10002481 | Ga0207658_100024818 | 177 |
| 1152 | 3300025986 | Ga0207658_10019932 | Ga0207658_100199327 | 177 |
| 1153 | 3300025986 | Ga0207658_10186325 | Ga0207658_101863253 | 177 |
| 1154 | 3300025986 | Ga0207658_10204295 | Ga0207658_102042952 | 177 |
| 1155 | 3300025986 | Ga0207658_10253878 | Ga0207658_102538783 | 177 |
| 1156 | 3300025986 | Ga0207658_10308286 | Ga0207658_103082863 | 177 |
| 1157 | 3300025986 | Ga0207658_10515759 | Ga0207658_105157592 | 177 |
| 1158 | 3300026023 | Ga0207677_10158539 | Ga0207677_101585392 | 177 |
| 1159 | 3300026023 | Ga0207677_10222318 | Ga0207677_102223183 | 177 |
| 1160 | 3300026023 | Ga0207677_10493235 | Ga0207677_104932352 | 177 |
| 1161 | 3300026023 | Ga0207677_10652352 | Ga0207677_106523522 | 177 |
| 1162 | 3300026023 | Ga0207677_10874039 | Ga0207677_108740392 | 177 |
| 1163 | 3300026035 | Ga0207703_10002613 | Ga0207703_100026133 | 177 |
| 1164 | 3300026035 | Ga0207703_10030166 | Ga0207703_100301666 | 177 |
| 1165 | 3300026035 | Ga0207703_10139551 | Ga0207703_101395513 | 177 |
| 1166 | 3300026041 | Ga0207639_10244159 | Ga0207639_102441592 | 177 |
| 1167 | 3300026041 | Ga0207639_10376167 | Ga0207639_103761672 | 177 |
| 1168 | 3300026041 | Ga0207639_10407530 | Ga0207639_104075302 | 177 |
| 1169 | 3300026041 | Ga0207639_10601595 | Ga0207639_106015952 | 177 |
| 1170 | 3300026041 | Ga0207639_10718737 | Ga0207639_107187372 | 177 |
| 1171 | 3300026067 | Ga0207678_10008286 | Ga0207678_1000828618 | 177 |
| 1172 | 3300026067 | Ga0207678_10087396 | Ga0207678_100873966 | 177 |
| 1173 | 3300026067 | Ga0207678_10099481 | Ga0207678_100994813 | 177 |
| 1174 | 3300026067 | Ga0207678_11077997 | Ga0207678_110779972 | 177 |
| 1175 | 3300026078 | Ga0207702_10004993 | Ga0207702_1000499314 | 177 |
| 1176 | 3300026078 | Ga0207702_10150760 | Ga0207702_101507602 | 177 |
| 1177 | 3300026078 | Ga0207702_10415921 | Ga0207702_104159213 | 177 |
| 1178 | 3300026078 | Ga0207702_10429607 | Ga0207702_104296072 | 177 |
| 1179 | 3300026078 | Ga0207702_10655235 | Ga0207702_106552352 | 177 |
| 1180 | 3300026088 | Ga0207641_10028453 | Ga0207641_100284533 | 177 |
| 1181 | 3300026088 | Ga0207641_10346817 | Ga0207641_103468172 | 177 |
| 1182 | 3300026089 | Ga0207648_10002176 | Ga0207648_1000217619 | 177 |
| 1183 | 3300026089 | Ga0207648_10015751 | Ga0207648_1001575111 | 177 |
| 1184 | 3300026089 | Ga0207648_10017221 | Ga0207648_100172212 | 177 |
| 1185 | 3300026089 | Ga0207648_10084574 | Ga0207648_100845742 | 177 |
| 1186 | 3300026089 | Ga0207648_10087281 | Ga0207648_100872815 | 177 |
| 1187 | 3300026089 | Ga0207648_10159685 | Ga0207648_101596854 | 177 |
| 1188 | 3300026089 | Ga0207648_10173287 | Ga0207648_101732872 | 177 |
| 1189 | 3300026089 | Ga0207648_10735211 | Ga0207648_107352112 | 177 |
| 1190 | 3300026095 | Ga0207676_10011142 | Ga0207676_100111423 | 177 |
| 1191 | 3300026095 | Ga0207676_10083692 | Ga0207676_100836925 | 177 |
| 1192 | 3300026095 | Ga0207676_10432909 | Ga0207676_104329092 | 177 |
