F493655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1399 | 508 | 2799 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100114325|Ga0068860_1001143252 |
| Length | 230 |
| Sequence | MAWYAKTVKRRSSAGSLRRRYGFGARWNAGHARCVKILAVVFVLDNYDSFTYNLVQYLGELGAKVEVRRNDQVTIEEVERLRPERIVVSPGPCTPQEAGISIELIRHFAGRVPLLGVCLGHQAIGAAFGGSVVRARNLMHGKTSQVQHDGRTIFRGVASPMTATRYHSLIVAEEDLPADLEVTAHTLEKDGTRVIMGLRHRRFPVEGVQFHPESVLTADGKNLVKNFLEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 149 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 150 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 151 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 242 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 246 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 260 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 261 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 262 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 269 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 284 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 292 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 297 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 298 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 299 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 300 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 301 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 302 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 303 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 304 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 305 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 306 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 307 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 308 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 310 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 311 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 312 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 313 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 314 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 317 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 318 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 319 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 383 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 411 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 416 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 420 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 433 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 436 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 437 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 438 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 439 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 440 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 441 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 442 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 443 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 444 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 445 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 446 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 447 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 448 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 449 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 450 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 451 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 452 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 453 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 454 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 455 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 456 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 457 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 458 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 459 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 460 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 461 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 462 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 463 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 464 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 465 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 466 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 467 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 468 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 469 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 470 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 471 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 472 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 473 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 474 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 475 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 476 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 477 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 478 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 479 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 480 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 481 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 482 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 483 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 484 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 485 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 486 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 487 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 488 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 489 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 490 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 491 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 492 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 493 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 494 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 495 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 496 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 497 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 498 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 499 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 500 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 501 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 502 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 503 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 504 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 505 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 506 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 507 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 508 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.14 |
| Metatranscriptomes | 1.72 |
| Isolates | 5.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 6.65 |
| Rhizosphere | 88.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068860_100114325 | 3300005843 | Bacteria | 2581 |
| 2 | JGI24752J21851_1000650 | 3300001976 | Bacteria | 4633 |
| 3 | JGI24737J22298_10062562 | 3300001990 | Bacteria | 1118 |
| 4 | JGI24743J22301_10017797 | 3300001991 | Bacteria | 1338 |
| 5 | JGI24735J21928_10031651 | 3300002067 | Bacteria | 1568 |
| 6 | JGI24751J29686_10002240 | 3300002459 | Bacteria | 3917 |
| 7 | JGI25406J46586_10034709 | 3300003203 | Bacteria | 1848 |
| 8 | rootH1_10038406 | 3300003316 | Bacteria | 5727 |
| 9 | rootH1_10038406 | 3300003323 | Bacteria | 17804 |
| 10 | Ga0055526_1024061 | 3300003771 | Bacteria | 2007 |
| 11 | Ga0055537_1000149 | 3300003773 | Bacteria | 52269 |
| 12 | Ga0055536_1035424 | 3300003781 | Bacteria | 1248 |
| 13 | Ga0058692_1011227 | 3300003856 | Bacteria | 2176 |
| 14 | Ga0065712_10009377 | 3300005290 | Bacteria | 2551 |
| 15 | Ga0065712_10078052 | 3300005290 | Bacteria | 3401 |
| 16 | Ga0065707_10103873 | 3300005295 | Bacteria | 2725 |
| 17 | Ga0070658_10061551 | 3300005327 | Bacteria | 3058 |
| 18 | Ga0070658_10239517 | 3300005327 | Bacteria | 1537 |
| 19 | Ga0070658_10259800 | 3300005327 | Bacteria | 1475 |
| 20 | Ga0070658_10314824 | 3300005327 | Bacteria | 1336 |
| 21 | Ga0070676_10102753 | 3300005328 | Bacteria | 1768 |
| 22 | Ga0070676_10233614 | 3300005328 | Bacteria | 1220 |
| 23 | Ga0070683_100005535 | 3300005329 | Bacteria | 10553 |
| 24 | Ga0070683_100011335 | 3300005329 | Bacteria | 7700 |
| 25 | Ga0070683_100072776 | 3300005329 | Bacteria | 3209 |
| 26 | Ga0070683_100194924 | 3300005329 | Bacteria | 1924 |
| 27 | Ga0070683_100256339 | 3300005329 | Bacteria | 1664 |
| 28 | Ga0070683_100376306 | 3300005329 | Bacteria | 1353 |
| 29 | Ga0070683_100540844 | 3300005329 | Bacteria | 1114 |
| 30 | Ga0070690_100002873 | 3300005330 | Bacteria | 9292 |
| 31 | Ga0070690_100015460 | 3300005330 | Bacteria | 4553 |
| 32 | Ga0070690_100055841 | 3300005330 | Bacteria | 2530 |
| 33 | Ga0070690_100081392 | 3300005330 | Bacteria | 2119 |
| 34 | Ga0070670_100001994 | 3300005331 | Bacteria | 16695 |
| 35 | Ga0070670_100085671 | 3300005331 | Bacteria | 2707 |
| 36 | Ga0070670_100324572 | 3300005331 | Bacteria | 1349 |
| 37 | Ga0070670_100668670 | 3300005331 | Bacteria | 932 |
| 38 | Ga0070677_10013893 | 3300005333 | Bacteria | 2826 |
| 39 | Ga0068869_100015244 | 3300005334 | Bacteria | 5151 |
| 40 | Ga0068869_100048422 | 3300005334 | Bacteria | 3073 |
| 41 | Ga0068869_100176047 | 3300005334 | Bacteria | 1674 |
| 42 | Ga0070666_10000661 | 3300005335 | Bacteria | 20806 |
| 43 | Ga0070666_10066656 | 3300005335 | Bacteria | 2443 |
| 44 | Ga0070680_100286675 | 3300005336 | Bacteria | 1396 |
| 45 | Ga0070680_100341735 | 3300005336 | Bacteria | 1272 |
| 46 | Ga0070680_100570007 | 3300005336 | Bacteria | 971 |
| 47 | Ga0070682_100006928 | 3300005337 | Bacteria | 6371 |
| 48 | Ga0070682_100180582 | 3300005337 | Bacteria | 1474 |
| 49 | Ga0070682_100363945 | 3300005337 | Bacteria | 1082 |
| 50 | Ga0068868_100000504 | 3300005338 | Bacteria | 26070 |
| 51 | Ga0068868_100017206 | 3300005338 | Bacteria | 5380 |
| 52 | Ga0068868_100041741 | 3300005338 | Bacteria | 3575 |
| 53 | Ga0068868_100057085 | 3300005338 | Bacteria | 3084 |
| 54 | Ga0068868_100079154 | 3300005338 | Bacteria | 2633 |
| 55 | Ga0070660_100002867 | 3300005339 | Bacteria | 11876 |
| 56 | Ga0070660_100025266 | 3300005339 | Bacteria | 4413 |
| 57 | Ga0070660_100035205 | 3300005339 | Bacteria | 3789 |
| 58 | Ga0070689_100709587 | 3300005340 | Bacteria | 879 |
| 59 | Ga0070687_100012708 | 3300005343 | Bacteria | 3725 |
| 60 | Ga0070661_100024795 | 3300005344 | Bacteria | 4304 |
| 61 | Ga0070661_100031525 | 3300005344 | Bacteria | 3835 |
| 62 | Ga0070661_100061451 | 3300005344 | Bacteria | 2757 |
| 63 | Ga0070661_100273825 | 3300005344 | Bacteria | 1308 |
| 64 | Ga0070692_10100191 | 3300005345 | Bacteria | 1587 |
| 65 | Ga0070668_100009641 | 3300005347 | Bacteria | 7161 |
| 66 | Ga0070668_100016265 | 3300005347 | Bacteria | 5564 |
| 67 | Ga0070668_100022820 | 3300005347 | Bacteria | 4731 |
| 68 | Ga0070669_100262422 | 3300005353 | Bacteria | 1379 |
| 69 | Ga0070669_100717362 | 3300005353 | Bacteria | 845 |
| 70 | Ga0070669_100829798 | 3300005353 | Bacteria | 787 |
| 71 | Ga0070675_100022011 | 3300005354 | Bacteria | 5094 |
| 72 | Ga0070671_100028977 | 3300005355 | Bacteria | 4564 |
| 73 | Ga0070671_100048259 | 3300005355 | Bacteria | 3540 |
| 74 | Ga0070674_100004017 | 3300005356 | Bacteria | 8340 |
| 75 | Ga0070674_100427599 | 3300005356 | Bacteria | 1088 |
| 76 | Ga0070674_100535697 | 3300005356 | Bacteria | 980 |
| 77 | Ga0070673_100029452 | 3300005364 | Bacteria | 4094 |
| 78 | Ga0070673_100066374 | 3300005364 | Bacteria | 2882 |
| 79 | Ga0070673_100077101 | 3300005364 | Bacteria | 2693 |
| 80 | Ga0070673_100164469 | 3300005364 | Bacteria | 1889 |
| 81 | Ga0070673_100464665 | 3300005364 | Bacteria | 1140 |
| 82 | Ga0070688_100012103 | 3300005365 | Bacteria | 4821 |
| 83 | Ga0070688_101043035 | 3300005365 | Bacteria | 651 |
| 84 | Ga0070659_100000441 | 3300005366 | Bacteria | 31078 |
| 85 | Ga0070659_100037235 | 3300005366 | Bacteria | 3792 |
| 86 | Ga0070659_100062741 | 3300005366 | Bacteria | 2938 |
| 87 | Ga0070659_100383491 | 3300005366 | Bacteria | 1184 |
| 88 | Ga0070667_100000600 | 3300005367 | Bacteria | 35155 |
| 89 | Ga0070667_100017478 | 3300005367 | Bacteria | 5944 |
| 90 | Ga0070667_100136457 | 3300005367 | Bacteria | 2145 |
| 91 | Ga0070667_100143615 | 3300005367 | Bacteria | 2092 |
| 92 | Ga0070667_100231688 | 3300005367 | Bacteria | 1647 |
| 93 | Ga0070667_100372408 | 3300005367 | Bacteria | 1296 |
| 94 | Ga0070709_10005028 | 3300005434 | Bacteria | 7148 |
| 95 | Ga0070709_10019229 | 3300005434 | Bacteria | 3945 |
| 96 | Ga0070709_10022512 | 3300005434 | Bacteria | 3688 |
| 97 | Ga0070709_10109546 | 3300005434 | Bacteria | 1854 |
| 98 | Ga0070709_10111775 | 3300005434 | Bacteria | 1837 |
| 99 | Ga0070709_10120662 | 3300005434 | Bacteria | 1776 |
| 100 | Ga0070709_10197930 | 3300005434 | Bacteria | 1421 |
| 101 | Ga0070714_100027851 | 3300005435 | Bacteria | 4682 |
| 102 | Ga0070714_100156782 | 3300005435 | Bacteria | 2056 |
| 103 | Ga0070714_100226535 | 3300005435 | Bacteria | 1721 |
| 104 | Ga0070714_100550288 | 3300005435 | Bacteria | 1105 |
| 105 | Ga0070713_100000114 | 3300005436 | Bacteria | 52713 |
| 106 | Ga0070713_100007883 | 3300005436 | Bacteria | 7514 |
| 107 | Ga0070713_100016681 | 3300005436 | Bacteria | 5527 |
| 108 | Ga0070713_100018928 | 3300005436 | Bacteria | 5243 |
| 109 | Ga0070713_100224194 | 3300005436 | Bacteria | 1706 |
| 110 | Ga0070713_100275971 | 3300005436 | Bacteria | 1541 |
| 111 | Ga0070713_100471899 | 3300005436 | Bacteria | 1181 |
| 112 | Ga0070713_100800630 | 3300005436 | Bacteria | 903 |
| 113 | Ga0070713_100859813 | 3300005436 | Bacteria | 871 |
| 114 | Ga0070713_100970027 | 3300005436 | Bacteria | 819 |
| 115 | Ga0070710_10002299 | 3300005437 | Bacteria | 9045 |
| 116 | Ga0070710_10149885 | 3300005437 | Bacteria | 1438 |
| 117 | Ga0070710_10394928 | 3300005437 | Bacteria | 926 |
| 118 | Ga0070711_100000079 | 3300005439 | Bacteria | 53822 |
| 119 | Ga0070711_100063062 | 3300005439 | Bacteria | 2586 |
| 120 | Ga0070711_101297572 | 3300005439 | Bacteria | 632 |
| 121 | Ga0070705_100037016 | 3300005440 | Bacteria | 2749 |
| 122 | Ga0070700_100203178 | 3300005441 | Bacteria | 1393 |
| 123 | Ga0070694_100211912 | 3300005444 | Bacteria | 1449 |
| 124 | Ga0070694_100806629 | 3300005444 | Bacteria | 770 |
| 125 | Ga0070708_100007624 | 3300005445 | Bacteria | 8668 |
| 126 | Ga0070708_100017236 | 3300005445 | Bacteria | 6017 |
| 127 | Ga0070708_100019283 | 3300005445 | Bacteria | 5729 |
| 128 | Ga0070708_100032809 | 3300005445 | Bacteria | 4506 |
| 129 | Ga0070708_100041725 | 3300005445 | Bacteria | 4024 |
| 130 | Ga0070708_100072878 | 3300005445 | Bacteria | 3095 |
| 131 | Ga0070708_100099478 | 3300005445 | Bacteria | 2661 |
| 132 | Ga0070708_100115612 | 3300005445 | Bacteria | 2469 |
| 133 | Ga0070708_100296677 | 3300005445 | Bacteria | 1522 |
| 134 | Ga0070708_100589993 | 3300005445 | Bacteria | 1047 |
| 135 | Ga0070708_101140121 | 3300005445 | Bacteria | 730 |
| 136 | Ga0070708_101512150 | 3300005445 | Bacteria | 625 |
| 137 | Ga0070708_101524037 | 3300005445 | Bacteria | 623 |
| 138 | Ga0070663_100218346 | 3300005455 | Bacteria | 1496 |
| 139 | Ga0070678_100103712 | 3300005456 | Bacteria | 2210 |
| 140 | Ga0070662_100011640 | 3300005457 | Bacteria | 5807 |
| 141 | Ga0070662_100322788 | 3300005457 | Unclassified | 1259 |
| 142 | Ga0070681_10000642 | 3300005458 | Bacteria | 28781 |
| 143 | Ga0070681_10011678 | 3300005458 | Bacteria | 8699 |
| 144 | Ga0070681_10016194 | 3300005458 | Bacteria | 7433 |
| 145 | Ga0070681_10262055 | 3300005458 | Bacteria | 1641 |
| 146 | Ga0070681_10303161 | 3300005458 | Bacteria | 1507 |
| 147 | Ga0070681_10324808 | 3300005458 | Bacteria | 1448 |
| 148 | Ga0070681_10405412 | 3300005458 | Bacteria | 1275 |
| 149 | Ga0070681_10641871 | 3300005458 | Bacteria | 976 |
| 150 | Ga0070681_10715097 | 3300005458 | Bacteria | 918 |
| 151 | Ga0068867_100004954 | 3300005459 | Bacteria | 9385 |
| 152 | Ga0068867_100024665 | 3300005459 | Bacteria | 4310 |
| 153 | Ga0068867_100060574 | 3300005459 | Bacteria | 2808 |
| 154 | Ga0070685_10018857 | 3300005466 | Bacteria | 3716 |
| 155 | Ga0070706_100000496 | 3300005467 | Bacteria | 46239 |
| 156 | Ga0070706_100000955 | 3300005467 | Bacteria | 31473 |
| 157 | Ga0070706_100028459 | 3300005467 | Bacteria | 5144 |
| 158 | Ga0070706_100040073 | 3300005467 | Bacteria | 4324 |
| 159 | Ga0070706_100157284 | 3300005467 | Bacteria | 2121 |
| 160 | Ga0070706_100391676 | 3300005467 | Bacteria | 1293 |
| 161 | Ga0070707_100004175 | 3300005468 | Bacteria | 13535 |
| 162 | Ga0070707_100004753 | 3300005468 | Bacteria | 12719 |
| 163 | Ga0070707_100005558 | 3300005468 | Bacteria | 11775 |
| 164 | Ga0070707_100082927 | 3300005468 | Bacteria | 3097 |
| 165 | Ga0070707_100159304 | 3300005468 | Bacteria | 2199 |
| 166 | Ga0070707_100248320 | 3300005468 | Bacteria | 1732 |
| 167 | Ga0070707_100251853 | 3300005468 | Bacteria | 1719 |
| 168 | Ga0070707_100297150 | 3300005468 | Bacteria | 1569 |
| 169 | Ga0070707_100433974 | 3300005468 | Bacteria | 1274 |
| 170 | Ga0070707_100504240 | 3300005468 | Bacteria | 1172 |
| 171 | Ga0070707_100662898 | 3300005468 | Bacteria | 1006 |
| 172 | Ga0070698_100000012 | 3300005471 | Bacteria | 116260 |
| 173 | Ga0070698_100000017 | 3300005471 | Bacteria | 107963 |
| 174 | Ga0070698_100001685 | 3300005471 | Bacteria | 24660 |
