F493655

General Info

Members Datasets Scaffolds Average Seq Length
1399 508 2799 193

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100114325|Ga0068860_1001143252
Length 230
Sequence MAWYAKTVKRRSSAGSLRRRYGFGARWNAGHARCVKILAVVFVLDNYDSFTYNLVQYLGELGAKVEVRRNDQVTIEEVERLRPERIVVSPGPCTPQEAGISIELIRHFAGRVPLLGVCLGHQAIGAAFGGSVVRARNLMHGKTSQVQHDGRTIFRGVASPMTATRYHSLIVAEEDLPADLEVTAHTLEKDGTRVIMGLRHRRFPVEGVQFHPESVLTADGKNLVKNFLEQ

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
149 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
150 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
151 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
225 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
242 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
246 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
260 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
261 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
262 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
274 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
278 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
279 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
280 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
283 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
284 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
292 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
297 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
298 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
299 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
300 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
301 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
302 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
303 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
304 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
305 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
306 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
307 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
308 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
309 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
314 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
317 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
318 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
330 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
331 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
332 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
333 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
334 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
335 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
356 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
357 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
403 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
404 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
407 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
408 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
409 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
410 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
411 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
412 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
413 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
414 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
415 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
416 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
419 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
420 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
421 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
422 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
423 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
424 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
425 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
426 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
427 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
428 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
432 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
433 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
436 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
437 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
438 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
439 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
440 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
441 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
442 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
443 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
444 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
445 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
446 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
447 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
448 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
449 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
450 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
451 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
452 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
453 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
454 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
455 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
456 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
457 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
458 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
459 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
460 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
461 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
462 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
463 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
464 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
465 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
466 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
467 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
468 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
469 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
470 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
471 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
472 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
473 2636415599 Klebsiella variicola DX120E Isolate Unclassified
474 2643221559 Lysobacter sp. Root559 Isolate Unclassified
475 2643221573 Lysobacter sp. Root604 Isolate Unclassified
476 2643221586 Lysobacter sp. Root667 Isolate Unclassified
477 2643221612 Lysobacter sp. Root76 Isolate Unclassified
478 2643221720 Lysobacter sp. Root916 Isolate Unclassified
479 2643221727 Lysobacter sp. Root96 Isolate Unclassified
480 2643221728 Lysobacter sp. Root983 Isolate Unclassified
481 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
482 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
483 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
484 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
485 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
486 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
487 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
488 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
489 2775507074 Klebsiella sp. D5A Isolate Unclassified
490 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
491 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
492 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
493 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
494 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
495 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
496 2919513703 Luteimonas sp. 3794 Isolate Unclassified
497 2919675420 Luteimonas terrae 4099 Isolate Unclassified
498 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
499 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
500 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
501 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
502 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
503 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
504 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
505 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
506 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
507 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
508 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 1.72
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 6.65
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100114325 3300005843 Bacteria 2581
2 JGI24752J21851_1000650 3300001976 Bacteria 4633
3 JGI24737J22298_10062562 3300001990 Bacteria 1118
4 JGI24743J22301_10017797 3300001991 Bacteria 1338
5 JGI24735J21928_10031651 3300002067 Bacteria 1568
6 JGI24751J29686_10002240 3300002459 Bacteria 3917
7 JGI25406J46586_10034709 3300003203 Bacteria 1848
8 rootH1_10038406 3300003316 Bacteria 5727
9 rootH1_10038406 3300003323 Bacteria 17804
10 Ga0055526_1024061 3300003771 Bacteria 2007
11 Ga0055537_1000149 3300003773 Bacteria 52269
12 Ga0055536_1035424 3300003781 Bacteria 1248
13 Ga0058692_1011227 3300003856 Bacteria 2176
14 Ga0065712_10009377 3300005290 Bacteria 2551
15 Ga0065712_10078052 3300005290 Bacteria 3401
16 Ga0065707_10103873 3300005295 Bacteria 2725
17 Ga0070658_10061551 3300005327 Bacteria 3058
18 Ga0070658_10239517 3300005327 Bacteria 1537
19 Ga0070658_10259800 3300005327 Bacteria 1475
20 Ga0070658_10314824 3300005327 Bacteria 1336
21 Ga0070676_10102753 3300005328 Bacteria 1768
22 Ga0070676_10233614 3300005328 Bacteria 1220
23 Ga0070683_100005535 3300005329 Bacteria 10553
24 Ga0070683_100011335 3300005329 Bacteria 7700
25 Ga0070683_100072776 3300005329 Bacteria 3209
26 Ga0070683_100194924 3300005329 Bacteria 1924
27 Ga0070683_100256339 3300005329 Bacteria 1664
28 Ga0070683_100376306 3300005329 Bacteria 1353
29 Ga0070683_100540844 3300005329 Bacteria 1114
30 Ga0070690_100002873 3300005330 Bacteria 9292
31 Ga0070690_100015460 3300005330 Bacteria 4553
32 Ga0070690_100055841 3300005330 Bacteria 2530
33 Ga0070690_100081392 3300005330 Bacteria 2119
34 Ga0070670_100001994 3300005331 Bacteria 16695
35 Ga0070670_100085671 3300005331 Bacteria 2707
36 Ga0070670_100324572 3300005331 Bacteria 1349
37 Ga0070670_100668670 3300005331 Bacteria 932
38 Ga0070677_10013893 3300005333 Bacteria 2826
39 Ga0068869_100015244 3300005334 Bacteria 5151
40 Ga0068869_100048422 3300005334 Bacteria 3073
41 Ga0068869_100176047 3300005334 Bacteria 1674
42 Ga0070666_10000661 3300005335 Bacteria 20806
43 Ga0070666_10066656 3300005335 Bacteria 2443
44 Ga0070680_100286675 3300005336 Bacteria 1396
45 Ga0070680_100341735 3300005336 Bacteria 1272
46 Ga0070680_100570007 3300005336 Bacteria 971
47 Ga0070682_100006928 3300005337 Bacteria 6371
48 Ga0070682_100180582 3300005337 Bacteria 1474
49 Ga0070682_100363945 3300005337 Bacteria 1082
50 Ga0068868_100000504 3300005338 Bacteria 26070
51 Ga0068868_100017206 3300005338 Bacteria 5380
52 Ga0068868_100041741 3300005338 Bacteria 3575
53 Ga0068868_100057085 3300005338 Bacteria 3084
54 Ga0068868_100079154 3300005338 Bacteria 2633
55 Ga0070660_100002867 3300005339 Bacteria 11876
56 Ga0070660_100025266 3300005339 Bacteria 4413
57 Ga0070660_100035205 3300005339 Bacteria 3789
58 Ga0070689_100709587 3300005340 Bacteria 879
59 Ga0070687_100012708 3300005343 Bacteria 3725
60 Ga0070661_100024795 3300005344 Bacteria 4304
61 Ga0070661_100031525 3300005344 Bacteria 3835
62 Ga0070661_100061451 3300005344 Bacteria 2757
63 Ga0070661_100273825 3300005344 Bacteria 1308
64 Ga0070692_10100191 3300005345 Bacteria 1587
65 Ga0070668_100009641 3300005347 Bacteria 7161
66 Ga0070668_100016265 3300005347 Bacteria 5564
67 Ga0070668_100022820 3300005347 Bacteria 4731
68 Ga0070669_100262422 3300005353 Bacteria 1379
69 Ga0070669_100717362 3300005353 Bacteria 845
70 Ga0070669_100829798 3300005353 Bacteria 787
71 Ga0070675_100022011 3300005354 Bacteria 5094
72 Ga0070671_100028977 3300005355 Bacteria 4564
73 Ga0070671_100048259 3300005355 Bacteria 3540
74 Ga0070674_100004017 3300005356 Bacteria 8340
75 Ga0070674_100427599 3300005356 Bacteria 1088
76 Ga0070674_100535697 3300005356 Bacteria 980
77 Ga0070673_100029452 3300005364 Bacteria 4094
78 Ga0070673_100066374 3300005364 Bacteria 2882
79 Ga0070673_100077101 3300005364 Bacteria 2693
80 Ga0070673_100164469 3300005364 Bacteria 1889
81 Ga0070673_100464665 3300005364 Bacteria 1140
82 Ga0070688_100012103 3300005365 Bacteria 4821
83 Ga0070688_101043035 3300005365 Bacteria 651
84 Ga0070659_100000441 3300005366 Bacteria 31078
85 Ga0070659_100037235 3300005366 Bacteria 3792
86 Ga0070659_100062741 3300005366 Bacteria 2938
87 Ga0070659_100383491 3300005366 Bacteria 1184
88 Ga0070667_100000600 3300005367 Bacteria 35155
89 Ga0070667_100017478 3300005367 Bacteria 5944
90 Ga0070667_100136457 3300005367 Bacteria 2145
91 Ga0070667_100143615 3300005367 Bacteria 2092
92 Ga0070667_100231688 3300005367 Bacteria 1647
93 Ga0070667_100372408 3300005367 Bacteria 1296
94 Ga0070709_10005028 3300005434 Bacteria 7148
95 Ga0070709_10019229 3300005434 Bacteria 3945
96 Ga0070709_10022512 3300005434 Bacteria 3688
97 Ga0070709_10109546 3300005434 Bacteria 1854
98 Ga0070709_10111775 3300005434 Bacteria 1837
99 Ga0070709_10120662 3300005434 Bacteria 1776
100 Ga0070709_10197930 3300005434 Bacteria 1421
101 Ga0070714_100027851 3300005435 Bacteria 4682
102 Ga0070714_100156782 3300005435 Bacteria 2056
103 Ga0070714_100226535 3300005435 Bacteria 1721
104 Ga0070714_100550288 3300005435 Bacteria 1105
105 Ga0070713_100000114 3300005436 Bacteria 52713
106 Ga0070713_100007883 3300005436 Bacteria 7514
107 Ga0070713_100016681 3300005436 Bacteria 5527
108 Ga0070713_100018928 3300005436 Bacteria 5243
109 Ga0070713_100224194 3300005436 Bacteria 1706
110 Ga0070713_100275971 3300005436 Bacteria 1541