| 1193 | 3300026095 | Ga0207676_10663401 | Ga0207676_106634012 | 177 |
| 1194 | 3300026095 | Ga0207676_11735979 | Ga0207676_117359791 | 177 |
| 1195 | 3300026116 | Ga0207674_10123860 | Ga0207674_101238602 | 177 |
| 1196 | 3300026116 | Ga0207674_10171993 | Ga0207674_101719932 | 177 |
| 1197 | 3300026116 | Ga0207674_10380168 | Ga0207674_103801682 | 177 |
| 1198 | 3300026116 | Ga0207674_10441964 | Ga0207674_104419643 | 177 |
| 1199 | 3300026116 | Ga0207674_11239639 | Ga0207674_112396391 | 177 |
| 1200 | 3300026116 | Ga0207674_11328406 | Ga0207674_113284062 | 177 |
| 1201 | 3300026118 | Ga0207675_100039987 | Ga0207675_1000399876 | 177 |
| 1202 | 3300026118 | Ga0207675_100255531 | Ga0207675_1002555312 | 177 |
| 1203 | 3300026118 | Ga0207675_100373676 | Ga0207675_1003736763 | 177 |
| 1204 | 3300026121 | Ga0207683_10005923 | Ga0207683_100059236 | 177 |
| 1205 | 3300026121 | Ga0207683_10119357 | Ga0207683_101193573 | 177 |
| 1206 | 3300026121 | Ga0207683_10124519 | Ga0207683_101245194 | 177 |
| 1207 | 3300026121 | Ga0207683_10276638 | Ga0207683_102766382 | 177 |
| 1208 | 3300026121 | Ga0207683_10379334 | Ga0207683_103793342 | 177 |
| 1209 | 3300026121 | Ga0207683_10677579 | Ga0207683_106775792 | 177 |
| 1210 | 3300026121 | Ga0207683_11336775 | Ga0207683_113367751 | 177 |
| 1211 | 3300026142 | Ga0207698_10017410 | Ga0207698_1001741010 | 177 |
| 1212 | 3300026142 | Ga0207698_10137421 | Ga0207698_101374213 | 177 |
| 1213 | 3300026142 | Ga0207698_10224392 | Ga0207698_102243922 | 177 |
| 1214 | 3300026142 | Ga0207698_10232611 | Ga0207698_102326113 | 177 |
| 1215 | 3300026142 | Ga0207698_10278355 | Ga0207698_102783552 | 177 |
| 1216 | 3300026142 | Ga0207698_10582075 | Ga0207698_105820751 | 177 |
| 1217 | 3300026142 | Ga0207698_10912475 | Ga0207698_109124752 | 177 |
| 1218 | 3300027111 | Ga0209281_1000147 | Ga0209281_100014719 | 177 |
| 1219 | 3300027296 | Ga0209389_1000305 | Ga0209389_100030529 | 177 |
| 1220 | 3300027312 | Ga0209371_1008392 | Ga0209371_10083925 | 177 |
| 1221 | 3300027378 | Ga0209981_1003413 | Ga0209981_10034132 | 177 |
| 1222 | 3300027395 | Ga0209996_1000729 | Ga0209996_10007297 | 177 |
| 1223 | 3300027471 | Ga0209995_1000242 | Ga0209995_100024210 | 177 |
| 1224 | 3300027526 | Ga0209968_1000130 | Ga0209968_100013016 | 177 |
| 1225 | 3300027682 | Ga0209971_1072576 | Ga0209971_10725762 | 177 |
| 1226 | 3300027695 | Ga0209966_1000117 | Ga0209966_100011734 | 177 |
| 1227 | 3300027717 | Ga0209998_10002530 | Ga0209998_1000253010 | 177 |
| 1228 | 3300027866 | Ga0209813_10018964 | Ga0209813_100189645 | 177 |
| 1229 | 3300027866 | Ga0209813_10215862 | Ga0209813_102158622 | 177 |
| 1230 | 3300027876 | Ga0209974_10000149 | Ga0209974_1000014919 | 177 |
| 1231 | 3300027907 | Ga0207428_10650266 | Ga0207428_106502662 | 177 |
| 1232 | 3300028380 | Ga0268265_10186906 | Ga0268265_101869063 | 177 |
| 1233 | 3300028380 | Ga0268265_10241678 | Ga0268265_102416782 | 177 |