| 175 | Ga0070698_100006862 | 3300005471 | Bacteria | 12330 |
| 176 | Ga0070698_100040622 | 3300005471 | Bacteria | 4780 |
| 177 | Ga0070698_100065165 | 3300005471 | Bacteria | 3669 |
| 178 | Ga0070698_100153734 | 3300005471 | Bacteria | 2247 |
| 179 | Ga0070698_100254312 | 3300005471 | Bacteria | 1689 |
| 180 | Ga0070699_100006774 | 3300005518 | Bacteria | 9969 |
| 181 | Ga0070699_100041263 | 3300005518 | Bacteria | 3995 |
| 182 | Ga0070699_100084830 | 3300005518 | Bacteria | 2764 |
| 183 | Ga0070699_100689739 | 3300005518 | Bacteria | 933 |
| 184 | Ga0070679_100012676 | 3300005530 | Bacteria | 8062 |
| 185 | Ga0070679_100053788 | 3300005530 | Bacteria | 4008 |
| 186 | Ga0070679_100339985 | 3300005530 | Bacteria | 1449 |
| 187 | Ga0070679_100410943 | 3300005530 | Bacteria | 1299 |
| 188 | Ga0070679_100424446 | 3300005530 | Unclassified | 1275 |
| 189 | Ga0070684_100019600 | 3300005535 | Bacteria | 5598 |
| 190 | Ga0070684_100025303 | 3300005535 | Bacteria | 4988 |
| 191 | Ga0070684_100171598 | 3300005535 | Bacteria | 1970 |
| 192 | Ga0070684_100187089 | 3300005535 | Bacteria | 1883 |
| 193 | Ga0070697_100000873 | 3300005536 | Bacteria | 22668 |
| 194 | Ga0070697_100007553 | 3300005536 | Bacteria | 8465 |
| 195 | Ga0070697_100008250 | 3300005536 | Bacteria | 8128 |
| 196 | Ga0070697_100017259 | 3300005536 | Bacteria | 5676 |
| 197 | Ga0070697_100017646 | 3300005536 | Bacteria | 5621 |
| 198 | Ga0070697_100023354 | 3300005536 | Bacteria | 4917 |
| 199 | Ga0070697_100053091 | 3300005536 | Bacteria | 3294 |
| 200 | Ga0070697_100075525 | 3300005536 | Bacteria | 2770 |
| 201 | Ga0070697_100156419 | 3300005536 | Bacteria | 1924 |
| 202 | Ga0070697_100520075 | 3300005536 | Bacteria | 1042 |
| 203 | Ga0070697_100678662 | 3300005536 | Bacteria | 908 |
| 204 | Ga0070697_100911080 | 3300005536 | Bacteria | 780 |
| 205 | Ga0070697_101152232 | 3300005536 | Bacteria | 691 |
| 206 | Ga0068853_100000021 | 3300005539 | Bacteria | 149283 |
| 207 | Ga0068853_100007555 | 3300005539 | Bacteria | 8701 |
| 208 | Ga0068853_100113553 | 3300005539 | Bacteria | 2409 |
| 209 | Ga0068853_100122534 | 3300005539 | Bacteria | 2321 |
| 210 | Ga0070672_100390524 | 3300005543 | Bacteria | 1192 |
| 211 | Ga0070686_100253314 | 3300005544 | Bacteria | 1287 |
| 212 | Ga0070695_100147961 | 3300005545 | Bacteria | 1636 |
| 213 | Ga0070695_100207944 | 3300005545 | Bacteria | 1403 |
| 214 | Ga0070695_100269279 | 3300005545 | Bacteria | 1247 |
| 215 | Ga0070696_100007647 | 3300005546 | Bacteria | 7221 |
| 216 | Ga0070696_100115687 | 3300005546 | Bacteria | 1936 |
| 217 | Ga0070696_100135388 | 3300005546 | Bacteria | 1796 |
| 218 | Ga0070693_100021064 | 3300005547 | Bacteria | 3449 |
| 219 | Ga0070693_100054370 | 3300005547 | Bacteria | 2302 |
| 220 | Ga0070693_100100776 | 3300005547 | Bacteria | 1759 |
| 221 | Ga0070693_100119601 | 3300005547 | Bacteria | 1632 |
| 222 | Ga0070665_100279358 | 3300005548 | Bacteria | 1671 |
| 223 | Ga0070665_100798245 | 3300005548 | Bacteria | 957 |
| 224 | Ga0070704_100144686 | 3300005549 | Bacteria | 1861 |
| 225 | Ga0070704_100383974 | 3300005549 | Bacteria | 1194 |
| 226 | Ga0070704_100480180 | 3300005549 | Bacteria | 1075 |
| 227 | Ga0068855_100004030 | 3300005563 | Bacteria | 17929 |
| 228 | Ga0068855_100021151 | 3300005563 | Bacteria | 7799 |
| 229 | Ga0068855_100045941 | 3300005563 | Bacteria | 5163 |
| 230 | Ga0068855_100048051 | 3300005563 | Bacteria | 5037 |
| 231 | Ga0068855_100102272 | 3300005563 | Bacteria | 3298 |
| 232 | Ga0068855_100108155 | 3300005563 | Bacteria | 3194 |
| 233 | Ga0068855_100111413 | 3300005563 | Bacteria | 3142 |
| 234 | Ga0068855_100217176 | 3300005563 | Bacteria | 2146 |
| 235 | Ga0068855_100279099 | 3300005563 | Bacteria | 1856 |
| 236 | Ga0068855_100521175 | 3300005563 | Bacteria | 1289 |
| 237 | Ga0068855_100792066 | 3300005563 | Bacteria | 1008 |
| 238 | Ga0068855_100955485 | 3300005563 | Bacteria | 902 |
| 239 | Ga0068855_101040517 | 3300005563 | Bacteria | 858 |
| 240 | Ga0068855_101122042 | 3300005563 | Bacteria | 821 |
| 241 | Ga0070664_100000740 | 3300005564 | Bacteria | 25178 |
| 242 | Ga0070664_100699940 | 3300005564 | Bacteria | 944 |
| 243 | Ga0070664_100711765 | 3300005564 | Bacteria | 936 |
| 244 | Ga0068857_100000267 | 3300005577 | Bacteria | 35430 |
| 245 | Ga0068857_100002375 | 3300005577 | Bacteria | 15345 |
| 246 | Ga0068857_100100451 | 3300005577 | Bacteria | 2595 |
| 247 | Ga0068857_100478199 | 3300005577 | Bacteria | 1167 |
| 248 | Ga0068857_100718617 | 3300005577 | Bacteria | 950 |
| 249 | Ga0068857_100769593 | 3300005577 | Bacteria | 918 |
| 250 | Ga0068857_101119497 | 3300005577 | Bacteria | 761 |
| 251 | Ga0068854_100000075 | 3300005578 | Bacteria | 71042 |
| 252 | Ga0068854_100023364 | 3300005578 | Bacteria | 4222 |
| 253 | Ga0068854_100162470 | 3300005578 | Bacteria | 1731 |
| 254 | Ga0068854_100338409 | 3300005578 | Bacteria | 1228 |
| 255 | Ga0068856_100000269 | 3300005614 | Bacteria | 56597 |
| 256 | Ga0068856_100002494 | 3300005614 | Bacteria | 18939 |
| 257 | Ga0068856_100005791 | 3300005614 | Bacteria | 12177 |
| 258 | Ga0068856_100043287 | 3300005614 | Bacteria | 4430 |
| 259 | Ga0068856_100051572 | 3300005614 | Bacteria | 4056 |
| 260 | Ga0068856_100121153 | 3300005614 | Bacteria | 2617 |
| 261 | Ga0068856_100133325 | 3300005614 | Bacteria | 2489 |
| 262 | Ga0068856_100209044 | 3300005614 | Bacteria | 1966 |
| 263 | Ga0068856_100209101 | 3300005614 | Bacteria | 1966 |
| 264 | Ga0068856_100315781 | 3300005614 | Bacteria | 1580 |
| 265 | Ga0068856_100810903 | 3300005614 | Bacteria | 955 |
| 266 | Ga0068856_100842084 | 3300005614 | Bacteria | 936 |
| 267 | Ga0070702_100001604 | 3300005615 | Bacteria | 9345 |
| 268 | Ga0070702_100359896 | 3300005615 | Bacteria | 1028 |
| 269 | Ga0070702_100376419 | 3300005615 | Bacteria | 1008 |
| 270 | Ga0068852_100025621 | 3300005616 | Bacteria | 4781 |
| 271 | Ga0068852_100116269 | 3300005616 | Bacteria | 2440 |
| 272 | Ga0068852_100318991 | 3300005616 | Bacteria | 1509 |
| 273 | Ga0068859_100000431 | 3300005617 | Bacteria | 42019 |
| 274 | Ga0068859_100055276 | 3300005617 | Bacteria | 3994 |
| 275 | Ga0068859_100157039 | 3300005617 | Bacteria | 2352 |
| 276 | Ga0068859_100584780 | 3300005617 | Bacteria | 1210 |
| 277 | Ga0068864_100036410 | 3300005618 | Bacteria | 4195 |
| 278 | Ga0068864_100061894 | 3300005618 | Bacteria | 3242 |
| 279 | Ga0068866_10064075 | 3300005718 | Bacteria | 1918 |
| 280 | Ga0068866_10106189 | 3300005718 | Bacteria | 1558 |
| 281 | Ga0068861_100058704 | 3300005719 | Bacteria | 2943 |
| 282 | Ga0068861_100808501 | 3300005719 | Bacteria | 880 |
| 283 | Ga0068851_10021663 | 3300005834 | Bacteria | 3121 |
| 284 | Ga0068851_10071374 | 3300005834 | Bacteria | 1797 |
| 285 | Ga0068851_10304219 | 3300005834 | Bacteria | 917 |
| 286 | Ga0068870_10003679 | 3300005840 | Bacteria | 6514 |
| 287 | Ga0068870_10006265 | 3300005840 | Bacteria | 5238 |
| 288 | Ga0068863_100013702 | 3300005841 | Bacteria | 7818 |
| 289 | Ga0068863_100033779 | 3300005841 | Bacteria | 4873 |
| 290 | Ga0068863_100068166 | 3300005841 | Bacteria | 3366 |
| 291 | Ga0068863_100418270 | 3300005841 | Bacteria | 1313 |
| 292 | Ga0068858_100000940 | 3300005842 | Bacteria | 30178 |
| 293 | Ga0068858_100001833 | 3300005842 | Bacteria | 21646 |
| 294 | Ga0068858_100022771 | 3300005842 | Bacteria | 5842 |
| 295 | Ga0068858_100096556 | 3300005842 | Bacteria | 2754 |
| 296 | Ga0068858_100103209 | 3300005842 | Bacteria | 2660 |
| 297 | Ga0068858_100545820 | 3300005842 | Bacteria | 1122 |
| 298 | Ga0068858_100610848 | 3300005842 | Bacteria | 1058 |
| 299 | Ga0068860_100024142 | 3300005843 | Bacteria | 5879 |
| 300 | Ga0068860_100098924 | 3300005843 | Bacteria | 2782 |
| 301 | Ga0068860_100234677 | 3300005843 | Bacteria | 1783 |
| 302 | Ga0068860_100246000 | 3300005843 | Bacteria | 1740 |
| 303 | Ga0068860_100472801 | 3300005843 | Bacteria | 1248 |
| 304 | Ga0068860_100542714 | 3300005843 | Bacteria | 1164 |
| 305 | Ga0068862_100649853 | 3300005844 | Bacteria | 1017 |
| 306 | Ga0081455_10001388 | 3300005937 | Bacteria | 29908 |
| 307 | Ga0081455_10203612 | 3300005937 | Bacteria | 1480 |
| 308 | Ga0081540_1062392 | 3300005983 | Bacteria | 1770 |
| 309 | Ga0081539_10000728 | 3300005985 | Bacteria | 65949 |
| 310 | Ga0081539_10060584 | 3300005985 | Bacteria | 2077 |
| 311 | Ga0070717_10004198 | 3300006028 | Bacteria | 10389 |
| 312 | Ga0070717_10057313 | 3300006028 | Bacteria | 3220 |
| 313 | Ga0070717_10259897 | 3300006028 | Bacteria | 1536 |
| 314 | Ga0070717_10382357 | 3300006028 | Bacteria | 1262 |
| 315 | Ga0075363_100147428 | 3300006048 | Bacteria | 1327 |
| 316 | Ga0075432_10007225 | 3300006058 | Bacteria | 3779 |
| 317 | Ga0070715_10118853 | 3300006163 | Bacteria | 1257 |
| 318 | Ga0070716_100006307 | 3300006173 | Bacteria | 5789 |
| 319 | Ga0070716_100006656 | 3300006173 | Bacteria | 5655 |
| 320 | Ga0070716_100029593 | 3300006173 | Bacteria | 2963 |
| 321 | Ga0070716_100033701 | 3300006173 | Bacteria | 2803 |
| 322 | Ga0070716_100135199 | 3300006173 | Bacteria | 1564 |
| 323 | Ga0070716_100140547 | 3300006173 | Bacteria | 1539 |
| 324 | Ga0070716_100284246 | 3300006173 | Bacteria | 1143 |
| 325 | Ga0070716_100350276 | 3300006173 | Bacteria | 1045 |
| 326 | Ga0070712_100000211 | 3300006175 | Bacteria | 32872 |
| 327 | Ga0070712_100042436 | 3300006175 | Bacteria | 3128 |
| 328 | Ga0070712_100494881 | 3300006175 | Bacteria | 1024 |
| 329 | Ga0070712_100527016 | 3300006175 | Bacteria | 993 |
| 330 | Ga0070712_100872214 | 3300006175 | Bacteria | 775 |
| 331 | Ga0075427_10005714 | 3300006194 | Bacteria | 1780 |
| 332 | Ga0097621_100000044 | 3300006237 | Bacteria | 65368 |
| 333 | Ga0097621_100000545 | 3300006237 | Bacteria | 26489 |
| 334 | Ga0097621_100011159 | 3300006237 | Bacteria | 6612 |
| 335 | Ga0097621_100024996 | 3300006237 | Bacteria | 4670 |
| 336 | Ga0097621_100118923 | 3300006237 | Bacteria | 2239 |
| 337 | Ga0097621_100424482 | 3300006237 | Bacteria | 1194 |
| 338 | Ga0068871_100000175 | 3300006358 | Bacteria | 43254 |
| 339 | Ga0068871_100010478 | 3300006358 | Bacteria | 6767 |
| 340 | Ga0068871_100020452 | 3300006358 | Bacteria | 5071 |
| 341 | Ga0068871_100042533 | 3300006358 | Bacteria | 3648 |
| 342 | Ga0068871_100102587 | 3300006358 | Bacteria | 2398 |
| 343 | Ga0068871_100167115 | 3300006358 | Bacteria | 1884 |
| 344 | Ga0068871_100326711 | 3300006358 | Bacteria | 1352 |
| 345 | Ga0075428_100067910 | 3300006844 | Bacteria | 3901 |
| 346 | Ga0075428_100343300 | 3300006844 | Bacteria | 1603 |
| 347 | Ga0075428_100361528 | 3300006844 | Bacteria | 1557 |
| 348 | Ga0075428_101469511 | 3300006844 | Bacteria | 714 |
| 349 | Ga0075430_100010696 | 3300006846 | Bacteria | 7775 |
| 350 | Ga0075430_100082297 | 3300006846 | Bacteria | 2697 |
| 351 | Ga0075430_100209261 | 3300006846 | Bacteria | 1618 |
| 352 | Ga0075431_100012237 | 3300006847 | Bacteria | 8662 |
| 353 | Ga0075433_10005361 | 3300006852 | Bacteria | 10069 |
| 354 | Ga0075433_10007214 | 3300006852 | Bacteria | 8800 |
| 355 | Ga0075433_10009062 | 3300006852 | Bacteria | 7950 |
| 356 | Ga0075433_10014696 | 3300006852 | Bacteria | 6405 |
| 357 | Ga0075433_10084262 | 3300006852 | Bacteria | 2806 |
| 358 | Ga0075433_10378965 | 3300006852 | Bacteria | 1249 |
| 359 | Ga0075433_10562884 | 3300006852 | Bacteria | 1001 |
| 360 | Ga0075433_10849391 | 3300006852 | Bacteria | 797 |
| 361 | Ga0075434_100000076 | 3300006871 | Bacteria | 52420 |
| 362 | Ga0075434_100002914 | 3300006871 | Bacteria | 15197 |
| 363 | Ga0075434_100010261 | 3300006871 | Bacteria | 8776 |
| 364 | Ga0075434_100026121 | 3300006871 | Bacteria | 5720 |
| 365 | Ga0075434_100223706 | 3300006871 | Bacteria | 1902 |
| 366 | Ga0075429_100113808 | 3300006880 | Bacteria | 2365 |
| 367 | Ga0075429_100706356 | 3300006880 | Bacteria | 883 |
| 368 | Ga0068865_100016118 | 3300006881 | Bacteria | 4774 |
| 369 | Ga0068865_100018173 | 3300006881 | Bacteria | 4534 |
| 370 | Ga0068865_100025186 | 3300006881 | Bacteria | 3910 |
| 371 | Ga0068865_100068742 | 3300006881 | Bacteria | 2505 |
| 372 | Ga0068865_100367576 | 3300006881 | Bacteria | 1170 |
| 373 | Ga0075436_100011662 | 3300006914 | Bacteria | 6030 |
| 374 | Ga0075436_100018962 | 3300006914 | Bacteria | 4712 |
| 375 | Ga0075436_100219020 | 3300006914 | Bacteria | 1350 |
| 376 | Ga0097620_100000431 | 3300006931 | Bacteria | 42019 |
| 377 | Ga0097620_100055276 | 3300006931 | Bacteria | 3994 |
| 378 | Ga0097620_100157038 | 3300006931 | Bacteria | 2352 |
| 379 | Ga0097620_100584816 | 3300006931 | Bacteria | 1210 |
| 380 | Ga0075435_100000055 | 3300007076 | Bacteria | 58409 |
| 381 | Ga0075435_100002266 | 3300007076 | Bacteria | 12708 |
| 382 | Ga0075435_100015080 | 3300007076 | Bacteria | 5801 |
| 383 | Ga0075435_100054000 | 3300007076 | Bacteria | 3242 |
| 384 | Ga0075435_100224416 | 3300007076 | Bacteria | 1596 |
| 385 | Ga0075435_100290953 | 3300007076 | Bacteria | 1396 |
| 386 | Ga0099795_10056398 | 3300007788 | Bacteria | 1445 |
| 387 | Ga0105251_10035129 | 3300009011 | Bacteria | 2475 |
| 388 | Ga0105250_10000276 | 3300009092 | Bacteria | 41623 |
| 389 | Ga0105250_10150537 | 3300009092 | Bacteria | 968 |
| 390 | Ga0105240_10002515 | 3300009093 | Bacteria | 29452 |
| 391 | Ga0105240_10004363 | 3300009093 | Bacteria | 21597 |
| 392 | Ga0105240_10005521 | 3300009093 | Bacteria | 18843 |
| 393 | Ga0105240_10015602 | 3300009093 | Bacteria | 10322 |
| 394 | Ga0105240_10052579 | 3300009093 | Bacteria | 5119 |
| 395 | Ga0105240_10242923 | 3300009093 | Bacteria | 2087 |
| 396 | Ga0105240_10374277 | 3300009093 | Bacteria | 1610 |
| 397 | Ga0111539_10011786 | 3300009094 | Bacteria | 10961 |
| 398 | Ga0111539_10073664 | 3300009094 | Bacteria | 4026 |
| 399 | Ga0111539_10159322 | 3300009094 | Bacteria | 2640 |
| 400 | Ga0111539_10502042 | 3300009094 | Bacteria | 1413 |
| 401 | Ga0111539_11428068 | 3300009094 | Bacteria | 803 |
| 402 | Ga0111539_11919754 | 3300009094 | Bacteria | 687 |
| 403 | Ga0105245_10014641 | 3300009098 | Bacteria | 6830 |
| 404 | Ga0105245_10083561 | 3300009098 | Bacteria | 2923 |
| 405 | Ga0105245_10107957 | 3300009098 | Bacteria | 2585 |
| 406 | Ga0105245_10232265 | 3300009098 | Bacteria | 1784 |
| 407 | Ga0105245_10587053 | 3300009098 | Bacteria | 1139 |
| 408 | Ga0105245_11127801 | 3300009098 | Bacteria | 831 |
| 409 | Ga0105247_10022834 | 3300009101 | Bacteria | 3768 |
| 410 | Ga0105247_10689915 | 3300009101 | Bacteria | 767 |
| 411 | Ga0114129_10008318 | 3300009147 | Bacteria | 14803 |
| 412 | Ga0114129_10014422 | 3300009147 | Bacteria | 11262 |
| 413 | Ga0114129_10022610 | 3300009147 | Bacteria | 8918 |
| 414 | Ga0114129_10053713 | 3300009147 | Bacteria | 5651 |
| 415 | Ga0114129_10682864 | 3300009147 | Bacteria | 1322 |
| 416 | Ga0114129_10722887 | 3300009147 | Bacteria | 1278 |
| 417 | Ga0114129_11199592 | 3300009147 | Bacteria | 945 |
| 418 | Ga0105243_10028281 | 3300009148 | Bacteria | 4303 |
| 419 | Ga0105243_10296176 | 3300009148 | Bacteria | 1464 |
| 420 | Ga0105243_10886705 | 3300009148 | Bacteria | 886 |
| 421 | Ga0105241_10001816 | 3300009174 | Bacteria | 16204 |
| 422 | Ga0105241_10062941 | 3300009174 | Bacteria | 2861 |
| 423 | Ga0105241_10125023 | 3300009174 | Bacteria | 2076 |
| 424 | Ga0105241_10175659 | 3300009174 | Bacteria | 1772 |
| 425 | Ga0105241_10282878 | 3300009174 | Bacteria | 1417 |
| 426 | Ga0105241_10778889 | 3300009174 | Bacteria | 879 |
| 427 | Ga0105241_11065676 | 3300009174 | Bacteria | 759 |
| 428 | Ga0105242_10127676 | 3300009176 | Bacteria | 2191 |
| 429 | Ga0105242_10134819 | 3300009176 | Bacteria | 2136 |
| 430 | Ga0105248_10007656 | 3300009177 | Bacteria | 11867 |
| 431 | Ga0105248_10009203 | 3300009177 | Bacteria | 10866 |
| 432 | Ga0105248_10074104 | 3300009177 | Bacteria | 3826 |
| 433 | Ga0105248_10156053 | 3300009177 | Bacteria | 2575 |
| 434 | Ga0105237_10004117 | 3300009545 | Bacteria | 16957 |
| 435 | Ga0105237_10011074 | 3300009545 | Bacteria | 9559 |
| 436 | Ga0105237_10038679 | 3300009545 | Bacteria | 4817 |
| 437 | Ga0105237_10091507 | 3300009545 | Bacteria | 3031 |
| 438 | Ga0105237_10477911 | 3300009545 | Bacteria | 1252 |
| 439 | Ga0105237_10491205 | 3300009545 | Bacteria | 1234 |
| 440 | Ga0105238_10000743 | 3300009551 | Bacteria | 34004 |
| 441 | Ga0105238_10061647 | 3300009551 | Bacteria | 3752 |
| 442 | Ga0105238_10132351 | 3300009551 | Bacteria | 2472 |
| 443 | Ga0105238_10186504 | 3300009551 | Bacteria | 2051 |
| 444 | Ga0105249_10108111 | 3300009553 | Bacteria | 2625 |
| 445 | Ga0105249_10217481 | 3300009553 | Bacteria | 1878 |
| 446 | Ga0105249_10474072 | 3300009553 | Bacteria | 1293 |
| 447 | Ga0099796_10000882 | 3300010159 | Bacteria | 5562 |
| 448 | Ga0105239_10079926 | 3300010375 | Bacteria | 3598 |
| 449 | Ga0105239_10094834 | 3300010375 | Bacteria | 3296 |
| 450 | Ga0105239_10201493 | 3300010375 | Bacteria | 2230 |
| 451 | Ga0105239_10474814 | 3300010375 | Bacteria | 1420 |
| 452 | Ga0105239_10608917 | 3300010375 | Bacteria | 1246 |
| 453 | Ga0105239_10828913 | 3300010375 | Bacteria | 1060 |
| 454 | Ga0105246_10238949 | 3300011119 | Bacteria | 1435 |
| 455 | Ga0105246_10242737 | 3300011119 | Bacteria | 1425 |
| 456 | Ga0157337_1000372 | 3300012483 | Bacteria | 2073 |
| 457 | Ga0157373_10005308 | 3300013100 | Bacteria | 9678 |
| 458 | Ga0157373_10063488 | 3300013100 | Bacteria | 2615 |
| 459 | Ga0157371_10007963 | 3300013102 | Bacteria | 8503 |
| 460 | Ga0157371_10014239 | 3300013102 | Bacteria | 6013 |
| 461 | Ga0157371_10193238 | 3300013102 | Bacteria | 1458 |
| 462 | Ga0157371_10249094 | 3300013102 | Bacteria | 1279 |