111 Ga0070713_100471899 3300005436 Bacteria 1181
112 Ga0070713_100800630 3300005436 Bacteria 903
113 Ga0070713_100859813 3300005436 Bacteria 871
114 Ga0070713_100970027 3300005436 Bacteria 819
115 Ga0070710_10002299 3300005437 Bacteria 9045
116 Ga0070710_10149885 3300005437 Bacteria 1438
117 Ga0070710_10394928 3300005437 Bacteria 926
118 Ga0070711_100000079 3300005439 Bacteria 53822
119 Ga0070711_100063062 3300005439 Bacteria 2586
120 Ga0070711_101297572 3300005439 Bacteria 632
121 Ga0070705_100037016 3300005440 Bacteria 2749
122 Ga0070700_100203178 3300005441 Bacteria 1393
123 Ga0070694_100211912 3300005444 Bacteria 1449
124 Ga0070694_100806629 3300005444 Bacteria 770
125 Ga0070708_100007624 3300005445 Bacteria 8668
126 Ga0070708_100017236 3300005445 Bacteria 6017
127 Ga0070708_100019283 3300005445 Bacteria 5729
128 Ga0070708_100032809 3300005445 Bacteria 4506
129 Ga0070708_100041725 3300005445 Bacteria 4024
130 Ga0070708_100072878 3300005445 Bacteria 3095
131 Ga0070708_100099478 3300005445 Bacteria 2661
132 Ga0070708_100115612 3300005445 Bacteria 2469
133 Ga0070708_100296677 3300005445 Bacteria 1522
134 Ga0070708_100589993 3300005445 Bacteria 1047
135 Ga0070708_101140121 3300005445 Bacteria 730
136 Ga0070708_101512150 3300005445 Bacteria 625
137 Ga0070708_101524037 3300005445 Bacteria 623
138 Ga0070663_100218346 3300005455 Bacteria 1496
139 Ga0070678_100103712 3300005456 Bacteria 2210
140 Ga0070662_100011640 3300005457 Bacteria 5807
141 Ga0070662_100322788 3300005457 Unclassified 1259
142 Ga0070681_10000642 3300005458 Bacteria 28781
143 Ga0070681_10011678 3300005458 Bacteria 8699
144 Ga0070681_10016194 3300005458 Bacteria 7433
145 Ga0070681_10262055 3300005458 Bacteria 1641
146 Ga0070681_10303161 3300005458 Bacteria 1507
147 Ga0070681_10324808 3300005458 Bacteria 1448
148 Ga0070681_10405412 3300005458 Bacteria 1275
149 Ga0070681_10641871 3300005458 Bacteria 976
150 Ga0070681_10715097 3300005458 Bacteria 918
151 Ga0068867_100004954 3300005459 Bacteria 9385
152 Ga0068867_100024665 3300005459 Bacteria 4310
153 Ga0068867_100060574 3300005459 Bacteria 2808
154 Ga0070685_10018857 3300005466 Bacteria 3716
155 Ga0070706_100000496 3300005467 Bacteria 46239
156 Ga0070706_100000955 3300005467 Bacteria 31473
157 Ga0070706_100028459 3300005467 Bacteria 5144
158 Ga0070706_100040073 3300005467 Bacteria 4324
159 Ga0070706_100157284 3300005467 Bacteria 2121
160 Ga0070706_100391676 3300005467 Bacteria 1293
161 Ga0070707_100004175 3300005468 Bacteria 13535
162 Ga0070707_100004753 3300005468 Bacteria 12719
163 Ga0070707_100005558 3300005468 Bacteria 11775
164 Ga0070707_100082927 3300005468 Bacteria 3097
165 Ga0070707_100159304 3300005468 Bacteria 2199
166 Ga0070707_100248320 3300005468 Bacteria 1732
167 Ga0070707_100251853 3300005468 Bacteria 1719
168 Ga0070707_100297150 3300005468 Bacteria 1569
169 Ga0070707_100433974 3300005468 Bacteria 1274
170 Ga0070707_100504240 3300005468 Bacteria 1172
171 Ga0070707_100662898 3300005468 Bacteria 1006
172 Ga0070698_100000012 3300005471 Bacteria 116260
173 Ga0070698_100000017 3300005471 Bacteria 107963
174 Ga0070698_100001685 3300005471 Bacteria 24660
175 Ga0070698_100006862 3300005471 Bacteria 12330
176 Ga0070698_100040622 3300005471 Bacteria 4780
177 Ga0070698_100065165 3300005471 Bacteria 3669
178 Ga0070698_100153734 3300005471 Bacteria 2247
179 Ga0070698_100254312 3300005471 Bacteria 1689
180 Ga0070699_100006774 3300005518 Bacteria 9969
181 Ga0070699_100041263 3300005518 Bacteria 3995
182 Ga0070699_100084830 3300005518 Bacteria 2764
183 Ga0070699_100689739 3300005518 Bacteria 933
184 Ga0070679_100012676 3300005530 Bacteria 8062
185 Ga0070679_100053788 3300005530 Bacteria 4008
186 Ga0070679_100339985 3300005530 Bacteria 1449
187 Ga0070679_100410943 3300005530 Bacteria 1299
188 Ga0070679_100424446 3300005530 Unclassified 1275
189 Ga0070684_100019600 3300005535 Bacteria 5598
190 Ga0070684_100025303 3300005535 Bacteria 4988
191 Ga0070684_100171598 3300005535 Bacteria 1970
192 Ga0070684_100187089 3300005535 Bacteria 1883
193 Ga0070697_100000873 3300005536 Bacteria 22668
194 Ga0070697_100007553 3300005536 Bacteria 8465
195 Ga0070697_100008250 3300005536 Bacteria 8128
196 Ga0070697_100017259 3300005536 Bacteria 5676
197 Ga0070697_100017646 3300005536 Bacteria 5621
198 Ga0070697_100023354 3300005536 Bacteria 4917
199 Ga0070697_100053091 3300005536 Bacteria 3294
200 Ga0070697_100075525 3300005536 Bacteria 2770
201 Ga0070697_100156419 3300005536 Bacteria 1924
202 Ga0070697_100520075 3300005536 Bacteria 1042
203 Ga0070697_100678662 3300005536 Bacteria 908
204 Ga0070697_100911080 3300005536 Bacteria 780
205 Ga0070697_101152232 3300005536 Bacteria 691
206 Ga0068853_100000021 3300005539 Bacteria 149283
207 Ga0068853_100007555 3300005539 Bacteria 8701
208 Ga0068853_100113553 3300005539 Bacteria 2409
209 Ga0068853_100122534 3300005539 Bacteria 2321
210 Ga0070672_100390524 3300005543 Bacteria 1192
211 Ga0070686_100253314 3300005544 Bacteria 1287
212 Ga0070695_100147961 3300005545 Bacteria 1636
213 Ga0070695_100207944 3300005545 Bacteria 1403
214 Ga0070695_100269279 3300005545 Bacteria 1247
215 Ga0070696_100007647 3300005546 Bacteria 7221
216 Ga0070696_100115687 3300005546 Bacteria 1936
217 Ga0070696_100135388 3300005546 Bacteria 1796
218 Ga0070693_100021064 3300005547 Bacteria 3449
219 Ga0070693_100054370 3300005547 Bacteria 2302
220 Ga0070693_100100776 3300005547 Bacteria 1759
221 Ga0070693_100119601 3300005547 Bacteria 1632
222 Ga0070665_100279358 3300005548 Bacteria 1671
223 Ga0070665_100798245 3300005548 Bacteria 957
224 Ga0070704_100144686 3300005549 Bacteria 1861
225 Ga0070704_100383974 3300005549 Bacteria 1194
226 Ga0070704_100480180 3300005549 Bacteria 1075
227 Ga0068855_100004030 3300005563 Bacteria 17929
228 Ga0068855_100021151 3300005563 Bacteria 7799
229 Ga0068855_100045941 3300005563 Bacteria 5163
230 Ga0068855_100048051 3300005563 Bacteria 5037
231 Ga0068855_100102272 3300005563 Bacteria 3298
232 Ga0068855_100108155 3300005563 Bacteria 3194
233 Ga0068855_100111413 3300005563 Bacteria 3142
234 Ga0068855_100217176 3300005563 Bacteria 2146
235 Ga0068855_100279099 3300005563 Bacteria 1856
236 Ga0068855_100521175 3300005563 Bacteria 1289
237 Ga0068855_100792066 3300005563 Bacteria 1008
238 Ga0068855_100955485 3300005563 Bacteria 902
239 Ga0068855_101040517 3300005563 Bacteria 858
240 Ga0068855_101122042 3300005563 Bacteria 821
241 Ga0070664_100000740 3300005564 Bacteria 25178
242 Ga0070664_100699940 3300005564 Bacteria 944
243 Ga0070664_100711765 3300005564 Bacteria 936
244 Ga0068857_100000267 3300005577 Bacteria 35430
245 Ga0068857_100002375 3300005577 Bacteria 15345
246 Ga0068857_100100451 3300005577 Bacteria 2595
247 Ga0068857_100478199 3300005577 Bacteria 1167
248 Ga0068857_100718617 3300005577 Bacteria 950
249 Ga0068857_100769593 3300005577 Bacteria 918
250 Ga0068857_101119497 3300005577 Bacteria 761
251 Ga0068854_100000075 3300005578 Bacteria 71042
252 Ga0068854_100023364 3300005578 Bacteria 4222
253 Ga0068854_100162470 3300005578 Bacteria 1731
254 Ga0068854_100338409 3300005578 Bacteria 1228
255 Ga0068856_100000269 3300005614 Bacteria 56597
256 Ga0068856_100002494 3300005614 Bacteria 18939
257 Ga0068856_100005791 3300005614 Bacteria 12177
258 Ga0068856_100043287 3300005614 Bacteria 4430
259 Ga0068856_100051572 3300005614 Bacteria 4056
260 Ga0068856_100121153 3300005614 Bacteria 2617
261 Ga0068856_100133325 3300005614 Bacteria 2489
262 Ga0068856_100209044 3300005614 Bacteria 1966
263 Ga0068856_100209101 3300005614 Bacteria 1966
264 Ga0068856_100315781 3300005614 Bacteria 1580
265 Ga0068856_100810903 3300005614 Bacteria 955
266 Ga0068856_100842084 3300005614 Bacteria 936
267 Ga0070702_100001604 3300005615 Bacteria 9345
268 Ga0070702_100359896 3300005615 Bacteria 1028
269 Ga0070702_100376419 3300005615 Bacteria 1008
270 Ga0068852_100025621 3300005616 Bacteria 4781
271 Ga0068852_100116269 3300005616 Bacteria 2440
272 Ga0068852_100318991 3300005616 Bacteria 1509
273 Ga0068859_100000431 3300005617 Bacteria 42019
274 Ga0068859_100055276 3300005617 Bacteria 3994
275 Ga0068859_100157039 3300005617 Bacteria 2352
276 Ga0068859_100584780 3300005617 Bacteria 1210
277 Ga0068864_100036410 3300005618 Bacteria 4195
278 Ga0068864_100061894 3300005618 Bacteria 3242
279 Ga0068866_10064075 3300005718 Bacteria 1918
280 Ga0068866_10106189 3300005718 Bacteria 1558
281 Ga0068861_100058704 3300005719 Bacteria 2943
282 Ga0068861_100808501 3300005719 Bacteria 880
283 Ga0068851_10021663 3300005834 Bacteria 3121
284 Ga0068851_10071374 3300005834 Bacteria 1797
285 Ga0068851_10304219 3300005834 Bacteria 917
286 Ga0068870_10003679 3300005840 Bacteria 6514
287 Ga0068870_10006265 3300005840 Bacteria 5238
288 Ga0068863_100013702 3300005841 Bacteria 7818
289 Ga0068863_100033779 3300005841 Bacteria 4873
290 Ga0068863_100068166 3300005841 Bacteria 3366
291 Ga0068863_100418270 3300005841 Bacteria 1313
292 Ga0068858_100000940 3300005842 Bacteria 30178
293 Ga0068858_100001833 3300005842 Bacteria 21646
294 Ga0068858_100022771 3300005842 Bacteria 5842
295 Ga0068858_100096556 3300005842 Bacteria 2754
296 Ga0068858_100103209 3300005842 Bacteria 2660
297 Ga0068858_100545820 3300005842 Bacteria 1122
298 Ga0068858_100610848 3300005842 Bacteria 1058
299 Ga0068860_100024142 3300005843 Bacteria 5879
300 Ga0068860_100098924 3300005843 Bacteria 2782
301 Ga0068860_100234677 3300005843 Bacteria 1783
302 Ga0068860_100246000 3300005843 Bacteria 1740
303 Ga0068860_100472801 3300005843 Bacteria 1248
304 Ga0068860_100542714 3300005843 Bacteria 1164
305 Ga0068862_100649853 3300005844 Bacteria 1017
306 Ga0081455_10001388 3300005937 Bacteria 29908
307 Ga0081455_10203612 3300005937 Bacteria 1480
308 Ga0081540_1062392 3300005983 Bacteria 1770
309 Ga0081539_10000728 3300005985 Bacteria 65949
310 Ga0081539_10060584 3300005985 Bacteria 2077
311 Ga0070717_10004198 3300006028 Bacteria 10389
312 Ga0070717_10057313 3300006028 Bacteria 3220
313 Ga0070717_10259897 3300006028 Bacteria 1536
314 Ga0070717_10382357 3300006028 Bacteria 1262
315 Ga0075363_100147428 3300006048 Bacteria 1327
316 Ga0075432_10007225 3300006058 Bacteria 3779
317 Ga0070715_10118853 3300006163 Bacteria 1257
318 Ga0070716_100006307 3300006173 Bacteria 5789
319 Ga0070716_100006656 3300006173 Bacteria 5655
320 Ga0070716_100029593 3300006173 Bacteria 2963
321 Ga0070716_100033701 3300006173 Bacteria 2803
322 Ga0070716_100135199 3300006173 Bacteria 1564
323 Ga0070716_100140547 3300006173 Bacteria 1539
324 Ga0070716_100284246 3300006173 Bacteria 1143
325 Ga0070716_100350276 3300006173 Bacteria 1045
326 Ga0070712_100000211 3300006175 Bacteria 32872
327 Ga0070712_100042436 3300006175 Bacteria 3128
328 Ga0070712_100494881 3300006175 Bacteria 1024
329 Ga0070712_100527016 3300006175 Bacteria 993
330 Ga0070712_100872214 3300006175 Bacteria 775
331 Ga0075427_10005714 3300006194 Bacteria 1780
332 Ga0097621_100000044 3300006237 Bacteria 65368
333 Ga0097621_100000545 3300006237 Bacteria 26489
334 Ga0097621_100011159 3300006237 Bacteria 6612
335 Ga0097621_100024996 3300006237 Bacteria 4670
336 Ga0097621_100118923 3300006237 Bacteria 2239
337 Ga0097621_100424482 3300006237 Bacteria 1194
338 Ga0068871_100000175 3300006358 Bacteria 43254
339 Ga0068871_100010478 3300006358 Bacteria 6767
340 Ga0068871_100020452 3300006358 Bacteria 5071
341 Ga0068871_100042533 3300006358 Bacteria 3648
342 Ga0068871_100102587 3300006358 Bacteria 2398
343 Ga0068871_100167115 3300006358 Bacteria 1884
344 Ga0068871_100326711 3300006358 Bacteria 1352
345 Ga0075428_100067910 3300006844 Bacteria 3901
346 Ga0075428_100343300 3300006844 Bacteria 1603
347 Ga0075428_100361528 3300006844 Bacteria 1557
348 Ga0075428_101469511 3300006844 Bacteria 714
349 Ga0075430_100010696 3300006846 Bacteria 7775
350 Ga0075430_100082297 3300006846 Bacteria 2697
351 Ga0075430_100209261 3300006846 Bacteria 1618
352 Ga0075431_100012237 3300006847 Bacteria 8662
353 Ga0075433_10005361 3300006852 Bacteria 10069
354 Ga0075433_10007214 3300006852 Bacteria 8800
355 Ga0075433_10009062 3300006852 Bacteria 7950
356 Ga0075433_10014696 3300006852 Bacteria 6405
357 Ga0075433_10084262 3300006852 Bacteria 2806
358 Ga0075433_10378965 3300006852 Bacteria 1249
359 Ga0075433_10562884 3300006852 Bacteria 1001
360 Ga0075433_10849391 3300006852 Bacteria 797
361 Ga0075434_100000076 3300006871 Bacteria 52420
362 Ga0075434_100002914 3300006871 Bacteria 15197
363 Ga0075434_100010261 3300006871 Bacteria 8776
364 Ga0075434_100026121 3300006871 Bacteria 5720
365 Ga0075434_100223706 3300006871 Bacteria 1902
366 Ga0075429_100113808 3300006880 Bacteria 2365
367 Ga0075429_100706356 3300006880 Bacteria 883
368 Ga0068865_100016118 3300006881 Bacteria 4774
369 Ga0068865_100018173 3300006881 Bacteria 4534
370 Ga0068865_100025186 3300006881 Bacteria 3910
371 Ga0068865_100068742 3300006881 Bacteria 2505
372 Ga0068865_100367576 3300006881 Bacteria 1170
373 Ga0075436_100011662 3300006914 Bacteria 6030
374 Ga0075436_100018962 3300006914 Bacteria 4712
375 Ga0075436_100219020 3300006914 Bacteria 1350
376 Ga0097620_100000431 3300006931 Bacteria 42019
377 Ga0097620_100055276 3300006931 Bacteria 3994
378 Ga0097620_100157038 3300006931 Bacteria 2352
379 Ga0097620_100584816 3300006931 Bacteria 1210
380 Ga0075435_100000055 3300007076 Bacteria 58409
381 Ga0075435_100002266 3300007076 Bacteria 12708
382 Ga0075435_100015080 3300007076 Bacteria 5801
383 Ga0075435_100054000 3300007076 Bacteria 3242
384 Ga0075435_100224416 3300007076 Bacteria 1596
385 Ga0075435_100290953 3300007076 Bacteria 1396
386 Ga0099795_10056398 3300007788 Bacteria 1445
387 Ga0105251_10035129 3300009011 Bacteria 2475
388 Ga0105250_10000276 3300009092 Bacteria 41623
389 Ga0105250_10150537 3300009092 Bacteria 968
390 Ga0105240_10002515 3300009093 Bacteria 29452
391 Ga0105240_10004363 3300009093 Bacteria 21597
392 Ga0105240_10005521 3300009093 Bacteria 18843