| 1234 | 3300028381 | Ga0268264_10002070 | Ga0268264_1000207019 | 177 |
| 1235 | 3300028381 | Ga0268264_10053634 | Ga0268264_100536344 | 177 |
| 1236 | 3300028381 | Ga0268264_10057251 | Ga0268264_100572516 | 177 |
| 1237 | 3300028381 | Ga0268264_10324135 | Ga0268264_103241353 | 177 |
| 1238 | 3300028573 | Ga0265334_10119748 | Ga0265334_101197482 | 177 |
| 1239 | 3300028666 | Ga0265336_10000028 | Ga0265336_1000002821 | 177 |
| 1240 | 3300028786 | Ga0307517_10014561 | Ga0307517_100145617 | 177 |
| 1241 | 3300028786 | Ga0307517_10110559 | Ga0307517_101105592 | 177 |
| 1242 | 3300028786 | Ga0307517_10314484 | Ga0307517_103144841 | 177 |
| 1243 | 3300028786 | Ga0307517_10447661 | Ga0307517_104476612 | 177 |
| 1244 | 3300028786 | Ga0307517_10475582 | Ga0307517_104755821 | 177 |
| 1245 | 3300028794 | Ga0307515_10000096 | Ga0307515_10000096185 | 177 |
| 1246 | 3300028794 | Ga0307515_10012540 | Ga0307515_1001254012 | 177 |
| 1247 | 3300028794 | Ga0307515_10021273 | Ga0307515_1002127319 | 177 |
| 1248 | 3300028794 | Ga0307515_10053115 | Ga0307515_100531157 | 177 |
| 1249 | 3300028794 | Ga0307515_10095676 | Ga0307515_100956763 | 177 |
| 1250 | 3300028794 | Ga0307515_10108460 | Ga0307515_101084607 | 177 |
| 1251 | 3300028794 | Ga0307515_10124094 | Ga0307515_101240943 | 177 |
| 1252 | 3300028794 | Ga0307515_10186828 | Ga0307515_101868284 | 177 |
| 1253 | 3300028794 | Ga0307515_10489385 | Ga0307515_104893852 | 177 |
| 1254 | 3300029957 | Ga0265324_10000286 | Ga0265324_1000028631 | 177 |
| 1255 | 3300030500 | Ga0268256_1008739 | Ga0268256_10087395 | 177 |
| 1256 | 3300030522 | Ga0307512_10045873 | Ga0307512_100458736 | 177 |
| 1257 | 3300030522 | Ga0307512_10091067 | Ga0307512_100910672 | 177 |
| 1258 | 3300030863 | Ga0265766_1000558 | Ga0265766_10005583 | 177 |
| 1259 | 3300030888 | Ga0265769_100669 | Ga0265769_1006693 | 177 |
| 1260 | 3300031239 | Ga0265328_10046852 | Ga0265328_100468523 | 177 |
| 1261 | 3300031250 | Ga0265331_10028635 | Ga0265331_100286354 | 177 |
| 1262 | 3300031251 | Ga0265327_10000020 | Ga0265327_10000020383 | 177 |
| 1263 | 3300031344 | Ga0265316_10000201 | Ga0265316_1000020112 | 177 |
| 1264 | 3300031456 | Ga0307513_10004080 | Ga0307513_1000408026 | 177 |
| 1265 | 3300031456 | Ga0307513_10019109 | Ga0307513_1001910913 | 177 |
| 1266 | 3300031456 | Ga0307513_10034953 | Ga0307513_100349531 | 177 |
| 1267 | 3300031456 | Ga0307513_10063852 | Ga0307513_100638526 | 177 |
| 1268 | 3300031456 | Ga0307513_10299705 | Ga0307513_102997052 | 177 |
| 1269 | 3300031456 | Ga0307513_10613605 | Ga0307513_106136051 | 177 |
| 1270 | 3300031507 | Ga0307509_10111735 | Ga0307509_101117355 | 177 |
| 1271 | 3300031507 | Ga0307509_10147814 | Ga0307509_101478143 | 177 |
| 1272 | 3300031507 | Ga0307509_10422082 | Ga0307509_104220822 | 177 |
| 1273 | 3300031507 | Ga0307509_10538122 | Ga0307509_105381222 | 177 |
| 1274 | 3300031548 | Ga0307408_100000089 | Ga0307408_10000008933 | 177 |