| 463 | Ga0157371_10413811 | 3300013102 | Bacteria | 988 |
| 464 | Ga0157371_10608664 | 3300013102 | Bacteria | 813 |
| 465 | Ga0157370_10254749 | 3300013104 | Bacteria | 1623 |
| 466 | Ga0157370_10298999 | 3300013104 | Bacteria | 1486 |
| 467 | Ga0157370_10541587 | 3300013104 | Bacteria | 1067 |
| 468 | Ga0157370_10826117 | 3300013104 | Bacteria | 843 |
| 469 | Ga0157369_10000231 | 3300013105 | Bacteria | 77118 |
| 470 | Ga0157369_10000319 | 3300013105 | Bacteria | 64594 |
| 471 | Ga0157369_10005543 | 3300013105 | Bacteria | 14663 |
| 472 | Ga0157369_10120102 | 3300013105 | Bacteria | 2789 |
| 473 | Ga0157369_10265990 | 3300013105 | Bacteria | 1788 |
| 474 | Ga0157369_10268297 | 3300013105 | Bacteria | 1779 |
| 475 | Ga0157369_10914059 | 3300013105 | Bacteria | 900 |
| 476 | Ga0157369_10916146 | 3300013105 | Bacteria | 899 |
| 477 | Ga0157369_11118949 | 3300013105 | Bacteria | 805 |
| 478 | Ga0157374_10000299 | 3300013296 | Bacteria | 45851 |
| 479 | Ga0157374_10000756 | 3300013296 | Bacteria | 28229 |
| 480 | Ga0157374_10001394 | 3300013296 | Bacteria | 20506 |
| 481 | Ga0157374_10010350 | 3300013296 | Bacteria | 8023 |
| 482 | Ga0157374_10023781 | 3300013296 | Bacteria | 5486 |
| 483 | Ga0157374_10039002 | 3300013296 | Bacteria | 4369 |
| 484 | Ga0157374_10053108 | 3300013296 | Bacteria | 3777 |
| 485 | Ga0157374_10102210 | 3300013296 | Bacteria | 2749 |
| 486 | Ga0157374_10174393 | 3300013296 | Bacteria | 2099 |
| 487 | Ga0157374_10208177 | 3300013296 | Bacteria | 1917 |
| 488 | Ga0157378_10000073 | 3300013297 | Bacteria | 90844 |
| 489 | Ga0157378_10000222 | 3300013297 | Bacteria | 55407 |
| 490 | Ga0157378_10004962 | 3300013297 | Bacteria | 11664 |
| 491 | Ga0157378_10007445 | 3300013297 | Bacteria | 9564 |
| 492 | Ga0157378_10045793 | 3300013297 | Bacteria | 3888 |
| 493 | Ga0157378_10284800 | 3300013297 | Bacteria | 1594 |
| 494 | Ga0163162_10129426 | 3300013306 | Bacteria | 2632 |
| 495 | Ga0163162_10169897 | 3300013306 | Bacteria | 2305 |
| 496 | Ga0163162_10461584 | 3300013306 | Bacteria | 1402 |
| 497 | Ga0163162_10997910 | 3300013306 | Bacteria | 946 |
| 498 | Ga0163162_11205135 | 3300013306 | Bacteria | 859 |
| 499 | Ga0157372_10000559 | 3300013307 | Bacteria | 40959 |
| 500 | Ga0157372_10002399 | 3300013307 | Bacteria | 20289 |
| 501 | Ga0157372_10003262 | 3300013307 | Bacteria | 17534 |
| 502 | Ga0157372_10007072 | 3300013307 | Bacteria | 11957 |
| 503 | Ga0157372_10013225 | 3300013307 | Bacteria | 8807 |
| 504 | Ga0157372_10045174 | 3300013307 | Bacteria | 4885 |
| 505 | Ga0157372_10056971 | 3300013307 | Bacteria | 4368 |
| 506 | Ga0157372_10087452 | 3300013307 | Bacteria | 3536 |
| 507 | Ga0157372_10089704 | 3300013307 | Bacteria | 3493 |
| 508 | Ga0157372_10125545 | 3300013307 | Bacteria | 2950 |
| 509 | Ga0157372_10203409 | 3300013307 | Bacteria | 2294 |
| 510 | Ga0157372_10416566 | 3300013307 | Bacteria | 1565 |
| 511 | Ga0157372_10521870 | 3300013307 | Bacteria | 1385 |
| 512 | Ga0157372_10565792 | 3300013307 | Bacteria | 1325 |
| 513 | Ga0157372_10731665 | 3300013307 | Bacteria | 1150 |
| 514 | Ga0157372_11601033 | 3300013307 | Bacteria | 750 |
| 515 | Ga0157375_10041855 | 3300013308 | Bacteria | 4427 |
| 516 | Ga0157375_10232117 | 3300013308 | Bacteria | 2004 |
| 517 | Ga0157375_10257143 | 3300013308 | Bacteria | 1908 |
| 518 | Ga0157375_10477922 | 3300013308 | Bacteria | 1411 |
| 519 | Ga0157375_10926379 | 3300013308 | Bacteria | 1014 |
| 520 | Ga0163163_10013371 | 3300014325 | Bacteria | 7513 |
| 521 | Ga0163163_10019682 | 3300014325 | Bacteria | 6343 |
| 522 | Ga0163163_10021989 | 3300014325 | Bacteria | 6030 |
| 523 | Ga0163163_10030798 | 3300014325 | Bacteria | 5174 |
| 524 | Ga0163163_10032156 | 3300014325 | Bacteria | 5068 |
| 525 | Ga0163163_10041561 | 3300014325 | Bacteria | 4497 |
| 526 | Ga0163163_10148927 | 3300014325 | Bacteria | 2385 |
| 527 | Ga0163163_10748137 | 3300014325 | Bacteria | 1041 |
| 528 | Ga0163163_10818416 | 3300014325 | Bacteria | 995 |
| 529 | Ga0163163_10903667 | 3300014325 | Bacteria | 946 |
| 530 | Ga0157380_10366117 | 3300014326 | Bacteria | 1355 |
| 531 | Ga0182008_10007425 | 3300014497 | Bacteria | 6053 |
| 532 | Ga0182008_10016242 | 3300014497 | Bacteria | 3871 |
| 533 | Ga0157377_10002869 | 3300014745 | Bacteria | 7697 |
| 534 | Ga0157379_10000101 | 3300014968 | Bacteria | 58702 |
| 535 | Ga0157379_10001379 | 3300014968 | Bacteria | 19872 |
| 536 | Ga0157379_10741705 | 3300014968 | Bacteria | 924 |
| 537 | Ga0157376_10006528 | 3300014969 | Bacteria | 8248 |
| 538 | Ga0157376_10008992 | 3300014969 | Bacteria | 7234 |
| 539 | Ga0157376_10011649 | 3300014969 | Bacteria | 6491 |
| 540 | Ga0157376_10383636 | 3300014969 | Bacteria | 1354 |
| 541 | Ga0157376_10506457 | 3300014969 | Bacteria | 1187 |
| 542 | Ga0182006_1084453 | 3300015261 | Bacteria | 1153 |
| 543 | Ga0182007_10000052 | 3300015262 | Bacteria | 95132 |
| 544 | Ga0182007_10002110 | 3300015262 | Bacteria | 10173 |
| 545 | Ga0182005_1000929 | 3300015265 | Bacteria | 12788 |
| 546 | Ga0163161_10012859 | 3300017792 | Bacteria | 5816 |
| 547 | Ga0163161_10128033 | 3300017792 | Bacteria | 1913 |
| 548 | Ga0163161_10848801 | 3300017792 | Bacteria | 771 |
| 549 | Ga0206352_10404164 | 3300020078 | Bacteria | 1585 |
| 550 | Ga0213872_10001314 | 3300021361 | Bacteria | 16478 |
| 551 | Ga0213872_10006401 | 3300021361 | Bacteria | 5921 |
| 552 | Ga0213872_10138644 | 3300021361 | Bacteria | 1068 |
| 553 | Ga0213874_10020175 | 3300021377 | Bacteria | 1824 |
| 554 | Ga0213871_10002272 | 3300021441 | Bacteria | 3506 |
| 555 | Ga0224572_1003411 | 3300024225 | Bacteria | 2678 |
| 556 | Ga0228598_1000137 | 3300024227 | Bacteria | 12449 |
| 557 | Ga0207656_10022091 | 3300025321 | Bacteria | 2549 |
| 558 | Ga0207656_10318419 | 3300025321 | Bacteria | 772 |
| 559 | Ga0207696_1085302 | 3300025711 | Bacteria | 869 |
| 560 | Ga0207682_10017839 | 3300025893 | Bacteria | 2770 |
| 561 | Ga0207692_10001224 | 3300025898 | Bacteria | 9516 |
| 562 | Ga0207710_10062652 | 3300025900 | Bacteria | 1691 |
| 563 | Ga0207647_10002035 | 3300025904 | Bacteria | 15456 |
| 564 | Ga0207647_10012919 | 3300025904 | Bacteria | 5802 |
| 565 | Ga0207647_10108859 | 3300025904 | Bacteria | 1639 |
| 566 | Ga0207685_10095995 | 3300025905 | Bacteria | 1258 |
| 567 | Ga0207685_10472403 | 3300025905 | Bacteria | 656 |
| 568 | Ga0207699_10003962 | 3300025906 | Bacteria | 7083 |
| 569 | Ga0207699_10040002 | 3300025906 | Bacteria | 2698 |
| 570 | Ga0207699_10139497 | 3300025906 | Bacteria | 1592 |
| 571 | Ga0207699_10159785 | 3300025906 | Bacteria | 1499 |
| 572 | Ga0207699_10198383 | 3300025906 | Bacteria | 1358 |
| 573 | Ga0207699_10348067 | 3300025906 | Bacteria | 1045 |
| 574 | Ga0207645_10000450 | 3300025907 | Bacteria | 34259 |
| 575 | Ga0207643_10004594 | 3300025908 | Bacteria | 7416 |
| 576 | Ga0207705_10229697 | 3300025909 | Bacteria | 1411 |
| 577 | Ga0207705_10403214 | 3300025909 | Bacteria | 1058 |
| 578 | Ga0207684_10001079 | 3300025910 | Bacteria | 30538 |
| 579 | Ga0207684_10010310 | 3300025910 | Bacteria | 8228 |
| 580 | Ga0207684_10012423 | 3300025910 | Bacteria | 7408 |
| 581 | Ga0207684_10013493 | 3300025910 | Bacteria | 7067 |
| 582 | Ga0207654_10052893 | 3300025911 | Bacteria | 2342 |
| 583 | Ga0207654_10139415 | 3300025911 | Bacteria | 1545 |
| 584 | Ga0207654_10440806 | 3300025911 | Bacteria | 912 |
| 585 | Ga0207707_10002539 | 3300025912 | Bacteria | 16383 |
| 586 | Ga0207707_10013653 | 3300025912 | Bacteria | 7083 |
| 587 | Ga0207707_10064089 | 3300025912 | Bacteria | 3199 |
| 588 | Ga0207707_10070264 | 3300025912 | Bacteria | 3051 |
| 589 | Ga0207707_10071238 | 3300025912 | Bacteria | 3029 |
| 590 | Ga0207707_10152475 | 3300025912 | Bacteria | 2020 |
| 591 | Ga0207707_10203714 | 3300025912 | Bacteria | 1725 |
| 592 | Ga0207707_10233033 | 3300025912 | Bacteria | 1602 |
| 593 | Ga0207695_10004398 | 3300025913 | Bacteria | 19266 |
| 594 | Ga0207695_10032088 | 3300025913 | Bacteria | 5752 |
| 595 | Ga0207695_10161833 | 3300025913 | Bacteria | 2169 |
| 596 | Ga0207671_10069552 | 3300025914 | Bacteria | 2624 |
| 597 | Ga0207671_10128514 | 3300025914 | Bacteria | 1943 |
| 598 | Ga0207693_10005542 | 3300025915 | Bacteria | 10501 |
| 599 | Ga0207693_10110600 | 3300025915 | Bacteria | 2154 |
| 600 | Ga0207693_10336439 | 3300025915 | Bacteria | 1181 |
| 601 | Ga0207693_10823710 | 3300025915 | Bacteria | 715 |
| 602 | Ga0207663_10101481 | 3300025916 | Bacteria | 1933 |
| 603 | Ga0207663_10308608 | 3300025916 | Bacteria | 1185 |
| 604 | Ga0207660_10207138 | 3300025917 | Bacteria | 1534 |
| 605 | Ga0207660_10513643 | 3300025917 | Bacteria | 973 |
| 606 | Ga0207662_10007359 | 3300025918 | Bacteria | 5990 |
| 607 | Ga0207657_10000382 | 3300025919 | Bacteria | 46682 |
| 608 | Ga0207657_10000415 | 3300025919 | Bacteria | 45249 |
| 609 | Ga0207657_10001641 | 3300025919 | Bacteria | 24118 |
| 610 | Ga0207649_10000699 | 3300025920 | Bacteria | 22010 |
| 611 | Ga0207652_10020296 | 3300025921 | Bacteria | 5470 |
| 612 | Ga0207652_10064861 | 3300025921 | Bacteria | 3161 |
| 613 | Ga0207652_10123801 | 3300025921 | Bacteria | 2302 |
| 614 | Ga0207652_10382380 | 3300025921 | Bacteria | 1270 |
| 615 | Ga0207652_10724602 | 3300025921 | Bacteria | 886 |
| 616 | Ga0207646_10002735 | 3300025922 | Bacteria | 20614 |
| 617 | Ga0207646_10012699 | 3300025922 | Bacteria | 8083 |
| 618 | Ga0207646_10024477 | 3300025922 | Bacteria | 5530 |
| 619 | Ga0207646_10029066 | 3300025922 | Bacteria | 5025 |
| 620 | Ga0207646_10033309 | 3300025922 | Bacteria | 4662 |
| 621 | Ga0207646_10034593 | 3300025922 | Bacteria | 4566 |
| 622 | Ga0207646_10167091 | 3300025922 | Bacteria | 1986 |
| 623 | Ga0207646_10180106 | 3300025922 | Bacteria | 1909 |
| 624 | Ga0207646_10217579 | 3300025922 | Bacteria | 1726 |
| 625 | Ga0207646_10678359 | 3300025922 | Bacteria | 922 |
| 626 | Ga0207646_10854335 | 3300025922 | Bacteria | 809 |
| 627 | Ga0207681_10111139 | 3300025923 | Bacteria | 1993 |
| 628 | Ga0207694_10000619 | 3300025924 | Bacteria | 32276 |
| 629 | Ga0207694_10125933 | 3300025924 | Bacteria | 2049 |
| 630 | Ga0207694_10271336 | 3300025924 | Bacteria | 1392 |
| 631 | Ga0207650_10000124 | 3300025925 | Bacteria | 97031 |
| 632 | Ga0207650_10001441 | 3300025925 | Bacteria | 17130 |
| 633 | Ga0207650_10375377 | 3300025925 | Bacteria | 1173 |
| 634 | Ga0207650_10780621 | 3300025925 | Bacteria | 809 |
| 635 | Ga0207659_10050898 | 3300025926 | Bacteria | 2944 |
| 636 | Ga0207687_10048962 | 3300025927 | Bacteria | 2936 |
| 637 | Ga0207687_10055498 | 3300025927 | Bacteria | 2776 |
| 638 | Ga0207687_10149936 | 3300025927 | Bacteria | 1778 |
| 639 | Ga0207700_10000018 | 3300025928 | Bacteria | 191007 |
| 640 | Ga0207700_10011398 | 3300025928 | Bacteria | 5665 |
| 641 | Ga0207700_10027688 | 3300025928 | Bacteria | 3973 |
| 642 | Ga0207700_10049703 | 3300025928 | Bacteria | 3121 |
| 643 | Ga0207700_10103759 | 3300025928 | Bacteria | 2274 |
| 644 | Ga0207700_10122191 | 3300025928 | Bacteria | 2113 |
| 645 | Ga0207700_10226461 | 3300025928 | Bacteria | 1587 |
| 646 | Ga0207700_10345694 | 3300025928 | Bacteria | 1294 |
| 647 | Ga0207700_10432839 | 3300025928 | Bacteria | 1157 |
| 648 | Ga0207700_10454848 | 3300025928 | Bacteria | 1129 |
| 649 | Ga0207700_10702627 | 3300025928 | Bacteria | 903 |
| 650 | Ga0207700_11024353 | 3300025928 | Bacteria | 739 |
| 651 | Ga0207664_10069992 | 3300025929 | Bacteria | 2822 |
| 652 | Ga0207664_10115104 | 3300025929 | Bacteria | 2242 |
| 653 | Ga0207664_10140066 | 3300025929 | Bacteria | 2045 |
| 654 | Ga0207664_10148805 | 3300025929 | Bacteria | 1987 |
| 655 | Ga0207664_10232467 | 3300025929 | Bacteria | 1603 |
| 656 | Ga0207664_10476152 | 3300025929 | Bacteria | 1116 |
| 657 | Ga0207664_10524978 | 3300025929 | Bacteria | 1061 |
| 658 | Ga0207664_10888488 | 3300025929 | Bacteria | 800 |
| 659 | Ga0207644_10023204 | 3300025931 | Bacteria | 4246 |
| 660 | Ga0207644_10907556 | 3300025931 | Bacteria | 738 |
| 661 | Ga0207690_10001363 | 3300025932 | Bacteria | 15339 |
| 662 | Ga0207690_10225438 | 3300025932 | Bacteria | 1436 |
| 663 | Ga0207690_10625897 | 3300025932 | Bacteria | 880 |
| 664 | Ga0207706_10014430 | 3300025933 | Bacteria | 7161 |
| 665 | Ga0207706_10022635 | 3300025933 | Bacteria | 5640 |
| 666 | Ga0207706_10192323 | 3300025933 | Bacteria | 1791 |
| 667 | Ga0207686_10087581 | 3300025934 | Bacteria | 2048 |
| 668 | Ga0207686_10091032 | 3300025934 | Bacteria | 2014 |
| 669 | Ga0207686_10135908 | 3300025934 | Bacteria | 1693 |
| 670 | Ga0207709_10037794 | 3300025935 | Bacteria | 2870 |
| 671 | Ga0207709_10371632 | 3300025935 | Bacteria | 1085 |
| 672 | Ga0207709_10648904 | 3300025935 | Bacteria | 840 |
| 673 | Ga0207670_10022198 | 3300025936 | Bacteria | 3930 |
| 674 | Ga0207670_10756374 | 3300025936 | Bacteria | 807 |
| 675 | Ga0207669_10005789 | 3300025937 | Bacteria | 5584 |
| 676 | Ga0207669_10269596 | 3300025937 | Bacteria | 1278 |
| 677 | Ga0207669_10431912 | 3300025937 | Bacteria | 1039 |
| 678 | Ga0207704_10009764 | 3300025938 | Bacteria | 4647 |
| 679 | Ga0207704_10011932 | 3300025938 | Bacteria | 4297 |
| 680 | Ga0207704_10034228 | 3300025938 | Bacteria | 2897 |
| 681 | Ga0207704_10183487 | 3300025938 | Bacteria | 1514 |
| 682 | Ga0207665_10003883 | 3300025939 | Bacteria | 9995 |
| 683 | Ga0207665_10007183 | 3300025939 | Bacteria | 7369 |
| 684 | Ga0207665_10021074 | 3300025939 | Bacteria | 4284 |
| 685 | Ga0207665_10053921 | 3300025939 | Bacteria | 2711 |
| 686 | Ga0207665_10127526 | 3300025939 | Bacteria | 1803 |
| 687 | Ga0207665_10252570 | 3300025939 | Bacteria | 1303 |
| 688 | Ga0207665_10400930 | 3300025939 | Bacteria | 1045 |
| 689 | Ga0207665_10721767 | 3300025939 | Bacteria | 784 |
| 690 | Ga0207691_10024609 | 3300025940 | Bacteria | 5663 |
| 691 | Ga0207691_10183581 | 3300025940 | Bacteria | 1827 |
| 692 | Ga0207691_10872706 | 3300025940 | Bacteria | 754 |
| 693 | Ga0207711_10018438 | 3300025941 | Bacteria | 5802 |
| 694 | Ga0207711_10021441 | 3300025941 | Bacteria | 5397 |
| 695 | Ga0207711_10259890 | 3300025941 | Bacteria | 1595 |
| 696 | Ga0207711_10302816 | 3300025941 | Bacteria | 1475 |
| 697 | Ga0207689_10000658 | 3300025942 | Bacteria | 32969 |
| 698 | Ga0207689_10020015 | 3300025942 | Bacteria | 5637 |
| 699 | Ga0207689_10302529 | 3300025942 | Bacteria | 1326 |
| 700 | Ga0207661_10004224 | 3300025944 | Bacteria | 10054 |
| 701 | Ga0207661_10044824 | 3300025944 | Bacteria | 3498 |
| 702 | Ga0207661_10051620 | 3300025944 | Bacteria | 3282 |
| 703 | Ga0207661_10108398 | 3300025944 | Bacteria | 2345 |
| 704 | Ga0207661_10123392 | 3300025944 | Bacteria | 2209 |
| 705 | Ga0207661_10307928 | 3300025944 | Bacteria | 1421 |
| 706 | Ga0207661_10359586 | 3300025944 | Bacteria | 1315 |
| 707 | Ga0207661_10390788 | 3300025944 | Bacteria | 1260 |
| 708 | Ga0207661_10627881 | 3300025944 | Unclassified | 987 |
| 709 | Ga0207661_11128906 | 3300025944 | Bacteria | 722 |
| 710 | Ga0207679_10000216 | 3300025945 | Bacteria | 45504 |
| 711 | Ga0207679_10024128 | 3300025945 | Bacteria | 4167 |
| 712 | Ga0207679_10616660 | 3300025945 | Bacteria | 979 |
| 713 | Ga0207679_11034804 | 3300025945 | Bacteria | 753 |
| 714 | Ga0207667_10001480 | 3300025949 | Bacteria | 29472 |
| 715 | Ga0207667_10012373 | 3300025949 | Bacteria | 9837 |
| 716 | Ga0207667_10017951 | 3300025949 | Bacteria | 7951 |
| 717 | Ga0207667_10121696 | 3300025949 | Bacteria | 2689 |
| 718 | Ga0207667_10181876 | 3300025949 | Bacteria | 2159 |
| 719 | Ga0207667_10283703 | 3300025949 | Bacteria | 1692 |
| 720 | Ga0207667_10310520 | 3300025949 | Bacteria | 1611 |
| 721 | Ga0207667_11310910 | 3300025949 | Bacteria | 700 |
| 722 | Ga0207651_10072509 | 3300025960 | Bacteria | 2445 |
| 723 | Ga0207651_10173897 | 3300025960 | Bacteria | 1701 |
| 724 | Ga0207712_10176532 | 3300025961 | Bacteria | 1674 |
| 725 | Ga0207712_10267624 | 3300025961 | Bacteria | 1389 |
| 726 | Ga0207668_10049551 | 3300025972 | Bacteria | 2888 |
| 727 | Ga0207668_10092587 | 3300025972 | Bacteria | 2225 |
| 728 | Ga0207640_10000034 | 3300025981 | Bacteria | 112705 |
| 729 | Ga0207640_10077122 | 3300025981 | Bacteria | 2264 |
| 730 | Ga0207640_10137112 | 3300025981 | Bacteria | 1778 |
| 731 | Ga0207640_10542183 | 3300025981 | Bacteria | 976 |
| 732 | Ga0207658_10004844 | 3300025986 | Bacteria | 9301 |
| 733 | Ga0207658_10022794 | 3300025986 | Bacteria | 4361 |
| 734 | Ga0207658_10025681 | 3300025986 | Bacteria | 4125 |
| 735 | Ga0207658_10025899 | 3300025986 | Bacteria | 4108 |
| 736 | Ga0207658_10129938 | 3300025986 | Bacteria | 2022 |
| 737 | Ga0207658_10186552 | 3300025986 | Bacteria | 1721 |
| 738 | Ga0207658_10299831 | 3300025986 | Bacteria | 1384 |
| 739 | Ga0207677_10018913 | 3300026023 | Bacteria | 4147 |
| 740 | Ga0207677_10037178 | 3300026023 | Bacteria | 3180 |
| 741 | Ga0207677_10043135 | 3300026023 | Bacteria | 2996 |
| 742 | Ga0207677_10048788 | 3300026023 | Bacteria | 2852 |
| 743 | Ga0207677_10138193 | 3300026023 | Bacteria | 1861 |
| 744 | Ga0207677_10270127 | 3300026023 | Bacteria | 1390 |
| 745 | Ga0207703_10003557 | 3300026035 | Bacteria | 13022 |
| 746 | Ga0207703_10017369 | 3300026035 | Bacteria | 5617 |
| 747 | Ga0207703_10027593 | 3300026035 | Bacteria | 4471 |
| 748 | Ga0207703_10152655 | 3300026035 | Bacteria | 2015 |
| 749 | Ga0207639_10000035 | 3300026041 | Bacteria | 149309 |
| 750 | Ga0207639_10005433 | 3300026041 | Bacteria | 8605 |
| 751 | Ga0207639_10031575 | 3300026041 | Bacteria | 3893 |
| 752 | Ga0207678_10021692 | 3300026067 | Bacteria | 5632 |
| 753 | Ga0207678_10029209 | 3300026067 | Bacteria | 4811 |
| 754 | Ga0207678_10839659 | 3300026067 | Bacteria | 811 |