393 Ga0105240_10015602 3300009093 Bacteria 10322
394 Ga0105240_10052579 3300009093 Bacteria 5119
395 Ga0105240_10242923 3300009093 Bacteria 2087
396 Ga0105240_10374277 3300009093 Bacteria 1610
397 Ga0111539_10011786 3300009094 Bacteria 10961
398 Ga0111539_10073664 3300009094 Bacteria 4026
399 Ga0111539_10159322 3300009094 Bacteria 2640
400 Ga0111539_10502042 3300009094 Bacteria 1413
401 Ga0111539_11428068 3300009094 Bacteria 803
402 Ga0111539_11919754 3300009094 Bacteria 687
403 Ga0105245_10014641 3300009098 Bacteria 6830
404 Ga0105245_10083561 3300009098 Bacteria 2923
405 Ga0105245_10107957 3300009098 Bacteria 2585
406 Ga0105245_10232265 3300009098 Bacteria 1784
407 Ga0105245_10587053 3300009098 Bacteria 1139
408 Ga0105245_11127801 3300009098 Bacteria 831
409 Ga0105247_10022834 3300009101 Bacteria 3768
410 Ga0105247_10689915 3300009101 Bacteria 767
411 Ga0114129_10008318 3300009147 Bacteria 14803
412 Ga0114129_10014422 3300009147 Bacteria 11262
413 Ga0114129_10022610 3300009147 Bacteria 8918
414 Ga0114129_10053713 3300009147 Bacteria 5651
415 Ga0114129_10682864 3300009147 Bacteria 1322
416 Ga0114129_10722887 3300009147 Bacteria 1278
417 Ga0114129_11199592 3300009147 Bacteria 945
418 Ga0105243_10028281 3300009148 Bacteria 4303
419 Ga0105243_10296176 3300009148 Bacteria 1464
420 Ga0105243_10886705 3300009148 Bacteria 886
421 Ga0105241_10001816 3300009174 Bacteria 16204
422 Ga0105241_10062941 3300009174 Bacteria 2861
423 Ga0105241_10125023 3300009174 Bacteria 2076
424 Ga0105241_10175659 3300009174 Bacteria 1772
425 Ga0105241_10282878 3300009174 Bacteria 1417
426 Ga0105241_10778889 3300009174 Bacteria 879
427 Ga0105241_11065676 3300009174 Bacteria 759
428 Ga0105242_10127676 3300009176 Bacteria 2191
429 Ga0105242_10134819 3300009176 Bacteria 2136
430 Ga0105248_10007656 3300009177 Bacteria 11867
431 Ga0105248_10009203 3300009177 Bacteria 10866
432 Ga0105248_10074104 3300009177 Bacteria 3826
433 Ga0105248_10156053 3300009177 Bacteria 2575
434 Ga0105237_10004117 3300009545 Bacteria 16957
435 Ga0105237_10011074 3300009545 Bacteria 9559
436 Ga0105237_10038679 3300009545 Bacteria 4817
437 Ga0105237_10091507 3300009545 Bacteria 3031
438 Ga0105237_10477911 3300009545 Bacteria 1252
439 Ga0105237_10491205 3300009545 Bacteria 1234
440 Ga0105238_10000743 3300009551 Bacteria 34004
441 Ga0105238_10061647 3300009551 Bacteria 3752
442 Ga0105238_10132351 3300009551 Bacteria 2472
443 Ga0105238_10186504 3300009551 Bacteria 2051
444 Ga0105249_10108111 3300009553 Bacteria 2625
445 Ga0105249_10217481 3300009553 Bacteria 1878
446 Ga0105249_10474072 3300009553 Bacteria 1293
447 Ga0099796_10000882 3300010159 Bacteria 5562
448 Ga0105239_10079926 3300010375 Bacteria 3598
449 Ga0105239_10094834 3300010375 Bacteria 3296
450 Ga0105239_10201493 3300010375 Bacteria 2230
451 Ga0105239_10474814 3300010375 Bacteria 1420
452 Ga0105239_10608917 3300010375 Bacteria 1246
453 Ga0105239_10828913 3300010375 Bacteria 1060
454 Ga0105246_10238949 3300011119 Bacteria 1435
455 Ga0105246_10242737 3300011119 Bacteria 1425
456 Ga0157337_1000372 3300012483 Bacteria 2073
457 Ga0157373_10005308 3300013100 Bacteria 9678
458 Ga0157373_10063488 3300013100 Bacteria 2615
459 Ga0157371_10007963 3300013102 Bacteria 8503
460 Ga0157371_10014239 3300013102 Bacteria 6013
461 Ga0157371_10193238 3300013102 Bacteria 1458
462 Ga0157371_10249094 3300013102 Bacteria 1279
463 Ga0157371_10413811 3300013102 Bacteria 988
464 Ga0157371_10608664 3300013102 Bacteria 813
465 Ga0157370_10254749 3300013104 Bacteria 1623
466 Ga0157370_10298999 3300013104 Bacteria 1486
467 Ga0157370_10541587 3300013104 Bacteria 1067
468 Ga0157370_10826117 3300013104 Bacteria 843
469 Ga0157369_10000231 3300013105 Bacteria 77118
470 Ga0157369_10000319 3300013105 Bacteria 64594
471 Ga0157369_10005543 3300013105 Bacteria 14663
472 Ga0157369_10120102 3300013105 Bacteria 2789
473 Ga0157369_10265990 3300013105 Bacteria 1788
474 Ga0157369_10268297 3300013105 Bacteria 1779
475 Ga0157369_10914059 3300013105 Bacteria 900
476 Ga0157369_10916146 3300013105 Bacteria 899
477 Ga0157369_11118949 3300013105 Bacteria 805
478 Ga0157374_10000299 3300013296 Bacteria 45851
479 Ga0157374_10000756 3300013296 Bacteria 28229
480 Ga0157374_10001394 3300013296 Bacteria 20506
481 Ga0157374_10010350 3300013296 Bacteria 8023
482 Ga0157374_10023781 3300013296 Bacteria 5486
483 Ga0157374_10039002 3300013296 Bacteria 4369
484 Ga0157374_10053108 3300013296 Bacteria 3777
485 Ga0157374_10102210 3300013296 Bacteria 2749
486 Ga0157374_10174393 3300013296 Bacteria 2099
487 Ga0157374_10208177 3300013296 Bacteria 1917
488 Ga0157378_10000073 3300013297 Bacteria 90844
489 Ga0157378_10000222 3300013297 Bacteria 55407
490 Ga0157378_10004962 3300013297 Bacteria 11664
491 Ga0157378_10007445 3300013297 Bacteria 9564
492 Ga0157378_10045793 3300013297 Bacteria 3888
493 Ga0157378_10284800 3300013297 Bacteria 1594
494 Ga0163162_10129426 3300013306 Bacteria 2632
495 Ga0163162_10169897 3300013306 Bacteria 2305
496 Ga0163162_10461584 3300013306 Bacteria 1402
497 Ga0163162_10997910 3300013306 Bacteria 946
498 Ga0163162_11205135 3300013306 Bacteria 859
499 Ga0157372_10000559 3300013307 Bacteria 40959
500 Ga0157372_10002399 3300013307 Bacteria 20289
501 Ga0157372_10003262 3300013307 Bacteria 17534
502 Ga0157372_10007072 3300013307 Bacteria 11957
503 Ga0157372_10013225 3300013307 Bacteria 8807
504 Ga0157372_10045174 3300013307 Bacteria 4885
505 Ga0157372_10056971 3300013307 Bacteria 4368
506 Ga0157372_10087452 3300013307 Bacteria 3536
507 Ga0157372_10089704 3300013307 Bacteria 3493
508 Ga0157372_10125545 3300013307 Bacteria 2950
509 Ga0157372_10203409 3300013307 Bacteria 2294
510 Ga0157372_10416566 3300013307 Bacteria 1565
511 Ga0157372_10521870 3300013307 Bacteria 1385
512 Ga0157372_10565792 3300013307 Bacteria 1325
513 Ga0157372_10731665 3300013307 Bacteria 1150
514 Ga0157372_11601033 3300013307 Bacteria 750
515 Ga0157375_10041855 3300013308 Bacteria 4427
516 Ga0157375_10232117 3300013308 Bacteria 2004
517 Ga0157375_10257143 3300013308 Bacteria 1908
518 Ga0157375_10477922 3300013308 Bacteria 1411
519 Ga0157375_10926379 3300013308 Bacteria 1014
520 Ga0163163_10013371 3300014325 Bacteria 7513
521 Ga0163163_10019682 3300014325 Bacteria 6343
522 Ga0163163_10021989 3300014325 Bacteria 6030
523 Ga0163163_10030798 3300014325 Bacteria 5174
524 Ga0163163_10032156 3300014325 Bacteria 5068
525 Ga0163163_10041561 3300014325 Bacteria 4497
526 Ga0163163_10148927 3300014325 Bacteria 2385
527 Ga0163163_10748137 3300014325 Bacteria 1041
528 Ga0163163_10818416 3300014325 Bacteria 995
529 Ga0163163_10903667 3300014325 Bacteria 946
530 Ga0157380_10366117 3300014326 Bacteria 1355
531 Ga0182008_10007425 3300014497 Bacteria 6053
532 Ga0182008_10016242 3300014497 Bacteria 3871
533 Ga0157377_10002869 3300014745 Bacteria 7697
534 Ga0157379_10000101 3300014968 Bacteria 58702
535 Ga0157379_10001379 3300014968 Bacteria 19872
536 Ga0157379_10741705 3300014968 Bacteria 924
537 Ga0157376_10006528 3300014969 Bacteria 8248
538 Ga0157376_10008992 3300014969 Bacteria 7234
539 Ga0157376_10011649 3300014969 Bacteria 6491
540 Ga0157376_10383636 3300014969 Bacteria 1354
541 Ga0157376_10506457 3300014969 Bacteria 1187
542 Ga0182006_1084453 3300015261 Bacteria 1153
543 Ga0182007_10000052 3300015262 Bacteria 95132
544 Ga0182007_10002110 3300015262 Bacteria 10173
545 Ga0182005_1000929 3300015265 Bacteria 12788
546 Ga0163161_10012859 3300017792 Bacteria 5816
547 Ga0163161_10128033 3300017792 Bacteria 1913
548 Ga0163161_10848801 3300017792 Bacteria 771
549 Ga0206352_10404164 3300020078 Bacteria 1585
550 Ga0213872_10001314 3300021361 Bacteria 16478
551 Ga0213872_10006401 3300021361 Bacteria 5921
552 Ga0213872_10138644 3300021361 Bacteria 1068
553 Ga0213874_10020175 3300021377 Bacteria 1824
554 Ga0213871_10002272 3300021441 Bacteria 3506
555 Ga0224572_1003411 3300024225 Bacteria 2678
556 Ga0228598_1000137 3300024227 Bacteria 12449
557 Ga0207656_10022091 3300025321 Bacteria 2549
558 Ga0207656_10318419 3300025321 Bacteria 772
559 Ga0207696_1085302 3300025711 Bacteria 869
560 Ga0207682_10017839 3300025893 Bacteria 2770
561 Ga0207692_10001224 3300025898 Bacteria 9516
562 Ga0207710_10062652 3300025900 Bacteria 1691
563 Ga0207647_10002035 3300025904 Bacteria 15456
564 Ga0207647_10012919 3300025904 Bacteria 5802
565 Ga0207647_10108859 3300025904 Bacteria 1639
566 Ga0207685_10095995 3300025905 Bacteria 1258
567 Ga0207685_10472403 3300025905 Bacteria 656
568 Ga0207699_10003962 3300025906 Bacteria 7083
569 Ga0207699_10040002 3300025906 Bacteria 2698
570 Ga0207699_10139497 3300025906 Bacteria 1592
571 Ga0207699_10159785 3300025906 Bacteria 1499
572 Ga0207699_10198383 3300025906 Bacteria 1358
573 Ga0207699_10348067 3300025906 Bacteria 1045
574 Ga0207645_10000450 3300025907 Bacteria 34259
575 Ga0207643_10004594 3300025908 Bacteria 7416
576 Ga0207705_10229697 3300025909 Bacteria 1411
577 Ga0207705_10403214 3300025909 Bacteria 1058
578 Ga0207684_10001079 3300025910 Bacteria 30538
579 Ga0207684_10010310 3300025910 Bacteria 8228
580 Ga0207684_10012423 3300025910 Bacteria 7408
581 Ga0207684_10013493 3300025910 Bacteria 7067
582 Ga0207654_10052893 3300025911 Bacteria 2342
583 Ga0207654_10139415 3300025911 Bacteria 1545
584 Ga0207654_10440806 3300025911 Bacteria 912
585 Ga0207707_10002539 3300025912 Bacteria 16383
586 Ga0207707_10013653 3300025912 Bacteria 7083
587 Ga0207707_10064089 3300025912 Bacteria 3199
588 Ga0207707_10070264 3300025912 Bacteria 3051
589 Ga0207707_10071238 3300025912 Bacteria 3029
590 Ga0207707_10152475 3300025912 Bacteria 2020
591 Ga0207707_10203714 3300025912 Bacteria 1725
592 Ga0207707_10233033 3300025912 Bacteria 1602
593 Ga0207695_10004398 3300025913 Bacteria 19266
594 Ga0207695_10032088 3300025913 Bacteria 5752
595 Ga0207695_10161833 3300025913 Bacteria 2169
596 Ga0207671_10069552 3300025914 Bacteria 2624
597 Ga0207671_10128514 3300025914 Bacteria 1943
598 Ga0207693_10005542 3300025915 Bacteria 10501
599 Ga0207693_10110600 3300025915 Bacteria 2154
600 Ga0207693_10336439 3300025915 Bacteria 1181
601 Ga0207693_10823710 3300025915 Bacteria 715
602 Ga0207663_10101481 3300025916 Bacteria 1933
603 Ga0207663_10308608 3300025916 Bacteria 1185
604 Ga0207660_10207138 3300025917 Bacteria 1534
605 Ga0207660_10513643 3300025917 Bacteria 973
606 Ga0207662_10007359 3300025918 Bacteria 5990
607 Ga0207657_10000382 3300025919 Bacteria 46682
608 Ga0207657_10000415 3300025919 Bacteria 45249
609 Ga0207657_10001641 3300025919 Bacteria 24118
610 Ga0207649_10000699 3300025920 Bacteria 22010
611 Ga0207652_10020296 3300025921 Bacteria 5470
612 Ga0207652_10064861 3300025921 Bacteria 3161
613 Ga0207652_10123801 3300025921 Bacteria 2302
614 Ga0207652_10382380 3300025921 Bacteria 1270
615 Ga0207652_10724602 3300025921 Bacteria 886
616 Ga0207646_10002735 3300025922 Bacteria 20614
617 Ga0207646_10012699 3300025922 Bacteria 8083
618 Ga0207646_10024477 3300025922 Bacteria 5530
619 Ga0207646_10029066 3300025922 Bacteria 5025
620 Ga0207646_10033309 3300025922 Bacteria 4662
621 Ga0207646_10034593 3300025922 Bacteria 4566
622 Ga0207646_10167091 3300025922 Bacteria 1986
623 Ga0207646_10180106 3300025922 Bacteria 1909
624 Ga0207646_10217579 3300025922 Bacteria 1726
625 Ga0207646_10678359 3300025922 Bacteria 922
626 Ga0207646_10854335 3300025922 Bacteria 809
627 Ga0207681_10111139 3300025923 Bacteria 1993
628 Ga0207694_10000619 3300025924 Bacteria 32276
629 Ga0207694_10125933 3300025924 Bacteria 2049
630 Ga0207694_10271336 3300025924 Bacteria 1392
631 Ga0207650_10000124 3300025925 Bacteria 97031
632 Ga0207650_10001441 3300025925 Bacteria 17130
633 Ga0207650_10375377 3300025925 Bacteria 1173
634 Ga0207650_10780621 3300025925 Bacteria 809
635 Ga0207659_10050898 3300025926 Bacteria 2944
636 Ga0207687_10048962 3300025927 Bacteria 2936
637 Ga0207687_10055498 3300025927 Bacteria 2776
638 Ga0207687_10149936 3300025927 Bacteria 1778
639 Ga0207700_10000018 3300025928 Bacteria 191007
640 Ga0207700_10011398 3300025928 Bacteria 5665
641 Ga0207700_10027688 3300025928 Bacteria 3973
642 Ga0207700_10049703 3300025928 Bacteria 3121
643 Ga0207700_10103759 3300025928 Bacteria 2274
644 Ga0207700_10122191 3300025928 Bacteria 2113
645 Ga0207700_10226461 3300025928 Bacteria 1587
646 Ga0207700_10345694 3300025928 Bacteria 1294
647 Ga0207700_10432839 3300025928 Bacteria 1157
648 Ga0207700_10454848 3300025928 Bacteria 1129
649 Ga0207700_10702627 3300025928 Bacteria 903
650 Ga0207700_11024353 3300025928 Bacteria 739
651 Ga0207664_10069992 3300025929 Bacteria 2822
652 Ga0207664_10115104 3300025929 Bacteria 2242
653 Ga0207664_10140066 3300025929 Bacteria 2045
654 Ga0207664_10148805 3300025929 Bacteria 1987
655 Ga0207664_10232467 3300025929 Bacteria 1603
656 Ga0207664_10476152 3300025929 Bacteria 1116
657 Ga0207664_10524978 3300025929 Bacteria 1061
658 Ga0207664_10888488 3300025929 Bacteria 800
659 Ga0207644_10023204 3300025931 Bacteria 4246
660 Ga0207644_10907556 3300025931 Bacteria 738
661 Ga0207690_10001363 3300025932 Bacteria 15339
662 Ga0207690_10225438 3300025932 Bacteria 1436
663 Ga0207690_10625897 3300025932 Bacteria 880
664 Ga0207706_10014430 3300025933 Bacteria 7161
665 Ga0207706_10022635 3300025933 Bacteria 5640
666 Ga0207706_10192323 3300025933 Bacteria 1791
667 Ga0207686_10087581 3300025934 Bacteria 2048
668 Ga0207686_10091032 3300025934 Bacteria 2014
669 Ga0207686_10135908 3300025934 Bacteria 1693
670 Ga0207709_10037794 3300025935 Bacteria 2870
671 Ga0207709_10371632 3300025935 Bacteria 1085
672 Ga0207709_10648904 3300025935 Bacteria 840
673 Ga0207670_10022198 3300025936 Bacteria 3930
674 Ga0207670_10756374 3300025936 Bacteria 807
675 Ga0207669_10005789 3300025937 Bacteria 5584
676 Ga0207669_10269596 3300025937 Bacteria 1278
677 Ga0207669_10431912 3300025937 Bacteria 1039
678 Ga0207704_10009764 3300025938 Bacteria 4647
679 Ga0207704_10011932 3300025938 Bacteria 4297