| 1275 | 3300031548 | Ga0307408_100013705 | Ga0307408_1000137056 | 177 |
| 1276 | 3300031548 | Ga0307408_100041917 | Ga0307408_1000419176 | 177 |
| 1277 | 3300031548 | Ga0307408_100255715 | Ga0307408_1002557151 | 177 |
| 1278 | 3300031548 | Ga0307408_100299160 | Ga0307408_1002991602 | 177 |
| 1279 | 3300031548 | Ga0307408_100345201 | Ga0307408_1003452011 | 177 |
| 1280 | 3300031616 | Ga0307508_10000392 | Ga0307508_1000039241 | 177 |
| 1281 | 3300031616 | Ga0307508_10103635 | Ga0307508_101036352 | 177 |
| 1282 | 3300031616 | Ga0307508_10335419 | Ga0307508_103354192 | 177 |
| 1283 | 3300031616 | Ga0307508_10529775 | Ga0307508_105297751 | 177 |
| 1284 | 3300031649 | Ga0307514_10000339 | Ga0307514_1000033957 | 177 |
| 1285 | 3300031649 | Ga0307514_10034392 | Ga0307514_100343926 | 177 |
| 1286 | 3300031649 | Ga0307514_10181649 | Ga0307514_101816492 | 177 |
| 1287 | 3300031730 | Ga0307516_10011689 | Ga0307516_1001168919 | 177 |
| 1288 | 3300031730 | Ga0307516_10019197 | Ga0307516_1001919711 | 177 |
| 1289 | 3300031730 | Ga0307516_10026535 | Ga0307516_100265356 | 177 |
| 1290 | 3300031730 | Ga0307516_10027941 | Ga0307516_1002794113 | 177 |
| 1291 | 3300031730 | Ga0307516_10357568 | Ga0307516_103575682 | 177 |
| 1292 | 3300031730 | Ga0307516_10435876 | Ga0307516_104358761 | 177 |
| 1293 | 3300031731 | Ga0307405_10012091 | Ga0307405_100120915 | 177 |
| 1294 | 3300031731 | Ga0307405_10046436 | Ga0307405_100464363 | 177 |
| 1295 | 3300031731 | Ga0307405_10089073 | Ga0307405_100890731 | 177 |
| 1296 | 3300031731 | Ga0307405_10114216 | Ga0307405_101142162 | 177 |
| 1297 | 3300031731 | Ga0307405_10423167 | Ga0307405_104231672 | 177 |
| 1298 | 3300031731 | Ga0307405_10425456 | Ga0307405_104254562 | 177 |
| 1299 | 3300031731 | Ga0307405_10997327 | Ga0307405_109973272 | 177 |
| 1300 | 3300031824 | Ga0307413_10032313 | Ga0307413_100323135 | 177 |
| 1301 | 3300031824 | Ga0307413_10400822 | Ga0307413_104008222 | 177 |
| 1302 | 3300031852 | Ga0307410_10063849 | Ga0307410_100638491 | 177 |
| 1303 | 3300031852 | Ga0307410_10073323 | Ga0307410_100733233 | 177 |
| 1304 | 3300031852 | Ga0307410_10140307 | Ga0307410_101403072 | 177 |
| 1305 | 3300031852 | Ga0307410_10351464 | Ga0307410_103514642 | 177 |
| 1306 | 3300031852 | Ga0307410_10480325 | Ga0307410_104803252 | 177 |
| 1307 | 3300031852 | Ga0307410_10516423 | Ga0307410_105164231 | 177 |
| 1308 | 3300031901 | Ga0307406_10004866 | Ga0307406_1000486610 | 177 |
| 1309 | 3300031901 | Ga0307406_10163268 | Ga0307406_101632683 | 177 |
| 1310 | 3300031901 | Ga0307406_10919022 | Ga0307406_109190221 | 177 |
| 1311 | 3300031901 | Ga0307406_10926733 | Ga0307406_109267332 | 177 |
| 1312 | 3300031903 | Ga0307407_10061462 | Ga0307407_100614623 | 177 |
| 1313 | 3300031903 | Ga0307407_10150436 | Ga0307407_101504363 | 177 |
| 1314 | 3300031903 | Ga0307407_10168478 | Ga0307407_101684783 | 177 |
| 1315 | 3300031911 | Ga0307412_10011559 | Ga0307412_100115594 | 177 |