| 755 | Ga0207708_10072956 | 3300026075 | Bacteria | 2630 |
| 756 | Ga0207702_10000304 | 3300026078 | Bacteria | 56789 |
| 757 | Ga0207702_10009861 | 3300026078 | Bacteria | 8005 |
| 758 | Ga0207702_10018049 | 3300026078 | Bacteria | 5838 |
| 759 | Ga0207702_10022299 | 3300026078 | Bacteria | 5249 |
| 760 | Ga0207702_10025028 | 3300026078 | Bacteria | 4951 |
| 761 | Ga0207702_10033348 | 3300026078 | Bacteria | 4301 |
| 762 | Ga0207702_10072312 | 3300026078 | Bacteria | 2972 |
| 763 | Ga0207702_10235014 | 3300026078 | Bacteria | 1714 |
| 764 | Ga0207702_10428396 | 3300026078 | Bacteria | 1280 |
| 765 | Ga0207702_10433799 | 3300026078 | Bacteria | 1272 |
| 766 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 767 | Ga0207641_10007266 | 3300026088 | Bacteria | 9228 |
| 768 | Ga0207641_10094843 | 3300026088 | Bacteria | 2617 |
| 769 | Ga0207641_10158423 | 3300026088 | Bacteria | 2056 |
| 770 | Ga0207641_10206571 | 3300026088 | Bacteria | 1814 |
| 771 | Ga0207641_11012705 | 3300026088 | Bacteria | 828 |
| 772 | Ga0207648_10003409 | 3300026089 | Bacteria | 16681 |
| 773 | Ga0207648_10007481 | 3300026089 | Bacteria | 10732 |
| 774 | Ga0207648_10125908 | 3300026089 | Bacteria | 2254 |
| 775 | Ga0207648_10887050 | 3300026089 | Bacteria | 833 |
| 776 | Ga0207676_10000272 | 3300026095 | Bacteria | 44817 |
| 777 | Ga0207676_10070879 | 3300026095 | Bacteria | 2796 |
| 778 | Ga0207676_10087256 | 3300026095 | Bacteria | 2551 |
| 779 | Ga0207676_10469151 | 3300026095 | Bacteria | 1190 |
| 780 | Ga0207674_10001455 | 3300026116 | Bacteria | 30595 |
| 781 | Ga0207674_10003186 | 3300026116 | Bacteria | 20202 |
| 782 | Ga0207674_10004925 | 3300026116 | Bacteria | 15959 |
| 783 | Ga0207674_10010900 | 3300026116 | Bacteria | 10234 |
| 784 | Ga0207674_10095120 | 3300026116 | Bacteria | 2965 |
| 785 | Ga0207674_10116424 | 3300026116 | Bacteria | 2644 |
| 786 | Ga0207674_10622401 | 3300026116 | Bacteria | 1042 |
| 787 | Ga0207674_10738819 | 3300026116 | Bacteria | 950 |
| 788 | Ga0207675_100005242 | 3300026118 | Bacteria | 12475 |
| 789 | Ga0207675_100585893 | 3300026118 | Bacteria | 1117 |
| 790 | Ga0207683_10000615 | 3300026121 | Bacteria | 32879 |
| 791 | Ga0207683_10065128 | 3300026121 | Bacteria | 3212 |
| 792 | Ga0207683_10189811 | 3300026121 | Bacteria | 1865 |
| 793 | Ga0207698_10171351 | 3300026142 | Bacteria | 1912 |
| 794 | Ga0207698_10467828 | 3300026142 | Bacteria | 1220 |
| 795 | Ga0207698_10498026 | 3300026142 | Bacteria | 1185 |
| 796 | Ga0207698_10943471 | 3300026142 | Bacteria | 872 |
| 797 | Ga0207698_10945433 | 3300026142 | Bacteria | 871 |
| 798 | Ga0209371_1000240 | 3300027312 | Bacteria | 68413 |
| 799 | Ga0209966_1062939 | 3300027695 | Bacteria | 804 |
| 800 | Ga0207428_10200109 | 3300027907 | Bacteria | 1503 |
| 801 | Ga0268266_10051953 | 3300028379 | Bacteria | 3519 |
| 802 | Ga0268266_10053029 | 3300028379 | Bacteria | 3483 |
| 803 | Ga0268266_10630264 | 3300028379 | Bacteria | 1031 |
| 804 | Ga0268265_10040311 | 3300028380 | Bacteria | 3448 |
| 805 | Ga0268265_10201159 | 3300028380 | Bacteria | 1728 |
| 806 | Ga0268265_10258448 | 3300028380 | Bacteria | 1547 |
| 807 | Ga0268265_11089447 | 3300028380 | Bacteria | 793 |
| 808 | Ga0268264_10017468 | 3300028381 | Bacteria | 5874 |
| 809 | Ga0268264_10021798 | 3300028381 | Bacteria | 5229 |
| 810 | Ga0268264_10338473 | 3300028381 | Bacteria | 1428 |
| 811 | Ga0268264_10344003 | 3300028381 | Bacteria | 1418 |
| 812 | Ga0265326_10026747 | 3300028558 | Bacteria | 1645 |
| 813 | Ga0265334_10012454 | 3300028573 | Bacteria | 3573 |
| 814 | Ga0265334_10022745 | 3300028573 | Bacteria | 2552 |
| 815 | Ga0265338_10010744 | 3300028800 | Bacteria | 10684 |
| 816 | Ga0265338_10021845 | 3300028800 | Bacteria | 6651 |
| 817 | Ga0265338_10052282 | 3300028800 | Bacteria | 3667 |
| 818 | Ga0265338_10055590 | 3300028800 | Bacteria | 3520 |
| 819 | Ga0265338_10211636 | 3300028800 | Bacteria | 1455 |
| 820 | Ga0265338_10213479 | 3300028800 | Bacteria | 1447 |
| 821 | Ga0265324_10060812 | 3300029957 | Bacteria | 1291 |
| 822 | Ga0268256_1001896 | 3300030500 | Bacteria | 11540 |
| 823 | Ga0265762_1011440 | 3300030760 | Bacteria | 1586 |
| 824 | Ga0265762_1027034 | 3300030760 | Bacteria | 1075 |
| 825 | Ga0265770_1001601 | 3300030878 | Bacteria | 3102 |
| 826 | Ga0265770_1046539 | 3300030878 | Bacteria | 773 |
| 827 | Ga0265765_1016810 | 3300030879 | Bacteria | 859 |
| 828 | Ga0265773_1007224 | 3300031018 | Bacteria | 861 |
| 829 | Ga0265760_10000795 | 3300031090 | Bacteria | 9098 |
| 830 | Ga0265760_10001799 | 3300031090 | Bacteria | 6294 |
| 831 | Ga0265760_10011756 | 3300031090 | Bacteria | 2502 |
| 832 | Ga0265760_10011874 | 3300031090 | Bacteria | 2488 |
| 833 | Ga0265330_10084043 | 3300031235 | Bacteria | 1370 |
| 834 | Ga0265320_10347591 | 3300031240 | Bacteria | 655 |
| 835 | Ga0265325_10223412 | 3300031241 | Bacteria | 861 |
| 836 | Ga0265325_10268794 | 3300031241 | Bacteria | 767 |
| 837 | Ga0265340_10041870 | 3300031247 | Bacteria | 2250 |
| 838 | Ga0265340_10235277 | 3300031247 | Bacteria | 818 |
| 839 | Ga0265340_10264904 | 3300031247 | Bacteria | 765 |
| 840 | Ga0265339_10091931 | 3300031249 | Bacteria | 1589 |
| 841 | Ga0265339_10101501 | 3300031249 | Bacteria | 1497 |
| 842 | Ga0265331_10012775 | 3300031250 | Bacteria | 4536 |
| 843 | Ga0265331_10041416 | 3300031250 | Bacteria | 2238 |
| 844 | Ga0265316_10098825 | 3300031344 | Bacteria | 2221 |
| 845 | Ga0265316_10557629 | 3300031344 | Bacteria | 815 |
| 846 | Ga0307408_100000574 | 3300031548 | Bacteria | 31711 |
| 847 | Ga0307408_100000699 | 3300031548 | Bacteria | 27364 |
| 848 | Ga0307408_100005138 | 3300031548 | Bacteria | 8775 |
| 849 | Ga0307408_100375634 | 3300031548 | Bacteria | 1214 |
| 850 | Ga0307408_100494051 | 3300031548 | Bacteria | 1070 |
| 851 | Ga0307408_100809849 | 3300031548 | Bacteria | 851 |
| 852 | Ga0265313_10001496 | 3300031595 | Bacteria | 21782 |
| 853 | Ga0316575_10027814 | 3300031665 | Bacteria | 2200 |
| 854 | Ga0316575_10041239 | 3300031665 | Bacteria | 1826 |
| 855 | Ga0316575_10089686 | 3300031665 | Bacteria | 1245 |
| 856 | Ga0316579_10000419 | 3300031691 | Bacteria | 13540 |
| 857 | Ga0316579_10023436 | 3300031691 | Bacteria | 2771 |
| 858 | Ga0316579_10045687 | 3300031691 | Bacteria | 2042 |
| 859 | Ga0316579_10050163 | 3300031691 | Bacteria | 1951 |
| 860 | Ga0265314_10020480 | 3300031711 | Bacteria | 5105 |
| 861 | Ga0265314_10238068 | 3300031711 | Bacteria | 1052 |
| 862 | Ga0265314_10415021 | 3300031711 | Bacteria | 724 |
| 863 | Ga0265342_10045203 | 3300031712 | Bacteria | 2652 |
| 864 | Ga0265342_10089228 | 3300031712 | Bacteria | 1770 |
| 865 | Ga0316576_10005266 | 3300031727 | Bacteria | 7877 |
| 866 | Ga0316576_10014612 | 3300031727 | Bacteria | 5247 |
| 867 | Ga0316576_10024892 | 3300031727 | Bacteria | 4184 |
| 868 | Ga0316576_10056624 | 3300031727 | Bacteria | 2863 |
| 869 | Ga0316576_10066163 | 3300031727 | Bacteria | 2657 |
| 870 | Ga0316576_10071666 | 3300031727 | Bacteria | 2556 |
| 871 | Ga0316576_10077929 | 3300031727 | Bacteria | 2455 |
| 872 | Ga0316576_10122128 | 3300031727 | Bacteria | 1956 |
| 873 | Ga0316576_10153473 | 3300031727 | Bacteria | 1735 |
| 874 | Ga0316576_10408788 | 3300031727 | Bacteria | 1005 |
| 875 | Ga0316576_10464450 | 3300031727 | Bacteria | 934 |
| 876 | Ga0316578_10000029 | 3300031728 | Bacteria | 29549 |
| 877 | Ga0316578_10001182 | 3300031728 | Bacteria | 10329 |
| 878 | Ga0316578_10008525 | 3300031728 | Bacteria | 5223 |
| 879 | Ga0316578_10030141 | 3300031728 | Bacteria | 3082 |
| 880 | Ga0316578_10034019 | 3300031728 | Bacteria | 2924 |
| 881 | Ga0316578_10040101 | 3300031728 | Bacteria | 2705 |
| 882 | Ga0316578_10386482 | 3300031728 | Bacteria | 830 |
| 883 | Ga0307405_10009176 | 3300031731 | Bacteria | 5059 |
| 884 | Ga0316577_10000654 | 3300031733 | Bacteria | 14481 |
| 885 | Ga0316577_10007154 | 3300031733 | Bacteria | 5938 |
| 886 | Ga0316577_10072353 | 3300031733 | Bacteria | 1924 |
| 887 | Ga0316577_10221345 | 3300031733 | Bacteria | 1070 |
| 888 | Ga0307413_10004045 | 3300031824 | Bacteria | 6309 |
| 889 | Ga0307413_10098524 | 3300031824 | Bacteria | 1925 |
| 890 | Ga0307410_10056743 | 3300031852 | Bacteria | 2664 |
| 891 | Ga0307410_10237307 | 3300031852 | Bacteria | 1411 |
| 892 | Ga0307406_10000834 | 3300031901 | Bacteria | 17319 |
| 893 | Ga0307406_10001613 | 3300031901 | Bacteria | 12405 |
| 894 | Ga0307406_10051619 | 3300031901 | Bacteria | 2612 |
| 895 | Ga0307407_10019613 | 3300031903 | Bacteria | 3447 |
| 896 | Ga0307407_10054721 | 3300031903 | Bacteria | 2303 |
| 897 | Ga0307412_10007134 | 3300031911 | Bacteria | 6343 |
| 898 | Ga0307412_10141786 | 3300031911 | Bacteria | 1761 |
| 899 | Ga0307409_100020780 | 3300031995 | Bacteria | 4484 |
| 900 | Ga0307409_100037629 | 3300031995 | Bacteria | 3569 |
| 901 | Ga0307409_100050989 | 3300031995 | Bacteria | 3164 |
| 902 | Ga0307409_100071410 | 3300031995 | Bacteria | 2760 |
| 903 | Ga0307416_100004997 | 3300032002 | Bacteria | 8088 |
| 904 | Ga0307416_100094583 | 3300032002 | Bacteria | 2577 |
| 905 | Ga0307416_100206427 | 3300032002 | Bacteria | 1869 |
| 906 | Ga0307416_101017329 | 3300032002 | Bacteria | 932 |
| 907 | Ga0307414_10046397 | 3300032004 | Bacteria | 2983 |
| 908 | Ga0307414_10052683 | 3300032004 | Bacteria | 2833 |
| 909 | Ga0307411_10010295 | 3300032005 | Bacteria | 4975 |
| 910 | Ga0307411_10014780 | 3300032005 | Bacteria | 4358 |
| 911 | Ga0307415_100023061 | 3300032126 | Bacteria | 3855 |
| 912 | Ga0307415_100108044 | 3300032126 | Bacteria | 2057 |
| 913 | Ga0307415_100135844 | 3300032126 | Bacteria | 1870 |
| 914 | Ga0307415_100354518 | 3300032126 | Bacteria | 1236 |
| 915 | Ga0316583_10000401 | 3300032133 | Bacteria | 12644 |
| 916 | Ga0316583_10005061 | 3300032133 | Bacteria | 4719 |
| 917 | Ga0316583_10051643 | 3300032133 | Bacteria | 1447 |
| 918 | Ga0316583_10055533 | 3300032133 | Bacteria | 1392 |
| 919 | Ga0316585_10000035 | 3300032137 | Bacteria | 20542 |
| 920 | Ga0316585_10006872 | 3300032137 | Bacteria | 3265 |
| 921 | Ga0316585_10015208 | 3300032137 | Bacteria | 2306 |
| 922 | Ga0316585_10015503 | 3300032137 | Bacteria | 2286 |
| 923 | Ga0316585_10078523 | 3300032137 | Bacteria | 1074 |
| 924 | Ga0316585_10165644 | 3300032137 | Bacteria | 730 |
| 925 | Ga0316580_10000418 | 3300032139 | Bacteria | 9678 |
| 926 | Ga0316580_10005792 | 3300032139 | Bacteria | 3625 |
| 927 | Ga0316580_10013725 | 3300032139 | Bacteria | 2468 |
| 928 | Ga0316580_10025218 | 3300032139 | Bacteria | 1838 |
| 929 | Ga0316580_10056608 | 3300032139 | Bacteria | 1205 |
| 930 | Ga0316593_10026263 | 3300032168 | Bacteria | 1860 |
| 931 | Ga0316593_10149847 | 3300032168 | Bacteria | 848 |
| 932 | Ga0307510_10019078 | 3300033180 | Bacteria | 8045 |
| 933 | Ga0316592_1003590 | 3300033524 | Bacteria | 2811 |
| 934 | Ga0316592_1004978 | 3300033524 | Bacteria | 2501 |
| 935 | Ga0316592_1020463 | 3300033524 | Bacteria | 1406 |
| 936 | Ga0316592_1044763 | 3300033524 | Bacteria | 984 |
| 937 | Ga0316588_1000275 | 3300033528 | Bacteria | 6331 |
| 938 | Ga0316588_1003220 | 3300033528 | Bacteria | 2951 |
| 939 | Ga0316588_1021963 | 3300033528 | Bacteria | 1455 |
| 940 | Ga0316587_1037230 | 3300033529 | Bacteria | 872 |
| 941 | Ga0316596_1001497 | 3300033541 | Bacteria | 4736 |
| 942 | Ga0316596_1008590 | 3300033541 | Bacteria | 2440 |
| 943 | Ga0316596_1023278 | 3300033541 | Bacteria | 1586 |
| 944 | Ga0373926_0047187 | 3300035083 | Bacteria | 1547 |
| 945 | Ga0373926_0076003 | 3300035083 | Bacteria | 1238 |
| 946 | Ga0373929_0039763 | 3300035085 | Bacteria | 1040 |
| 947 | Ga0373934_0000404 | 3300035086 | Bacteria | 15111 |
| 948 | Ga0373940_0140212 | 3300035088 | Bacteria | 764 |
| 949 | Ga0373923_0019471 | 3300035111 | Bacteria | 2629 |
| 950 | Ga0373923_0366681 | 3300035111 | Bacteria | 690 |
| 951 | Ga0373932_0015112 | 3300035112 | Bacteria | 1953 |
| 952 | Ga0373936_0114343 | 3300035113 | Bacteria | 1148 |
| 953 | Ga0373936_0134352 | 3300035113 | Bacteria | 1065 |
| 954 | Ga0373936_0197426 | 3300035113 | Bacteria | 887 |
| 955 | Ga0373954_0000224 | 3300035118 | Bacteria | 20728 |
| 956 | Ga0373956_0001105 | 3300035119 | Bacteria | 11121 |
| 957 | Ga0373956_0043221 | 3300035119 | Bacteria | 2006 |
| 958 | Ga0373957_0007746 | 3300035120 | Bacteria | 3449 |
| 959 | Ga0373960_0111502 | 3300035121 | Bacteria | 898 |
| 960 | Ga0373943_0183863 | 3300035170 | Bacteria | 1150 |
| 961 | Ga0373943_0244295 | 3300035170 | Bacteria | 1007 |
| 962 | Ga0373946_0097826 | 3300035171 | Bacteria | 1311 |
| 963 | Ga0373955_0000521 | 3300035172 | Bacteria | 16367 |
| 964 | Ga0373942_0035037 | 3300035207 | Bacteria | 1345 |
| 965 | Ga0316574_0000298 | 3300035398 | Bacteria | 18690 |
| 966 | Ga0316574_0000526 | 3300035398 | Bacteria | 15691 |
| 967 | Ga0316574_0013680 | 3300035398 | Bacteria | 4672 |
| 968 | Ga0316574_0015936 | 3300035398 | Bacteria | 4369 |
| 969 | Ga0316574_0113732 | 3300035398 | Bacteria | 1735 |
| 970 | Ga0316574_0836351 | 3300035398 | Bacteria | 559 |
| 971 | Ga0373924_0054965 | 3300035410 | Bacteria | 1656 |
| 972 | Ga0373924_0118153 | 3300035410 | Bacteria | 1149 |
| 973 | Ga0373924_0312387 | 3300035410 | Bacteria | 698 |
| 974 | Ga0373931_0015181 | 3300035691 | Bacteria | 3775 |
| 975 | Ga0373931_0028076 | 3300035691 | Bacteria | 2878 |
| 976 | Ga0373931_0048522 | 3300035691 | Bacteria | 2251 |
| 977 | Ga0373931_0104755 | 3300035691 | Bacteria | 1596 |
| 978 | Ga0373935_0002526 | 3300035692 | Bacteria | 10482 |
| 979 | Ga0373935_0015252 | 3300035692 | Bacteria | 4643 |
| 980 | Ga0373935_0104703 | 3300035692 | Bacteria | 1870 |
| 981 | Ga0373927_0003380 | 3300035695 | Bacteria | 11492 |
| 982 | Ga0373927_0231770 | 3300035695 | Bacteria | 1213 |
| 983 | Ga0373927_0288792 | 3300035695 | Bacteria | 1079 |
| 984 | Ga0373933_0001196 | 3300035724 | Bacteria | 15359 |
| 985 | Ga0373933_0067405 | 3300035724 | Bacteria | 2171 |
| 986 | Ga0373933_0102230 | 3300035724 | Bacteria | 1779 |
| 987 | Ga0373933_0535502 | 3300035724 | Bacteria | 768 |
| 988 | Ga0373947_0261201 | 3300035725 | Bacteria | 1147 |
| 989 | Ga0373937_0001689 | 3300036401 | Bacteria | 18562 |
| 990 | Ga0373937_0594156 | 3300036401 | Bacteria | 1051 |
| 991 | Ga0316582_0000066 | 3300036647 | Bacteria | 26412 |
| 992 | Ga0316582_0087534 | 3300036647 | Bacteria | 2044 |
| 993 | Ga0316582_0209809 | 3300036647 | Bacteria | 1330 |
| 994 | Ga0316582_0214810 | 3300036647 | Bacteria | 1314 |
| 995 | Ga0316582_0229238 | 3300036647 | Bacteria | 1271 |
| 996 | Ga0316584_0001073 | 3300036712 | Bacteria | 15985 |
| 997 | Ga0316584_0004102 | 3300036712 | Bacteria | 9606 |
| 998 | Ga0316584_0004310 | 3300036712 | Bacteria | 9407 |
| 999 | Ga0316584_0015740 | 3300036712 | Bacteria | 5415 |
| 1000 | Ga0316584_0030122 | 3300036712 | Bacteria | 4009 |
| 1001 | Ga0316584_0062237 | 3300036712 | Bacteria | 2795 |
| 1002 | Ga0316584_0184223 | 3300036712 | Bacteria | 1545 |
| 1003 | Ga0316584_0241221 | 3300036712 | Bacteria | 1322 |
| 1004 | Ga0373925_0003562 | 3300037068 | Bacteria | 12001 |
| 1005 | Ga0395900_0546088 | 3300037418 | Bacteria | 1104 |
| 1006 | Ga0395905_0000293 | 3300037471 | Bacteria | 73306 |
| 1007 | Ga0395905_0007654 | 3300037471 | Bacteria | 10723 |
| 1008 | Ga0395905_0221986 | 3300037471 | Bacteria | 1769 |
| 1009 | Ga0395905_0377044 | 3300037471 | Bacteria | 1312 |
| 1010 | Ga0395905_0462105 | 3300037471 | Bacteria | 1168 |
| 1011 | Ga0395905_0494261 | 3300037471 | Bacteria | 1123 |
| 1012 | Ga0237819_16747 | 3300038705 | Bacteria | 819 |
| 1013 | Ga0400490_57581 | 3300038726 | Bacteria | 6829 |
| 1014 | Ga0400485_17163 | 3300038735 | Bacteria | 43508 |
| 1015 | Ga0400485_18026 | 3300038735 | Bacteria | 1831 |
| 1016 | Ga0400488_50200 | 3300038741 | Bacteria | 9554 |
| 1017 | Ga0400486_01662 | 3300038742 | Bacteria | 43450 |
| 1018 | Ga0242420_063814 | 3300038996 | Bacteria | 739 |
| 1019 | Ga0400489_14236 | 3300039093 | Bacteria | 4828 |
| 1020 | Ga0400489_31446 | 3300039093 | Bacteria | 2453 |
| 1021 | Ga0400487_10419 | 3300039110 | Bacteria | 1295 |
| 1022 | Ga0400487_17601 | 3300039110 | Bacteria | 48398 |
| 1023 | Ga0436365_0001200 | 3300039437 | Bacteria | 856 |
| 1024 | Ga0436365_0261237 | 3300039437 | Bacteria | 3252 |
| 1025 | Ga0436365_1454779 | 3300039437 | Bacteria | 4597 |
| 1026 | Ga0436365_1685032 | 3300039437 | Bacteria | 686 |
| 1027 | Ga0436360_0369279 | 3300039438 | Bacteria | 4330 |
| 1028 | Ga0436360_0932224 | 3300039438 | Bacteria | 741 |
| 1029 | Ga0436361_0175726 | 3300039447 | Bacteria | 5548 |
| 1030 | Ga0436361_0823786 | 3300039447 | Bacteria | 33073 |
| 1031 | Ga0436361_1034179 | 3300039447 | Bacteria | 3275 |
| 1032 | Ga0436363_0533398 | 3300039450 | Bacteria | 3648 |
| 1033 | Ga0436363_1569701 | 3300039450 | Bacteria | 8415 |
| 1034 | Ga0451797_0453838 | 3300041453 | Bacteria | 1272 |
| 1035 | Ga0451833_0076051 | 3300041491 | Bacteria | 745 |
| 1036 | Ga0439446_0093751 | 3300042156 | Bacteria | 943 |
| 1037 | Ga0439435_0113155 | 3300042436 | Bacteria | 844 |
| 1038 | Ga0451577_0009319 | 3300042876 | Bacteria | 9463 |
| 1039 | Ga0451577_0115367 | 3300042876 | Bacteria | 2405 |
| 1040 | Ga0451577_0177133 | 3300042876 | Bacteria | 1922 |
| 1041 | Ga0451577_0494716 | 3300042876 | Bacteria | 1110 |
| 1042 | Ga0466969_0067414 | 3300044656 | Bacteria | 1727 |
| 1043 | Ga0453683_0000058 | 3300044673 | Bacteria | 189089 |
| 1044 | Ga0453683_0024122 | 3300044673 | Bacteria | 3874 |
| 1045 | Ga0466966_0012789 | 3300044684 | Bacteria | 5560 |
| 1046 | Ga0466963_0013437 | 3300044694 | Bacteria | 5028 |