680 Ga0207704_10034228 3300025938 Bacteria 2897
681 Ga0207704_10183487 3300025938 Bacteria 1514
682 Ga0207665_10003883 3300025939 Bacteria 9995
683 Ga0207665_10007183 3300025939 Bacteria 7369
684 Ga0207665_10021074 3300025939 Bacteria 4284
685 Ga0207665_10053921 3300025939 Bacteria 2711
686 Ga0207665_10127526 3300025939 Bacteria 1803
687 Ga0207665_10252570 3300025939 Bacteria 1303
688 Ga0207665_10400930 3300025939 Bacteria 1045
689 Ga0207665_10721767 3300025939 Bacteria 784
690 Ga0207691_10024609 3300025940 Bacteria 5663
691 Ga0207691_10183581 3300025940 Bacteria 1827
692 Ga0207691_10872706 3300025940 Bacteria 754
693 Ga0207711_10018438 3300025941 Bacteria 5802
694 Ga0207711_10021441 3300025941 Bacteria 5397
695 Ga0207711_10259890 3300025941 Bacteria 1595
696 Ga0207711_10302816 3300025941 Bacteria 1475
697 Ga0207689_10000658 3300025942 Bacteria 32969
698 Ga0207689_10020015 3300025942 Bacteria 5637
699 Ga0207689_10302529 3300025942 Bacteria 1326
700 Ga0207661_10004224 3300025944 Bacteria 10054
701 Ga0207661_10044824 3300025944 Bacteria 3498
702 Ga0207661_10051620 3300025944 Bacteria 3282
703 Ga0207661_10108398 3300025944 Bacteria 2345
704 Ga0207661_10123392 3300025944 Bacteria 2209
705 Ga0207661_10307928 3300025944 Bacteria 1421
706 Ga0207661_10359586 3300025944 Bacteria 1315
707 Ga0207661_10390788 3300025944 Bacteria 1260
708 Ga0207661_10627881 3300025944 Unclassified 987
709 Ga0207661_11128906 3300025944 Bacteria 722
710 Ga0207679_10000216 3300025945 Bacteria 45504
711 Ga0207679_10024128 3300025945 Bacteria 4167
712 Ga0207679_10616660 3300025945 Bacteria 979
713 Ga0207679_11034804 3300025945 Bacteria 753
714 Ga0207667_10001480 3300025949 Bacteria 29472
715 Ga0207667_10012373 3300025949 Bacteria 9837
716 Ga0207667_10017951 3300025949 Bacteria 7951
717 Ga0207667_10121696 3300025949 Bacteria 2689
718 Ga0207667_10181876 3300025949 Bacteria 2159
719 Ga0207667_10283703 3300025949 Bacteria 1692
720 Ga0207667_10310520 3300025949 Bacteria 1611
721 Ga0207667_11310910 3300025949 Bacteria 700
722 Ga0207651_10072509 3300025960 Bacteria 2445
723 Ga0207651_10173897 3300025960 Bacteria 1701
724 Ga0207712_10176532 3300025961 Bacteria 1674
725 Ga0207712_10267624 3300025961 Bacteria 1389
726 Ga0207668_10049551 3300025972 Bacteria 2888
727 Ga0207668_10092587 3300025972 Bacteria 2225
728 Ga0207640_10000034 3300025981 Bacteria 112705
729 Ga0207640_10077122 3300025981 Bacteria 2264
730 Ga0207640_10137112 3300025981 Bacteria 1778
731 Ga0207640_10542183 3300025981 Bacteria 976
732 Ga0207658_10004844 3300025986 Bacteria 9301
733 Ga0207658_10022794 3300025986 Bacteria 4361
734 Ga0207658_10025681 3300025986 Bacteria 4125
735 Ga0207658_10025899 3300025986 Bacteria 4108
736 Ga0207658_10129938 3300025986 Bacteria 2022
737 Ga0207658_10186552 3300025986 Bacteria 1721
738 Ga0207658_10299831 3300025986 Bacteria 1384
739 Ga0207677_10018913 3300026023 Bacteria 4147
740 Ga0207677_10037178 3300026023 Bacteria 3180
741 Ga0207677_10043135 3300026023 Bacteria 2996
742 Ga0207677_10048788 3300026023 Bacteria 2852
743 Ga0207677_10138193 3300026023 Bacteria 1861
744 Ga0207677_10270127 3300026023 Bacteria 1390
745 Ga0207703_10003557 3300026035 Bacteria 13022
746 Ga0207703_10017369 3300026035 Bacteria 5617
747 Ga0207703_10027593 3300026035 Bacteria 4471
748 Ga0207703_10152655 3300026035 Bacteria 2015
749 Ga0207639_10000035 3300026041 Bacteria 149309
750 Ga0207639_10005433 3300026041 Bacteria 8605
751 Ga0207639_10031575 3300026041 Bacteria 3893
752 Ga0207678_10021692 3300026067 Bacteria 5632
753 Ga0207678_10029209 3300026067 Bacteria 4811
754 Ga0207678_10839659 3300026067 Bacteria 811
755 Ga0207708_10072956 3300026075 Bacteria 2630
756 Ga0207702_10000304 3300026078 Bacteria 56789
757 Ga0207702_10009861 3300026078 Bacteria 8005
758 Ga0207702_10018049 3300026078 Bacteria 5838
759 Ga0207702_10022299 3300026078 Bacteria 5249
760 Ga0207702_10025028 3300026078 Bacteria 4951
761 Ga0207702_10033348 3300026078 Bacteria 4301
762 Ga0207702_10072312 3300026078 Bacteria 2972
763 Ga0207702_10235014 3300026078 Bacteria 1714
764 Ga0207702_10428396 3300026078 Bacteria 1280
765 Ga0207702_10433799 3300026078 Bacteria 1272
766 Ga0207641_10000006 3300026088 Bacteria 442569
767 Ga0207641_10007266 3300026088 Bacteria 9228
768 Ga0207641_10094843 3300026088 Bacteria 2617
769 Ga0207641_10158423 3300026088 Bacteria 2056
770 Ga0207641_10206571 3300026088 Bacteria 1814
771 Ga0207641_11012705 3300026088 Bacteria 828
772 Ga0207648_10003409 3300026089 Bacteria 16681
773 Ga0207648_10007481 3300026089 Bacteria 10732
774 Ga0207648_10125908 3300026089 Bacteria 2254
775 Ga0207648_10887050 3300026089 Bacteria 833
776 Ga0207676_10000272 3300026095 Bacteria 44817
777 Ga0207676_10070879 3300026095 Bacteria 2796
778 Ga0207676_10087256 3300026095 Bacteria 2551
779 Ga0207676_10469151 3300026095 Bacteria 1190
780 Ga0207674_10001455 3300026116 Bacteria 30595
781 Ga0207674_10003186 3300026116 Bacteria 20202
782 Ga0207674_10004925 3300026116 Bacteria 15959
783 Ga0207674_10010900 3300026116 Bacteria 10234
784 Ga0207674_10095120 3300026116 Bacteria 2965
785 Ga0207674_10116424 3300026116 Bacteria 2644
786 Ga0207674_10622401 3300026116 Bacteria 1042
787 Ga0207674_10738819 3300026116 Bacteria 950
788 Ga0207675_100005242 3300026118 Bacteria 12475
789 Ga0207675_100585893 3300026118 Bacteria 1117
790 Ga0207683_10000615 3300026121 Bacteria 32879
791 Ga0207683_10065128 3300026121 Bacteria 3212
792 Ga0207683_10189811 3300026121 Bacteria 1865
793 Ga0207698_10171351 3300026142 Bacteria 1912
794 Ga0207698_10467828 3300026142 Bacteria 1220
795 Ga0207698_10498026 3300026142 Bacteria 1185
796 Ga0207698_10943471 3300026142 Bacteria 872
797 Ga0207698_10945433 3300026142 Bacteria 871
798 Ga0209371_1000240 3300027312 Bacteria 68413
799 Ga0209966_1062939 3300027695 Bacteria 804
800 Ga0207428_10200109 3300027907 Bacteria 1503
801 Ga0268266_10051953 3300028379 Bacteria 3519
802 Ga0268266_10053029 3300028379 Bacteria 3483
803 Ga0268266_10630264 3300028379 Bacteria 1031
804 Ga0268265_10040311 3300028380 Bacteria 3448
805 Ga0268265_10201159 3300028380 Bacteria 1728
806 Ga0268265_10258448 3300028380 Bacteria 1547
807 Ga0268265_11089447 3300028380 Bacteria 793
808 Ga0268264_10017468 3300028381 Bacteria 5874
809 Ga0268264_10021798 3300028381 Bacteria 5229
810 Ga0268264_10338473 3300028381 Bacteria 1428
811 Ga0268264_10344003 3300028381 Bacteria 1418
812 Ga0265326_10026747 3300028558 Bacteria 1645
813 Ga0265334_10012454 3300028573 Bacteria 3573
814 Ga0265334_10022745 3300028573 Bacteria 2552
815 Ga0265338_10010744 3300028800 Bacteria 10684
816 Ga0265338_10021845 3300028800 Bacteria 6651
817 Ga0265338_10052282 3300028800 Bacteria 3667
818 Ga0265338_10055590 3300028800 Bacteria 3520
819 Ga0265338_10211636 3300028800 Bacteria 1455
820 Ga0265338_10213479 3300028800 Bacteria 1447
821 Ga0265324_10060812 3300029957 Bacteria 1291
822 Ga0268256_1001896 3300030500 Bacteria 11540
823 Ga0265762_1011440 3300030760 Bacteria 1586
824 Ga0265762_1027034 3300030760 Bacteria 1075
825 Ga0265770_1001601 3300030878 Bacteria 3102
826 Ga0265770_1046539 3300030878 Bacteria 773
827 Ga0265765_1016810 3300030879 Bacteria 859
828 Ga0265773_1007224 3300031018 Bacteria 861
829 Ga0265760_10000795 3300031090 Bacteria 9098
830 Ga0265760_10001799 3300031090 Bacteria 6294
831 Ga0265760_10011756 3300031090 Bacteria 2502
832 Ga0265760_10011874 3300031090 Bacteria 2488
833 Ga0265330_10084043 3300031235 Bacteria 1370
834 Ga0265320_10347591 3300031240 Bacteria 655
835 Ga0265325_10223412 3300031241 Bacteria 861
836 Ga0265325_10268794 3300031241 Bacteria 767
837 Ga0265340_10041870 3300031247 Bacteria 2250
838 Ga0265340_10235277 3300031247 Bacteria 818
839 Ga0265340_10264904 3300031247 Bacteria 765
840 Ga0265339_10091931 3300031249 Bacteria 1589
841 Ga0265339_10101501 3300031249 Bacteria 1497
842 Ga0265331_10012775 3300031250 Bacteria 4536
843 Ga0265331_10041416 3300031250 Bacteria 2238
844 Ga0265316_10098825 3300031344 Bacteria 2221
845 Ga0265316_10557629 3300031344 Bacteria 815
846 Ga0307408_100000574 3300031548 Bacteria 31711
847 Ga0307408_100000699 3300031548 Bacteria 27364
848 Ga0307408_100005138 3300031548 Bacteria 8775
849 Ga0307408_100375634 3300031548 Bacteria 1214
850 Ga0307408_100494051 3300031548 Bacteria 1070
851 Ga0307408_100809849 3300031548 Bacteria 851
852 Ga0265313_10001496 3300031595 Bacteria 21782
853 Ga0316575_10027814 3300031665 Bacteria 2200
854 Ga0316575_10041239 3300031665 Bacteria 1826
855 Ga0316575_10089686 3300031665 Bacteria 1245
856 Ga0316579_10000419 3300031691 Bacteria 13540
857 Ga0316579_10023436 3300031691 Bacteria 2771
858 Ga0316579_10045687 3300031691 Bacteria 2042
859 Ga0316579_10050163 3300031691 Bacteria 1951
860 Ga0265314_10020480 3300031711 Bacteria 5105
861 Ga0265314_10238068 3300031711 Bacteria 1052
862 Ga0265314_10415021 3300031711 Bacteria 724
863 Ga0265342_10045203 3300031712 Bacteria 2652
864 Ga0265342_10089228 3300031712 Bacteria 1770
865 Ga0316576_10005266 3300031727 Bacteria 7877
866 Ga0316576_10014612 3300031727 Bacteria 5247
867 Ga0316576_10024892 3300031727 Bacteria 4184
868 Ga0316576_10056624 3300031727 Bacteria 2863
869 Ga0316576_10066163 3300031727 Bacteria 2657
870 Ga0316576_10071666 3300031727 Bacteria 2556
871 Ga0316576_10077929 3300031727 Bacteria 2455
872 Ga0316576_10122128 3300031727 Bacteria 1956
873 Ga0316576_10153473 3300031727 Bacteria 1735
874 Ga0316576_10408788 3300031727 Bacteria 1005
875 Ga0316576_10464450 3300031727 Bacteria 934
876 Ga0316578_10000029 3300031728 Bacteria 29549
877 Ga0316578_10001182 3300031728 Bacteria 10329
878 Ga0316578_10008525 3300031728 Bacteria 5223
879 Ga0316578_10030141 3300031728 Bacteria 3082
880 Ga0316578_10034019 3300031728 Bacteria 2924
881 Ga0316578_10040101 3300031728 Bacteria 2705
882 Ga0316578_10386482 3300031728 Bacteria 830
883 Ga0307405_10009176 3300031731 Bacteria 5059
884 Ga0316577_10000654 3300031733 Bacteria 14481
885 Ga0316577_10007154 3300031733 Bacteria 5938
886 Ga0316577_10072353 3300031733 Bacteria 1924
887 Ga0316577_10221345 3300031733 Bacteria 1070
888 Ga0307413_10004045 3300031824 Bacteria 6309
889 Ga0307413_10098524 3300031824 Bacteria 1925
890 Ga0307410_10056743 3300031852 Bacteria 2664
891 Ga0307410_10237307 3300031852 Bacteria 1411
892 Ga0307406_10000834 3300031901 Bacteria 17319
893 Ga0307406_10001613 3300031901 Bacteria 12405
894 Ga0307406_10051619 3300031901 Bacteria 2612
895 Ga0307407_10019613 3300031903 Bacteria 3447
896 Ga0307407_10054721 3300031903 Bacteria 2303
897 Ga0307412_10007134 3300031911 Bacteria 6343
898 Ga0307412_10141786 3300031911 Bacteria 1761
899 Ga0307409_100020780 3300031995 Bacteria 4484
900 Ga0307409_100037629 3300031995 Bacteria 3569
901 Ga0307409_100050989 3300031995 Bacteria 3164
902 Ga0307409_100071410 3300031995 Bacteria 2760
903 Ga0307416_100004997 3300032002 Bacteria 8088
904 Ga0307416_100094583 3300032002 Bacteria 2577
905 Ga0307416_100206427 3300032002 Bacteria 1869
906 Ga0307416_101017329 3300032002 Bacteria 932
907 Ga0307414_10046397 3300032004 Bacteria 2983
908 Ga0307414_10052683 3300032004 Bacteria 2833
909 Ga0307411_10010295 3300032005 Bacteria 4975
910 Ga0307411_10014780 3300032005 Bacteria 4358
911 Ga0307415_100023061 3300032126 Bacteria 3855
912 Ga0307415_100108044 3300032126 Bacteria 2057
913 Ga0307415_100135844 3300032126 Bacteria 1870
914 Ga0307415_100354518 3300032126 Bacteria 1236
915 Ga0316583_10000401 3300032133 Bacteria 12644
916 Ga0316583_10005061 3300032133 Bacteria 4719
917 Ga0316583_10051643 3300032133 Bacteria 1447
918 Ga0316583_10055533 3300032133 Bacteria 1392
919 Ga0316585_10000035 3300032137 Bacteria 20542
920 Ga0316585_10006872 3300032137 Bacteria 3265
921 Ga0316585_10015208 3300032137 Bacteria 2306
922 Ga0316585_10015503 3300032137 Bacteria 2286
923 Ga0316585_10078523 3300032137 Bacteria 1074
924 Ga0316585_10165644 3300032137 Bacteria 730
925 Ga0316580_10000418 3300032139 Bacteria 9678
926 Ga0316580_10005792 3300032139 Bacteria 3625
927 Ga0316580_10013725 3300032139 Bacteria 2468
928 Ga0316580_10025218 3300032139 Bacteria 1838
929 Ga0316580_10056608 3300032139 Bacteria 1205
930 Ga0316593_10026263 3300032168 Bacteria 1860
931 Ga0316593_10149847 3300032168 Bacteria 848
932 Ga0307510_10019078 3300033180 Bacteria 8045
933 Ga0316592_1003590 3300033524 Bacteria 2811
934 Ga0316592_1004978 3300033524 Bacteria 2501
935 Ga0316592_1020463 3300033524 Bacteria 1406
936 Ga0316592_1044763 3300033524 Bacteria 984
937 Ga0316588_1000275 3300033528 Bacteria 6331
938 Ga0316588_1003220 3300033528 Bacteria 2951
939 Ga0316588_1021963 3300033528 Bacteria 1455
940 Ga0316587_1037230 3300033529 Bacteria 872
941 Ga0316596_1001497 3300033541 Bacteria 4736
942 Ga0316596_1008590 3300033541 Bacteria 2440
943 Ga0316596_1023278 3300033541 Bacteria 1586
944 Ga0373926_0047187 3300035083 Bacteria 1547
945 Ga0373926_0076003 3300035083 Bacteria 1238
946 Ga0373929_0039763 3300035085 Bacteria 1040
947 Ga0373934_0000404 3300035086 Bacteria 15111
948 Ga0373940_0140212 3300035088 Bacteria 764
949 Ga0373923_0019471 3300035111 Bacteria 2629
950 Ga0373923_0366681 3300035111 Bacteria 690
951 Ga0373932_0015112 3300035112 Bacteria 1953
952 Ga0373936_0114343 3300035113 Bacteria 1148
953 Ga0373936_0134352 3300035113 Bacteria 1065
954 Ga0373936_0197426 3300035113 Bacteria 887
955 Ga0373954_0000224 3300035118 Bacteria 20728
956 Ga0373956_0001105 3300035119 Bacteria 11121
957 Ga0373956_0043221 3300035119 Bacteria 2006
958 Ga0373957_0007746 3300035120 Bacteria 3449
959 Ga0373960_0111502 3300035121 Bacteria 898
960 Ga0373943_0183863 3300035170 Bacteria 1150
961 Ga0373943_0244295 3300035170 Bacteria 1007
962 Ga0373946_0097826 3300035171 Bacteria 1311
963 Ga0373955_0000521 3300035172 Bacteria 16367
964 Ga0373942_0035037 3300035207 Bacteria 1345
965 Ga0316574_0000298 3300035398 Bacteria 18690
966 Ga0316574_0000526 3300035398 Bacteria 15691
967 Ga0316574_0013680 3300035398 Bacteria 4672