| 1316 | 3300031911 | Ga0307412_10074922 | Ga0307412_100749224 | 177 |
| 1317 | 3300031911 | Ga0307412_10263875 | Ga0307412_102638752 | 177 |
| 1318 | 3300031911 | Ga0307412_10288983 | Ga0307412_102889833 | 177 |
| 1319 | 3300031911 | Ga0307412_10705923 | Ga0307412_107059232 | 177 |
| 1320 | 3300031995 | Ga0307409_100000577 | Ga0307409_10000057721 | 177 |
| 1321 | 3300031995 | Ga0307409_100077436 | Ga0307409_1000774362 | 177 |
| 1322 | 3300031995 | Ga0307409_100330064 | Ga0307409_1003300641 | 177 |
| 1323 | 3300031995 | Ga0307409_100676297 | Ga0307409_1006762972 | 177 |
| 1324 | 3300032002 | Ga0307416_100028404 | Ga0307416_1000284046 | 177 |
| 1325 | 3300032002 | Ga0307416_100043561 | Ga0307416_1000435613 | 177 |
| 1326 | 3300032002 | Ga0307416_100231430 | Ga0307416_1002314304 | 177 |
| 1327 | 3300032002 | Ga0307416_102038128 | Ga0307416_1020381281 | 177 |
| 1328 | 3300032004 | Ga0307414_10315494 | Ga0307414_103154942 | 177 |
| 1329 | 3300032004 | Ga0307414_10482787 | Ga0307414_104827872 | 177 |
| 1330 | 3300032004 | Ga0307414_10614971 | Ga0307414_106149712 | 177 |
| 1331 | 3300032004 | Ga0307414_11034159 | Ga0307414_110341591 | 177 |
| 1332 | 3300032004 | Ga0307414_11529907 | Ga0307414_115299071 | 177 |
| 1333 | 3300032005 | Ga0307411_10000085 | Ga0307411_1000008528 | 177 |
| 1334 | 3300032005 | Ga0307411_10059434 | Ga0307411_100594345 | 177 |
| 1335 | 3300032005 | Ga0307411_10249959 | Ga0307411_102499591 | 177 |
| 1336 | 3300032005 | Ga0307411_10330148 | Ga0307411_103301482 | 177 |
| 1337 | 3300032005 | Ga0307411_10372291 | Ga0307411_103722912 | 177 |
| 1338 | 3300032005 | Ga0307411_10417309 | Ga0307411_104173092 | 177 |
| 1339 | 3300032005 | Ga0307411_11428424 | Ga0307411_114284241 | 177 |
| 1340 | 3300032126 | Ga0307415_100034663 | Ga0307415_1000346633 | 177 |
| 1341 | 3300032126 | Ga0307415_100039097 | Ga0307415_1000390977 | 177 |
| 1342 | 3300032126 | Ga0307415_101345605 | Ga0307415_1013456051 | 177 |
| 1343 | 3300033179 | Ga0307507_10308226 | Ga0307507_103082261 | 177 |
| 1344 | 3300033180 | Ga0307510_10053339 | Ga0307510_100533392 | 177 |
| 1345 | 3300033180 | Ga0307510_10168701 | Ga0307510_101687012 | 177 |
| 1346 | 3300033180 | Ga0307510_10262217 | Ga0307510_102622171 | 177 |
| 1347 | 3300033180 | Ga0307510_10511068 | Ga0307510_105110681 | 177 |
| 1348 | 3300034817 | Ga0373948_0007447 | Ga0373948_0007447_1091_1624 | 177 |
| 1349 | 3300034818 | Ga0373950_0010768 | Ga0373950_0010768_614_1147 | 177 |
| 1350 | 3300034957 | Ga0373938_0017777 | Ga0373938_0017777_810_1343 | 177 |
| 1351 | 3300035092 | Ga0373952_0009457 | Ga0373952_0009457_847_1380 | 177 |
| 1352 | 3300035112 | Ga0373932_0032954 | Ga0373932_0032954_437_970 | 177 |
| 1353 | 3300035114 | Ga0373939_0000348 | Ga0373939_0000348_2739_3272 | 177 |
| 1354 | 3300035114 | Ga0373939_0042737 | Ga0373939_0042737_90_623 | 177 |
| 1355 | 3300035115 | Ga0373941_0041755 | Ga0373941_0041755_479_1012 | 177 |
| 1356 | 3300035121 | Ga0373960_0000482 | Ga0373960_0000482_6697_7230 | 177 |