| 1047 | Ga0466963_0166716 | 3300044694 | Bacteria | 1534 |
| 1048 | Ga0466963_0167080 | 3300044694 | Bacteria | 1533 |
| 1049 | Ga0466963_0258200 | 3300044694 | Bacteria | 1223 |
| 1050 | Ga0466963_0299289 | 3300044694 | Bacteria | 1131 |
| 1051 | Ga0466963_0342599 | 3300044694 | Bacteria | 1052 |
| 1052 | Ga0466963_0456718 | 3300044694 | Bacteria | 901 |
| 1053 | Ga0453684_0014465 | 3300044712 | Bacteria | 12621 |
| 1054 | Ga0453684_0206673 | 3300044712 | Bacteria | 2285 |
| 1055 | Ga0453684_0881976 | 3300044712 | Bacteria | 959 |
| 1056 | Ga0453684_1215318 | 3300044712 | Bacteria | 790 |
| 1057 | Ga0466971_0088660 | 3300044719 | Bacteria | 1415 |
| 1058 | Ga0466957_0179777 | 3300044842 | Bacteria | 1381 |
| 1059 | Ga0466957_0190686 | 3300044842 | Bacteria | 1343 |
| 1060 | Ga0451576_0021438 | 3300045051 | Bacteria | 7023 |
| 1061 | Ga0451576_0678964 | 3300045051 | Bacteria | 1082 |
| 1062 | Ga0451576_0724718 | 3300045051 | Unclassified | 1045 |
| 1063 | Ga0451576_0754920 | 3300045051 | Bacteria | 1022 |
| 1064 | Ga0466958_0409435 | 3300045836 | Bacteria | 876 |
| 1065 | Ga0466967_0206840 | 3300045976 | Bacteria | 1860 |
| 1066 | Ga0466967_0280872 | 3300045976 | Bacteria | 1597 |
| 1067 | Ga0466967_0593921 | 3300045976 | Bacteria | 1092 |
| 1068 | Ga0466967_0888433 | 3300045976 | Bacteria | 886 |
| 1069 | Ga0466967_1205269 | 3300045976 | Bacteria | 754 |
| 1070 | Ga0495592_0237790 | 3300046454 | Bacteria | 1210 |
| 1071 | Ga0495603_0005735 | 3300046455 | Bacteria | 7427 |
| 1072 | Ga0495638_0005254 | 3300046460 | Bacteria | 9669 |
| 1073 | Ga0495638_0393440 | 3300046460 | Bacteria | 721 |
| 1074 | Ga0495641_0013923 | 3300046461 | Bacteria | 4384 |
| 1075 | Ga0495580_0005430 | 3300046472 | Bacteria | 10532 |
| 1076 | Ga0495580_0006518 | 3300046472 | Bacteria | 9499 |
| 1077 | Ga0495580_0011543 | 3300046472 | Bacteria | 6833 |
| 1078 | Ga0495580_0029864 | 3300046472 | Bacteria | 3953 |
| 1079 | Ga0495580_0037783 | 3300046472 | Bacteria | 3462 |
| 1080 | Ga0495580_0066022 | 3300046472 | Bacteria | 2534 |
| 1081 | Ga0495580_0076587 | 3300046472 | Bacteria | 2333 |
| 1082 | Ga0495580_0109697 | 3300046472 | Bacteria | 1916 |
| 1083 | Ga0495580_0196395 | 3300046472 | Bacteria | 1391 |
| 1084 | Ga0495580_0292534 | 3300046472 | Bacteria | 1110 |
| 1085 | Ga0495580_0476231 | 3300046472 | Bacteria | 835 |
| 1086 | Ga0495582_0000133 | 3300046473 | Bacteria | 39882 |
| 1087 | Ga0495605_0049612 | 3300046474 | Bacteria | 2050 |
| 1088 | Ga0495639_0037105 | 3300046475 | Bacteria | 2184 |
| 1089 | Ga0495585_0058734 | 3300046492 | Bacteria | 2122 |
| 1090 | Ga0495585_0230074 | 3300046492 | Bacteria | 932 |
| 1091 | Ga0495594_0027035 | 3300046499 | Bacteria | 3091 |
| 1092 | Ga0495594_0065481 | 3300046499 | Bacteria | 2015 |
| 1093 | Ga0495583_0019840 | 3300046506 | Bacteria | 3499 |
| 1094 | Ga0495610_0010253 | 3300046512 | Bacteria | 5838 |
| 1095 | Ga0495631_0005948 | 3300046518 | Bacteria | 6346 |
| 1096 | Ga0495631_0018464 | 3300046518 | Bacteria | 3282 |
| 1097 | Ga0495644_0000015 | 3300046523 | Bacteria | 89336 |
| 1098 | Ga0495652_0118600 | 3300046529 | Bacteria | 2114 |
| 1099 | Ga0495665_0029914 | 3300046531 | Bacteria | 2916 |
| 1100 | Ga0495640_0082216 | 3300046533 | Bacteria | 2139 |
| 1101 | Ga0495586_0021497 | 3300046535 | Bacteria | 3440 |
| 1102 | Ga0495587_0002546 | 3300046536 | Bacteria | 12190 |
| 1103 | Ga0495609_0011878 | 3300046538 | Bacteria | 4139 |
| 1104 | Ga0495609_0030292 | 3300046538 | Bacteria | 2463 |
| 1105 | Ga0495645_0116079 | 3300046543 | Bacteria | 1890 |
| 1106 | Ga0495633_0032625 | 3300046558 | Bacteria | 2515 |
| 1107 | Ga0495633_0204350 | 3300046558 | Bacteria | 906 |
| 1108 | Ga0495656_0029883 | 3300046615 | Bacteria | 2198 |
| 1109 | Ga0495668_0040960 | 3300046616 | Bacteria | 2582 |
| 1110 | Ga0495611_0029649 | 3300046648 | Bacteria | 2400 |
| 1111 | Ga0495625_0011188 | 3300046660 | Bacteria | 7341 |
| 1112 | Ga0495625_0399493 | 3300046660 | Bacteria | 859 |
| 1113 | Ga0495635_0089167 | 3300046663 | Bacteria | 2110 |
| 1114 | Ga0495623_0037309 | 3300046679 | Bacteria | 3111 |
| 1115 | Ga0495623_0209744 | 3300046679 | Bacteria | 1116 |
| 1116 | Ga0495623_0313750 | 3300046679 | Bacteria | 863 |
| 1117 | Ga0495646_0019554 | 3300046680 | Bacteria | 4285 |
| 1118 | Ga0495669_0002696 | 3300046684 | Bacteria | 7276 |
| 1119 | Ga0495669_0025427 | 3300046684 | Bacteria | 2582 |
| 1120 | Ga0495669_0183217 | 3300046684 | Bacteria | 998 |
| 1121 | Ga0495669_0370796 | 3300046684 | Bacteria | 692 |
| 1122 | Ga0495613_0023739 | 3300046689 | Bacteria | 4570 |
| 1123 | Ga0495613_0126633 | 3300046689 | Bacteria | 1831 |
| 1124 | Ga0495671_0193976 | 3300046692 | Bacteria | 986 |
| 1125 | Ga0495589_0104429 | 3300046794 | Bacteria | 1370 |
| 1126 | Ga0495600_0157448 | 3300046809 | Bacteria | 1469 |
| 1127 | Ga0495660_0021351 | 3300046810 | Bacteria | 3708 |
| 1128 | Ga0495581_0047764 | 3300047315 | Bacteria | 2473 |
| 1129 | Ga0495604_0000910 | 3300047317 | Bacteria | 24583 |
| 1130 | Ga0495674_0144941 | 3300047319 | Bacteria | 1994 |
| 1131 | Ga0495672_0056919 | 3300047320 | Bacteria | 2272 |
| 1132 | Ga0495683_0082537 | 3300047323 | Bacteria | 1566 |
| 1133 | Ga0495679_026130 | 3300047446 | Bacteria | 1943 |
| 1134 | Ga0495684_0035045 | 3300047471 | Bacteria | 3850 |
| 1135 | Ga0495602_0189038 | 3300048088 | Bacteria | 1581 |
| 1136 | Ga0495602_0198103 | 3300048088 | Bacteria | 1534 |
| 1137 | Ga0496100_0064043 | 3300048903 | Bacteria | 2432 |
| 1138 | Ga0496100_0641350 | 3300048903 | Bacteria | 827 |
| 1139 | Ga0496101_0043147 | 3300048904 | Bacteria | 3222 |
| 1140 | Ga0496102_0072345 | 3300048905 | Bacteria | 3168 |
| 1141 | Ga0496102_0077132 | 3300048905 | Bacteria | 3067 |
| 1142 | Ga0496102_0261235 | 3300048905 | Bacteria | 1632 |
| 1143 | Ga0496102_0358807 | 3300048905 | Bacteria | 1372 |
| 1144 | Ga0496103_0077440 | 3300048906 | Bacteria | 2087 |
| 1145 | Ga0496104_0001058 | 3300048907 | Bacteria | 23466 |
| 1146 | Ga0496104_0024241 | 3300048907 | Bacteria | 5581 |
| 1147 | Ga0496104_0075030 | 3300048907 | Bacteria | 3220 |
| 1148 | Ga0496104_0339093 | 3300048907 | Bacteria | 1416 |
| 1149 | Ga0496104_0638341 | 3300048907 | Bacteria | 974 |
| 1150 | Ga0496105_0003561 | 3300048908 | Bacteria | 11550 |
| 1151 | Ga0496105_0206590 | 3300048908 | Bacteria | 1602 |
| 1152 | Ga0496105_0265445 | 3300048908 | Bacteria | 1387 |
| 1153 | Ga0496105_0568666 | 3300048908 | Bacteria | 883 |
| 1154 | Ga0496106_0093047 | 3300048909 | Bacteria | 2329 |
| 1155 | Ga0496106_0366767 | 3300048909 | Bacteria | 1157 |
| 1156 | Ga0496106_0521550 | 3300048909 | Bacteria | 954 |
| 1157 | Ga0496107_0285074 | 3300048910 | Bacteria | 1229 |
| 1158 | Ga0496108_0000319 | 3300048911 | Bacteria | 40722 |
| 1159 | Ga0496108_0006344 | 3300048911 | Bacteria | 9583 |
| 1160 | Ga0496108_0067945 | 3300048911 | Bacteria | 3006 |
| 1161 | Ga0496108_0075338 | 3300048911 | Bacteria | 2851 |
| 1162 | Ga0496109_0000157 | 3300048912 | Bacteria | 66192 |
| 1163 | Ga0496109_0021538 | 3300048912 | Bacteria | 5701 |
| 1164 | Ga0496109_0126078 | 3300048912 | Bacteria | 2387 |
| 1165 | Ga0496109_0807817 | 3300048912 | Bacteria | 876 |
| 1166 | Ga0496109_0966009 | 3300048912 | Bacteria | 790 |
| 1167 | Ga0496110_0000078 | 3300048913 | Bacteria | 50473 |
| 1168 | Ga0496110_0086271 | 3300048913 | Bacteria | 2802 |
| 1169 | Ga0496110_0087724 | 3300048913 | Bacteria | 2778 |
| 1170 | Ga0496110_0296498 | 3300048913 | Bacteria | 1473 |
| 1171 | Ga0496111_0012083 | 3300048914 | Bacteria | 5838 |
| 1172 | Ga0496111_0046600 | 3300048914 | Bacteria | 3121 |
| 1173 | Ga0496111_0142210 | 3300048914 | Bacteria | 1778 |
| 1174 | Ga0496112_0000038 | 3300048915 | Bacteria | 94892 |
| 1175 | Ga0496112_0001454 | 3300048915 | Bacteria | 18184 |
| 1176 | Ga0496112_0004466 | 3300048915 | Bacteria | 11859 |
| 1177 | Ga0496112_0029489 | 3300048915 | Bacteria | 5306 |
| 1178 | Ga0496112_0034173 | 3300048915 | Bacteria | 4947 |
| 1179 | Ga0496112_0064541 | 3300048915 | Bacteria | 3613 |
| 1180 | Ga0496112_0101555 | 3300048915 | Bacteria | 2846 |
| 1181 | Ga0496112_0136804 | 3300048915 | Bacteria | 2420 |
| 1182 | Ga0496112_0157921 | 3300048915 | Bacteria | 2234 |
| 1183 | Ga0496112_0243771 | 3300048915 | Bacteria | 1749 |
| 1184 | Ga0496112_0372889 | 3300048915 | Bacteria | 1369 |
| 1185 | Ga0496113_0000064 | 3300048916 | Bacteria | 45691 |
| 1186 | Ga0496113_0047461 | 3300048916 | Bacteria | 3191 |
| 1187 | Ga0496113_0175273 | 3300048916 | Bacteria | 1699 |
| 1188 | Ga0496113_0336997 | 3300048916 | Bacteria | 1210 |
| 1189 | Ga0496113_0481639 | 3300048916 | Bacteria | 997 |
| 1190 | Ga0496113_0663823 | 3300048916 | Bacteria | 833 |
| 1191 | Ga0496114_0012085 | 3300048917 | Bacteria | 6909 |
| 1192 | Ga0496115_0011441 | 3300048918 | Bacteria | 6651 |
| 1193 | Ga0496119_0000174 | 3300048922 | Bacteria | 89804 |
| 1194 | Ga0496120_0000253 | 3300048923 | Bacteria | 89798 |
| 1195 | Ga0496121_0027466 | 3300048924 | Bacteria | 5326 |
| 1196 | Ga0496124_0017271 | 3300048927 | Bacteria | 6806 |
| 1197 | Ga0496124_0036238 | 3300048927 | Bacteria | 4305 |
| 1198 | Ga0496124_0120096 | 3300048927 | Bacteria | 2101 |
| 1199 | Ga0496125_0000162 | 3300048928 | Bacteria | 149093 |
| 1200 | Ga0496125_0036192 | 3300048928 | Bacteria | 4314 |
| 1201 | Ga0496125_0077270 | 3300048928 | Bacteria | 2567 |
| 1202 | Ga0496125_0085531 | 3300048928 | Bacteria | 2389 |
| 1203 | Ga0496126_0002736 | 3300048929 | Bacteria | 23301 |
| 1204 | Ga0495682_0139668 | 3300049460 | Bacteria | 865 |
| 1205 | Ga0501031_0030121 | 3300049568 | Bacteria | 3539 |
| 1206 | Ga0501031_0213124 | 3300049568 | Bacteria | 1258 |
| 1207 | Ga0501032_0000973 | 3300049569 | Bacteria | 23175 |
| 1208 | Ga0501032_0056886 | 3300049569 | Bacteria | 2628 |
| 1209 | Ga0501033_0003887 | 3300049570 | Bacteria | 12143 |
| 1210 | Ga0501033_0007719 | 3300049570 | Bacteria | 8345 |
| 1211 | Ga0501034_0001689 | 3300049571 | Bacteria | 28443 |
| 1212 | Ga0501034_0011024 | 3300049571 | Bacteria | 9383 |
| 1213 | Ga0501034_0012650 | 3300049571 | Bacteria | 8707 |
| 1214 | Ga0501034_0019726 | 3300049571 | Bacteria | 6891 |
| 1215 | Ga0501034_0091902 | 3300049571 | Bacteria | 3032 |
| 1216 | Ga0501034_0135309 | 3300049571 | Bacteria | 2445 |
| 1217 | Ga0501036_0019750 | 3300049572 | Bacteria | 5658 |
| 1218 | Ga0501037_0001543 | 3300049573 | Bacteria | 16806 |
| 1219 | Ga0501038_0008430 | 3300049574 | Bacteria | 9483 |
| 1220 | Ga0501038_0523743 | 3300049574 | Bacteria | 904 |
| 1221 | Ga0501040_0000116 | 3300049576 | Bacteria | 42224 |
| 1222 | Ga0501040_0032079 | 3300049576 | Bacteria | 3554 |
| 1223 | Ga0501041_0158617 | 3300049577 | Bacteria | 1414 |
| 1224 | Ga0501042_0000125 | 3300049578 | Bacteria | 33043 |
| 1225 | Ga0501043_0024168 | 3300049579 | Bacteria | 4768 |
| 1226 | Ga0501043_0059054 | 3300049579 | Bacteria | 3009 |
| 1227 | Ga0501043_0125116 | 3300049579 | Bacteria | 2016 |
| 1228 | Ga0501046_0000731 | 3300049580 | Bacteria | 31748 |
| 1229 | Ga0501047_0008742 | 3300049581 | Bacteria | 9556 |
| 1230 | Ga0501047_0017626 | 3300049581 | Bacteria | 6843 |
| 1231 | Ga0501070_0019673 | 3300049586 | Bacteria | 5661 |
| 1232 | Ga0501070_0332844 | 3300049586 | Bacteria | 1234 |
| 1233 | Ga0501070_0365838 | 3300049586 | Bacteria | 1169 |
| 1234 | Ga0501071_0013601 | 3300049587 | Bacteria | 5550 |
| 1235 | Ga0501071_0135171 | 3300049587 | Bacteria | 1834 |
| 1236 | Ga0501072_0134318 | 3300049588 | Bacteria | 1973 |
| 1237 | Ga0501072_0298175 | 3300049588 | Bacteria | 1281 |
| 1238 | Ga0501073_0004858 | 3300049589 | Bacteria | 10088 |
| 1239 | Ga0501073_0014887 | 3300049589 | Bacteria | 5644 |
| 1240 | Ga0501073_0681251 | 3300049589 | Bacteria | 709 |
| 1241 | Ga0501074_0019539 | 3300049590 | Bacteria | 4918 |
| 1242 | Ga0501074_0076371 | 3300049590 | Bacteria | 2404 |
| 1243 | Ga0501075_0009859 | 3300049591 | Bacteria | 6695 |
| 1244 | Ga0501075_0123385 | 3300049591 | Bacteria | 1972 |
| 1245 | Ga0501075_0200012 | 3300049591 | Bacteria | 1524 |
| 1246 | Ga0501075_0372846 | 3300049591 | Bacteria | 1088 |
| 1247 | Ga0501076_0009934 | 3300049592 | Bacteria | 7035 |
| 1248 | Ga0501076_0050250 | 3300049592 | Bacteria | 3298 |
| 1249 | Ga0501076_0299932 | 3300049592 | Bacteria | 1317 |
| 1250 | Ga0501077_0009941 | 3300049593 | Bacteria | 5921 |
| 1251 | Ga0501077_0200337 | 3300049593 | Bacteria | 1268 |
| 1252 | Ga0501077_0207376 | 3300049593 | Bacteria | 1245 |
| 1253 | Ga0501217_012416 | 3300049661 | Bacteria | 1897 |
| 1254 | Ga0501079_0005627 | 3300049741 | Bacteria | 9353 |
| 1255 | Ga0501080_0005086 | 3300049742 | Bacteria | 11720 |
| 1256 | Ga0501081_0009080 | 3300049743 | Bacteria | 6467 |
| 1257 | Ga0501083_0063116 | 3300049744 | Bacteria | 2471 |
| 1258 | Ga0501241_016205 | 3300049758 | Bacteria | 1358 |
| 1259 | Ga0501035_0003026 | 3300049822 | Bacteria | 16115 |
| 1260 | Ga0501035_0007843 | 3300049822 | Bacteria | 9978 |
| 1261 | Ga0501035_0122226 | 3300049822 | Bacteria | 2275 |
| 1262 | Ga0501035_0172256 | 3300049822 | Bacteria | 1869 |
| 1263 | Ga0501035_0434594 | 3300049822 | Bacteria | 1088 |
| 1264 | Ga0501044_0001659 | 3300049823 | Bacteria | 26121 |
| 1265 | Ga0501044_0016221 | 3300049823 | Bacteria | 8008 |
| 1266 | Ga0501044_0135913 | 3300049823 | Bacteria | 2450 |
| 1267 | Ga0501044_0379651 | 3300049823 | Bacteria | 1328 |
| 1268 | Ga0501045_0129350 | 3300049824 | Bacteria | 1877 |
| 1269 | Ga0501045_0157116 | 3300049824 | Bacteria | 1692 |
| 1270 | nmdc:mga0k408_10493_c2 | 3300050493 | Bacteria | 3320 |
| 1271 | nmdc:mga05p37_117993_c1 | 3300050507 | Bacteria | 3261 |
| 1272 | nmdc:mga05p37_174464_c1 | 3300050507 | Bacteria | 2620 |
| 1273 | nmdc:mga05p37_408391_c1 | 3300050507 | Bacteria | 1584 |
| 1274 | nmdc:mga05p37_4404_c1 | 3300050507 | Bacteria | 16454 |
| 1275 | nmdc:mga05p37_44905_c1 | 3300050507 | Bacteria | 5436 |
| 1276 | nmdc:mga05p37_73073_c1 | 3300050507 | Bacteria | 4221 |
| 1277 | nmdc:mga05p37_796518_c1 | 3300050507 | Bacteria | 1035 |
| 1278 | nmdc:mga09592_115103_c1 | 3300050508 | Bacteria | 2308 |
| 1279 | nmdc:mga09592_405833_c1 | 3300050508 | Bacteria | 1178 |
| 1280 | nmdc:mga0qj67_10008_c1 | 3300050509 | Bacteria | 7072 |
| 1281 | nmdc:mga0qj67_156136_c1 | 3300050509 | Bacteria | 1852 |
| 1282 | nmdc:mga0qj67_72618_c1 | 3300050509 | Bacteria | 2748 |
| 1283 | nmdc:mga06r32_171740_c1 | 3300050510 | Bacteria | 2152 |
| 1284 | nmdc:mga06r32_718685_c1 | 3300050510 | Bacteria | 964 |
| 1285 | nmdc:mga08y16_1027673_c1 | 3300050511 | Bacteria | 803 |
| 1286 | nmdc:mga08y16_12850_c1 | 3300050511 | Bacteria | 8804 |
| 1287 | nmdc:mga08y16_24065_c1 | 3300050511 | Bacteria | 6430 |
| 1288 | nmdc:mga0n895_219_c1 | 3300050512 | Bacteria | 36032 |
| 1289 | nmdc:mga0n895_22563_c1 | 3300050512 | Bacteria | 5903 |
| 1290 | nmdc:mga0n895_256791_c1 | 3300050512 | Bacteria | 1774 |
| 1291 | nmdc:mga0n895_500945_c1 | 3300050512 | Bacteria | 1223 |
| 1292 | nmdc:mga0n895_525518_c1 | 3300050512 | Bacteria | 1191 |
| 1293 | nmdc:mga0n895_60612_c1 | 3300050512 | Bacteria | 3734 |
| 1294 | nmdc:mga0n895_819321_c1 | 3300050512 | Bacteria | 920 |
| 1295 | nmdc:mga0n895_890010_c1 | 3300050512 | Bacteria | 876 |
| 1296 | nmdc:mga0rr50_1025591_c1 | 3300050513 | Bacteria | 703 |
| 1297 | nmdc:mga0rr50_15194_c1 | 3300050513 | Bacteria | 5076 |
| 1298 | nmdc:mga0rr50_211902_c1 | 3300050513 | Bacteria | 1596 |
| 1299 | nmdc:mga0rr50_420274_c1 | 3300050513 | Bacteria | 1131 |
| 1300 | nmdc:mga0rr50_5126_c1 | 3300050513 | Bacteria | 7780 |
| 1301 | nmdc:mga0rr50_63914_c1 | 3300050513 | Bacteria | 2781 |
| 1302 | nmdc:mga08x19_110649_c1 | 3300050514 | Bacteria | 1832 |
| 1303 | nmdc:mga08x19_13151_c1 | 3300050514 | Bacteria | 4998 |
| 1304 | nmdc:mga08x19_70723_c1 | 3300050514 | Bacteria | 2274 |
| 1305 | nmdc:mga0a205_29179_c1 | 3300050515 | Bacteria | 5280 |
| 1306 | nmdc:mga0a205_33459_c1 | 3300050515 | Bacteria | 4928 |
| 1307 | nmdc:mga0a205_371539_c1 | 3300050515 | Bacteria | 1296 |
| 1308 | nmdc:mga0a205_384910_c1 | 3300050515 | Bacteria | 1267 |
| 1309 | nmdc:mga0a205_406633_c1 | 3300050515 | Bacteria | 1225 |
| 1310 | nmdc:mga0a205_41124_c1 | 3300050515 | Bacteria | 4452 |
| 1311 | nmdc:mga0a205_431201_c1 | 3300050515 | Bacteria | 1180 |
| 1312 | nmdc:mga0a205_506303_c1 | 3300050515 | Bacteria | 1064 |
| 1313 | nmdc:mga0a205_7468_c1 | 3300050515 | Bacteria | 9307 |
| 1314 | nmdc:mga0a205_97138_c1 | 3300050515 | Bacteria | 2845 |
| 1315 | Ga0495601_0167511 | 3300053077 | Bacteria | 1436 |
| 1316 | Ga0495619_0039581 | 3300053085 | Bacteria | 3078 |
| 1317 | Ga0500616_0003860 | 3300053153 | Bacteria | 11066 |
| 1318 | Ga0500634_0198537 | 3300053161 | Bacteria | 884 |
| 1319 | Ga0501084_0003210 | 3300054114 | Bacteria | 13242 |
| 1320 | Ga0501084_0015269 | 3300054114 | Bacteria | 6368 |
| 1321 | Ga0501084_0019099 | 3300054114 | Bacteria | 5709 |
| 1322 | Ga0501082_0003375 | 3300060353 | Bacteria | 13939 |
| 1323 | Ga0501082_0015433 | 3300060353 | Bacteria | 6574 |
| 1324 | Ga0501082_0129780 | 3300060353 | Bacteria | 2187 |
| 1325 | Ga0466962_0019175 | 3300061719 | Bacteria | 3284 |
| 1326 | Ga0530510_0003630 | 3300061734 | Bacteria | 10616 |
| 1327 | Ga0530510_0075434 | 3300061734 | Bacteria | 2449 |
| 1328 | Ga0530510_0093991 | 3300061734 | Bacteria | 2190 |
| 1329 | 2599411864 | 2599185169 | Bacteria | 5441380 |
| 1330 | 2601524463 | 2600255254 | Bacteria | 5281859 |
| 1331 | 2601529617 | 2600255255 | Bacteria | 5282785 |
| 1332 | 2601616451 | 2600255280 | Bacteria | 5292309 |
| 1333 | 2601621173 | 2600255281 | Bacteria | 5288753 |
| 1334 | 2601646152 | 2600255287 | Bacteria | 5210468 |