968 Ga0316574_0015936 3300035398 Bacteria 4369
969 Ga0316574_0113732 3300035398 Bacteria 1735
970 Ga0316574_0836351 3300035398 Bacteria 559
971 Ga0373924_0054965 3300035410 Bacteria 1656
972 Ga0373924_0118153 3300035410 Bacteria 1149
973 Ga0373924_0312387 3300035410 Bacteria 698
974 Ga0373931_0015181 3300035691 Bacteria 3775
975 Ga0373931_0028076 3300035691 Bacteria 2878
976 Ga0373931_0048522 3300035691 Bacteria 2251
977 Ga0373931_0104755 3300035691 Bacteria 1596
978 Ga0373935_0002526 3300035692 Bacteria 10482
979 Ga0373935_0015252 3300035692 Bacteria 4643
980 Ga0373935_0104703 3300035692 Bacteria 1870
981 Ga0373927_0003380 3300035695 Bacteria 11492
982 Ga0373927_0231770 3300035695 Bacteria 1213
983 Ga0373927_0288792 3300035695 Bacteria 1079
984 Ga0373933_0001196 3300035724 Bacteria 15359
985 Ga0373933_0067405 3300035724 Bacteria 2171
986 Ga0373933_0102230 3300035724 Bacteria 1779
987 Ga0373933_0535502 3300035724 Bacteria 768
988 Ga0373947_0261201 3300035725 Bacteria 1147
989 Ga0373937_0001689 3300036401 Bacteria 18562
990 Ga0373937_0594156 3300036401 Bacteria 1051
991 Ga0316582_0000066 3300036647 Bacteria 26412
992 Ga0316582_0087534 3300036647 Bacteria 2044
993 Ga0316582_0209809 3300036647 Bacteria 1330
994 Ga0316582_0214810 3300036647 Bacteria 1314
995 Ga0316582_0229238 3300036647 Bacteria 1271
996 Ga0316584_0001073 3300036712 Bacteria 15985
997 Ga0316584_0004102 3300036712 Bacteria 9606
998 Ga0316584_0004310 3300036712 Bacteria 9407
999 Ga0316584_0015740 3300036712 Bacteria 5415
1000 Ga0316584_0030122 3300036712 Bacteria 4009
1001 Ga0316584_0062237 3300036712 Bacteria 2795
1002 Ga0316584_0184223 3300036712 Bacteria 1545
1003 Ga0316584_0241221 3300036712 Bacteria 1322
1004 Ga0373925_0003562 3300037068 Bacteria 12001
1005 Ga0395900_0546088 3300037418 Bacteria 1104
1006 Ga0395905_0000293 3300037471 Bacteria 73306
1007 Ga0395905_0007654 3300037471 Bacteria 10723
1008 Ga0395905_0221986 3300037471 Bacteria 1769
1009 Ga0395905_0377044 3300037471 Bacteria 1312
1010 Ga0395905_0462105 3300037471 Bacteria 1168
1011 Ga0395905_0494261 3300037471 Bacteria 1123
1012 Ga0237819_16747 3300038705 Bacteria 819
1013 Ga0400490_57581 3300038726 Bacteria 6829
1014 Ga0400485_17163 3300038735 Bacteria 43508
1015 Ga0400485_18026 3300038735 Bacteria 1831
1016 Ga0400488_50200 3300038741 Bacteria 9554
1017 Ga0400486_01662 3300038742 Bacteria 43450
1018 Ga0242420_063814 3300038996 Bacteria 739
1019 Ga0400489_14236 3300039093 Bacteria 4828
1020 Ga0400489_31446 3300039093 Bacteria 2453
1021 Ga0400487_10419 3300039110 Bacteria 1295
1022 Ga0400487_17601 3300039110 Bacteria 48398
1023 Ga0436365_0001200 3300039437 Bacteria 856
1024 Ga0436365_0261237 3300039437 Bacteria 3252
1025 Ga0436365_1454779 3300039437 Bacteria 4597
1026 Ga0436365_1685032 3300039437 Bacteria 686
1027 Ga0436360_0369279 3300039438 Bacteria 4330
1028 Ga0436360_0932224 3300039438 Bacteria 741
1029 Ga0436361_0175726 3300039447 Bacteria 5548
1030 Ga0436361_0823786 3300039447 Bacteria 33073
1031 Ga0436361_1034179 3300039447 Bacteria 3275
1032 Ga0436363_0533398 3300039450 Bacteria 3648
1033 Ga0436363_1569701 3300039450 Bacteria 8415
1034 Ga0451797_0453838 3300041453 Bacteria 1272
1035 Ga0451833_0076051 3300041491 Bacteria 745
1036 Ga0439446_0093751 3300042156 Bacteria 943
1037 Ga0439435_0113155 3300042436 Bacteria 844
1038 Ga0451577_0009319 3300042876 Bacteria 9463
1039 Ga0451577_0115367 3300042876 Bacteria 2405
1040 Ga0451577_0177133 3300042876 Bacteria 1922
1041 Ga0451577_0494716 3300042876 Bacteria 1110
1042 Ga0466969_0067414 3300044656 Bacteria 1727
1043 Ga0453683_0000058 3300044673 Bacteria 189089
1044 Ga0453683_0024122 3300044673 Bacteria 3874
1045 Ga0466966_0012789 3300044684 Bacteria 5560
1046 Ga0466963_0013437 3300044694 Bacteria 5028
1047 Ga0466963_0166716 3300044694 Bacteria 1534
1048 Ga0466963_0167080 3300044694 Bacteria 1533
1049 Ga0466963_0258200 3300044694 Bacteria 1223
1050 Ga0466963_0299289 3300044694 Bacteria 1131
1051 Ga0466963_0342599 3300044694 Bacteria 1052
1052 Ga0466963_0456718 3300044694 Bacteria 901
1053 Ga0453684_0014465 3300044712 Bacteria 12621
1054 Ga0453684_0206673 3300044712 Bacteria 2285
1055 Ga0453684_0881976 3300044712 Bacteria 959
1056 Ga0453684_1215318 3300044712 Bacteria 790
1057 Ga0466971_0088660 3300044719 Bacteria 1415
1058 Ga0466957_0179777 3300044842 Bacteria 1381
1059 Ga0466957_0190686 3300044842 Bacteria 1343
1060 Ga0451576_0021438 3300045051 Bacteria 7023
1061 Ga0451576_0678964 3300045051 Bacteria 1082
1062 Ga0451576_0724718 3300045051 Unclassified 1045
1063 Ga0451576_0754920 3300045051 Bacteria 1022
1064 Ga0466958_0409435 3300045836 Bacteria 876
1065 Ga0466967_0206840 3300045976 Bacteria 1860
1066 Ga0466967_0280872 3300045976 Bacteria 1597
1067 Ga0466967_0593921 3300045976 Bacteria 1092
1068 Ga0466967_0888433 3300045976 Bacteria 886
1069 Ga0466967_1205269 3300045976 Bacteria 754
1070 Ga0495592_0237790 3300046454 Bacteria 1210
1071 Ga0495603_0005735 3300046455 Bacteria 7427
1072 Ga0495638_0005254 3300046460 Bacteria 9669
1073 Ga0495638_0393440 3300046460 Bacteria 721
1074 Ga0495641_0013923 3300046461 Bacteria 4384
1075 Ga0495580_0005430 3300046472 Bacteria 10532
1076 Ga0495580_0006518 3300046472 Bacteria 9499
1077 Ga0495580_0011543 3300046472 Bacteria 6833
1078 Ga0495580_0029864 3300046472 Bacteria 3953
1079 Ga0495580_0037783 3300046472 Bacteria 3462
1080 Ga0495580_0066022 3300046472 Bacteria 2534
1081 Ga0495580_0076587 3300046472 Bacteria 2333
1082 Ga0495580_0109697 3300046472 Bacteria 1916
1083 Ga0495580_0196395 3300046472 Bacteria 1391
1084 Ga0495580_0292534 3300046472 Bacteria 1110
1085 Ga0495580_0476231 3300046472 Bacteria 835
1086 Ga0495582_0000133 3300046473 Bacteria 39882
1087 Ga0495605_0049612 3300046474 Bacteria 2050
1088 Ga0495639_0037105 3300046475 Bacteria 2184
1089 Ga0495585_0058734 3300046492 Bacteria 2122
1090 Ga0495585_0230074 3300046492 Bacteria 932
1091 Ga0495594_0027035 3300046499 Bacteria 3091
1092 Ga0495594_0065481 3300046499 Bacteria 2015
1093 Ga0495583_0019840 3300046506 Bacteria 3499
1094 Ga0495610_0010253 3300046512 Bacteria 5838
1095 Ga0495631_0005948 3300046518 Bacteria 6346
1096 Ga0495631_0018464 3300046518 Bacteria 3282
1097 Ga0495644_0000015 3300046523 Bacteria 89336
1098 Ga0495652_0118600 3300046529 Bacteria 2114
1099 Ga0495665_0029914 3300046531 Bacteria 2916
1100 Ga0495640_0082216 3300046533 Bacteria 2139
1101 Ga0495586_0021497 3300046535 Bacteria 3440
1102 Ga0495587_0002546 3300046536 Bacteria 12190
1103 Ga0495609_0011878 3300046538 Bacteria 4139
1104 Ga0495609_0030292 3300046538 Bacteria 2463
1105 Ga0495645_0116079 3300046543 Bacteria 1890
1106 Ga0495633_0032625 3300046558 Bacteria 2515
1107 Ga0495633_0204350 3300046558 Bacteria 906
1108 Ga0495656_0029883 3300046615 Bacteria 2198
1109 Ga0495668_0040960 3300046616 Bacteria 2582
1110 Ga0495611_0029649 3300046648 Bacteria 2400
1111 Ga0495625_0011188 3300046660 Bacteria 7341
1112 Ga0495625_0399493 3300046660 Bacteria 859
1113 Ga0495635_0089167 3300046663 Bacteria 2110
1114 Ga0495623_0037309 3300046679 Bacteria 3111
1115 Ga0495623_0209744 3300046679 Bacteria 1116
1116 Ga0495623_0313750 3300046679 Bacteria 863
1117 Ga0495646_0019554 3300046680 Bacteria 4285
1118 Ga0495669_0002696 3300046684 Bacteria 7276
1119 Ga0495669_0025427 3300046684 Bacteria 2582
1120 Ga0495669_0183217 3300046684 Bacteria 998
1121 Ga0495669_0370796 3300046684 Bacteria 692
1122 Ga0495613_0023739 3300046689 Bacteria 4570
1123 Ga0495613_0126633 3300046689 Bacteria 1831
1124 Ga0495671_0193976 3300046692 Bacteria 986
1125 Ga0495589_0104429 3300046794 Bacteria 1370
1126 Ga0495600_0157448 3300046809 Bacteria 1469
1127 Ga0495660_0021351 3300046810 Bacteria 3708
1128 Ga0495581_0047764 3300047315 Bacteria 2473
1129 Ga0495604_0000910 3300047317 Bacteria 24583
1130 Ga0495674_0144941 3300047319 Bacteria 1994
1131 Ga0495672_0056919 3300047320 Bacteria 2272
1132 Ga0495683_0082537 3300047323 Bacteria 1566
1133 Ga0495679_026130 3300047446 Bacteria 1943
1134 Ga0495684_0035045 3300047471 Bacteria 3850
1135 Ga0495602_0189038 3300048088 Bacteria 1581
1136 Ga0495602_0198103 3300048088 Bacteria 1534
1137 Ga0496100_0064043 3300048903 Bacteria 2432
1138 Ga0496100_0641350 3300048903 Bacteria 827
1139 Ga0496101_0043147 3300048904 Bacteria 3222
1140 Ga0496102_0072345 3300048905 Bacteria 3168
1141 Ga0496102_0077132 3300048905 Bacteria 3067
1142 Ga0496102_0261235 3300048905 Bacteria 1632
1143 Ga0496102_0358807 3300048905 Bacteria 1372
1144 Ga0496103_0077440 3300048906 Bacteria 2087
1145 Ga0496104_0001058 3300048907 Bacteria 23466
1146 Ga0496104_0024241 3300048907 Bacteria 5581
1147 Ga0496104_0075030 3300048907 Bacteria 3220
1148 Ga0496104_0339093 3300048907 Bacteria 1416
1149 Ga0496104_0638341 3300048907 Bacteria 974
1150 Ga0496105_0003561 3300048908 Bacteria 11550
1151 Ga0496105_0206590 3300048908 Bacteria 1602
1152 Ga0496105_0265445 3300048908 Bacteria 1387
1153 Ga0496105_0568666 3300048908 Bacteria 883
1154 Ga0496106_0093047 3300048909 Bacteria 2329
1155 Ga0496106_0366767 3300048909 Bacteria 1157
1156 Ga0496106_0521550 3300048909 Bacteria 954
1157 Ga0496107_0285074 3300048910 Bacteria 1229
1158 Ga0496108_0000319 3300048911 Bacteria 40722
1159 Ga0496108_0006344 3300048911 Bacteria 9583
1160 Ga0496108_0067945 3300048911 Bacteria 3006
1161 Ga0496108_0075338 3300048911 Bacteria 2851
1162 Ga0496109_0000157 3300048912 Bacteria 66192
1163 Ga0496109_0021538 3300048912 Bacteria 5701
1164 Ga0496109_0126078 3300048912 Bacteria 2387
1165 Ga0496109_0807817 3300048912 Bacteria 876
1166 Ga0496109_0966009 3300048912 Bacteria 790
1167 Ga0496110_0000078 3300048913 Bacteria 50473
1168 Ga0496110_0086271 3300048913 Bacteria 2802
1169 Ga0496110_0087724 3300048913 Bacteria 2778
1170 Ga0496110_0296498 3300048913 Bacteria 1473
1171 Ga0496111_0012083 3300048914 Bacteria 5838
1172 Ga0496111_0046600 3300048914 Bacteria 3121
1173 Ga0496111_0142210 3300048914 Bacteria 1778
1174 Ga0496112_0000038 3300048915 Bacteria 94892
1175 Ga0496112_0001454 3300048915 Bacteria 18184
1176 Ga0496112_0004466 3300048915 Bacteria 11859
1177 Ga0496112_0029489 3300048915 Bacteria 5306
1178 Ga0496112_0034173 3300048915 Bacteria 4947
1179 Ga0496112_0064541 3300048915 Bacteria 3613
1180 Ga0496112_0101555 3300048915 Bacteria 2846
1181 Ga0496112_0136804 3300048915 Bacteria 2420
1182 Ga0496112_0157921 3300048915 Bacteria 2234
1183 Ga0496112_0243771 3300048915 Bacteria 1749
1184 Ga0496112_0372889 3300048915 Bacteria 1369
1185 Ga0496113_0000064 3300048916 Bacteria 45691
1186 Ga0496113_0047461 3300048916 Bacteria 3191
1187 Ga0496113_0175273 3300048916 Bacteria 1699
1188 Ga0496113_0336997 3300048916 Bacteria 1210
1189 Ga0496113_0481639 3300048916 Bacteria 997
1190 Ga0496113_0663823 3300048916 Bacteria 833
1191 Ga0496114_0012085 3300048917 Bacteria 6909
1192 Ga0496115_0011441 3300048918 Bacteria 6651
1193 Ga0496119_0000174 3300048922 Bacteria 89804
1194 Ga0496120_0000253 3300048923 Bacteria 89798
1195 Ga0496121_0027466 3300048924 Bacteria 5326
1196 Ga0496124_0017271 3300048927 Bacteria 6806
1197 Ga0496124_0036238 3300048927 Bacteria 4305
1198 Ga0496124_0120096 3300048927 Bacteria 2101
1199 Ga0496125_0000162 3300048928 Bacteria 149093
1200 Ga0496125_0036192 3300048928 Bacteria 4314
1201 Ga0496125_0077270 3300048928 Bacteria 2567
1202 Ga0496125_0085531 3300048928 Bacteria 2389
1203 Ga0496126_0002736 3300048929 Bacteria 23301
1204 Ga0495682_0139668 3300049460 Bacteria 865
1205 Ga0501031_0030121 3300049568 Bacteria 3539
1206 Ga0501031_0213124 3300049568 Bacteria 1258
1207 Ga0501032_0000973 3300049569 Bacteria 23175
1208 Ga0501032_0056886 3300049569 Bacteria 2628
1209 Ga0501033_0003887 3300049570 Bacteria 12143
1210 Ga0501033_0007719 3300049570 Bacteria 8345
1211 Ga0501034_0001689 3300049571 Bacteria 28443
1212 Ga0501034_0011024 3300049571 Bacteria 9383
1213 Ga0501034_0012650 3300049571 Bacteria 8707
1214 Ga0501034_0019726 3300049571 Bacteria 6891
1215 Ga0501034_0091902 3300049571 Bacteria 3032
1216 Ga0501034_0135309 3300049571 Bacteria 2445
1217 Ga0501036_0019750 3300049572 Bacteria 5658
1218 Ga0501037_0001543 3300049573 Bacteria 16806
1219 Ga0501038_0008430 3300049574 Bacteria 9483
1220 Ga0501038_0523743 3300049574 Bacteria 904
1221 Ga0501040_0000116 3300049576 Bacteria 42224
1222 Ga0501040_0032079 3300049576 Bacteria 3554
1223 Ga0501041_0158617 3300049577 Bacteria 1414
1224 Ga0501042_0000125 3300049578 Bacteria 33043
1225 Ga0501043_0024168 3300049579 Bacteria 4768
1226 Ga0501043_0059054 3300049579 Bacteria 3009
1227 Ga0501043_0125116 3300049579 Bacteria 2016
1228 Ga0501046_0000731 3300049580 Bacteria 31748
1229 Ga0501047_0008742 3300049581 Bacteria 9556
1230 Ga0501047_0017626 3300049581 Bacteria 6843
1231 Ga0501070_0019673 3300049586 Bacteria 5661
1232 Ga0501070_0332844 3300049586 Bacteria 1234
1233 Ga0501070_0365838 3300049586 Bacteria 1169
1234 Ga0501071_0013601 3300049587 Bacteria 5550
1235 Ga0501071_0135171 3300049587 Bacteria 1834
1236 Ga0501072_0134318 3300049588 Bacteria 1973
1237 Ga0501072_0298175 3300049588 Bacteria 1281
1238 Ga0501073_0004858 3300049589 Bacteria 10088
1239 Ga0501073_0014887 3300049589 Bacteria 5644
1240 Ga0501073_0681251 3300049589 Bacteria 709
1241 Ga0501074_0019539 3300049590 Bacteria 4918
1242 Ga0501074_0076371 3300049590 Bacteria 2404
1243 Ga0501075_0009859 3300049591 Bacteria 6695
1244 Ga0501075_0123385 3300049591 Bacteria 1972
1245 Ga0501075_0200012 3300049591 Bacteria 1524
1246 Ga0501075_0372846 3300049591 Bacteria 1088
1247 Ga0501076_0009934 3300049592 Bacteria 7035
1248 Ga0501076_0050250 3300049592 Bacteria 3298
1249 Ga0501076_0299932 3300049592 Bacteria 1317
1250 Ga0501077_0009941 3300049593 Bacteria 5921
1251 Ga0501077_0200337 3300049593 Bacteria 1268
1252 Ga0501077_0207376 3300049593 Bacteria 1245
1253 Ga0501217_012416 3300049661 Bacteria 1897
1254 Ga0501079_0005627 3300049741 Bacteria 9353
1255 Ga0501080_0005086 3300049742 Bacteria 11720
1256 Ga0501081_0009080 3300049743 Bacteria 6467
1257 Ga0501083_0063116 3300049744 Bacteria 2471
1258 Ga0501241_016205 3300049758 Bacteria 1358
1259 Ga0501035_0003026 3300049822 Bacteria 16115
1260 Ga0501035_0007843 3300049822 Bacteria 9978
1261 Ga0501035_0122226 3300049822 Bacteria 2275
1262 Ga0501035_0172256 3300049822 Bacteria 1869
1263 Ga0501035_0434594 3300049822 Bacteria 1088
1264 Ga0501044_0001659 3300049823 Bacteria 26121
1265 Ga0501044_0016221 3300049823 Bacteria 8008
1266 Ga0501044_0135913 3300049823 Bacteria 2450
1267 Ga0501044_0379651 3300049823 Bacteria 1328
1268 Ga0501045_0129350 3300049824 Bacteria 1877
1269 Ga0501045_0157116 3300049824 Bacteria 1692
1270 nmdc:mga0k408_10493_c2 3300050493 Bacteria 3320
1271 nmdc:mga05p37_117993_c1 3300050507 Bacteria 3261
1272 nmdc:mga05p37_174464_c1 3300050507 Bacteria 2620
1273 nmdc:mga05p37_408391_c1 3300050507 Bacteria 1584
1274 nmdc:mga05p37_4404_c1 3300050507 Bacteria 16454
1275 nmdc:mga05p37_44905_c1 3300050507 Bacteria 5436
1276 nmdc:mga05p37_73073_c1 3300050507 Bacteria 4221
1277 nmdc:mga05p37_796518_c1 3300050507 Bacteria 1035
1278 nmdc:mga09592_115103_c1 3300050508 Bacteria 2308
1279 nmdc:mga09592_405833_c1 3300050508 Bacteria 1178
1280 nmdc:mga0qj67_10008_c1 3300050509 Bacteria 7072
1281 nmdc:mga0qj67_156136_c1 3300050509 Bacteria 1852
1282 nmdc:mga0qj67_72618_c1 3300050509 Bacteria 2748
1283 nmdc:mga06r32_171740_c1 3300050510 Bacteria 2152
1284 nmdc:mga06r32_718685_c1 3300050510 Bacteria 964
1285 nmdc:mga08y16_1027673_c1 3300050511 Bacteria 803
1286 nmdc:mga08y16_12850_c1 3300050511 Bacteria 8804
1287 nmdc:mga08y16_24065_c1 3300050511 Bacteria 6430
1288 nmdc:mga0n895_219_c1 3300050512 Bacteria 36032
1289 nmdc:mga0n895_22563_c1 3300050512 Bacteria 5903
1290 nmdc:mga0n895_256791_c1 3300050512 Bacteria 1774
1291 nmdc:mga0n895_500945_c1 3300050512 Bacteria 1223
1292 nmdc:mga0n895_525518_c1 3300050512 Bacteria 1191
1293 nmdc:mga0n895_60612_c1 3300050512 Bacteria 3734
1294 nmdc:mga0n895_819321_c1 3300050512 Bacteria 920
1295 nmdc:mga0n895_890010_c1 3300050512 Bacteria 876
1296 nmdc:mga0rr50_1025591_c1 3300050513 Bacteria 703
1297 nmdc:mga0rr50_15194_c1 3300050513 Bacteria 5076
1298 nmdc:mga0rr50_211902_c1 3300050513 Bacteria 1596
1299 nmdc:mga0rr50_420274_c1 3300050513 Bacteria 1131
1300 nmdc:mga0rr50_5126_c1 3300050513 Bacteria 7780
1301 nmdc:mga0rr50_63914_c1 3300050513 Bacteria 2781
1302 nmdc:mga08x19_110649_c1 3300050514 Bacteria 1832
1303 nmdc:mga08x19_13151_c1 3300050514 Bacteria 4998
1304 nmdc:mga08x19_70723_c1 3300050514 Bacteria 2274
1305 nmdc:mga0a205_29179_c1 3300050515 Bacteria 5280
1306 nmdc:mga0a205_33459_c1 3300050515 Bacteria 4928
1307 nmdc:mga0a205_371539_c1 3300050515 Bacteria 1296
1308 nmdc:mga0a205_384910_c1 3300050515 Bacteria 1267
1309 nmdc:mga0a205_406633_c1 3300050515 Bacteria 1225
1310 nmdc:mga0a205_41124_c1 3300050515 Bacteria 4452
1311 nmdc:mga0a205_431201_c1 3300050515 Bacteria 1180
1312 nmdc:mga0a205_506303_c1 3300050515 Bacteria 1064
1313 nmdc:mga0a205_7468_c1 3300050515 Bacteria 9307
1314 nmdc:mga0a205_97138_c1 3300050515 Bacteria 2845
1315 Ga0495601_0167511 3300053077 Bacteria 1436
1316 Ga0495619_0039581 3300053085 Bacteria 3078
1317 Ga0500616_0003860 3300053153 Bacteria 11066
1318 Ga0500634_0198537 3300053161 Bacteria 884
1319 Ga0501084_0003210 3300054114 Bacteria 13242
1320 Ga0501084_0015269 3300054114 Bacteria 6368
1321 Ga0501084_0019099 3300054114 Bacteria 5709
1322 Ga0501082_0003375 3300060353 Bacteria 13939
1323 Ga0501082_0015433 3300060353 Bacteria 6574
1324 Ga0501082_0129780 3300060353 Bacteria 2187
1325 Ga0466962_0019175 3300061719 Bacteria 3284
1326 Ga0530510_0003630 3300061734 Bacteria 10616
1327 Ga0530510_0075434 3300061734 Bacteria 2449
1328 Ga0530510_0093991 3300061734 Bacteria 2190
1329 2599411864 2599185169 Bacteria 5441380
1330 2601524463 2600255254 Bacteria 5281859
1331 2601529617 2600255255 Bacteria 5282785
1332 2601616451 2600255280 Bacteria 5292309
1333 2601621173 2600255281 Bacteria 5288753
1334 2601646152 2600255287 Bacteria 5210468
1335 2601649570 2600255288 Bacteria 5282738
1336 2601654497 2600255289 Bacteria 5281907
1337 2601660229 2600255290 Bacteria 5282218
1338 2601664266 2600255291 Bacteria 5217298
1339 2601699160 2600255298 Bacteria 5215185
1340 2601702569 2600255299 Bacteria 5218662
1341 2601707241 2600255300 Bacteria 5287774
1342 2601712262 2600255301 Bacteria 5280532
1343 2601717758 2600255302 Bacteria 5288235
1344 2601723072 2600255303 Bacteria 5219315
1345 2601727686 2600255304 Bacteria 5283973
1346 2601732703 2600255305 Bacteria 5282329
1347 2601737528 2600255306 Bacteria 5281613
1348 2601741947 2600255307 Bacteria 5439064
1349 2601752845 2600255309 Bacteria 5431045
1350 2602021807 2600255392 Bacteria 5437392
1351 2603662430 2602042052 Bacteria 5215873
1352 2603667326 2602042053 Bacteria 5214361
1353 2603840112 2602042103 Bacteria 5284714
1354 2603845189 2602042104 Bacteria 5281639
1355 2603850262 2602042105 Bacteria 5282303
1356 2603855330 2602042106 Bacteria 5282744
1357 2603868412 2602042109 Bacteria 5152801
1358 2603873222 2602042110 Bacteria 5283285
1359 2603878137 2602042111 Bacteria 5212080
1360 2606050091 2603880178 Bacteria 5283018
1361 2606071755 2603880184 Bacteria 5217896
1362 2606147774 2603880202 Bacteria 5284684
1363 2606178291 2603880211 Bacteria 5284226
1364 2621297133 2619619299 Bacteria 6649820
1365 2637222992 2636415599 Bacteria 5718434
1366 2643818466 2643221559 Bacteria 4424915
1367 2643880667 2643221573 Bacteria 4784121
1368 2643938393 2643221586 Bacteria 4446529
1369 2644079044 2643221612 Bacteria 4361984
1370 2644661238 2643221720 Bacteria 4694283
1371 2644693821 2643221727 Bacteria 4415595
1372 2644699315 2643221728 Bacteria 4797149
1373 2676408728 2675903046 Bacteria 5451247
1374 2686995266 2684623153 Bacteria 3878815
1375 2687234971 2684623219 Bacteria 8442773
1376 2738671952 2738541265 Bacteria 6594665
1377 2738716207 2738541276 Bacteria 4690596
1378 2738750346 2738541282 Bacteria 6593925
1379 2738859386 2738541303 Bacteria 6591772
1380 2774131164 2773857672 Bacteria 4993178
1381 2777021331 2775507074 Bacteria 5532402
1382 2817493754 2816332298 Bacteria 6852809
1383 2852651852 2852649853 Bacteria 4036942
1384 2884218054 2884215851 Bacteria 4554841
1385 2904517992 2904513164 Bacteria 5476410
1386 2917836436 2917832318 Bacteria 5346010
1387 2919126542 2919125081 Bacteria 5385106
1388 2919515643 2919513703 Bacteria 3844312
1389 2919678359 2919675420 Bacteria 3969095
1390 2939623738 2939622612 Bacteria 4698046
1391 2941478489 2941475908 Bacteria 4145589
1392 2969080019 2969079654 Bacteria 5439582
1393 2974302767 2974298342 Bacteria 4840922
1394 2984499647 2984499530 Bacteria 5020881
1395 2984506893 2984504281 Bacteria 5262371
1396 2984562473 2984559226 Bacteria 5683096
1397 2984600533 2984595703 Bacteria 5682994
1398 3006975070 3006973921 Bacteria 4423788
1399 8016731053 8016728285 Bacteria 5263933
1400 8055823597 8055817908 Bacteria 6609162
1401 Ga0068860_100114325
1402 JGI24752J21851_1000650
1403 JGI24737J22298_10062562
1404 JGI24743J22301_10017797
1405 JGI24735J21928_10031651
1406 JGI24751J29686_10002240
1407 JGI25406J46586_10034709
1408 rootH1_10038406
1409 Ga0055526_1024061
1410 Ga0055537_1000149
1411 Ga0055536_1035424
1412 Ga0058692_1011227
1413 Ga0065712_10009377
1414 Ga0065712_10078052
1415 Ga0065707_10103873
1416 Ga0070658_10061551
1417 Ga0070658_10239517
1418 Ga0070658_10259800
1419 Ga0070658_10314824
1420 Ga0070676_10102753
1421 Ga0070676_10233614
1422 Ga0070683_100005535
1423 Ga0070683_100011335
1424 Ga0070683_100072776
1425 Ga0070683_100194924
1426 Ga0070683_100256339
1427 Ga0070683_100376306
1428 Ga0070683_100540844
1429 Ga0070690_100002873
1430 Ga0070690_100015460
1431 Ga0070690_100055841
1432 Ga0070690_100081392
1433 Ga0070670_100001994
1434 Ga0070670_100085671
1435 Ga0070670_100324572
1436 Ga0070670_100668670
1437 Ga0070677_10013893
1438 Ga0068869_100015244
1439 Ga0068869_100048422
1440 Ga0068869_100176047
1441 Ga0070666_10000661
1442 Ga0070666_10066656
1443 Ga0070680_100286675
1444 Ga0070680_100341735
1445 Ga0070680_100570007
1446 Ga0070682_100006928
1447 Ga0070682_100180582
1448 Ga0070682_100363945
1449 Ga0068868_100000504
1450 Ga0068868_100017206
1451 Ga0068868_100041741
1452 Ga0068868_100057085
1453 Ga0068868_100079154
1454 Ga0070660_100002867
1455 Ga0070660_100025266
1456 Ga0070660_100035205
1457 Ga0070689_100709587
1458 Ga0070687_100012708
1459 Ga0070661_100024795
1460 Ga0070661_100031525
1461 Ga0070661_100061451
1462 Ga0070661_100273825
1463 Ga0070692_10100191
1464 Ga0070668_100009641
1465 Ga0070668_100016265
1466 Ga0070668_100022820
1467 Ga0070669_100262422
1468 Ga0070669_100717362
1469 Ga0070669_100829798
1470 Ga0070675_100022011
1471 Ga0070671_100028977
1472 Ga0070671_100048259
1473 Ga0070674_100004017
1474 Ga0070674_100427599
1475 Ga0070674_100535697
1476 Ga0070673_100029452
1477 Ga0070673_100066374
1478 Ga0070673_100077101
1479 Ga0070673_100164469
1480 Ga0070673_100464665
1481 Ga0070688_100012103
1482 Ga0070688_101043035
1483 Ga0070659_100000441
1484 Ga0070659_100037235
1485 Ga0070659_100062741
1486 Ga0070659_100383491
1487 Ga0070667_100000600
1488 Ga0070667_100017478
1489 Ga0070667_100136457
1490 Ga0070667_100143615
1491 Ga0070667_100231688
1492 Ga0070667_100372408
1493 Ga0070709_10005028
1494 Ga0070709_10019229
1495 Ga0070709_10022512
1496 Ga0070709_10109546
1497 Ga0070709_10111775
1498 Ga0070709_10120662
1499 Ga0070709_10197930
1500 Ga0070714_100027851
1501 Ga0070714_100156782
1502 Ga0070714_100226535
1503 Ga0070714_100550288
1504 Ga0070713_100000114
1505 Ga0070713_100007883
1506 Ga0070713_100016681
1507 Ga0070713_100018928
1508 Ga0070713_100224194
1509 Ga0070713_100275971
1510 Ga0070713_100471899
1511 Ga0070713_100800630
1512 Ga0070713_100859813
1513 Ga0070713_100970027
1514 Ga0070710_10002299
1515 Ga0070710_10149885
1516 Ga0070710_10394928
1517 Ga0070711_100000079
1518 Ga0070711_100063062
1519 Ga0070711_101297572
1520 Ga0070705_100037016
1521 Ga0070700_100203178
1522 Ga0070694_100211912
1523 Ga0070694_100806629
1524 Ga0070708_100007624
1525 Ga0070708_100017236
1526 Ga0070708_100019283
1527 Ga0070708_100032809
1528 Ga0070708_100041725
1529 Ga0070708_100072878
1530 Ga0070708_100099478
1531 Ga0070708_100115612
1532 Ga0070708_100296677
1533 Ga0070708_100589993
1534 Ga0070708_101140121
1535 Ga0070708_101512150
1536 Ga0070708_101524037
1537 Ga0070663_100218346
1538 Ga0070678_100103712
1539 Ga0070662_100011640
1540 Ga0070662_100322788
1541 Ga0070681_10000642
1542 Ga0070681_10011678
1543 Ga0070681_10016194
1544 Ga0070681_10262055
1545 Ga0070681_10303161
1546 Ga0070681_10324808
1547 Ga0070681_10405412
1548 Ga0070681_10641871
1549 Ga0070681_10715097
1550 Ga0068867_100004954
1551 Ga0068867_100024665
1552 Ga0068867_100060574
1553 Ga0070685_10018857
1554 Ga0070706_100000496
1555 Ga0070706_100000955
1556 Ga0070706_100028459
1557 Ga0070706_100040073
1558 Ga0070706_100157284
1559 Ga0070706_100391676
1560 Ga0070707_100004175
1561 Ga0070707_100004753
1562 Ga0070707_100005558
1563 Ga0070707_100082927
1564 Ga0070707_100159304
1565 Ga0070707_100248320
1566 Ga0070707_100251853
1567 Ga0070707_100297150
1568 Ga0070707_100433974
1569 Ga0070707_100504240
1570 Ga0070707_100662898
1571 Ga0070698_100000012
1572 Ga0070698_100000017
1573 Ga0070698_100001685
1574 Ga0070698_100006862
1575 Ga0070698_100040622
1576 Ga0070698_100065165
1577 Ga0070698_100153734
1578 Ga0070698_100254312
1579 Ga0070699_100006774
1580 Ga0070699_100041263
1581 Ga0070699_100084830
1582 Ga0070699_100689739
1583 Ga0070679_100012676
1584 Ga0070679_100053788
1585 Ga0070679_100339985
1586 Ga0070679_100410943
1587 Ga0070679_100424446
1588 Ga0070684_100019600
1589 Ga0070684_100025303
1590 Ga0070684_100171598
1591 Ga0070684_100187089
1592 Ga0070697_100000873
1593 Ga0070697_100007553
1594 Ga0070697_100008250
1595 Ga0070697_100017259
1596 Ga0070697_100017646
1597 Ga0070697_100023354
1598 Ga0070697_100053091
1599 Ga0070697_100075525
1600 Ga0070697_100156419
1601 Ga0070697_100520075
1602 Ga0070697_100678662
1603 Ga0070697_100911080
1604 Ga0070697_101152232
1605 Ga0068853_100000021
1606 Ga0068853_100007555
1607 Ga0068853_100113553
1608 Ga0068853_100122534
1609 Ga0070672_100390524
1610 Ga0070686_100253314
1611 Ga0070695_100147961
1612 Ga0070695_100207944
1613 Ga0070695_100269279
1614 Ga0070696_100007647
1615 Ga0070696_100115687
1616 Ga0070696_100135388
1617 Ga0070693_100021064
1618 Ga0070693_100054370
1619 Ga0070693_100100776
1620 Ga0070693_100119601
1621 Ga0070665_100279358
1622 Ga0070665_100798245
1623 Ga0070704_100144686
1624 Ga0070704_100383974
1625 Ga0070704_100480180
1626 Ga0068855_100004030
1627 Ga0068855_100021151
1628 Ga0068855_100045941
1629 Ga0068855_100048051
1630 Ga0068855_100102272
1631 Ga0068855_100108155
1632 Ga0068855_100111413
1633 Ga0068855_100217176
1634 Ga0068855_100279099
1635 Ga0068855_100521175
1636 Ga0068855_100792066
1637 Ga0068855_100955485
1638 Ga0068855_101040517
1639 Ga0068855_101122042
1640 Ga0070664_100000740
1641 Ga0070664_100699940
1642 Ga0070664_100711765
1643 Ga0068857_100000267
1644 Ga0068857_100002375
1645 Ga0068857_100100451
1646 Ga0068857_100478199
1647 Ga0068857_100718617
1648 Ga0068857_100769593
1649 Ga0068857_101119497
1650 Ga0068854_100000075
1651 Ga0068854_100023364
1652 Ga0068854_100162470
1653 Ga0068854_100338409
1654 Ga0068856_100000269
1655 Ga0068856_100002494
1656 Ga0068856_100005791
1657 Ga0068856_100043287
1658 Ga0068856_100051572
1659 Ga0068856_100121153
1660 Ga0068856_100133325
1661 Ga0068856_100209044
1662 Ga0068856_100209101
1663 Ga0068856_100315781
1664 Ga0068856_100810903
1665 Ga0068856_100842084
1666 Ga0070702_100001604
1667 Ga0070702_100359896
1668 Ga0070702_100376419
1669 Ga0068852_100025621
1670 Ga0068852_100116269
1671 Ga0068852_100318991
1672 Ga0068859_100000431
1673 Ga0068859_100055276
1674 Ga0068859_100157039
1675 Ga0068859_100584780
1676 Ga0068864_100036410
1677 Ga0068864_100061894
1678 Ga0068866_10064075
1679 Ga0068866_10106189
1680 Ga0068861_100058704
1681 Ga0068861_100808501
1682 Ga0068851_10021663
1683 Ga0068851_10071374
1684 Ga0068851_10304219
1685 Ga0068870_10003679
1686 Ga0068870_10006265
1687 Ga0068863_100013702
1688 Ga0068863_100033779
1689 Ga0068863_100068166
1690 Ga0068863_100418270
1691 Ga0068858_100000940
1692 Ga0068858_100001833
1693 Ga0068858_100022771
1694 Ga0068858_100096556
1695 Ga0068858_100103209
1696 Ga0068858_100545820
1697 Ga0068858_100610848
1698 Ga0068860_100024142
1699 Ga0068860_100098924
1700 Ga0068860_100234677
1701 Ga0068860_100246000
1702 Ga0068860_100472801
1703 Ga0068860_100542714
1704 Ga0068862_100649853
1705 Ga0081455_10001388
1706 Ga0081455_10203612
1707 Ga0081540_1062392
1708 Ga0081539_10000728
1709 Ga0081539_10060584
1710 Ga0070717_10004198
1711 Ga0070717_10057313
1712 Ga0070717_10259897
1713 Ga0070717_10382357
1714 Ga0075363_100147428
1715 Ga0075432_10007225
1716 Ga0070715_10118853
1717 Ga0070716_100006307
1718 Ga0070716_100006656
1719 Ga0070716_100029593
1720 Ga0070716_100033701
1721 Ga0070716_100135199
1722 Ga0070716_100140547
1723 Ga0070716_100284246
1724 Ga0070716_100350276
1725 Ga0070712_100000211
1726 Ga0070712_100042436
1727 Ga0070712_100494881
1728 Ga0070712_100527016
1729 Ga0070712_100872214
1730 Ga0075427_10005714
1731 Ga0097621_100000044
1732 Ga0097621_100000545
1733 Ga0097621_100011159
1734 Ga0097621_100024996
1735 Ga0097621_100118923
1736 Ga0097621_100424482
1737 Ga0068871_100000175
1738 Ga0068871_100010478
1739 Ga0068871_100020452
1740 Ga0068871_100042533
1741 Ga0068871_100102587
1742 Ga0068871_100167115
1743 Ga0068871_100326711
1744 Ga0075428_100067910
1745 Ga0075428_100343300
1746 Ga0075428_100361528
1747 Ga0075428_101469511
1748 Ga0075430_100010696
1749 Ga0075430_100082297
1750 Ga0075430_100209261
1751 Ga0075431_100012237
1752 Ga0075433_10005361
1753 Ga0075433_10007214
1754 Ga0075433_10009062
1755 Ga0075433_10014696
1756 Ga0075433_10084262
1757 Ga0075433_10378965
1758 Ga0075433_10562884
1759 Ga0075433_10849391
1760 Ga0075434_100000076
1761 Ga0075434_100002914
1762 Ga0075434_100010261
1763 Ga0075434_100026121
1764 Ga0075434_100223706
1765 Ga0075429_100113808
1766 Ga0075429_100706356
1767 Ga0068865_100016118
1768 Ga0068865_100018173
1769 Ga0068865_100025186
1770 Ga0068865_100068742
1771 Ga0068865_100367576
1772 Ga0075436_100011662
1773 Ga0075436_100018962
1774 Ga0075436_100219020
1775 Ga0097620_100000431
1776 Ga0097620_100055276
1777 Ga0097620_100157038
1778 Ga0097620_100584816
1779 Ga0075435_100000055
1780 Ga0075435_100002266
1781 Ga0075435_100015080
1782 Ga0075435_100054000
1783 Ga0075435_100224416
1784 Ga0075435_100290953
1785 Ga0099795_10056398
1786 Ga0105251_10035129
1787 Ga0105250_10000276
1788 Ga0105250_10150537
1789 Ga0105240_10002515
1790 Ga0105240_10004363
1791 Ga0105240_10005521
1792 Ga0105240_10015602
1793 Ga0105240_10052579
1794 Ga0105240_10242923
1795 Ga0105240_10374277
1796 Ga0111539_10011786
1797 Ga0111539_10073664
1798 Ga0111539_10159322
1799 Ga0111539_10502042
1800 Ga0111539_11428068
1801 Ga0111539_11919754
1802 Ga0105245_10014641
1803 Ga0105245_10083561
1804 Ga0105245_10107957
1805 Ga0105245_10232265
1806 Ga0105245_10587053
1807 Ga0105245_11127801
1808 Ga0105247_10022834
1809 Ga0105247_10689915
1810 Ga0114129_10008318
1811 Ga0114129_10014422
1812 Ga0114129_10022610
1813 Ga0114129_10053713
1814 Ga0114129_10682864
1815 Ga0114129_10722887
1816 Ga0114129_11199592
1817 Ga0105243_10028281
1818 Ga0105243_10296176
1819 Ga0105243_10886705
1820 Ga0105241_10001816
1821 Ga0105241_10062941
1822 Ga0105241_10125023
1823 Ga0105241_10175659
1824 Ga0105241_10282878
1825 Ga0105241_10778889
1826 Ga0105241_11065676
1827 Ga0105242_10127676
1828 Ga0105242_10134819
1829 Ga0105248_10007656
1830 Ga0105248_10009203
1831 Ga0105248_10074104
1832 Ga0105248_10156053
1833 Ga0105237_10004117
1834 Ga0105237_10011074
1835 Ga0105237_10038679
1836 Ga0105237_10091507
1837 Ga0105237_10477911
1838 Ga0105237_10491205
1839 Ga0105238_10000743
1840 Ga0105238_10061647
1841 Ga0105238_10132351
1842 Ga0105238_10186504
1843 Ga0105249_10108111
1844 Ga0105249_10217481
1845 Ga0105249_10474072
1846 Ga0099796_10000882
1847 Ga0105239_10079926
1848 Ga0105239_10094834
1849 Ga0105239_10201493
1850 Ga0105239_10474814
1851 Ga0105239_10608917
1852 Ga0105239_10828913
1853 Ga0105246_10238949
1854 Ga0105246_10242737
1855 Ga0157337_1000372
1856 Ga0157373_10005308
1857 Ga0157373_10063488
1858 Ga0157371_10007963
1859 Ga0157371_10014239
1860 Ga0157371_10193238
1861 Ga0157371_10249094
1862 Ga0157371_10413811
1863 Ga0157371_10608664
1864 Ga0157370_10254749
1865 Ga0157370_10298999
1866 Ga0157370_10541587
1867 Ga0157370_10826117
1868 Ga0157369_10000231
1869 Ga0157369_10000319
1870 Ga0157369_10005543
1871 Ga0157369_10120102
1872 Ga0157369_10265990
1873 Ga0157369_10268297
1874 Ga0157369_10914059
1875 Ga0157369_10916146
1876 Ga0157369_11118949
1877 Ga0157374_10000299
1878 Ga0157374_10000756
1879 Ga0157374_10001394
1880 Ga0157374_10010350
1881 Ga0157374_10023781
1882 Ga0157374_10039002
1883 Ga0157374_10053108
1884 Ga0157374_10102210
1885 Ga0157374_10174393
1886 Ga0157374_10208177
1887 Ga0157378_10000073
1888 Ga0157378_10000222
1889 Ga0157378_10004962
1890 Ga0157378_10007445
1891 Ga0157378_10045793
1892 Ga0157378_10284800
1893 Ga0163162_10129426
1894 Ga0163162_10169897
1895 Ga0163162_10461584
1896 Ga0163162_10997910
1897 Ga0163162_11205135
1898 Ga0157372_10000559
1899 Ga0157372_10002399
1900 Ga0157372_10003262
1901 Ga0157372_10007072
1902 Ga0157372_10013225
1903 Ga0157372_10045174
1904 Ga0157372_10056971
1905 Ga0157372_10087452
1906 Ga0157372_10089704
1907 Ga0157372_10125545
1908 Ga0157372_10203409
1909 Ga0157372_10416566
1910 Ga0157372_10521870
1911 Ga0157372_10565792
1912 Ga0157372_10731665
1913 Ga0157372_11601033
1914 Ga0157375_10041855
1915 Ga0157375_10232117
1916 Ga0157375_10257143
1917 Ga0157375_10477922
1918 Ga0157375_10926379
1919 Ga0163163_10013371
1920 Ga0163163_10019682
1921 Ga0163163_10021989
1922 Ga0163163_10030798
1923 Ga0163163_10032156
1924 Ga0163163_10041561
1925 Ga0163163_10148927
1926 Ga0163163_10748137
1927 Ga0163163_10818416
1928 Ga0163163_10903667
1929 Ga0157380_10366117
1930 Ga0182008_10007425
1931 Ga0182008_10016242
1932 Ga0157377_10002869
1933 Ga0157379_10000101
1934 Ga0157379_10001379
1935 Ga0157379_10741705
1936 Ga0157376_10006528
1937 Ga0157376_10008992
1938 Ga0157376_10011649
1939 Ga0157376_10383636
1940 Ga0157376_10506457
1941 Ga0182006_1084453
1942 Ga0182007_10000052
1943 Ga0182007_10002110
1944 Ga0182005_1000929
1945 Ga0163161_10012859
1946 Ga0163161_10128033
1947 Ga0163161_10848801
1948 Ga0206352_10404164
1949 Ga0213872_10001314
1950 Ga0213872_10006401
1951 Ga0213872_10138644
1952 Ga0213874_10020175
1953 Ga0213871_10002272
1954 Ga0224572_1003411
1955 Ga0228598_1000137
1956 Ga0207656_10022091
1957 Ga0207656_10318419
1958 Ga0207696_1085302
1959 Ga0207682_10017839
1960 Ga0207692_10001224
1961 Ga0207710_10062652
1962 Ga0207647_10002035
1963 Ga0207647_10012919
1964 Ga0207647_10108859
1965 Ga0207685_10095995
1966 Ga0207685_10472403
1967 Ga0207699_10003962
1968 Ga0207699_10040002
1969 Ga0207699_10139497
1970 Ga0207699_10159785
1971 Ga0207699_10198383
1972 Ga0207699_10348067
1973 Ga0207645_10000450
1974 Ga0207643_10004594
1975 Ga0207705_10229697
1976 Ga0207705_10403214
1977 Ga0207684_10001079
1978 Ga0207684_10010310
1979 Ga0207684_10012423
1980 Ga0207684_10013493
1981 Ga0207654_10052893
1982 Ga0207654_10139415
1983 Ga0207654_10440806
1984 Ga0207707_10002539
1985 Ga0207707_10013653
1986 Ga0207707_10064089
1987 Ga0207707_10070264
1988 Ga0207707_10071238
1989 Ga0207707_10152475
1990 Ga0207707_10203714
1991 Ga0207707_10233033
1992 Ga0207695_10004398
1993 Ga0207695_10032088
1994 Ga0207695_10161833
1995 Ga0207671_10069552
1996 Ga0207671_10128514
1997 Ga0207693_10005542
1998 Ga0207693_10110600
1999 Ga0207693_10336439
2000 Ga0207693_10823710
2001 Ga0207663_10101481
2002 Ga0207663_10308608
2003 Ga0207660_10207138
2004 Ga0207660_10513643
2005 Ga0207662_10007359
2006 Ga0207657_10000382
2007 Ga0207657_10000415
2008 Ga0207657_10001641
2009 Ga0207649_10000699
2010 Ga0207652_10020296
2011 Ga0207652_10064861
2012 Ga0207652_10123801
2013 Ga0207652_10382380
2014 Ga0207652_10724602
2015 Ga0207646_10002735
2016 Ga0207646_10012699
2017 Ga0207646_10024477
2018 Ga0207646_10029066
2019 Ga0207646_10033309
2020 Ga0207646_10034593
2021 Ga0207646_10167091
2022 Ga0207646_10180106
2023 Ga0207646_10217579
2024 Ga0207646_10678359
2025 Ga0207646_10854335
2026 Ga0207681_10111139
2027 Ga0207694_10000619
2028 Ga0207694_10125933
2029 Ga0207694_10271336
2030 Ga0207650_10000124
2031 Ga0207650_10001441
2032 Ga0207650_10375377
2033 Ga0207650_10780621
2034 Ga0207659_10050898
2035 Ga0207687_10048962
2036 Ga0207687_10055498
2037 Ga0207687_10149936
2038 Ga0207700_10000018
2039 Ga0207700_10011398
2040 Ga0207700_10027688
2041 Ga0207700_10049703
2042 Ga0207700_10103759
2043 Ga0207700_10122191
2044 Ga0207700_10226461
2045 Ga0207700_10345694
2046 Ga0207700_10432839
2047 Ga0207700_10454848
2048 Ga0207700_10702627
2049 Ga0207700_11024353
2050 Ga0207664_10069992
2051 Ga0207664_10115104
2052 Ga0207664_10140066
2053 Ga0207664_10148805
2054 Ga0207664_10232467
2055 Ga0207664_10476152
2056 Ga0207664_10524978
2057 Ga0207664_10888488
2058 Ga0207644_10023204
2059 Ga0207644_10907556
2060 Ga0207690_10001363
2061 Ga0207690_10225438
2062 Ga0207690_10625897
2063 Ga0207706_10014430
2064 Ga0207706_10022635
2065 Ga0207706_10192323
2066 Ga0207686_10087581
2067 Ga0207686_10091032
2068 Ga0207686_10135908
2069 Ga0207709_10037794
2070 Ga0207709_10371632
2071 Ga0207709_10648904
2072 Ga0207670_10022198
2073 Ga0207670_10756374
2074 Ga0207669_10005789
2075 Ga0207669_10269596
2076 Ga0207669_10431912
2077 Ga0207704_10009764
2078 Ga0207704_10011932
2079 Ga0207704_10034228
2080 Ga0207704_10183487
2081 Ga0207665_10003883
2082 Ga0207665_10007183
2083 Ga0207665_10021074
2084 Ga0207665_10053921
2085 Ga0207665_10127526
2086 Ga0207665_10252570
2087 Ga0207665_10400930
2088 Ga0207665_10721767
2089 Ga0207691_10024609
2090 Ga0207691_10183581
2091 Ga0207691_10872706
2092 Ga0207711_10018438
2093 Ga0207711_10021441
2094 Ga0207711_10259890
2095 Ga0207711_10302816
2096 Ga0207689_10000658
2097 Ga0207689_10020015
2098 Ga0207689_10302529
2099 Ga0207661_10004224
2100 Ga0207661_10044824
2101 Ga0207661_10051620
2102 Ga0207661_10108398
2103 Ga0207661_10123392
2104 Ga0207661_10307928
2105 Ga0207661_10359586
2106 Ga0207661_10390788
2107 Ga0207661_10627881
2108 Ga0207661_11128906
2109 Ga0207679_10000216
2110 Ga0207679_10024128
2111 Ga0207679_10616660
2112 Ga0207679_11034804
2113 Ga0207667_10001480
2114 Ga0207667_10012373
2115 Ga0207667_10017951
2116 Ga0207667_10121696
2117 Ga0207667_10181876
2118 Ga0207667_10283703
2119 Ga0207667_10310520
2120 Ga0207667_11310910
2121 Ga0207651_10072509
2122 Ga0207651_10173897
2123 Ga0207712_10176532
2124 Ga0207712_10267624
2125 Ga0207668_10049551
2126 Ga0207668_10092587
2127 Ga0207640_10000034
2128 Ga0207640_10077122
2129 Ga0207640_10137112
2130 Ga0207640_10542183
2131 Ga0207658_10004844
2132 Ga0207658_10022794
2133 Ga0207658_10025681
2134 Ga0207658_10025899
2135 Ga0207658_10129938
2136 Ga0207658_10186552
2137 Ga0207658_10299831
2138 Ga0207677_10018913
2139 Ga0207677_10037178
2140 Ga0207677_10043135
2141 Ga0207677_10048788
2142 Ga0207677_10138193
2143 Ga0207677_10270127
2144 Ga0207703_10003557
2145 Ga0207703_10017369
2146 Ga0207703_10027593
2147 Ga0207703_10152655
2148 Ga0207639_10000035
2149 Ga0207639_10005433
2150 Ga0207639_10031575
2151 Ga0207678_10021692
2152 Ga0207678_10029209
2153 Ga0207678_10839659
2154 Ga0207708_10072956
2155 Ga0207702_10000304
2156 Ga0207702_10009861
2157 Ga0207702_10018049
2158 Ga0207702_10022299
2159 Ga0207702_10025028
2160 Ga0207702_10033348
2161 Ga0207702_10072312
2162 Ga0207702_10235014
2163 Ga0207702_10428396
2164 Ga0207702_10433799
2165 Ga0207641_10000006
2166 Ga0207641_10007266
2167 Ga0207641_10094843
2168 Ga0207641_10158423
2169 Ga0207641_10206571
2170 Ga0207641_11012705
2171 Ga0207648_10003409
2172 Ga0207648_10007481
2173 Ga0207648_10125908
2174 Ga0207648_10887050
2175 Ga0207676_10000272
2176 Ga0207676_10070879
2177 Ga0207676_10087256
2178 Ga0207676_10469151
2179 Ga0207674_10001455
2180 Ga0207674_10003186
2181 Ga0207674_10004925
2182 Ga0207674_10010900
2183 Ga0207674_10095120
2184 Ga0207674_10116424
2185 Ga0207674_10622401
2186 Ga0207674_10738819
2187 Ga0207675_100005242
2188 Ga0207675_100585893
2189 Ga0207683_10000615
2190 Ga0207683_10065128
2191 Ga0207683_10189811
2192 Ga0207698_10171351
2193 Ga0207698_10467828
2194 Ga0207698_10498026
2195 Ga0207698_10943471
2196 Ga0207698_10945433
2197 Ga0209371_1000240
2198 Ga0209966_1062939
2199 Ga0207428_10200109
2200 Ga0268266_10051953
2201 Ga0268266_10053029
2202 Ga0268266_10630264
2203 Ga0268265_10040311
2204 Ga0268265_10201159
2205 Ga0268265_10258448
2206 Ga0268265_11089447
2207 Ga0268264_10017468
2208 Ga0268264_10021798
2209 Ga0268264_10338473
2210 Ga0268264_10344003
2211 Ga0265326_10026747
2212 Ga0265334_10012454
2213 Ga0265334_10022745
2214 Ga0265338_10010744
2215 Ga0265338_10021845
2216 Ga0265338_10052282
2217 Ga0265338_10055590
2218 Ga0265338_10211636
2219 Ga0265338_10213479
2220 Ga0265324_10060812
2221 Ga0268256_1001896
2222 Ga0265762_1011440
2223 Ga0265762_1027034
2224 Ga0265770_1001601
2225 Ga0265770_1046539
2226 Ga0265765_1016810
2227 Ga0265773_1007224
2228 Ga0265760_10000795
2229 Ga0265760_10001799
2230 Ga0265760_10011756
2231 Ga0265760_10011874
2232 Ga0265330_10084043
2233 Ga0265320_10347591
2234 Ga0265325_10223412
2235 Ga0265325_10268794
2236 Ga0265340_10041870
2237 Ga0265340_10235277
2238 Ga0265340_10264904
2239 Ga0265339_10091931
2240 Ga0265339_10101501
2241 Ga0265331_10012775
2242 Ga0265331_10041416
2243 Ga0265316_10098825
2244 Ga0265316_10557629
2245 Ga0307408_100000574
2246 Ga0307408_100000699
2247 Ga0307408_100005138
2248 Ga0307408_100375634
2249 Ga0307408_100494051
2250 Ga0307408_100809849
2251 Ga0265313_10001496
2252 Ga0316575_10027814
2253 Ga0316575_10041239
2254 Ga0316575_10089686
2255 Ga0316579_10000419
2256 Ga0316579_10023436
2257 Ga0316579_10045687
2258 Ga0316579_10050163
2259 Ga0265314_10020480
2260 Ga0265314_10238068
2261 Ga0265314_10415021
2262 Ga0265342_10045203
2263 Ga0265342_10089228
2264 Ga0316576_10005266
2265 Ga0316576_10014612
2266 Ga0316576_10024892
2267 Ga0316576_10056624
2268 Ga0316576_10066163
2269 Ga0316576_10071666
2270 Ga0316576_10077929
2271 Ga0316576_10122128
2272 Ga0316576_10153473
2273 Ga0316576_10408788
2274 Ga0316576_10464450
2275 Ga0316578_10000029
2276 Ga0316578_10001182
2277 Ga0316578_10008525
2278 Ga0316578_10030141
2279 Ga0316578_10034019
2280 Ga0316578_10040101
2281 Ga0316578_10386482
2282 Ga0307405_10009176
2283 Ga0316577_10000654
2284 Ga0316577_10007154
2285 Ga0316577_10072353
2286 Ga0316577_10221345
2287 Ga0307413_10004045
2288 Ga0307413_10098524
2289 Ga0307410_10056743
2290 Ga0307410_10237307
2291 Ga0307406_10000834
2292 Ga0307406_10001613
2293 Ga0307406_10051619
2294 Ga0307407_10019613
2295 Ga0307407_10054721
2296 Ga0307412_10007134
2297 Ga0307412_10141786
2298 Ga0307409_100020780
2299 Ga0307409_100037629
2300 Ga0307409_100050989
2301 Ga0307409_100071410
2302 Ga0307416_100004997
2303 Ga0307416_100094583
2304 Ga0307416_100206427
2305 Ga0307416_101017329
2306 Ga0307414_10046397
2307 Ga0307414_10052683
2308 Ga0307411_10010295
2309 Ga0307411_10014780
2310 Ga0307415_100023061
2311 Ga0307415_100108044
2312 Ga0307415_100135844
2313 Ga0307415_100354518
2314 Ga0316583_10000401
2315 Ga0316583_10005061
2316 Ga0316583_10051643
2317 Ga0316583_10055533
2318 Ga0316585_10000035
2319 Ga0316585_10006872
2320 Ga0316585_10015208
2321 Ga0316585_10015503
2322 Ga0316585_10078523
2323 Ga0316585_10165644
2324 Ga0316580_10000418
2325 Ga0316580_10005792
2326 Ga0316580_10013725
2327 Ga0316580_10025218
2328 Ga0316580_10056608
2329 Ga0316593_10026263
2330 Ga0316593_10149847
2331 Ga0307510_10019078
2332 Ga0316592_1003590
2333 Ga0316592_1004978
2334 Ga0316592_1020463
2335 Ga0316592_1044763
2336 Ga0316588_1000275
2337 Ga0316588_1003220
2338 Ga0316588_1021963
2339 Ga0316587_1037230
2340 Ga0316596_1001497
2341 Ga0316596_1008590
2342 Ga0316596_1023278
2343 Ga0373926_0047187
2344 Ga0373926_0076003
2345 Ga0373929_0039763
2346 Ga0373934_0000404
2347 Ga0373940_0140212
2348 Ga0373923_0019471
2349 Ga0373923_0366681
2350 Ga0373932_0015112
2351 Ga0373936_0114343
2352 Ga0373936_0134352
2353 Ga0373936_0197426
2354 Ga0373954_0000224
2355 Ga0373956_0001105
2356 Ga0373956_0043221
2357 Ga0373957_0007746
2358 Ga0373960_0111502
2359 Ga0373943_0183863
2360 Ga0373943_0244295
2361 Ga0373946_0097826
2362 Ga0373955_0000521
2363 Ga0373942_0035037
2364 Ga0316574_0000298
2365 Ga0316574_0000526
2366 Ga0316574_0013680
2367 Ga0316574_0015936
2368 Ga0316574_0113732
2369 Ga0316574_0836351
2370 Ga0373924_0054965
2371 Ga0373924_0118153
2372 Ga0373924_0312387
2373 Ga0373931_0015181
2374 Ga0373931_0028076
2375 Ga0373931_0048522
2376 Ga0373931_0104755
2377 Ga0373935_0002526
2378 Ga0373935_0015252
2379 Ga0373935_0104703
2380 Ga0373927_0003380
2381 Ga0373927_0231770
2382 Ga0373927_0288792
2383 Ga0373933_0001196
2384 Ga0373933_0067405
2385 Ga0373933_0102230
2386 Ga0373933_0535502
2387 Ga0373947_0261201
2388 Ga0373937_0001689
2389 Ga0373937_0594156
2390 Ga0316582_0000066
2391 Ga0316582_0087534
2392 Ga0316582_0209809
2393 Ga0316582_0214810
2394 Ga0316582_0229238
2395 Ga0316584_0001073
2396 Ga0316584_0004102
2397 Ga0316584_0004310
2398 Ga0316584_0015740
2399 Ga0316584_0030122
2400 Ga0316584_0062237
2401 Ga0316584_0184223
2402 Ga0316584_0241221
2403 Ga0373925_0003562
2404 Ga0395900_0546088
2405 Ga0395905_0000293
2406 Ga0395905_0007654
2407 Ga0395905_0221986
2408 Ga0395905_0377044
2409 Ga0395905_0462105
2410 Ga0395905_0494261
2411 Ga0237819_16747
2412 Ga0400490_57581
2413 Ga0400485_17163
2414 Ga0400485_18026
2415 Ga0400488_50200
2416 Ga0400486_01662
2417 Ga0242420_063814
2418 Ga0400489_14236
2419 Ga0400489_31446
2420 Ga0400487_10419
2421 Ga0400487_17601
2422 Ga0436365_0001200
2423 Ga0436365_0261237
2424 Ga0436365_1454779
2425 Ga0436365_1685032
2426 Ga0436360_0369279
2427 Ga0436360_0932224
2428 Ga0436361_0175726
2429 Ga0436361_0823786
2430 Ga0436361_1034179
2431 Ga0436363_0533398
2432 Ga0436363_1569701
2433 Ga0451797_0453838
2434 Ga0451833_0076051
2435 Ga0439446_0093751
2436 Ga0439435_0113155
2437 Ga0451577_0009319
2438 Ga0451577_0115367
2439 Ga0451577_0177133
2440 Ga0451577_0494716
2441 Ga0466969_0067414
2442 Ga0453683_0000058
2443 Ga0453683_0024122
2444 Ga0466966_0012789
2445 Ga0466963_0013437
2446 Ga0466963_0166716
2447 Ga0466963_0167080
2448 Ga0466963_0258200
2449 Ga0466963_0299289
2450 Ga0466963_0342599
2451 Ga0466963_0456718
2452 Ga0453684_0014465
2453 Ga0453684_0206673
2454 Ga0453684_0881976
2455 Ga0453684_1215318
2456 Ga0466971_0088660
2457 Ga0466957_0179777
2458 Ga0466957_0190686
2459 Ga0451576_0021438
2460 Ga0451576_0678964
2461 Ga0451576_0724718
2462 Ga0451576_0754920
2463 Ga0466958_0409435
2464 Ga0466967_0206840
2465 Ga0466967_0280872
2466 Ga0466967_0593921
2467 Ga0466967_0888433
2468 Ga0466967_1205269
2469 Ga0495592_0237790
2470 Ga0495603_0005735
2471 Ga0495638_0005254
2472 Ga0495638_0393440
2473 Ga0495641_0013923
2474 Ga0495580_0005430
2475 Ga0495580_0006518
2476 Ga0495580_0011543
2477 Ga0495580_0029864
2478 Ga0495580_0037783
2479 Ga0495580_0066022
2480 Ga0495580_0076587
2481 Ga0495580_0109697
2482 Ga0495580_0196395
2483 Ga0495580_0292534
2484 Ga0495580_0476231
2485 Ga0495582_0000133
2486 Ga0495605_0049612
2487 Ga0495639_0037105
2488 Ga0495585_0058734
2489 Ga0495585_0230074
2490 Ga0495594_0027035
2491 Ga0495594_0065481
2492 Ga0495583_0019840
2493 Ga0495610_0010253
2494 Ga0495631_0005948
2495 Ga0495631_0018464
2496 Ga0495644_0000015
2497 Ga0495652_0118600
2498 Ga0495665_0029914
2499 Ga0495640_0082216
2500 Ga0495586_0021497
2501 Ga0495587_0002546
2502 Ga0495609_0011878
2503 Ga0495609_0030292
2504 Ga0495645_0116079
2505 Ga0495633_0032625
2506 Ga0495633_0204350
2507 Ga0495656_0029883
2508 Ga0495668_0040960
2509 Ga0495611_0029649
2510 Ga0495625_0011188
2511 Ga0495625_0399493
2512 Ga0495635_0089167
2513 Ga0495623_0037309
2514 Ga0495623_0209744
2515 Ga0495623_0313750
2516 Ga0495646_0019554
2517 Ga0495669_0002696
2518 Ga0495669_0025427
2519 Ga0495669_0183217
2520 Ga0495669_0370796
2521 Ga0495613_0023739
2522 Ga0495613_0126633
2523 Ga0495671_0193976
2524 Ga0495589_0104429
2525 Ga0495600_0157448
2526 Ga0495660_0021351
2527 Ga0495581_0047764
2528 Ga0495604_0000910
2529 Ga0495674_0144941
2530 Ga0495672_0056919
2531 Ga0495683_0082537
2532 Ga0495679_026130
2533 Ga0495684_0035045
2534 Ga0495602_0189038
2535 Ga0495602_0198103
2536 Ga0496100_0064043
2537 Ga0496100_0641350
2538 Ga0496101_0043147
2539 Ga0496102_0072345
2540 Ga0496102_0077132
2541 Ga0496102_0261235
2542 Ga0496102_0358807
2543 Ga0496103_0077440
2544 Ga0496104_0001058
2545 Ga0496104_0024241
2546 Ga0496104_0075030
2547 Ga0496104_0339093
2548 Ga0496104_0638341
2549 Ga0496105_0003561
2550 Ga0496105_0206590
2551 Ga0496105_0265445
2552 Ga0496105_0568666
2553 Ga0496106_0093047
2554 Ga0496106_0366767
2555 Ga0496106_0521550
2556 Ga0496107_0285074
2557 Ga0496108_0000319
2558 Ga0496108_0006344
2559 Ga0496108_0067945
2560 Ga0496108_0075338
2561 Ga0496109_0000157
2562 Ga0496109_0021538
2563 Ga0496109_0126078
2564 Ga0496109_0807817
2565 Ga0496109_0966009
2566 Ga0496110_0000078
2567 Ga0496110_0086271
2568 Ga0496110_0087724
2569 Ga0496110_0296498
2570 Ga0496111_0012083
2571 Ga0496111_0046600
2572 Ga0496111_0142210
2573 Ga0496112_0000038
2574 Ga0496112_0001454
2575 Ga0496112_0004466
2576 Ga0496112_0029489
2577 Ga0496112_0034173
2578 Ga0496112_0064541
2579 Ga0496112_0101555
2580 Ga0496112_0136804
2581 Ga0496112_0157921
2582 Ga0496112_0243771
2583 Ga0496112_0372889
2584 Ga0496113_0000064
2585 Ga0496113_0047461
2586 Ga0496113_0175273
2587 Ga0496113_0336997
2588 Ga0496113_0481639
2589 Ga0496113_0663823
2590 Ga0496114_0012085
2591 Ga0496115_0011441
2592 Ga0496119_0000174
2593 Ga0496120_0000253
2594 Ga0496121_0027466
2595 Ga0496124_0017271
2596 Ga0496124_0036238
2597 Ga0496124_0120096
2598 Ga0496125_0000162
2599 Ga0496125_0036192
2600 Ga0496125_0077270
2601 Ga0496125_0085531
2602 Ga0496126_0002736
2603 Ga0495682_0139668
2604 Ga0501031_0030121
2605 Ga0501031_0213124
2606 Ga0501032_0000973
2607 Ga0501032_0056886
2608 Ga0501033_0003887
2609 Ga0501033_0007719
2610 Ga0501034_0001689
2611 Ga0501034_0011024
2612 Ga0501034_0012650
2613 Ga0501034_0019726
2614 Ga0501034_0091902
2615 Ga0501034_0135309
2616 Ga0501036_0019750
2617 Ga0501037_0001543
2618 Ga0501038_0008430
2619 Ga0501038_0523743
2620 Ga0501040_0000116
2621 Ga0501040_0032079
2622 Ga0501041_0158617
2623 Ga0501042_0000125
2624 Ga0501043_0024168
2625 Ga0501043_0059054
2626 Ga0501043_0125116
2627 Ga0501046_0000731
2628 Ga0501047_0008742
2629 Ga0501047_0017626
2630 Ga0501070_0019673
2631 Ga0501070_0332844
2632 Ga0501070_0365838
2633 Ga0501071_0013601
2634 Ga0501071_0135171
2635 Ga0501072_0134318
2636 Ga0501072_0298175
2637 Ga0501073_0004858
2638 Ga0501073_0014887
2639 Ga0501073_0681251
2640 Ga0501074_0019539
2641 Ga0501074_0076371
2642 Ga0501075_0009859
2643 Ga0501075_0123385
2644 Ga0501075_0200012
2645 Ga0501075_0372846
2646 Ga0501076_0009934
2647 Ga0501076_0050250
2648 Ga0501076_0299932
2649 Ga0501077_0009941
2650 Ga0501077_0200337
2651 Ga0501077_0207376
2652 Ga0501217_012416
2653 Ga0501079_0005627
2654 Ga0501080_0005086
2655 Ga0501081_0009080
2656 Ga0501083_0063116
2657 Ga0501241_016205
2658 Ga0501035_0003026
2659 Ga0501035_0007843
2660 Ga0501035_0122226
2661 Ga0501035_0172256
2662 Ga0501035_0434594
2663 Ga0501044_0001659
2664 Ga0501044_0016221
2665 Ga0501044_0135913
2666 Ga0501044_0379651
2667 Ga0501045_0129350
2668 Ga0501045_0157116
2669 nmdc:mga0k408_10493_c2
2670 nmdc:mga05p37_117993_c1
2671 nmdc:mga05p37_174464_c1
2672 nmdc:mga05p37_408391_c1
2673 nmdc:mga05p37_4404_c1
2674 nmdc:mga05p37_44905_c1
2675 nmdc:mga05p37_73073_c1
2676 nmdc:mga05p37_796518_c1
2677 nmdc:mga09592_115103_c1
2678 nmdc:mga09592_405833_c1
2679 nmdc:mga0qj67_10008_c1
2680 nmdc:mga0qj67_156136_c1
2681 nmdc:mga0qj67_72618_c1
2682 nmdc:mga06r32_171740_c1
2683 nmdc:mga06r32_718685_c1
2684 nmdc:mga08y16_1027673_c1
2685 nmdc:mga08y16_12850_c1
2686 nmdc:mga08y16_24065_c1
2687 nmdc:mga0n895_219_c1
2688 nmdc:mga0n895_22563_c1
2689 nmdc:mga0n895_256791_c1
2690 nmdc:mga0n895_500945_c1
2691 nmdc:mga0n895_525518_c1
2692 nmdc:mga0n895_60612_c1
2693 nmdc:mga0n895_819321_c1
2694 nmdc:mga0n895_890010_c1
2695 nmdc:mga0rr50_1025591_c1
2696 nmdc:mga0rr50_15194_c1
2697 nmdc:mga0rr50_211902_c1
2698 nmdc:mga0rr50_420274_c1
2699 nmdc:mga0rr50_5126_c1
2700 nmdc:mga0rr50_63914_c1
2701 nmdc:mga08x19_110649_c1
2702 nmdc:mga08x19_13151_c1
2703 nmdc:mga08x19_70723_c1
2704 nmdc:mga0a205_29179_c1
2705 nmdc:mga0a205_33459_c1
2706 nmdc:mga0a205_371539_c1
2707 nmdc:mga0a205_384910_c1
2708 nmdc:mga0a205_406633_c1
2709 nmdc:mga0a205_41124_c1
2710 nmdc:mga0a205_431201_c1
2711 nmdc:mga0a205_506303_c1
2712 nmdc:mga0a205_7468_c1
2713 nmdc:mga0a205_97138_c1
2714 Ga0495601_0167511
2715 Ga0495619_0039581
2716 Ga0500616_0003860
2717 Ga0500634_0198537
2718 Ga0501084_0003210
2719 Ga0501084_0015269
2720 Ga0501084_0019099
2721 Ga0501082_0003375
2722 Ga0501082_0015433
2723 Ga0501082_0129780
2724 Ga0466962_0019175
2725 Ga0530510_0003630
2726 Ga0530510_0075434
2727 Ga0530510_0093991
2728 2599411864
2729 2601524463
2730 2601529617
2731 2601616451
2732 2601621173
2733 2601646152
2734 2601649570
2735 2601654497
2736 2601660229
2737 2601664266
2738 2601699160
2739 2601702569
2740 2601707241
2741 2601712262
2742 2601717758
2743 2601723072
2744 2601727686
2745 2601732703
2746 2601737528
2747 2601741947
2748 2601752845
2749 2602021807
2750 2603662430
2751 2603667326
2752 2603840112
2753 2603845189
2754 2603850262
2755 2603855330
2756 2603868412
2757 2603873222
2758 2603878137
2759 2606050091
2760 2606071755
2761 2606147774
2762 2606178291
2763 2621297133
2764 2637222992
2765 2643818466
2766 2643880667
2767 2643938393
2768 2644079044
2769 2644661238
2770 2644693821
2771 2644699315
2772 2676408728
2773 2686995266
2774 2687234971
2775 2738671952
2776 2738716207
2777 2738750346
2778 2738859386
2779 2774131164
2780 2777021331
2781 2817493754
2782 2852651852
2783 2884218054
2784 2904517992
2785 2917836436
2786 2919126542
2787 2919515643
2788 2919678359
2789 2939623738
2790 2941478489
2791 2969080019
2792 2974302767
2793 2984499647
2794 2984506893
2795 2984562473
2796 2984600533
2797 3006975070
2798 8016731053
2799 8055823597

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

42

230

0.95

PF07722

Peptidase_C26

Peptidase C26

86

213

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9358 31 221
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9294 31 221
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9179 30 218
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9176 30 219
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9146 30 219
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9625 31 221 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9575 31 221 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.949 31 220 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9355 32 221 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9344 31 220 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A6L4Y847-F1-model_v4 Anthranilate synthase component II 0.9971 31 114 GO:0000162
GO:0004049
GO:0005829
AF-A0A7V1MHK6-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9954 31 146 GO:0000162
GO:0004049
GO:0005829
AF-A0A5S9M081-F1-model_v4 Glutamine amidotransferase domain-containing protein 0.9932 31 164 GO:0000162
GO:0004049
GO:0005829
AF-A0A351SBL0-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9932 31 129 GO:0000162
GO:0004049
GO:0005829
AF-A0A7Y0WXZ1-F1-model_v4 deleted 0.9929 31 125

Map