| 1357 | 3300035172 | Ga0373955_0325970 | Ga0373955_0325970_39_572 | 177 |
| 1358 | 3300035207 | Ga0373942_0048831 | Ga0373942_0048831_44_577 | 177 |
| 1359 | 3300035242 | Ga0373962_0023573 | Ga0373962_0023573_371_904 | 177 |
| 1360 | 3300035242 | Ga0373962_0036659 | Ga0373962_0036659_367_900 | 177 |
| 1361 | 3300035691 | Ga0373931_0000535 | Ga0373931_0000535_3726_4259 | 177 |
| 1362 | 3300035691 | Ga0373931_0001474 | Ga0373931_0001474_5065_5598 | 177 |
| 1363 | 3300039447 | Ga0436361_0714431 | Ga0436361_0714431_7085_7618 | 177 |
| 1364 | 3300041443 | Ga0451789_0781745 | Ga0451789_0781745_238_771 | 177 |
| 1365 | 3300042012 | Ga0439455_0097345 | Ga0439455_0097345_247_780 | 177 |
| 1366 | 3300042127 | Ga0450890_000550 | Ga0450890_000550_789_1322 | 177 |
| 1367 | 3300042438 | Ga0439459_0000309 | Ga0439459_0000309_2637_3170 | 177 |
| 1368 | 3300042876 | Ga0451577_0004524 | Ga0451577_0004524_4703_5236 | 177 |
| 1369 | 3300044694 | Ga0466963_0028896 | Ga0466963_0028896_819_1352 | 177 |
| 1370 | 3300044712 | Ga0453684_0000516 | Ga0453684_0000516_22307_22870 | 177 |
| 1371 | 3300045051 | Ga0451576_0106671 | Ga0451576_0106671_1810_2343 | 177 |
| 1372 | 3300045976 | Ga0466967_0397643 | Ga0466967_0397643_650_1183 | 177 |
| 1373 | 3300046526 | Ga0495666_0154415 | Ga0495666_0154415_507_1040 | 177 |
| 1374 | 3300046683 | Ga0495658_0085813 | Ga0495658_0085813_496_1029 | 177 |
| 1375 | 3300048091 | Ga0495626_0074338 | Ga0495626_0074338_820_1353 | 177 |
| 1376 | 3300048905 | Ga0496102_0381564 | Ga0496102_0381564_293_826 | 177 |
| 1377 | 3300048906 | Ga0496103_0130430 | Ga0496103_0130430_260_793 | 177 |
| 1378 | 3300048907 | Ga0496104_0104722 | Ga0496104_0104722_1663_2196 | 177 |
| 1379 | 3300048910 | Ga0496107_0429419 | Ga0496107_0429419_13_546 | 177 |
| 1380 | 3300048913 | Ga0496110_0199440 | Ga0496110_0199440_221_754 | 177 |
| 1381 | 3300048913 | Ga0496110_1077670 | Ga0496110_1077670_164_697 | 177 |
| 1382 | 3300048916 | Ga0496113_0910699 | Ga0496113_0910699_120_653 | 177 |
| 1383 | 3300048918 | Ga0496115_0030230 | Ga0496115_0030230_2226_2759 | 177 |
| 1384 | 3300048924 | Ga0496121_0042385 | Ga0496121_0042385_46_579 | 177 |
| 1385 | 3300048927 | Ga0496124_0001830 | Ga0496124_0001830_20635_21168 | 177 |
| 1386 | 3300048928 | Ga0496125_0013937 | Ga0496125_0013937_2415_2948 | 177 |
| 1387 | 3300049127 | Ga0501306_001910 | Ga0501306_001910_129_662 | 177 |
| 1388 | 3300049128 | Ga0501308_008278 | Ga0501308_008278_83_616 | 177 |
| 1389 | 3300049527 | Ga0501311_014890 | Ga0501311_014890_354_887 | 177 |
| 1390 | 3300049530 | Ga0501314_002966 | Ga0501314_002966_700_1233 | 177 |
| 1391 | 3300049532 | Ga0501316_001021 | Ga0501316_001021_567_1100 | 177 |
| 1392 | 3300049538 | Ga0501322_000402 | Ga0501322_000402_1332_1865 | 177 |
| 1393 | 3300049649 | Ga0501198_000043 | Ga0501198_000043_35659_36192 | 177 |
| 1394 | 3300049662 | Ga0501222_000051 | Ga0501222_000051_7979_8512 | 177 |