| 1335 | 2601649570 | 2600255288 | Bacteria | 5282738 |
| 1336 | 2601654497 | 2600255289 | Bacteria | 5281907 |
| 1337 | 2601660229 | 2600255290 | Bacteria | 5282218 |
| 1338 | 2601664266 | 2600255291 | Bacteria | 5217298 |
| 1339 | 2601699160 | 2600255298 | Bacteria | 5215185 |
| 1340 | 2601702569 | 2600255299 | Bacteria | 5218662 |
| 1341 | 2601707241 | 2600255300 | Bacteria | 5287774 |
| 1342 | 2601712262 | 2600255301 | Bacteria | 5280532 |
| 1343 | 2601717758 | 2600255302 | Bacteria | 5288235 |
| 1344 | 2601723072 | 2600255303 | Bacteria | 5219315 |
| 1345 | 2601727686 | 2600255304 | Bacteria | 5283973 |
| 1346 | 2601732703 | 2600255305 | Bacteria | 5282329 |
| 1347 | 2601737528 | 2600255306 | Bacteria | 5281613 |
| 1348 | 2601741947 | 2600255307 | Bacteria | 5439064 |
| 1349 | 2601752845 | 2600255309 | Bacteria | 5431045 |
| 1350 | 2602021807 | 2600255392 | Bacteria | 5437392 |
| 1351 | 2603662430 | 2602042052 | Bacteria | 5215873 |
| 1352 | 2603667326 | 2602042053 | Bacteria | 5214361 |
| 1353 | 2603840112 | 2602042103 | Bacteria | 5284714 |
| 1354 | 2603845189 | 2602042104 | Bacteria | 5281639 |
| 1355 | 2603850262 | 2602042105 | Bacteria | 5282303 |
| 1356 | 2603855330 | 2602042106 | Bacteria | 5282744 |
| 1357 | 2603868412 | 2602042109 | Bacteria | 5152801 |
| 1358 | 2603873222 | 2602042110 | Bacteria | 5283285 |
| 1359 | 2603878137 | 2602042111 | Bacteria | 5212080 |
| 1360 | 2606050091 | 2603880178 | Bacteria | 5283018 |
| 1361 | 2606071755 | 2603880184 | Bacteria | 5217896 |
| 1362 | 2606147774 | 2603880202 | Bacteria | 5284684 |
| 1363 | 2606178291 | 2603880211 | Bacteria | 5284226 |
| 1364 | 2621297133 | 2619619299 | Bacteria | 6649820 |
| 1365 | 2637222992 | 2636415599 | Bacteria | 5718434 |
| 1366 | 2643818466 | 2643221559 | Bacteria | 4424915 |
| 1367 | 2643880667 | 2643221573 | Bacteria | 4784121 |
| 1368 | 2643938393 | 2643221586 | Bacteria | 4446529 |
| 1369 | 2644079044 | 2643221612 | Bacteria | 4361984 |
| 1370 | 2644661238 | 2643221720 | Bacteria | 4694283 |
| 1371 | 2644693821 | 2643221727 | Bacteria | 4415595 |
| 1372 | 2644699315 | 2643221728 | Bacteria | 4797149 |
| 1373 | 2676408728 | 2675903046 | Bacteria | 5451247 |
| 1374 | 2686995266 | 2684623153 | Bacteria | 3878815 |
| 1375 | 2687234971 | 2684623219 | Bacteria | 8442773 |
| 1376 | 2738671952 | 2738541265 | Bacteria | 6594665 |
| 1377 | 2738716207 | 2738541276 | Bacteria | 4690596 |
| 1378 | 2738750346 | 2738541282 | Bacteria | 6593925 |
| 1379 | 2738859386 | 2738541303 | Bacteria | 6591772 |
| 1380 | 2774131164 | 2773857672 | Bacteria | 4993178 |
| 1381 | 2777021331 | 2775507074 | Bacteria | 5532402 |
| 1382 | 2817493754 | 2816332298 | Bacteria | 6852809 |
| 1383 | 2852651852 | 2852649853 | Bacteria | 4036942 |
| 1384 | 2884218054 | 2884215851 | Bacteria | 4554841 |
| 1385 | 2904517992 | 2904513164 | Bacteria | 5476410 |
| 1386 | 2917836436 | 2917832318 | Bacteria | 5346010 |
| 1387 | 2919126542 | 2919125081 | Bacteria | 5385106 |
| 1388 | 2919515643 | 2919513703 | Bacteria | 3844312 |
| 1389 | 2919678359 | 2919675420 | Bacteria | 3969095 |
| 1390 | 2939623738 | 2939622612 | Bacteria | 4698046 |
| 1391 | 2941478489 | 2941475908 | Bacteria | 4145589 |
| 1392 | 2969080019 | 2969079654 | Bacteria | 5439582 |
| 1393 | 2974302767 | 2974298342 | Bacteria | 4840922 |
| 1394 | 2984499647 | 2984499530 | Bacteria | 5020881 |
| 1395 | 2984506893 | 2984504281 | Bacteria | 5262371 |
| 1396 | 2984562473 | 2984559226 | Bacteria | 5683096 |
| 1397 | 2984600533 | 2984595703 | Bacteria | 5682994 |
| 1398 | 3006975070 | 3006973921 | Bacteria | 4423788 |
| 1399 | 8016731053 | 8016728285 | Bacteria | 5263933 |
| 1400 | 8055823597 | 8055817908 | Bacteria | 6609162 |
| 1401 | Ga0068860_100114325 | |||
| 1402 | JGI24752J21851_1000650 | |||
| 1403 | JGI24737J22298_10062562 | |||
| 1404 | JGI24743J22301_10017797 | |||
| 1405 | JGI24735J21928_10031651 | |||
| 1406 | JGI24751J29686_10002240 | |||
| 1407 | JGI25406J46586_10034709 | |||
| 1408 | rootH1_10038406 | |||
| 1409 | Ga0055526_1024061 | |||
| 1410 | Ga0055537_1000149 | |||
| 1411 | Ga0055536_1035424 | |||
| 1412 | Ga0058692_1011227 | |||
| 1413 | Ga0065712_10009377 | |||
| 1414 | Ga0065712_10078052 | |||
| 1415 | Ga0065707_10103873 | |||
| 1416 | Ga0070658_10061551 | |||
| 1417 | Ga0070658_10239517 | |||
| 1418 | Ga0070658_10259800 | |||
| 1419 | Ga0070658_10314824 | |||
| 1420 | Ga0070676_10102753 | |||
| 1421 | Ga0070676_10233614 | |||
| 1422 | Ga0070683_100005535 | |||
| 1423 | Ga0070683_100011335 | |||
| 1424 | Ga0070683_100072776 | |||
| 1425 | Ga0070683_100194924 | |||
| 1426 | Ga0070683_100256339 | |||
| 1427 | Ga0070683_100376306 | |||
| 1428 | Ga0070683_100540844 | |||
| 1429 | Ga0070690_100002873 | |||
| 1430 | Ga0070690_100015460 | |||
| 1431 | Ga0070690_100055841 | |||
| 1432 | Ga0070690_100081392 | |||
| 1433 | Ga0070670_100001994 | |||
| 1434 | Ga0070670_100085671 | |||
| 1435 | Ga0070670_100324572 | |||
| 1436 | Ga0070670_100668670 | |||
| 1437 | Ga0070677_10013893 | |||
| 1438 | Ga0068869_100015244 | |||
| 1439 | Ga0068869_100048422 | |||
| 1440 | Ga0068869_100176047 | |||
| 1441 | Ga0070666_10000661 | |||
| 1442 | Ga0070666_10066656 | |||
| 1443 | Ga0070680_100286675 | |||
| 1444 | Ga0070680_100341735 | |||
| 1445 | Ga0070680_100570007 | |||
| 1446 | Ga0070682_100006928 | |||
| 1447 | Ga0070682_100180582 | |||
| 1448 | Ga0070682_100363945 | |||
| 1449 | Ga0068868_100000504 | |||
| 1450 | Ga0068868_100017206 | |||
| 1451 | Ga0068868_100041741 | |||
| 1452 | Ga0068868_100057085 | |||
| 1453 | Ga0068868_100079154 | |||
| 1454 | Ga0070660_100002867 | |||
| 1455 | Ga0070660_100025266 | |||
| 1456 | Ga0070660_100035205 | |||
| 1457 | Ga0070689_100709587 | |||
| 1458 | Ga0070687_100012708 | |||
| 1459 | Ga0070661_100024795 | |||
| 1460 | Ga0070661_100031525 | |||
| 1461 | Ga0070661_100061451 | |||
| 1462 | Ga0070661_100273825 | |||
| 1463 | Ga0070692_10100191 | |||
| 1464 | Ga0070668_100009641 | |||
| 1465 | Ga0070668_100016265 | |||
| 1466 | Ga0070668_100022820 | |||
| 1467 | Ga0070669_100262422 | |||
| 1468 | Ga0070669_100717362 | |||
| 1469 | Ga0070669_100829798 | |||
| 1470 | Ga0070675_100022011 | |||
| 1471 | Ga0070671_100028977 | |||
| 1472 | Ga0070671_100048259 | |||
| 1473 | Ga0070674_100004017 | |||
| 1474 | Ga0070674_100427599 | |||
| 1475 | Ga0070674_100535697 | |||
| 1476 | Ga0070673_100029452 | |||
| 1477 | Ga0070673_100066374 | |||
| 1478 | Ga0070673_100077101 | |||
| 1479 | Ga0070673_100164469 | |||
| 1480 | Ga0070673_100464665 | |||
| 1481 | Ga0070688_100012103 | |||
| 1482 | Ga0070688_101043035 | |||
| 1483 | Ga0070659_100000441 | |||
| 1484 | Ga0070659_100037235 | |||
| 1485 | Ga0070659_100062741 | |||
| 1486 | Ga0070659_100383491 | |||
| 1487 | Ga0070667_100000600 | |||
| 1488 | Ga0070667_100017478 | |||
| 1489 | Ga0070667_100136457 | |||
| 1490 | Ga0070667_100143615 | |||
| 1491 | Ga0070667_100231688 | |||
| 1492 | Ga0070667_100372408 | |||
| 1493 | Ga0070709_10005028 | |||
| 1494 | Ga0070709_10019229 | |||
| 1495 | Ga0070709_10022512 | |||
| 1496 | Ga0070709_10109546 | |||
| 1497 | Ga0070709_10111775 | |||
| 1498 | Ga0070709_10120662 | |||
| 1499 | Ga0070709_10197930 | |||
| 1500 | Ga0070714_100027851 | |||
| 1501 | Ga0070714_100156782 | |||
| 1502 | Ga0070714_100226535 | |||
| 1503 | Ga0070714_100550288 | |||
| 1504 | Ga0070713_100000114 | |||
| 1505 | Ga0070713_100007883 | |||
| 1506 | Ga0070713_100016681 | |||
| 1507 | Ga0070713_100018928 | |||
| 1508 | Ga0070713_100224194 | |||
| 1509 | Ga0070713_100275971 | |||
| 1510 | Ga0070713_100471899 | |||
| 1511 | Ga0070713_100800630 | |||
| 1512 | Ga0070713_100859813 | |||
| 1513 | Ga0070713_100970027 | |||
| 1514 | Ga0070710_10002299 | |||
| 1515 | Ga0070710_10149885 | |||
| 1516 | Ga0070710_10394928 | |||
| 1517 | Ga0070711_100000079 | |||
| 1518 | Ga0070711_100063062 | |||
| 1519 | Ga0070711_101297572 | |||
| 1520 | Ga0070705_100037016 | |||
| 1521 | Ga0070700_100203178 | |||
| 1522 | Ga0070694_100211912 | |||
| 1523 | Ga0070694_100806629 | |||
| 1524 | Ga0070708_100007624 | |||
| 1525 | Ga0070708_100017236 | |||
| 1526 | Ga0070708_100019283 | |||
| 1527 | Ga0070708_100032809 | |||
| 1528 | Ga0070708_100041725 | |||
| 1529 | Ga0070708_100072878 | |||
| 1530 | Ga0070708_100099478 | |||
| 1531 | Ga0070708_100115612 | |||
| 1532 | Ga0070708_100296677 | |||
| 1533 | Ga0070708_100589993 | |||
| 1534 | Ga0070708_101140121 | |||
| 1535 | Ga0070708_101512150 | |||
| 1536 | Ga0070708_101524037 | |||
| 1537 | Ga0070663_100218346 | |||
| 1538 | Ga0070678_100103712 | |||
| 1539 | Ga0070662_100011640 | |||
| 1540 | Ga0070662_100322788 | |||
| 1541 | Ga0070681_10000642 | |||
| 1542 | Ga0070681_10011678 | |||
| 1543 | Ga0070681_10016194 | |||
| 1544 | Ga0070681_10262055 | |||
| 1545 | Ga0070681_10303161 | |||
| 1546 | Ga0070681_10324808 | |||
| 1547 | Ga0070681_10405412 | |||
| 1548 | Ga0070681_10641871 | |||
| 1549 | Ga0070681_10715097 | |||
| 1550 | Ga0068867_100004954 | |||
| 1551 | Ga0068867_100024665 | |||
| 1552 | Ga0068867_100060574 | |||
| 1553 | Ga0070685_10018857 | |||
| 1554 | Ga0070706_100000496 | |||
| 1555 | Ga0070706_100000955 | |||
| 1556 | Ga0070706_100028459 | |||
| 1557 | Ga0070706_100040073 | |||
| 1558 | Ga0070706_100157284 | |||
| 1559 | Ga0070706_100391676 | |||
| 1560 | Ga0070707_100004175 | |||
| 1561 | Ga0070707_100004753 | |||
| 1562 | Ga0070707_100005558 | |||
| 1563 | Ga0070707_100082927 | |||
| 1564 | Ga0070707_100159304 | |||
| 1565 | Ga0070707_100248320 | |||
| 1566 | Ga0070707_100251853 | |||
| 1567 | Ga0070707_100297150 | |||
| 1568 | Ga0070707_100433974 | |||
| 1569 | Ga0070707_100504240 | |||
| 1570 | Ga0070707_100662898 | |||
| 1571 | Ga0070698_100000012 | |||
| 1572 | Ga0070698_100000017 | |||
| 1573 | Ga0070698_100001685 | |||
| 1574 | Ga0070698_100006862 | |||
| 1575 | Ga0070698_100040622 | |||
| 1576 | Ga0070698_100065165 | |||
| 1577 | Ga0070698_100153734 | |||
| 1578 | Ga0070698_100254312 | |||
| 1579 | Ga0070699_100006774 | |||
| 1580 | Ga0070699_100041263 | |||
| 1581 | Ga0070699_100084830 | |||
| 1582 | Ga0070699_100689739 | |||
| 1583 | Ga0070679_100012676 | |||
| 1584 | Ga0070679_100053788 | |||
| 1585 | Ga0070679_100339985 | |||
| 1586 | Ga0070679_100410943 | |||
| 1587 | Ga0070679_100424446 | |||
| 1588 | Ga0070684_100019600 | |||
| 1589 | Ga0070684_100025303 | |||
| 1590 | Ga0070684_100171598 | |||
| 1591 | Ga0070684_100187089 | |||
| 1592 | Ga0070697_100000873 | |||
| 1593 | Ga0070697_100007553 | |||
| 1594 | Ga0070697_100008250 | |||
| 1595 | Ga0070697_100017259 | |||
| 1596 | Ga0070697_100017646 | |||
| 1597 | Ga0070697_100023354 | |||
| 1598 | Ga0070697_100053091 | |||
| 1599 | Ga0070697_100075525 | |||
| 1600 | Ga0070697_100156419 | |||
| 1601 | Ga0070697_100520075 | |||
| 1602 | Ga0070697_100678662 | |||
| 1603 | Ga0070697_100911080 | |||
| 1604 | Ga0070697_101152232 | |||
| 1605 | Ga0068853_100000021 | |||
| 1606 | Ga0068853_100007555 | |||
| 1607 | Ga0068853_100113553 | |||
| 1608 | Ga0068853_100122534 | |||
| 1609 | Ga0070672_100390524 | |||
| 1610 | Ga0070686_100253314 | |||
| 1611 | Ga0070695_100147961 | |||
| 1612 | Ga0070695_100207944 | |||
| 1613 | Ga0070695_100269279 | |||
| 1614 | Ga0070696_100007647 | |||
| 1615 | Ga0070696_100115687 | |||
| 1616 | Ga0070696_100135388 | |||
| 1617 | Ga0070693_100021064 | |||
| 1618 | Ga0070693_100054370 | |||
| 1619 | Ga0070693_100100776 | |||
| 1620 | Ga0070693_100119601 | |||
| 1621 | Ga0070665_100279358 | |||
| 1622 | Ga0070665_100798245 | |||
| 1623 | Ga0070704_100144686 | |||
| 1624 | Ga0070704_100383974 | |||
| 1625 | Ga0070704_100480180 | |||
| 1626 | Ga0068855_100004030 | |||
| 1627 | Ga0068855_100021151 | |||
| 1628 | Ga0068855_100045941 | |||
| 1629 | Ga0068855_100048051 | |||
| 1630 | Ga0068855_100102272 | |||
| 1631 | Ga0068855_100108155 | |||
| 1632 | Ga0068855_100111413 | |||
| 1633 | Ga0068855_100217176 | |||
| 1634 | Ga0068855_100279099 | |||
| 1635 | Ga0068855_100521175 | |||
| 1636 | Ga0068855_100792066 | |||
| 1637 | Ga0068855_100955485 | |||
| 1638 | Ga0068855_101040517 | |||
| 1639 | Ga0068855_101122042 | |||
| 1640 | Ga0070664_100000740 | |||
| 1641 | Ga0070664_100699940 | |||
| 1642 | Ga0070664_100711765 | |||
| 1643 | Ga0068857_100000267 | |||
| 1644 | Ga0068857_100002375 | |||
| 1645 | Ga0068857_100100451 | |||
| 1646 | Ga0068857_100478199 | |||
| 1647 | Ga0068857_100718617 | |||
| 1648 | Ga0068857_100769593 | |||
| 1649 | Ga0068857_101119497 | |||
| 1650 | Ga0068854_100000075 | |||
| 1651 | Ga0068854_100023364 | |||
| 1652 | Ga0068854_100162470 | |||
| 1653 | Ga0068854_100338409 | |||
| 1654 | Ga0068856_100000269 | |||
| 1655 | Ga0068856_100002494 | |||
| 1656 | Ga0068856_100005791 | |||
| 1657 | Ga0068856_100043287 | |||
| 1658 | Ga0068856_100051572 | |||
| 1659 | Ga0068856_100121153 | |||
| 1660 | Ga0068856_100133325 | |||
| 1661 | Ga0068856_100209044 | |||
| 1662 | Ga0068856_100209101 | |||
| 1663 | Ga0068856_100315781 | |||
| 1664 | Ga0068856_100810903 | |||
| 1665 | Ga0068856_100842084 | |||
| 1666 | Ga0070702_100001604 | |||
| 1667 | Ga0070702_100359896 | |||
| 1668 | Ga0070702_100376419 | |||
| 1669 | Ga0068852_100025621 | |||
| 1670 | Ga0068852_100116269 | |||
| 1671 | Ga0068852_100318991 | |||
| 1672 | Ga0068859_100000431 | |||
| 1673 | Ga0068859_100055276 | |||
| 1674 | Ga0068859_100157039 | |||
| 1675 | Ga0068859_100584780 | |||
| 1676 | Ga0068864_100036410 | |||
| 1677 | Ga0068864_100061894 | |||
| 1678 | Ga0068866_10064075 | |||
| 1679 | Ga0068866_10106189 | |||
| 1680 | Ga0068861_100058704 | |||
| 1681 | Ga0068861_100808501 | |||
| 1682 | Ga0068851_10021663 | |||
| 1683 | Ga0068851_10071374 | |||
| 1684 | Ga0068851_10304219 | |||
| 1685 | Ga0068870_10003679 | |||
| 1686 | Ga0068870_10006265 | |||
| 1687 | Ga0068863_100013702 | |||
| 1688 | Ga0068863_100033779 | |||
| 1689 | Ga0068863_100068166 | |||
| 1690 | Ga0068863_100418270 | |||
| 1691 | Ga0068858_100000940 | |||
| 1692 | Ga0068858_100001833 | |||
| 1693 | Ga0068858_100022771 | |||
| 1694 | Ga0068858_100096556 | |||
| 1695 | Ga0068858_100103209 | |||
| 1696 | Ga0068858_100545820 | |||
| 1697 | Ga0068858_100610848 | |||
| 1698 | Ga0068860_100024142 | |||
| 1699 | Ga0068860_100098924 | |||
| 1700 | Ga0068860_100234677 | |||
| 1701 | Ga0068860_100246000 | |||
| 1702 | Ga0068860_100472801 | |||
| 1703 | Ga0068860_100542714 | |||
| 1704 | Ga0068862_100649853 | |||
| 1705 | Ga0081455_10001388 | |||
| 1706 | Ga0081455_10203612 | |||
| 1707 | Ga0081540_1062392 | |||
| 1708 | Ga0081539_10000728 | |||
| 1709 | Ga0081539_10060584 | |||
| 1710 | Ga0070717_10004198 | |||
| 1711 | Ga0070717_10057313 | |||
| 1712 | Ga0070717_10259897 | |||
| 1713 | Ga0070717_10382357 | |||
| 1714 | Ga0075363_100147428 | |||
| 1715 | Ga0075432_10007225 | |||
| 1716 | Ga0070715_10118853 | |||
| 1717 | Ga0070716_100006307 | |||
| 1718 | Ga0070716_100006656 | |||
| 1719 | Ga0070716_100029593 | |||
| 1720 | Ga0070716_100033701 | |||
| 1721 | Ga0070716_100135199 | |||
| 1722 | Ga0070716_100140547 | |||
| 1723 | Ga0070716_100284246 | |||
| 1724 | Ga0070716_100350276 | |||
| 1725 | Ga0070712_100000211 | |||
| 1726 | Ga0070712_100042436 | |||
| 1727 | Ga0070712_100494881 | |||
| 1728 | Ga0070712_100527016 | |||
| 1729 | Ga0070712_100872214 | |||
| 1730 | Ga0075427_10005714 | |||
| 1731 | Ga0097621_100000044 | |||
| 1732 | Ga0097621_100000545 | |||
| 1733 | Ga0097621_100011159 | |||
| 1734 | Ga0097621_100024996 | |||
| 1735 | Ga0097621_100118923 | |||
| 1736 | Ga0097621_100424482 | |||
| 1737 | Ga0068871_100000175 | |||
| 1738 | Ga0068871_100010478 | |||
| 1739 | Ga0068871_100020452 | |||
| 1740 | Ga0068871_100042533 | |||
| 1741 | Ga0068871_100102587 | |||
| 1742 | Ga0068871_100167115 | |||
| 1743 | Ga0068871_100326711 | |||
| 1744 | Ga0075428_100067910 | |||
| 1745 | Ga0075428_100343300 | |||
| 1746 | Ga0075428_100361528 | |||
| 1747 | Ga0075428_101469511 | |||
| 1748 | Ga0075430_100010696 | |||
| 1749 | Ga0075430_100082297 | |||
| 1750 | Ga0075430_100209261 | |||
| 1751 | Ga0075431_100012237 | |||
| 1752 | Ga0075433_10005361 | |||
| 1753 | Ga0075433_10007214 | |||
| 1754 | Ga0075433_10009062 | |||
| 1755 | Ga0075433_10014696 | |||
| 1756 | Ga0075433_10084262 | |||
| 1757 | Ga0075433_10378965 | |||
| 1758 | Ga0075433_10562884 | |||
| 1759 | Ga0075433_10849391 | |||
| 1760 | Ga0075434_100000076 | |||
| 1761 | Ga0075434_100002914 | |||
| 1762 | Ga0075434_100010261 | |||
| 1763 | Ga0075434_100026121 | |||
| 1764 | Ga0075434_100223706 | |||
| 1765 | Ga0075429_100113808 | |||
| 1766 | Ga0075429_100706356 | |||
| 1767 | Ga0068865_100016118 | |||
| 1768 | Ga0068865_100018173 | |||
| 1769 | Ga0068865_100025186 | |||
| 1770 | Ga0068865_100068742 | |||
| 1771 | Ga0068865_100367576 | |||
| 1772 | Ga0075436_100011662 | |||
| 1773 | Ga0075436_100018962 | |||
| 1774 | Ga0075436_100219020 | |||
| 1775 | Ga0097620_100000431 | |||
| 1776 | Ga0097620_100055276 | |||
| 1777 | Ga0097620_100157038 | |||
| 1778 | Ga0097620_100584816 | |||
| 1779 | Ga0075435_100000055 | |||
| 1780 | Ga0075435_100002266 | |||
| 1781 | Ga0075435_100015080 | |||
| 1782 | Ga0075435_100054000 | |||
| 1783 | Ga0075435_100224416 | |||
| 1784 | Ga0075435_100290953 | |||
| 1785 | Ga0099795_10056398 | |||
| 1786 | Ga0105251_10035129 | |||
| 1787 | Ga0105250_10000276 | |||
| 1788 | Ga0105250_10150537 | |||
| 1789 | Ga0105240_10002515 | |||
| 1790 | Ga0105240_10004363 | |||
| 1791 | Ga0105240_10005521 | |||
| 1792 | Ga0105240_10015602 | |||
| 1793 | Ga0105240_10052579 | |||
| 1794 | Ga0105240_10242923 | |||
| 1795 | Ga0105240_10374277 | |||
| 1796 | Ga0111539_10011786 | |||
| 1797 | Ga0111539_10073664 | |||
| 1798 | Ga0111539_10159322 | |||
| 1799 | Ga0111539_10502042 | |||
| 1800 | Ga0111539_11428068 | |||
| 1801 | Ga0111539_11919754 | |||
| 1802 | Ga0105245_10014641 | |||
| 1803 | Ga0105245_10083561 | |||
| 1804 | Ga0105245_10107957 | |||
| 1805 | Ga0105245_10232265 | |||
| 1806 | Ga0105245_10587053 | |||
| 1807 | Ga0105245_11127801 | |||
| 1808 | Ga0105247_10022834 | |||
| 1809 | Ga0105247_10689915 | |||
| 1810 | Ga0114129_10008318 | |||
| 1811 | Ga0114129_10014422 | |||
| 1812 | Ga0114129_10022610 | |||
| 1813 | Ga0114129_10053713 | |||
| 1814 | Ga0114129_10682864 | |||
| 1815 | Ga0114129_10722887 | |||
| 1816 | Ga0114129_11199592 | |||
| 1817 | Ga0105243_10028281 | |||
| 1818 | Ga0105243_10296176 | |||
| 1819 | Ga0105243_10886705 | |||
| 1820 | Ga0105241_10001816 | |||
| 1821 | Ga0105241_10062941 | |||
| 1822 | Ga0105241_10125023 | |||
| 1823 | Ga0105241_10175659 | |||
| 1824 | Ga0105241_10282878 | |||
| 1825 | Ga0105241_10778889 | |||
| 1826 | Ga0105241_11065676 | |||
| 1827 | Ga0105242_10127676 | |||
| 1828 | Ga0105242_10134819 | |||
| 1829 | Ga0105248_10007656 | |||
| 1830 | Ga0105248_10009203 | |||
| 1831 | Ga0105248_10074104 | |||
| 1832 | Ga0105248_10156053 | |||
| 1833 | Ga0105237_10004117 | |||
| 1834 | Ga0105237_10011074 | |||
| 1835 | Ga0105237_10038679 | |||
| 1836 | Ga0105237_10091507 | |||
| 1837 | Ga0105237_10477911 | |||
| 1838 | Ga0105237_10491205 | |||
| 1839 | Ga0105238_10000743 | |||
| 1840 | Ga0105238_10061647 | |||
| 1841 | Ga0105238_10132351 | |||
| 1842 | Ga0105238_10186504 | |||
| 1843 | Ga0105249_10108111 | |||
| 1844 | Ga0105249_10217481 | |||
| 1845 | Ga0105249_10474072 | |||
| 1846 | Ga0099796_10000882 | |||
| 1847 | Ga0105239_10079926 | |||
| 1848 | Ga0105239_10094834 | |||
| 1849 | Ga0105239_10201493 | |||
| 1850 | Ga0105239_10474814 | |||
| 1851 | Ga0105239_10608917 | |||
| 1852 | Ga0105239_10828913 | |||
| 1853 | Ga0105246_10238949 | |||
| 1854 | Ga0105246_10242737 | |||
| 1855 | Ga0157337_1000372 | |||
| 1856 | Ga0157373_10005308 | |||
| 1857 | Ga0157373_10063488 | |||
| 1858 | Ga0157371_10007963 | |||
| 1859 | Ga0157371_10014239 | |||
| 1860 | Ga0157371_10193238 | |||
| 1861 | Ga0157371_10249094 | |||
| 1862 | Ga0157371_10413811 | |||
| 1863 | Ga0157371_10608664 | |||
| 1864 | Ga0157370_10254749 | |||
| 1865 | Ga0157370_10298999 | |||
| 1866 | Ga0157370_10541587 | |||
| 1867 | Ga0157370_10826117 | |||
| 1868 | Ga0157369_10000231 | |||
| 1869 | Ga0157369_10000319 | |||
| 1870 | Ga0157369_10005543 | |||
| 1871 | Ga0157369_10120102 | |||
| 1872 | Ga0157369_10265990 | |||
| 1873 | Ga0157369_10268297 | |||
| 1874 | Ga0157369_10914059 | |||
| 1875 | Ga0157369_10916146 | |||
| 1876 | Ga0157369_11118949 | |||
| 1877 | Ga0157374_10000299 | |||
| 1878 | Ga0157374_10000756 | |||
| 1879 | Ga0157374_10001394 | |||
| 1880 | Ga0157374_10010350 | |||
| 1881 | Ga0157374_10023781 | |||
| 1882 | Ga0157374_10039002 | |||
| 1883 | Ga0157374_10053108 | |||
| 1884 | Ga0157374_10102210 | |||
| 1885 | Ga0157374_10174393 | |||
| 1886 | Ga0157374_10208177 | |||
| 1887 | Ga0157378_10000073 | |||
| 1888 | Ga0157378_10000222 | |||
| 1889 | Ga0157378_10004962 | |||
| 1890 | Ga0157378_10007445 | |||
| 1891 | Ga0157378_10045793 | |||
| 1892 | Ga0157378_10284800 | |||
| 1893 | Ga0163162_10129426 | |||
| 1894 | Ga0163162_10169897 | |||
| 1895 | Ga0163162_10461584 | |||
| 1896 | Ga0163162_10997910 | |||
| 1897 | Ga0163162_11205135 | |||
| 1898 | Ga0157372_10000559 | |||
| 1899 | Ga0157372_10002399 | |||
| 1900 | Ga0157372_10003262 | |||
| 1901 | Ga0157372_10007072 | |||
| 1902 | Ga0157372_10013225 | |||
| 1903 | Ga0157372_10045174 | |||
| 1904 | Ga0157372_10056971 | |||
| 1905 | Ga0157372_10087452 | |||
| 1906 | Ga0157372_10089704 | |||
| 1907 | Ga0157372_10125545 | |||
| 1908 | Ga0157372_10203409 | |||
| 1909 | Ga0157372_10416566 | |||
| 1910 | Ga0157372_10521870 | |||
| 1911 | Ga0157372_10565792 | |||
| 1912 | Ga0157372_10731665 | |||
| 1913 | Ga0157372_11601033 | |||
| 1914 | Ga0157375_10041855 | |||
| 1915 | Ga0157375_10232117 | |||
| 1916 | Ga0157375_10257143 | |||
| 1917 | Ga0157375_10477922 | |||
| 1918 | Ga0157375_10926379 | |||
| 1919 | Ga0163163_10013371 | |||
| 1920 | Ga0163163_10019682 | |||
| 1921 | Ga0163163_10021989 | |||
| 1922 | Ga0163163_10030798 | |||
| 1923 | Ga0163163_10032156 | |||
| 1924 | Ga0163163_10041561 | |||
| 1925 | Ga0163163_10148927 | |||
| 1926 | Ga0163163_10748137 | |||
| 1927 | Ga0163163_10818416 | |||
| 1928 | Ga0163163_10903667 | |||
| 1929 | Ga0157380_10366117 | |||
| 1930 | Ga0182008_10007425 | |||
| 1931 | Ga0182008_10016242 | |||
| 1932 | Ga0157377_10002869 | |||
| 1933 | Ga0157379_10000101 | |||
| 1934 | Ga0157379_10001379 | |||
| 1935 | Ga0157379_10741705 | |||
| 1936 | Ga0157376_10006528 | |||
| 1937 | Ga0157376_10008992 | |||
| 1938 | Ga0157376_10011649 | |||
| 1939 | Ga0157376_10383636 | |||
| 1940 | Ga0157376_10506457 | |||
| 1941 | Ga0182006_1084453 | |||
| 1942 | Ga0182007_10000052 | |||
| 1943 | Ga0182007_10002110 | |||
| 1944 | Ga0182005_1000929 | |||
| 1945 | Ga0163161_10012859 | |||
| 1946 | Ga0163161_10128033 | |||
| 1947 | Ga0163161_10848801 | |||
| 1948 | Ga0206352_10404164 | |||
| 1949 | Ga0213872_10001314 | |||
| 1950 | Ga0213872_10006401 | |||
| 1951 | Ga0213872_10138644 | |||
| 1952 | Ga0213874_10020175 | |||
| 1953 | Ga0213871_10002272 | |||
| 1954 | Ga0224572_1003411 | |||
| 1955 | Ga0228598_1000137 | |||
| 1956 | Ga0207656_10022091 | |||
| 1957 | Ga0207656_10318419 | |||
| 1958 | Ga0207696_1085302 | |||
| 1959 | Ga0207682_10017839 | |||
| 1960 | Ga0207692_10001224 | |||
| 1961 | Ga0207710_10062652 | |||
| 1962 | Ga0207647_10002035 | |||
| 1963 | Ga0207647_10012919 | |||
| 1964 | Ga0207647_10108859 | |||
| 1965 | Ga0207685_10095995 | |||
| 1966 | Ga0207685_10472403 | |||
| 1967 | Ga0207699_10003962 | |||
| 1968 | Ga0207699_10040002 | |||
| 1969 | Ga0207699_10139497 | |||
| 1970 | Ga0207699_10159785 | |||
| 1971 | Ga0207699_10198383 | |||
| 1972 | Ga0207699_10348067 | |||
| 1973 | Ga0207645_10000450 | |||
| 1974 | Ga0207643_10004594 | |||
| 1975 | Ga0207705_10229697 | |||
| 1976 | Ga0207705_10403214 | |||
| 1977 | Ga0207684_10001079 | |||
| 1978 | Ga0207684_10010310 | |||
| 1979 | Ga0207684_10012423 | |||
| 1980 | Ga0207684_10013493 | |||
| 1981 | Ga0207654_10052893 | |||
| 1982 | Ga0207654_10139415 | |||
| 1983 | Ga0207654_10440806 | |||
| 1984 | Ga0207707_10002539 | |||
| 1985 | Ga0207707_10013653 | |||
| 1986 | Ga0207707_10064089 | |||
| 1987 | Ga0207707_10070264 | |||
| 1988 | Ga0207707_10071238 | |||
| 1989 | Ga0207707_10152475 | |||
| 1990 | Ga0207707_10203714 | |||
| 1991 | Ga0207707_10233033 | |||
| 1992 | Ga0207695_10004398 | |||
| 1993 | Ga0207695_10032088 | |||
| 1994 | Ga0207695_10161833 | |||
| 1995 | Ga0207671_10069552 | |||
| 1996 | Ga0207671_10128514 | |||
| 1997 | Ga0207693_10005542 | |||
| 1998 | Ga0207693_10110600 | |||
| 1999 | Ga0207693_10336439 | |||
| 2000 | Ga0207693_10823710 | |||
| 2001 | Ga0207663_10101481 | |||
| 2002 | Ga0207663_10308608 | |||
| 2003 | Ga0207660_10207138 | |||
| 2004 | Ga0207660_10513643 | |||
| 2005 | Ga0207662_10007359 | |||
| 2006 | Ga0207657_10000382 | |||
| 2007 | Ga0207657_10000415 | |||
| 2008 | Ga0207657_10001641 | |||
| 2009 | Ga0207649_10000699 | |||
| 2010 | Ga0207652_10020296 | |||
| 2011 | Ga0207652_10064861 | |||
| 2012 | Ga0207652_10123801 | |||
| 2013 | Ga0207652_10382380 | |||
| 2014 | Ga0207652_10724602 | |||
| 2015 | Ga0207646_10002735 | |||
| 2016 | Ga0207646_10012699 | |||
| 2017 | Ga0207646_10024477 | |||
| 2018 | Ga0207646_10029066 | |||
| 2019 | Ga0207646_10033309 | |||
| 2020 | Ga0207646_10034593 | |||
| 2021 | Ga0207646_10167091 | |||
| 2022 | Ga0207646_10180106 | |||
| 2023 | Ga0207646_10217579 | |||
| 2024 | Ga0207646_10678359 | |||
| 2025 | Ga0207646_10854335 | |||
| 2026 | Ga0207681_10111139 | |||
| 2027 | Ga0207694_10000619 | |||
| 2028 | Ga0207694_10125933 | |||
| 2029 | Ga0207694_10271336 | |||
| 2030 | Ga0207650_10000124 | |||
| 2031 | Ga0207650_10001441 | |||
| 2032 | Ga0207650_10375377 | |||
| 2033 | Ga0207650_10780621 | |||
| 2034 | Ga0207659_10050898 | |||
| 2035 | Ga0207687_10048962 | |||
| 2036 | Ga0207687_10055498 | |||
| 2037 | Ga0207687_10149936 | |||
| 2038 | Ga0207700_10000018 | |||
| 2039 | Ga0207700_10011398 | |||
| 2040 | Ga0207700_10027688 | |||
| 2041 | Ga0207700_10049703 | |||
| 2042 | Ga0207700_10103759 | |||
| 2043 | Ga0207700_10122191 | |||
| 2044 | Ga0207700_10226461 | |||
| 2045 | Ga0207700_10345694 | |||
| 2046 | Ga0207700_10432839 | |||
| 2047 | Ga0207700_10454848 | |||
| 2048 | Ga0207700_10702627 | |||
| 2049 | Ga0207700_11024353 | |||
| 2050 | Ga0207664_10069992 | |||
| 2051 | Ga0207664_10115104 | |||
| 2052 | Ga0207664_10140066 | |||
| 2053 | Ga0207664_10148805 | |||
| 2054 | Ga0207664_10232467 | |||
| 2055 | Ga0207664_10476152 | |||
| 2056 | Ga0207664_10524978 | |||
| 2057 | Ga0207664_10888488 | |||
| 2058 | Ga0207644_10023204 | |||
| 2059 | Ga0207644_10907556 | |||
| 2060 | Ga0207690_10001363 | |||
| 2061 | Ga0207690_10225438 | |||
| 2062 | Ga0207690_10625897 | |||
| 2063 | Ga0207706_10014430 | |||
| 2064 | Ga0207706_10022635 | |||
| 2065 | Ga0207706_10192323 | |||
| 2066 | Ga0207686_10087581 | |||
| 2067 | Ga0207686_10091032 | |||
| 2068 | Ga0207686_10135908 | |||
| 2069 | Ga0207709_10037794 | |||
| 2070 | Ga0207709_10371632 | |||
| 2071 | Ga0207709_10648904 | |||
| 2072 | Ga0207670_10022198 | |||
| 2073 | Ga0207670_10756374 | |||
| 2074 | Ga0207669_10005789 | |||
| 2075 | Ga0207669_10269596 | |||
| 2076 | Ga0207669_10431912 | |||
| 2077 | Ga0207704_10009764 | |||
| 2078 | Ga0207704_10011932 | |||
| 2079 | Ga0207704_10034228 | |||
| 2080 | Ga0207704_10183487 | |||
| 2081 | Ga0207665_10003883 | |||
| 2082 | Ga0207665_10007183 | |||
| 2083 | Ga0207665_10021074 | |||
| 2084 | Ga0207665_10053921 | |||
| 2085 | Ga0207665_10127526 | |||
| 2086 | Ga0207665_10252570 | |||
| 2087 | Ga0207665_10400930 | |||
| 2088 | Ga0207665_10721767 | |||
| 2089 | Ga0207691_10024609 | |||
| 2090 | Ga0207691_10183581 | |||
| 2091 | Ga0207691_10872706 | |||
| 2092 | Ga0207711_10018438 | |||
| 2093 | Ga0207711_10021441 | |||
| 2094 | Ga0207711_10259890 | |||
| 2095 | Ga0207711_10302816 | |||
| 2096 | Ga0207689_10000658 | |||
| 2097 | Ga0207689_10020015 | |||
| 2098 | Ga0207689_10302529 | |||
| 2099 | Ga0207661_10004224 | |||
| 2100 | Ga0207661_10044824 | |||
| 2101 | Ga0207661_10051620 | |||
| 2102 | Ga0207661_10108398 | |||
| 2103 | Ga0207661_10123392 | |||
| 2104 | Ga0207661_10307928 | |||
| 2105 | Ga0207661_10359586 | |||
| 2106 | Ga0207661_10390788 | |||
| 2107 | Ga0207661_10627881 | |||
| 2108 | Ga0207661_11128906 | |||
| 2109 | Ga0207679_10000216 | |||
| 2110 | Ga0207679_10024128 | |||
| 2111 | Ga0207679_10616660 | |||
| 2112 | Ga0207679_11034804 | |||
| 2113 | Ga0207667_10001480 | |||
| 2114 | Ga0207667_10012373 | |||
| 2115 | Ga0207667_10017951 | |||
| 2116 | Ga0207667_10121696 | |||
| 2117 | Ga0207667_10181876 | |||
| 2118 | Ga0207667_10283703 | |||
| 2119 | Ga0207667_10310520 | |||
| 2120 | Ga0207667_11310910 | |||
| 2121 | Ga0207651_10072509 | |||
| 2122 | Ga0207651_10173897 | |||
| 2123 | Ga0207712_10176532 | |||
| 2124 | Ga0207712_10267624 | |||
| 2125 | Ga0207668_10049551 | |||
| 2126 | Ga0207668_10092587 | |||
| 2127 | Ga0207640_10000034 | |||
| 2128 | Ga0207640_10077122 | |||
| 2129 | Ga0207640_10137112 | |||
| 2130 | Ga0207640_10542183 | |||
| 2131 | Ga0207658_10004844 | |||
| 2132 | Ga0207658_10022794 | |||
| 2133 | Ga0207658_10025681 | |||
| 2134 | Ga0207658_10025899 | |||
| 2135 | Ga0207658_10129938 | |||
| 2136 | Ga0207658_10186552 | |||
| 2137 | Ga0207658_10299831 | |||
| 2138 | Ga0207677_10018913 | |||
| 2139 | Ga0207677_10037178 | |||
| 2140 | Ga0207677_10043135 | |||
| 2141 | Ga0207677_10048788 | |||
| 2142 | Ga0207677_10138193 | |||
| 2143 | Ga0207677_10270127 | |||
| 2144 | Ga0207703_10003557 | |||
| 2145 | Ga0207703_10017369 | |||
| 2146 | Ga0207703_10027593 | |||
| 2147 | Ga0207703_10152655 | |||
| 2148 | Ga0207639_10000035 | |||
| 2149 | Ga0207639_10005433 | |||
| 2150 | Ga0207639_10031575 | |||
| 2151 | Ga0207678_10021692 | |||
| 2152 | Ga0207678_10029209 | |||
| 2153 | Ga0207678_10839659 | |||
| 2154 | Ga0207708_10072956 | |||
| 2155 | Ga0207702_10000304 | |||
| 2156 | Ga0207702_10009861 | |||
| 2157 | Ga0207702_10018049 | |||
| 2158 | Ga0207702_10022299 | |||
| 2159 | Ga0207702_10025028 | |||
| 2160 | Ga0207702_10033348 | |||
| 2161 | Ga0207702_10072312 | |||
| 2162 | Ga0207702_10235014 | |||
| 2163 | Ga0207702_10428396 | |||
| 2164 | Ga0207702_10433799 | |||
| 2165 | Ga0207641_10000006 | |||
| 2166 | Ga0207641_10007266 | |||
| 2167 | Ga0207641_10094843 | |||
| 2168 | Ga0207641_10158423 | |||
| 2169 | Ga0207641_10206571 | |||
| 2170 | Ga0207641_11012705 | |||
| 2171 | Ga0207648_10003409 | |||
| 2172 | Ga0207648_10007481 | |||
| 2173 | Ga0207648_10125908 | |||
| 2174 | Ga0207648_10887050 | |||
| 2175 | Ga0207676_10000272 | |||
| 2176 | Ga0207676_10070879 | |||
| 2177 | Ga0207676_10087256 | |||
| 2178 | Ga0207676_10469151 | |||
| 2179 | Ga0207674_10001455 | |||
| 2180 | Ga0207674_10003186 | |||
| 2181 | Ga0207674_10004925 | |||
| 2182 | Ga0207674_10010900 | |||
| 2183 | Ga0207674_10095120 | |||
| 2184 | Ga0207674_10116424 | |||
| 2185 | Ga0207674_10622401 | |||
| 2186 | Ga0207674_10738819 | |||
| 2187 | Ga0207675_100005242 | |||
| 2188 | Ga0207675_100585893 | |||
| 2189 | Ga0207683_10000615 | |||
| 2190 | Ga0207683_10065128 | |||
| 2191 | Ga0207683_10189811 | |||
| 2192 | Ga0207698_10171351 | |||
| 2193 | Ga0207698_10467828 | |||
| 2194 | Ga0207698_10498026 | |||
| 2195 | Ga0207698_10943471 | |||
| 2196 | Ga0207698_10945433 | |||
| 2197 | Ga0209371_1000240 | |||
| 2198 | Ga0209966_1062939 | |||
| 2199 | Ga0207428_10200109 | |||
| 2200 | Ga0268266_10051953 | |||
| 2201 | Ga0268266_10053029 | |||
| 2202 | Ga0268266_10630264 | |||
| 2203 | Ga0268265_10040311 | |||
| 2204 | Ga0268265_10201159 | |||
| 2205 | Ga0268265_10258448 | |||
| 2206 | Ga0268265_11089447 | |||
| 2207 | Ga0268264_10017468 | |||
| 2208 | Ga0268264_10021798 | |||
| 2209 | Ga0268264_10338473 | |||
| 2210 | Ga0268264_10344003 | |||
| 2211 | Ga0265326_10026747 | |||
| 2212 | Ga0265334_10012454 | |||
| 2213 | Ga0265334_10022745 | |||
| 2214 | Ga0265338_10010744 | |||
| 2215 | Ga0265338_10021845 | |||
| 2216 | Ga0265338_10052282 | |||
| 2217 | Ga0265338_10055590 | |||
| 2218 | Ga0265338_10211636 | |||
| 2219 | Ga0265338_10213479 | |||
| 2220 | Ga0265324_10060812 | |||
| 2221 | Ga0268256_1001896 | |||
| 2222 | Ga0265762_1011440 | |||
| 2223 | Ga0265762_1027034 | |||
| 2224 | Ga0265770_1001601 | |||
| 2225 | Ga0265770_1046539 | |||
| 2226 | Ga0265765_1016810 | |||
| 2227 | Ga0265773_1007224 | |||
| 2228 | Ga0265760_10000795 | |||
| 2229 | Ga0265760_10001799 | |||
| 2230 | Ga0265760_10011756 | |||
| 2231 | Ga0265760_10011874 | |||
| 2232 | Ga0265330_10084043 | |||
| 2233 | Ga0265320_10347591 | |||
| 2234 | Ga0265325_10223412 | |||
| 2235 | Ga0265325_10268794 | |||
| 2236 | Ga0265340_10041870 | |||
| 2237 | Ga0265340_10235277 | |||
| 2238 | Ga0265340_10264904 | |||
| 2239 | Ga0265339_10091931 | |||
| 2240 | Ga0265339_10101501 | |||
| 2241 | Ga0265331_10012775 | |||
| 2242 | Ga0265331_10041416 | |||
| 2243 | Ga0265316_10098825 | |||
| 2244 | Ga0265316_10557629 | |||
| 2245 | Ga0307408_100000574 | |||
| 2246 | Ga0307408_100000699 | |||
| 2247 | Ga0307408_100005138 | |||
| 2248 | Ga0307408_100375634 | |||
| 2249 | Ga0307408_100494051 | |||
| 2250 | Ga0307408_100809849 | |||
| 2251 | Ga0265313_10001496 | |||
| 2252 | Ga0316575_10027814 | |||
| 2253 | Ga0316575_10041239 | |||
| 2254 | Ga0316575_10089686 | |||
| 2255 | Ga0316579_10000419 | |||
| 2256 | Ga0316579_10023436 | |||
| 2257 | Ga0316579_10045687 | |||
| 2258 | Ga0316579_10050163 | |||
| 2259 | Ga0265314_10020480 | |||
| 2260 | Ga0265314_10238068 | |||
| 2261 | Ga0265314_10415021 | |||
| 2262 | Ga0265342_10045203 | |||
| 2263 | Ga0265342_10089228 | |||
| 2264 | Ga0316576_10005266 | |||
| 2265 | Ga0316576_10014612 | |||
| 2266 | Ga0316576_10024892 | |||
| 2267 | Ga0316576_10056624 | |||
| 2268 | Ga0316576_10066163 | |||
| 2269 | Ga0316576_10071666 | |||
| 2270 | Ga0316576_10077929 | |||
| 2271 | Ga0316576_10122128 | |||
| 2272 | Ga0316576_10153473 | |||
| 2273 | Ga0316576_10408788 | |||
| 2274 | Ga0316576_10464450 | |||
| 2275 | Ga0316578_10000029 | |||
| 2276 | Ga0316578_10001182 | |||
| 2277 | Ga0316578_10008525 | |||
| 2278 | Ga0316578_10030141 | |||
| 2279 | Ga0316578_10034019 | |||
| 2280 | Ga0316578_10040101 | |||
| 2281 | Ga0316578_10386482 | |||
| 2282 | Ga0307405_10009176 | |||
| 2283 | Ga0316577_10000654 | |||
| 2284 | Ga0316577_10007154 | |||
| 2285 | Ga0316577_10072353 | |||
| 2286 | Ga0316577_10221345 | |||
| 2287 | Ga0307413_10004045 | |||
| 2288 | Ga0307413_10098524 | |||
| 2289 | Ga0307410_10056743 | |||
| 2290 | Ga0307410_10237307 | |||
| 2291 | Ga0307406_10000834 | |||
| 2292 | Ga0307406_10001613 | |||
| 2293 | Ga0307406_10051619 | |||
| 2294 | Ga0307407_10019613 | |||
| 2295 | Ga0307407_10054721 | |||
| 2296 | Ga0307412_10007134 | |||
| 2297 | Ga0307412_10141786 | |||
| 2298 | Ga0307409_100020780 | |||
| 2299 | Ga0307409_100037629 | |||
| 2300 | Ga0307409_100050989 | |||
| 2301 | Ga0307409_100071410 | |||
| 2302 | Ga0307416_100004997 | |||
| 2303 | Ga0307416_100094583 | |||
| 2304 | Ga0307416_100206427 | |||
| 2305 | Ga0307416_101017329 | |||
| 2306 | Ga0307414_10046397 | |||
| 2307 | Ga0307414_10052683 | |||
| 2308 | Ga0307411_10010295 | |||
| 2309 | Ga0307411_10014780 | |||
| 2310 | Ga0307415_100023061 | |||
| 2311 | Ga0307415_100108044 | |||
| 2312 | Ga0307415_100135844 | |||
| 2313 | Ga0307415_100354518 | |||
| 2314 | Ga0316583_10000401 | |||
| 2315 | Ga0316583_10005061 | |||
| 2316 | Ga0316583_10051643 | |||
| 2317 | Ga0316583_10055533 | |||
| 2318 | Ga0316585_10000035 | |||
| 2319 | Ga0316585_10006872 | |||
| 2320 | Ga0316585_10015208 | |||
| 2321 | Ga0316585_10015503 | |||
| 2322 | Ga0316585_10078523 | |||
| 2323 | Ga0316585_10165644 | |||
| 2324 | Ga0316580_10000418 | |||
| 2325 | Ga0316580_10005792 | |||
| 2326 | Ga0316580_10013725 | |||
| 2327 | Ga0316580_10025218 | |||
| 2328 | Ga0316580_10056608 | |||
| 2329 | Ga0316593_10026263 | |||
| 2330 | Ga0316593_10149847 | |||
| 2331 | Ga0307510_10019078 | |||
| 2332 | Ga0316592_1003590 | |||
| 2333 | Ga0316592_1004978 | |||
| 2334 | Ga0316592_1020463 | |||
| 2335 | Ga0316592_1044763 | |||
| 2336 | Ga0316588_1000275 | |||
| 2337 | Ga0316588_1003220 | |||
| 2338 | Ga0316588_1021963 | |||
| 2339 | Ga0316587_1037230 | |||
| 2340 | Ga0316596_1001497 | |||
| 2341 | Ga0316596_1008590 | |||
| 2342 | Ga0316596_1023278 | |||
| 2343 | Ga0373926_0047187 | |||
| 2344 | Ga0373926_0076003 | |||
| 2345 | Ga0373929_0039763 | |||
| 2346 | Ga0373934_0000404 | |||
| 2347 | Ga0373940_0140212 | |||
| 2348 | Ga0373923_0019471 | |||
| 2349 | Ga0373923_0366681 | |||
| 2350 | Ga0373932_0015112 | |||
| 2351 | Ga0373936_0114343 | |||
| 2352 | Ga0373936_0134352 | |||
| 2353 | Ga0373936_0197426 | |||
| 2354 | Ga0373954_0000224 | |||
| 2355 | Ga0373956_0001105 | |||
| 2356 | Ga0373956_0043221 | |||
| 2357 | Ga0373957_0007746 | |||
| 2358 | Ga0373960_0111502 | |||
| 2359 | Ga0373943_0183863 | |||
| 2360 | Ga0373943_0244295 | |||
| 2361 | Ga0373946_0097826 | |||
| 2362 | Ga0373955_0000521 | |||
| 2363 | Ga0373942_0035037 | |||
| 2364 | Ga0316574_0000298 | |||
| 2365 | Ga0316574_0000526 | |||
| 2366 | Ga0316574_0013680 | |||
| 2367 | Ga0316574_0015936 | |||
| 2368 | Ga0316574_0113732 | |||
| 2369 | Ga0316574_0836351 | |||
| 2370 | Ga0373924_0054965 | |||
| 2371 | Ga0373924_0118153 | |||
| 2372 | Ga0373924_0312387 | |||
| 2373 | Ga0373931_0015181 | |||
| 2374 | Ga0373931_0028076 | |||
| 2375 | Ga0373931_0048522 | |||
| 2376 | Ga0373931_0104755 | |||
| 2377 | Ga0373935_0002526 | |||
| 2378 | Ga0373935_0015252 | |||
| 2379 | Ga0373935_0104703 | |||
| 2380 | Ga0373927_0003380 | |||
| 2381 | Ga0373927_0231770 | |||
| 2382 | Ga0373927_0288792 | |||
| 2383 | Ga0373933_0001196 | |||
| 2384 | Ga0373933_0067405 | |||
| 2385 | Ga0373933_0102230 | |||
| 2386 | Ga0373933_0535502 | |||
| 2387 | Ga0373947_0261201 | |||
| 2388 | Ga0373937_0001689 | |||
| 2389 | Ga0373937_0594156 | |||
| 2390 | Ga0316582_0000066 | |||
| 2391 | Ga0316582_0087534 | |||
| 2392 | Ga0316582_0209809 | |||
| 2393 | Ga0316582_0214810 | |||
| 2394 | Ga0316582_0229238 | |||
| 2395 | Ga0316584_0001073 | |||
| 2396 | Ga0316584_0004102 | |||
| 2397 | Ga0316584_0004310 | |||
| 2398 | Ga0316584_0015740 | |||
| 2399 | Ga0316584_0030122 | |||
| 2400 | Ga0316584_0062237 | |||
| 2401 | Ga0316584_0184223 | |||
| 2402 | Ga0316584_0241221 | |||
| 2403 | Ga0373925_0003562 | |||
| 2404 | Ga0395900_0546088 | |||
| 2405 | Ga0395905_0000293 | |||
| 2406 | Ga0395905_0007654 | |||
| 2407 | Ga0395905_0221986 | |||
| 2408 | Ga0395905_0377044 | |||
| 2409 | Ga0395905_0462105 | |||
| 2410 | Ga0395905_0494261 | |||
| 2411 | Ga0237819_16747 | |||
| 2412 | Ga0400490_57581 | |||
| 2413 | Ga0400485_17163 | |||
| 2414 | Ga0400485_18026 | |||
| 2415 | Ga0400488_50200 | |||
| 2416 | Ga0400486_01662 | |||
| 2417 | Ga0242420_063814 | |||
| 2418 | Ga0400489_14236 | |||
| 2419 | Ga0400489_31446 | |||
| 2420 | Ga0400487_10419 | |||
| 2421 | Ga0400487_17601 | |||
| 2422 | Ga0436365_0001200 | |||
| 2423 | Ga0436365_0261237 | |||
| 2424 | Ga0436365_1454779 | |||
| 2425 | Ga0436365_1685032 | |||
| 2426 | Ga0436360_0369279 | |||
| 2427 | Ga0436360_0932224 | |||
| 2428 | Ga0436361_0175726 | |||
| 2429 | Ga0436361_0823786 | |||
| 2430 | Ga0436361_1034179 | |||
| 2431 | Ga0436363_0533398 | |||
| 2432 | Ga0436363_1569701 | |||
| 2433 | Ga0451797_0453838 | |||
| 2434 | Ga0451833_0076051 | |||
| 2435 | Ga0439446_0093751 | |||
| 2436 | Ga0439435_0113155 | |||
| 2437 | Ga0451577_0009319 | |||
| 2438 | Ga0451577_0115367 | |||
| 2439 | Ga0451577_0177133 | |||
| 2440 | Ga0451577_0494716 | |||
| 2441 | Ga0466969_0067414 | |||
| 2442 | Ga0453683_0000058 | |||
| 2443 | Ga0453683_0024122 | |||
| 2444 | Ga0466966_0012789 | |||
| 2445 | Ga0466963_0013437 | |||
| 2446 | Ga0466963_0166716 | |||
| 2447 | Ga0466963_0167080 | |||
| 2448 | Ga0466963_0258200 | |||
| 2449 | Ga0466963_0299289 | |||
| 2450 | Ga0466963_0342599 | |||
| 2451 | Ga0466963_0456718 | |||
| 2452 | Ga0453684_0014465 | |||
| 2453 | Ga0453684_0206673 | |||
| 2454 | Ga0453684_0881976 | |||
| 2455 | Ga0453684_1215318 | |||
| 2456 | Ga0466971_0088660 | |||
| 2457 | Ga0466957_0179777 | |||
| 2458 | Ga0466957_0190686 | |||
| 2459 | Ga0451576_0021438 | |||
| 2460 | Ga0451576_0678964 | |||
| 2461 | Ga0451576_0724718 | |||
| 2462 | Ga0451576_0754920 | |||
| 2463 | Ga0466958_0409435 | |||
| 2464 | Ga0466967_0206840 | |||
| 2465 | Ga0466967_0280872 | |||
| 2466 | Ga0466967_0593921 | |||
| 2467 | Ga0466967_0888433 | |||
| 2468 | Ga0466967_1205269 | |||
| 2469 | Ga0495592_0237790 | |||
| 2470 | Ga0495603_0005735 | |||
| 2471 | Ga0495638_0005254 | |||
| 2472 | Ga0495638_0393440 | |||
| 2473 | Ga0495641_0013923 | |||
| 2474 | Ga0495580_0005430 | |||
| 2475 | Ga0495580_0006518 | |||
| 2476 | Ga0495580_0011543 | |||
| 2477 | Ga0495580_0029864 | |||
| 2478 | Ga0495580_0037783 | |||
| 2479 | Ga0495580_0066022 | |||
| 2480 | Ga0495580_0076587 | |||
| 2481 | Ga0495580_0109697 | |||
| 2482 | Ga0495580_0196395 | |||
| 2483 | Ga0495580_0292534 | |||
| 2484 | Ga0495580_0476231 | |||
| 2485 | Ga0495582_0000133 | |||
| 2486 | Ga0495605_0049612 | |||
| 2487 | Ga0495639_0037105 | |||
| 2488 | Ga0495585_0058734 | |||
| 2489 | Ga0495585_0230074 | |||
| 2490 | Ga0495594_0027035 | |||
| 2491 | Ga0495594_0065481 | |||
| 2492 | Ga0495583_0019840 | |||
| 2493 | Ga0495610_0010253 | |||
| 2494 | Ga0495631_0005948 | |||
| 2495 | Ga0495631_0018464 | |||
| 2496 | Ga0495644_0000015 | |||
| 2497 | Ga0495652_0118600 | |||
| 2498 | Ga0495665_0029914 | |||
| 2499 | Ga0495640_0082216 | |||
| 2500 | Ga0495586_0021497 | |||
| 2501 | Ga0495587_0002546 | |||
| 2502 | Ga0495609_0011878 | |||
| 2503 | Ga0495609_0030292 | |||
| 2504 | Ga0495645_0116079 | |||
| 2505 | Ga0495633_0032625 | |||
| 2506 | Ga0495633_0204350 | |||
| 2507 | Ga0495656_0029883 | |||
| 2508 | Ga0495668_0040960 | |||
| 2509 | Ga0495611_0029649 | |||
| 2510 | Ga0495625_0011188 | |||
| 2511 | Ga0495625_0399493 | |||
| 2512 | Ga0495635_0089167 | |||
| 2513 | Ga0495623_0037309 | |||
| 2514 | Ga0495623_0209744 | |||
| 2515 | Ga0495623_0313750 | |||
| 2516 | Ga0495646_0019554 | |||
| 2517 | Ga0495669_0002696 | |||
| 2518 | Ga0495669_0025427 | |||
| 2519 | Ga0495669_0183217 | |||
| 2520 | Ga0495669_0370796 | |||
| 2521 | Ga0495613_0023739 | |||
| 2522 | Ga0495613_0126633 | |||
| 2523 | Ga0495671_0193976 | |||
| 2524 | Ga0495589_0104429 | |||
| 2525 | Ga0495600_0157448 | |||
| 2526 | Ga0495660_0021351 | |||
| 2527 | Ga0495581_0047764 | |||
| 2528 | Ga0495604_0000910 | |||
| 2529 | Ga0495674_0144941 | |||
| 2530 | Ga0495672_0056919 | |||
| 2531 | Ga0495683_0082537 | |||
| 2532 | Ga0495679_026130 | |||
| 2533 | Ga0495684_0035045 | |||
| 2534 | Ga0495602_0189038 | |||
| 2535 | Ga0495602_0198103 | |||
| 2536 | Ga0496100_0064043 | |||
| 2537 | Ga0496100_0641350 | |||
| 2538 | Ga0496101_0043147 | |||
| 2539 | Ga0496102_0072345 | |||
| 2540 | Ga0496102_0077132 | |||
| 2541 | Ga0496102_0261235 | |||
| 2542 | Ga0496102_0358807 | |||
| 2543 | Ga0496103_0077440 | |||
| 2544 | Ga0496104_0001058 | |||
| 2545 | Ga0496104_0024241 | |||
| 2546 | Ga0496104_0075030 | |||
| 2547 | Ga0496104_0339093 | |||
| 2548 | Ga0496104_0638341 | |||
| 2549 | Ga0496105_0003561 | |||
| 2550 | Ga0496105_0206590 | |||
| 2551 | Ga0496105_0265445 | |||
| 2552 | Ga0496105_0568666 | |||
| 2553 | Ga0496106_0093047 | |||
| 2554 | Ga0496106_0366767 | |||
| 2555 | Ga0496106_0521550 | |||
| 2556 | Ga0496107_0285074 | |||
| 2557 | Ga0496108_0000319 | |||
| 2558 | Ga0496108_0006344 | |||
| 2559 | Ga0496108_0067945 | |||
| 2560 | Ga0496108_0075338 | |||
| 2561 | Ga0496109_0000157 | |||
| 2562 | Ga0496109_0021538 | |||
| 2563 | Ga0496109_0126078 | |||
| 2564 | Ga0496109_0807817 | |||
| 2565 | Ga0496109_0966009 | |||
| 2566 | Ga0496110_0000078 | |||
| 2567 | Ga0496110_0086271 | |||
| 2568 | Ga0496110_0087724 | |||
| 2569 | Ga0496110_0296498 | |||
| 2570 | Ga0496111_0012083 | |||
| 2571 | Ga0496111_0046600 | |||
| 2572 | Ga0496111_0142210 | |||
| 2573 | Ga0496112_0000038 | |||
| 2574 | Ga0496112_0001454 | |||
| 2575 | Ga0496112_0004466 | |||
| 2576 | Ga0496112_0029489 | |||
| 2577 | Ga0496112_0034173 | |||
| 2578 | Ga0496112_0064541 | |||
| 2579 | Ga0496112_0101555 | |||
| 2580 | Ga0496112_0136804 | |||
| 2581 | Ga0496112_0157921 | |||
| 2582 | Ga0496112_0243771 | |||
| 2583 | Ga0496112_0372889 | |||
| 2584 | Ga0496113_0000064 | |||
| 2585 | Ga0496113_0047461 | |||
| 2586 | Ga0496113_0175273 | |||
| 2587 | Ga0496113_0336997 | |||
| 2588 | Ga0496113_0481639 | |||
| 2589 | Ga0496113_0663823 | |||
| 2590 | Ga0496114_0012085 | |||
| 2591 | Ga0496115_0011441 | |||
| 2592 | Ga0496119_0000174 | |||
| 2593 | Ga0496120_0000253 | |||
| 2594 | Ga0496121_0027466 | |||
| 2595 | Ga0496124_0017271 | |||
| 2596 | Ga0496124_0036238 | |||
| 2597 | Ga0496124_0120096 | |||
| 2598 | Ga0496125_0000162 | |||
| 2599 | Ga0496125_0036192 | |||
| 2600 | Ga0496125_0077270 | |||
| 2601 | Ga0496125_0085531 | |||
| 2602 | Ga0496126_0002736 | |||
| 2603 | Ga0495682_0139668 | |||
| 2604 | Ga0501031_0030121 | |||
| 2605 | Ga0501031_0213124 | |||
| 2606 | Ga0501032_0000973 | |||
| 2607 | Ga0501032_0056886 | |||
| 2608 | Ga0501033_0003887 | |||
| 2609 | Ga0501033_0007719 | |||
| 2610 | Ga0501034_0001689 | |||
| 2611 | Ga0501034_0011024 | |||
| 2612 | Ga0501034_0012650 | |||
| 2613 | Ga0501034_0019726 | |||
| 2614 | Ga0501034_0091902 | |||
| 2615 | Ga0501034_0135309 | |||
| 2616 | Ga0501036_0019750 | |||
| 2617 | Ga0501037_0001543 | |||
| 2618 | Ga0501038_0008430 | |||
| 2619 | Ga0501038_0523743 | |||
| 2620 | Ga0501040_0000116 | |||
| 2621 | Ga0501040_0032079 | |||
| 2622 | Ga0501041_0158617 | |||
| 2623 | Ga0501042_0000125 | |||
| 2624 | Ga0501043_0024168 | |||
| 2625 | Ga0501043_0059054 | |||
| 2626 | Ga0501043_0125116 | |||
| 2627 | Ga0501046_0000731 | |||
| 2628 | Ga0501047_0008742 | |||
| 2629 | Ga0501047_0017626 | |||
| 2630 | Ga0501070_0019673 | |||
| 2631 | Ga0501070_0332844 | |||
| 2632 | Ga0501070_0365838 | |||
| 2633 | Ga0501071_0013601 | |||
| 2634 | Ga0501071_0135171 | |||
| 2635 | Ga0501072_0134318 | |||
| 2636 | Ga0501072_0298175 | |||
| 2637 | Ga0501073_0004858 | |||
| 2638 | Ga0501073_0014887 | |||
| 2639 | Ga0501073_0681251 | |||
| 2640 | Ga0501074_0019539 | |||
| 2641 | Ga0501074_0076371 | |||
| 2642 | Ga0501075_0009859 | |||
| 2643 | Ga0501075_0123385 | |||
| 2644 | Ga0501075_0200012 | |||
| 2645 | Ga0501075_0372846 | |||
| 2646 | Ga0501076_0009934 | |||
| 2647 | Ga0501076_0050250 | |||
| 2648 | Ga0501076_0299932 | |||
| 2649 | Ga0501077_0009941 | |||
| 2650 | Ga0501077_0200337 | |||
| 2651 | Ga0501077_0207376 | |||
| 2652 | Ga0501217_012416 | |||
| 2653 | Ga0501079_0005627 | |||
| 2654 | Ga0501080_0005086 | |||
| 2655 | Ga0501081_0009080 | |||
| 2656 | Ga0501083_0063116 | |||
| 2657 | Ga0501241_016205 | |||
| 2658 | Ga0501035_0003026 | |||
| 2659 | Ga0501035_0007843 | |||
| 2660 | Ga0501035_0122226 | |||
| 2661 | Ga0501035_0172256 | |||
| 2662 | Ga0501035_0434594 | |||
| 2663 | Ga0501044_0001659 | |||
| 2664 | Ga0501044_0016221 | |||
| 2665 | Ga0501044_0135913 | |||
| 2666 | Ga0501044_0379651 | |||
| 2667 | Ga0501045_0129350 | |||
| 2668 | Ga0501045_0157116 | |||
| 2669 | nmdc:mga0k408_10493_c2 | |||
| 2670 | nmdc:mga05p37_117993_c1 | |||
| 2671 | nmdc:mga05p37_174464_c1 | |||
| 2672 | nmdc:mga05p37_408391_c1 | |||
| 2673 | nmdc:mga05p37_4404_c1 | |||
| 2674 | nmdc:mga05p37_44905_c1 | |||
| 2675 | nmdc:mga05p37_73073_c1 | |||
| 2676 | nmdc:mga05p37_796518_c1 | |||
| 2677 | nmdc:mga09592_115103_c1 | |||
| 2678 | nmdc:mga09592_405833_c1 | |||
| 2679 | nmdc:mga0qj67_10008_c1 | |||
| 2680 | nmdc:mga0qj67_156136_c1 | |||
| 2681 | nmdc:mga0qj67_72618_c1 | |||
| 2682 | nmdc:mga06r32_171740_c1 | |||
| 2683 | nmdc:mga06r32_718685_c1 | |||
| 2684 | nmdc:mga08y16_1027673_c1 | |||
| 2685 | nmdc:mga08y16_12850_c1 | |||
| 2686 | nmdc:mga08y16_24065_c1 | |||
| 2687 | nmdc:mga0n895_219_c1 | |||
| 2688 | nmdc:mga0n895_22563_c1 | |||
| 2689 | nmdc:mga0n895_256791_c1 | |||
| 2690 | nmdc:mga0n895_500945_c1 | |||
| 2691 | nmdc:mga0n895_525518_c1 | |||
| 2692 | nmdc:mga0n895_60612_c1 | |||
| 2693 | nmdc:mga0n895_819321_c1 | |||
| 2694 | nmdc:mga0n895_890010_c1 | |||
| 2695 | nmdc:mga0rr50_1025591_c1 | |||
| 2696 | nmdc:mga0rr50_15194_c1 | |||
| 2697 | nmdc:mga0rr50_211902_c1 | |||
| 2698 | nmdc:mga0rr50_420274_c1 | |||
| 2699 | nmdc:mga0rr50_5126_c1 | |||
| 2700 | nmdc:mga0rr50_63914_c1 | |||
| 2701 | nmdc:mga08x19_110649_c1 | |||
| 2702 | nmdc:mga08x19_13151_c1 | |||
| 2703 | nmdc:mga08x19_70723_c1 | |||
| 2704 | nmdc:mga0a205_29179_c1 | |||
| 2705 | nmdc:mga0a205_33459_c1 | |||
| 2706 | nmdc:mga0a205_371539_c1 | |||
| 2707 | nmdc:mga0a205_384910_c1 | |||
| 2708 | nmdc:mga0a205_406633_c1 | |||
| 2709 | nmdc:mga0a205_41124_c1 | |||
| 2710 | nmdc:mga0a205_431201_c1 | |||
| 2711 | nmdc:mga0a205_506303_c1 | |||
| 2712 | nmdc:mga0a205_7468_c1 | |||
| 2713 | nmdc:mga0a205_97138_c1 | |||
| 2714 | Ga0495601_0167511 | |||
| 2715 | Ga0495619_0039581 | |||
| 2716 | Ga0500616_0003860 | |||
| 2717 | Ga0500634_0198537 | |||
| 2718 | Ga0501084_0003210 | |||
| 2719 | Ga0501084_0015269 | |||
| 2720 | Ga0501084_0019099 | |||
| 2721 | Ga0501082_0003375 | |||
| 2722 | Ga0501082_0015433 | |||
| 2723 | Ga0501082_0129780 | |||
| 2724 | Ga0466962_0019175 | |||
| 2725 | Ga0530510_0003630 | |||
| 2726 | Ga0530510_0075434 | |||
| 2727 | Ga0530510_0093991 | |||
| 2728 | 2599411864 | |||
| 2729 | 2601524463 | |||
| 2730 | 2601529617 | |||
| 2731 | 2601616451 | |||
| 2732 | 2601621173 | |||
| 2733 | 2601646152 | |||
| 2734 | 2601649570 | |||
| 2735 | 2601654497 | |||
| 2736 | 2601660229 | |||
| 2737 | 2601664266 | |||
| 2738 | 2601699160 | |||
| 2739 | 2601702569 | |||
| 2740 | 2601707241 | |||
| 2741 | 2601712262 | |||
| 2742 | 2601717758 | |||
| 2743 | 2601723072 | |||
| 2744 | 2601727686 | |||
| 2745 | 2601732703 | |||
| 2746 | 2601737528 | |||
| 2747 | 2601741947 | |||
| 2748 | 2601752845 | |||
| 2749 | 2602021807 | |||
| 2750 | 2603662430 | |||
| 2751 | 2603667326 | |||
| 2752 | 2603840112 | |||
| 2753 | 2603845189 | |||
| 2754 | 2603850262 | |||
| 2755 | 2603855330 | |||
| 2756 | 2603868412 | |||
| 2757 | 2603873222 | |||
| 2758 | 2603878137 | |||
| 2759 | 2606050091 | |||
| 2760 | 2606071755 | |||
| 2761 | 2606147774 | |||
| 2762 | 2606178291 | |||
| 2763 | 2621297133 | |||
| 2764 | 2637222992 | |||
| 2765 | 2643818466 | |||
| 2766 | 2643880667 | |||
| 2767 | 2643938393 | |||
| 2768 | 2644079044 | |||
| 2769 | 2644661238 | |||
| 2770 | 2644693821 | |||
| 2771 | 2644699315 | |||
| 2772 | 2676408728 | |||
| 2773 | 2686995266 | |||
| 2774 | 2687234971 | |||
| 2775 | 2738671952 | |||
| 2776 | 2738716207 | |||
| 2777 | 2738750346 | |||
| 2778 | 2738859386 | |||
| 2779 | 2774131164 | |||
| 2780 | 2777021331 | |||
| 2781 | 2817493754 | |||
| 2782 | 2852651852 | |||
| 2783 | 2884218054 | |||
| 2784 | 2904517992 | |||
| 2785 | 2917836436 | |||
| 2786 | 2919126542 | |||
| 2787 | 2919515643 | |||
| 2788 | 2919678359 | |||
| 2789 | 2939623738 | |||
| 2790 | 2941478489 | |||
| 2791 | 2969080019 | |||
| 2792 | 2974302767 | |||
| 2793 | 2984499647 | |||
| 2794 | 2984506893 | |||
| 2795 | 2984562473 | |||
| 2796 | 2984600533 | |||
| 2797 | 3006975070 | |||
| 2798 | 8016731053 | |||
| 2799 | 8055823597 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qur-assembly1.cif.gz_A | mapping the allosteric communication network of aminodeoxychorismate synthase | 0.9358 | 31 | 221 |
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.9294 | 31 | 221 |
| 8hx7-assembly1.cif.gz_A | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9179 | 30 | 218 |
| 8hx6-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae | 0.9176 | 30 | 219 |
| 8hx7-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9146 | 30 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9625 | 31 | 221 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9575 | 31 | 221 | 3.40.50.880 |
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.949 | 31 | 220 | 3.40.50.880 |
| af_K7L2D7_74_267_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9355 | 32 | 221 | 3.40.50.880 |
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9344 | 31 | 220 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L4Y847-F1-model_v4 | Anthranilate synthase component II | 0.9971 | 31 | 114 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A7V1MHK6-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) | 0.9954 | 31 | 146 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A5S9M081-F1-model_v4 | Glutamine amidotransferase domain-containing protein | 0.9932 | 31 | 164 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A351SBL0-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) | 0.9932 | 31 | 129 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A7Y0WXZ1-F1-model_v4 | deleted | 0.9929 | 31 | 125 |
|