| 1395 | 3300050493 | nmdc:mga0k408_117826_c1 | nmdc:mga0k408_117826_c1_427_960 | 177 |
| 1396 | 3300050496 | nmdc:mga07m45_13904_c1 | nmdc:mga07m45_13904_c1_2955_3488 | 177 |
| 1397 | 3300050496 | nmdc:mga07m45_74708_c1 | nmdc:mga07m45_74708_c1_913_1446 | 177 |
| 1398 | 3300059421 | Ga0590071_001831 | Ga0590071_001831_4096_4629 | 177 |
| 1399 | 3300059424 | Ga0590075_011325 | Ga0590075_011325_231_764 | 177 |
| 1400 | 3300059477 | Ga0587084_012022 | Ga0587084_012022_23_556 | 177 |
| 1401 | 3300059477 | Ga0587084_034985 | Ga0587084_034985_204_737 | 177 |
| 1402 | 3300059491 | Ga0587070_007134 | Ga0587070_007134_645_1178 | 177 |
| 1403 | 3300059491 | Ga0587070_098543 | Ga0587070_098543_29_562 | 177 |
| 1404 | 3300059505 | Ga0587083_0017882 | Ga0587083_0017882_94_627 | 177 |
| 1405 | 3300059507 | Ga0587086_016978 | Ga0587086_016978_191_724 | 177 |
| 1406 | 3300059623 | Ga0587101_001008 | Ga0587101_001008_423_956 | 177 |
| 1407 | 3300059639 | Ga0587062_008101 | Ga0587062_008101_236_769 | 177 |
| 1408 | 3300059641 | Ga0587068_001309 | Ga0587068_001309_1742_2275 | 177 |
| 1409 | 3300059653 | Ga0587108_002956 | Ga0587108_002956_522_1055 | 177 |
| 1410 | 3300060346 | Ga0587111_0005177 | Ga0587111_0005177_961_1494 | 177 |
| 1411 | 3300060346 | Ga0587111_0104287 | Ga0587111_0104287_31_564 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5li0-assembly1.cif.gz_H | 70s ribosome from staphylococcus aureus | 0.9175 | 9 | 167 |
| 6v3b-assembly1.cif.gz_G | cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state | 0.9163 | 2 | 167 |
| 7nhn-assembly1.cif.gz_K | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9147 | 9 | 167 |
| 8ceu-assembly1.cif.gz_g | retapamulin and capreomycin bound to the 50s subunit | 0.9121 | 2 | 167 |
| 487d-assembly1.cif.gz_J | seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution | 0.912 | 9 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x8tG01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9257 | 3 | 82 | 3.90.930.12 |
| 5x8tG01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9043 | 3 | 82 | 3.90.930.12 |
| 4qcxH01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.8968 | 2 | 82 | 3.90.930.12 |
| 2zjqE01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.8949 | 8 | 79 | 3.90.930.12 |
| 1vs8G01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.8932 | 2 | 82 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0LBH2-F1-model_v4 | 50S ribosomal protein L6 | 0.9876 | 8 | 79 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A4P9I807-F1-model_v4 | 50S ribosomal protein L6 | 0.9756 | 9 | 150 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A1V4GKA1-F1-model_v4 | deleted | 0.9646 | 78 | 146 |
|
| AF-A0A4P9I807-F1-model_v4 | 50S ribosomal protein L6 | 0.9623 | 9 | 150 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A6B3I972-F1-model_v4 | 50S ribosomal protein L6 | 0.9546 | 70 | 142 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar