F493623

General Info

Members Datasets Scaffolds Average Seq Length
1395 503 1364 125

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0214876|Ga0495686_0214876_110_484
Length 124
Sequence MPAKNDAPALPGSRAVAKHVRISPSKARRVVNLVRGLPAKEALTVLQFAPQSASEQVYKVLASAIANAENNHNLDIDALVVAEASVGKSFTMKRFHARGRGKSTQILKPFSRVRIVVREQTEEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
6 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
7 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
8 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
9 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
10 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
13 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
14 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
15 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
16 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
17 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
18 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
19 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
20 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
21 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
22 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
23 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
24 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
25 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
26 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
27 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
28 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
29 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
30 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
31 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
32 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
33 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
34 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
35 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
41 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
42 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
43 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
44 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
45 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
60 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
88 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
89 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
159 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
160 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
161 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
162 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
163 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
164 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
176 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
177 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
182 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
187 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
270 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
271 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
272 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
277 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
284 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
285 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
286 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
287 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
288 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
290 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
291 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
294 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
295 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
306 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
307 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
308 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
309 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
310 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
311 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
312 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
313 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
314 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
315 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
316 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
317 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
318 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
319 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
320 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
321 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
322 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
323 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
324 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
325 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
326 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
327 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
328 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
329 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
330 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
331 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
332 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
333 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
334 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
335 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
336 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
337 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
338 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
339 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
340 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
341 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
342 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
343 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
344 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
345 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
346 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
347 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
348 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
349 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
350 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
351 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
352 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
353 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
354 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
355 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
356 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
357 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
360 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
361 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
362 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
363 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
364 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
365 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
366 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
367 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
368 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
369 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
370 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
371 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
372 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
373 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
374 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
375 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
378 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
379 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
380 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
381 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
382 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
383 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
384 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
385 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
386 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
390 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
391 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
392 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
393 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
394 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
395 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
400 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
403 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
404 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
405 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
442 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
443 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
444 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
445 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
446 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
447 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
448 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
449 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
450 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
451 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
452 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
453 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
458 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
463 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
464 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
465 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
466 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
467 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
468 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
472 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
473 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
474 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
475 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
478 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
479 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
480 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
481 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
482 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
483 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
484 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
485 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
502 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
503 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 3.01
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 6.81
Rhizosphere 81.79
Stem 0
Stem Tuber 0.07
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1902450 2162886007 Bacteria 4174
2 SwRhRL2b_contig_219213 2162886007 Bacteria 2451
3 SwRhRL2b_contig_90406 2162886007 Bacteria 2673
4 ARcpr5yngRDRAFT_c009192 3300000043 Bacteria 847
5 ARCol0yngRDRAFT_1010664 3300000652 Bacteria 671
6 JGI24736J21556_1000017 3300001904 Bacteria 28475
7 JGI24741J21665_1001831 3300001915 Bacteria 5816
8 JGI24741J21665_1004669 3300001915 Bacteria 2991
9 JGI24740J21852_10023038 3300001979 Bacteria 2133
10 JGI24740J21852_10073730 3300001979 Bacteria 908
11 JGI24740J21852_10098157 3300001979 Bacteria 748
12 JGI24739J22299_10070471 3300001989 Bacteria 1088
13 JGI24739J22299_10119248 3300001989 Bacteria 789
14 JGI24737J22298_10010075 3300001990 Bacteria 3131
15 JGI24737J22298_10022076 3300001990 Bacteria 2022
16 JGI24737J22298_10076884 3300001990 Bacteria 995
17 JGI24737J22298_10197514 3300001990 Bacteria 594
18 JGI24735J21928_10001020 3300002067 Bacteria 10011
19 JGI24735J21928_10003396 3300002067 Bacteria 5432
20 JGI24735J21928_10052944 3300002067 Bacteria 1170
21 JGI24735J21928_10083171 3300002067 Bacteria 917
22 JGI24748J21848_1022174 3300002074 Bacteria 768
23 JGI24738J21930_10002167 3300002075 Bacteria 5226
24 JGI24738J21930_10015293 3300002075 Bacteria 1635
25 JGI24738J21930_10055219 3300002075 Bacteria 812
26 JGI24749J21850_1001152 3300002076 Bacteria 3752
27 JGI24033J26618_1006238 3300002155 Bacteria 1333
28 JGI24033J26618_1032954 3300002155 Bacteria 702
29 JGI24034J26672_10001857 3300002239 Bacteria 2848
30 JGI24034J26672_10004339 3300002239 Bacteria 2006
31 JGI24034J26672_10014590 3300002239 Bacteria 1199
32 JGI24034J26672_10030081 3300002239 Bacteria 881
33 JGI24034J26672_10051630 3300002239 Bacteria 708
34 JGI24751J29686_10000133 3300002459 Bacteria 37734
35 JGI24751J29686_10000325 3300002459 Bacteria 17611
36 JGI24751J29686_10109440 3300002459 Bacteria 578
37 JGI25152J39213_1019543 3300002773 Bacteria 1230
38 JGI25150J39212_1000365 3300002774 Bacteria 21872
39 JGI25151J46595_10034781 3300003187 Bacteria 1922
40 JGI26145J50221_1019280 3300003371 Bacteria 651
41 Ga0055526_1001689 3300003771 Bacteria 15428
42 Ga0055524_1041467 3300003775 Bacteria 1159
43 Ga0055536_1004136 3300003781 Bacteria 7522
44 Ga0055536_1012782 3300003781 Bacteria 3083
45 Ga0055536_1040482 3300003781 Bacteria 1108
46 Ga0055530_10004523 3300003791 Bacteria 7112
47 Ga0055530_10006129 3300003791 Bacteria 5463
48 Ga0055530_10053671 3300003791 Bacteria 925
49 Ga0055540_1000723 3300003792 Bacteria 22522
50 Ga0055540_1050858 3300003792 Bacteria 856
51 Ga0055531_10011237 3300003794 Bacteria 4347
52 Ga0055531_10018292 3300003794 Bacteria 2900
53 Ga0065165_1007044 3300005262 Bacteria 5660
54 Ga0065714_10439110 3300005288 Bacteria 528
55 Ga0065704_10070214 3300005289 Bacteria 70706
56 Ga0065704_10070777 3300005289 Bacteria 16263
57 Ga0065704_10101429 3300005289 Bacteria 2238
58 Ga0065704_10335587 3300005289 Bacteria 831
59 Ga0065712_10044945 3300005290 Bacteria 836
60 Ga0065712_10154061 3300005290 Bacteria 1348
61 Ga0065707_10007537 3300005295 Bacteria 4124
62 Ga0065707_10051097 3300005295 Bacteria 684
63 Ga0065707_10374061 3300005295 Bacteria 886
64 Ga0065707_10492149 3300005295 Bacteria 764
65 Ga0070658_10104595 3300005327 Bacteria 2342
66 Ga0070658_10217697 3300005327 Bacteria 1614
67 Ga0070658_10855387 3300005327 Bacteria 790
68 Ga0070658_11285588 3300005327 Bacteria 635
69 Ga0070676_10010202 3300005328 Bacteria 5093
70 Ga0070676_10114853 3300005328 Bacteria 1681
71 Ga0070676_10396009 3300005328 Bacteria 960
72 Ga0070676_10618497 3300005328 Bacteria 783
73 Ga0070676_10852711 3300005328 Bacteria 675
74 Ga0070683_100888866 3300005329 Bacteria 854
75 Ga0070690_100018053 3300005330 Bacteria 4254
76 Ga0070670_100024275 3300005331 Bacteria 5215
77 Ga0070670_100044177 3300005331 Bacteria 3831
78 Ga0070670_100047139 3300005331 Bacteria 3707
79 Ga0070670_100065360 3300005331 Bacteria 3121
80 Ga0070670_100100471 3300005331 Bacteria 2490
81 Ga0070670_100148526 3300005331 Bacteria 2028
82 Ga0070670_100240682 3300005331 Bacteria 1575
83 Ga0070670_100548160 3300005331 Bacteria 1031
84 Ga0070670_100628039 3300005331 Bacteria 962
85 Ga0070670_100738370 3300005331 Bacteria 887
86 Ga0070670_101368932 3300005331 Bacteria 648
87 Ga0070677_10018552 3300005333 Bacteria 2506
88 Ga0070677_10365215 3300005333 Bacteria 751
89 Ga0068869_100349580 3300005334 Bacteria 1205
90 Ga0068869_100922701 3300005334 Bacteria 757
91 Ga0070666_10007165 3300005335 Bacteria 6873
92 Ga0070666_10054950 3300005335 Bacteria 2687
93 Ga0070666_10179942 3300005335 Bacteria 1483
94 Ga0070666_10271508 3300005335 Bacteria 1204
95 Ga0070666_10525631 3300005335 Bacteria 859
96 Ga0070666_10890077 3300005335 Bacteria 658
97 Ga0070666_11149184 3300005335 Bacteria 578
98 Ga0070666_11161595 3300005335 Bacteria 575
99 Ga0070680_100162100 3300005336 Bacteria 1879
100 Ga0070680_100413449 3300005336 Bacteria 1150
101 Ga0070682_100167589 3300005337 Bacteria 1523
102 Ga0068868_100569237 3300005338 Bacteria 1000
103 Ga0068868_101966217 3300005338 Bacteria 555
104 Ga0070660_100018108 3300005339 Bacteria 5140
105 Ga0070660_100095636 3300005339 Bacteria 2348
106 Ga0070660_100676942 3300005339 Bacteria 864
107 Ga0070660_101411668 3300005339 Bacteria 591
108 Ga0070660_101834420 3300005339 Bacteria 517
109 Ga0070689_100665543 3300005340 Bacteria 907
110 Ga0070689_100764544 3300005340 Bacteria 848
111 Ga0070689_101589165 3300005340 Bacteria 594
112 Ga0070691_10023128 3300005341 Bacteria 2885
113 Ga0070691_10093826 3300005341 Bacteria 1483
114 Ga0070661_100241777 3300005344 Bacteria 1390
115 Ga0070661_100577775 3300005344 Bacteria 907
116 Ga0070661_100614891 3300005344 Bacteria 879
117 Ga0070661_101625825 3300005344 Bacteria 546
118 Ga0070692_10354552 3300005345 Bacteria 913
119 Ga0070692_11190734 3300005345 Bacteria 542
120 Ga0070668_100017451 3300005347 Bacteria 5380
121 Ga0070668_100396570 3300005347 Bacteria 1177
122 Ga0070668_100478984 3300005347 Bacteria 1074
123 Ga0070668_101335208 3300005347 Bacteria 652
124 Ga0070668_101983076 3300005347 Bacteria 537
125 Ga0070668_102028746 3300005347 Bacteria 531
126 Ga0070669_100004937 3300005353 Bacteria 9634
127 Ga0070669_100005654 3300005353 Bacteria 9030
128 Ga0070669_100014400 3300005353 Bacteria 5629
129 Ga0070669_100033975 3300005353 Bacteria 3691
130 Ga0070669_100264859 3300005353 Bacteria 1373
131 Ga0070669_100334722 3300005353 Bacteria 1225
132 Ga0070669_100380842 3300005353 Bacteria 1150
133 Ga0070669_100492436 3300005353 Bacteria 1016
134 Ga0070669_100527333 3300005353 Bacteria 982
135 Ga0070669_100557818 3300005353 Bacteria 956
136 Ga0070675_100021317 3300005354 Bacteria 5177
137 Ga0070675_100282639 3300005354 Bacteria 1458
138 Ga0070675_100660469 3300005354 Bacteria 950
139 Ga0070675_101392207 3300005354 Bacteria 647
140 Ga0070675_101761456 3300005354 Bacteria 571
141 Ga0070675_101826824 3300005354 Bacteria 561
142 Ga0070671_100001718 3300005355 Bacteria 16629
143 Ga0070671_100052885 3300005355 Bacteria 3376
144 Ga0070671_100071036 3300005355 Bacteria 2905
145 Ga0070671_100075094 3300005355 Bacteria 2823
146 Ga0070671_100149996 3300005355 Bacteria 1968
147 Ga0070671_100230557 3300005355 Bacteria 1571
148 Ga0070671_100243374 3300005355 Bacteria 1527
149 Ga0070671_101271800 3300005355 Bacteria 648
150 Ga0070671_102056963 3300005355 Bacteria 509
151 Ga0070674_100065137 3300005356 Bacteria 2556
152 Ga0070674_100101471 3300005356 Bacteria 2097
153 Ga0070674_101294936 3300005356 Bacteria 650
154 Ga0070674_101384186 3300005356 Bacteria 629
155 Ga0070673_100034662 3300005364 Bacteria 3821
156 Ga0070673_101239019 3300005364 Bacteria 700
157 Ga0070688_100364027 3300005365 Bacteria 1062
158 Ga0070659_100052713 3300005366 Bacteria 3200
159 Ga0070659_100180084 3300005366 Bacteria 1734
160 Ga0070659_100310110 3300005366 Bacteria 1317
161 Ga0070659_100368816 3300005366 Bacteria 1207
162 Ga0070659_100902102 3300005366 Bacteria 772
163 Ga0070659_101601104 3300005366 Bacteria 581
164 Ga0070667_100000088 3300005367 Bacteria 113956
165 Ga0070667_100001059 3300005367 Bacteria 25137
166 Ga0070667_100141917 3300005367 Bacteria 2104
167 Ga0070667_100508657 3300005367 Bacteria 1104
168 Ga0070667_100692723 3300005367 Bacteria 942
169 Ga0070714_100056706 3300005435 Bacteria 3351
170 Ga0070714_100446850 3300005435 Bacteria 1227
171 Ga0070713_100050613 3300005436 Bacteria 3432
172 Ga0070701_10543196 3300005438 Bacteria 761
173 Ga0070705_100529297 3300005440 Bacteria 900
174 Ga0070700_100044432 3300005441 Bacteria 2736
175 Ga0070700_100904716 3300005441 Bacteria 719
176 Ga0070694_100564632 3300005444 Bacteria 913
177 Ga0070663_100082480 3300005455 Bacteria 2365
178 Ga0070663_100155543 3300005455 Bacteria 1756
179 Ga0070663_100388956 3300005455 Bacteria 1137
180 Ga0070663_100439922 3300005455 Bacteria 1073
181 Ga0070663_100738153 3300005455 Bacteria 840
182 Ga0070663_100820918 3300005455 Bacteria 798
183 Ga0070663_101654665 3300005455 Bacteria 572
184 Ga0070678_100020582 3300005456 Bacteria 4331
185 Ga0070678_100204291 3300005456 Bacteria 1633
186 Ga0070678_100228696 3300005456 Bacteria 1549
187 Ga0070678_100446078 3300005456 Bacteria 1133
188 Ga0070678_100926518 3300005456 Bacteria 798
189 Ga0070678_101187273 3300005456 Bacteria 707
190 Ga0070662_100249078 3300005457 Bacteria 1427
191 Ga0070662_100329829 3300005457 Bacteria 1246
192 Ga0070662_100343467 3300005457 Bacteria 1222
193 Ga0070662_100834265 3300005457 Bacteria 784
194 Ga0070662_101608754 3300005457 Bacteria 561
195 Ga0070662_101683119 3300005457 Bacteria 548
196 Ga0070662_101745263 3300005457 Bacteria 538
197 Ga0070681_10842690 3300005458 Bacteria 834
198 Ga0070681_11187871 3300005458 Bacteria 685
199 Ga0070681_11666624 3300005458 Bacteria 564
200 Ga0068867_100167090 3300005459 Bacteria 1739
201 Ga0068867_100239469 3300005459 Bacteria 1471
202 Ga0068867_100339305 3300005459 Bacteria 1250
203 Ga0068867_100608690 3300005459 Bacteria 954
204 Ga0068867_100858773 3300005459 Bacteria 814
205 Ga0070699_101902222 3300005518 Bacteria 544
206 Ga0070679_101027471 3300005530 Bacteria 768
207 Ga0070679_102141505 3300005530 Bacteria 509
208 Ga0070684_100038268 3300005535 Bacteria 4119
209 Ga0070697_100271153 3300005536 Bacteria 1455
210 Ga0068853_100100537 3300005539 Bacteria 2556
211 Ga0068853_100134014 3300005539 Bacteria 2219
212 Ga0068853_100413468 3300005539 Bacteria 1264
213 Ga0068853_100965538 3300005539 Bacteria 820
214 Ga0068853_101107283 3300005539 Bacteria 764
215 Ga0068853_101923504 3300005539 Bacteria 573
216 Ga0070672_100034217 3300005543 Bacteria 3855
217 Ga0070672_100627533 3300005543 Bacteria 937
218 Ga0070672_100817407 3300005543 Bacteria 821
219 Ga0070672_100841589 3300005543 Bacteria 808
220 Ga0070672_101407993 3300005543 Bacteria 624
221 Ga0070672_102153785 3300005543 Bacteria 503
222 Ga0070686_100162697 3300005544 Bacteria 1573
223 Ga0070686_100312950 3300005544 Bacteria 1168
224 Ga0070696_100274635 3300005546 Bacteria 1283
225 Ga0070693_100090075 3300005547 Bacteria 1847
226 Ga0070693_100280396 3300005547 Bacteria 1116
227 Ga0070693_101054800 3300005547 Bacteria 618
228 Ga0070665_100017754 3300005548 Bacteria 7145
229 Ga0070665_100043393 3300005548 Bacteria 4519
230 Ga0070665_100080805 3300005548 Bacteria 3256
231 Ga0070665_100107634 3300005548 Bacteria 2790
232 Ga0070665_101362015 3300005548 Bacteria 719
233 Ga0070665_101775586 3300005548 Bacteria 623
234 Ga0070704_100284431 3300005549 Bacteria 1371
235 Ga0070704_101993804 3300005549 Bacteria 539
236 Ga0068855_100042514 3300005563 Bacteria 5384
237 Ga0068855_100080645 3300005563 Bacteria 3773
238 Ga0068855_100269053 3300005563 Bacteria 1895
239 Ga0068855_100820305 3300005563 Bacteria 987
240 Ga0068855_100932750 3300005563 Bacteria 915
241 Ga0068855_100998628 3300005563 Bacteria 879
242 Ga0070664_100036985 3300005564 Bacteria 4103
243 Ga0070664_100070110 3300005564 Bacteria 3001
244 Ga0070664_100253451 3300005564 Bacteria 1582
245 Ga0070664_100464231 3300005564 Bacteria 1164
246 Ga0070664_100976480 3300005564 Bacteria 796
247 Ga0070664_101382016 3300005564 Bacteria 665
248 Ga0070664_101968684 3300005564 Bacteria 554
249 Ga0070664_102158471 3300005564 Bacteria 528
250 Ga0068857_100026049 3300005577 Bacteria 5151
251 Ga0068857_100359493 3300005577 Bacteria 1349
252 Ga0068857_100764880 3300005577 Bacteria 921
253 Ga0068857_101288741 3300005577 Bacteria 709
254 Ga0068857_101691162 3300005577 Bacteria 618
255 Ga0068854_100097571 3300005578 Bacteria 2197
256 Ga0068854_100175422 3300005578 Bacteria 1671
257 Ga0068854_101151278 3300005578 Bacteria 693
258 Ga0068854_102143988 3300005578 Bacteria 516
259 Ga0068856_100058104 3300005614 Bacteria 3820
260 Ga0068856_100364986 3300005614 Bacteria 1463
261 Ga0068856_101251499 3300005614 Bacteria 758
262 Ga0070702_100090393 3300005615 Bacteria 1856
263 Ga0070702_100379736 3300005615 Bacteria 1004
264 Ga0068852_100343494 3300005616 Bacteria 1455
265 Ga0068852_100448060 3300005616 Bacteria 1277
266 Ga0068852_101538415 3300005616 Bacteria 688
267 Ga0068852_101918233 3300005616 Bacteria 614
268 Ga0068852_102079416 3300005616 Bacteria 590
269 Ga0068859_100006387 3300005617 Bacteria 11959
270 Ga0068859_100030651 3300005617 Bacteria 5398
271 Ga0068859_100323648 3300005617 Bacteria 1636
272 Ga0068859_100440837 3300005617 Bacteria 1399
273 Ga0068859_101116349 3300005617 Bacteria 867
274 Ga0068859_101612409 3300005617 Bacteria 717
275 Ga0068859_101774425 3300005617 Bacteria 681
276 Ga0068864_100014199 3300005618 Bacteria 6612
277 Ga0068864_100081298 3300005618 Bacteria 2840
278 Ga0068864_100599726 3300005618 Bacteria 1069
279 Ga0068864_100649123 3300005618 Bacteria 1027
280 Ga0068864_100832313 3300005618 Bacteria 909
281 Ga0068864_101664716 3300005618 Bacteria 642
282 Ga0068866_10028552 3300005718 Bacteria 2660
283 Ga0068866_11315034 3300005718 Bacteria 526
284 Ga0068861_100002700 3300005719 Bacteria 11613
285 Ga0068861_100039077 3300005719 Bacteria 3540
286 Ga0068861_100134622 3300005719 Bacteria 2009
287 Ga0068861_101079403 3300005719 Bacteria 770
288 Ga0068861_101285918 3300005719 Bacteria 711
289 Ga0068851_10039033 3300005834 Bacteria 2384
290 Ga0068851_10109610 3300005834 Bacteria 1473
291 Ga0068870_10196609 3300005840 Bacteria 1220
292 Ga0068870_10230894 3300005840 Bacteria 1138
293 Ga0068870_10594405 3300005840 Bacteria 751
294 Ga0068870_10676704 3300005840 Bacteria 709
295 Ga0068863_100007187 3300005841 Bacteria 10925
296 Ga0068863_100008669 3300005841 Bacteria 9938
297 Ga0068863_100080807 3300005841 Bacteria 3079
298 Ga0068863_100388526 3300005841 Bacteria 1363
299 Ga0068863_101323670 3300005841 Bacteria 727
300 Ga0068858_100141594 3300005842 Bacteria 2258
301 Ga0068858_100305438 3300005842 Bacteria 1518
302 Ga0068858_101424513 3300005842 Bacteria 683
303 Ga0068860_100000220 3300005843 Bacteria 89460
304 Ga0068860_100009418 3300005843 Bacteria 9706
305 Ga0068860_100290484 3300005843 Bacteria 1600
306 Ga0068860_100365743 3300005843 Bacteria 1422
307 Ga0068860_100683453 3300005843 Bacteria 1035
308 Ga0068862_100000126 3300005844 Bacteria 89210
309 Ga0068862_100002931 3300005844 Bacteria 14924
310 Ga0068862_100136266 3300005844 Bacteria 2175
311 Ga0068862_100188127 3300005844 Bacteria 1856
312 Ga0068862_100355311 3300005844 Bacteria 1360
313 Ga0068862_100383926 3300005844 Bacteria 1311
314 Ga0068862_100849430 3300005844 Bacteria 895
315 Ga0068862_101527106 3300005844 Bacteria 674
316 Ga0070717_10009669 3300006028 Bacteria 7259
317 Ga0075365_11071766 3300006038 Bacteria 567
318 Ga0075363_100000434 3300006048 Bacteria 13047
319 Ga0075363_100007657 3300006048 Bacteria 4981
320 Ga0075364_10154814 3300006051 Bacteria 1546
321 Ga0075364_10389625 3300006051 Bacteria 951
322 Ga0070712_100734954 3300006175 Bacteria 844
323 Ga0075362_10001156 3300006177 Bacteria 8246
324 Ga0075362_10143859 3300006177 Bacteria 1141
325 Ga0075367_10151422 3300006178 Bacteria 1439
326 Ga0075369_10017872 3300006186 Bacteria 2881
327 Ga0075366_10043854 3300006195 Bacteria 2650
328 Ga0075366_10688912 3300006195 Bacteria 634
329 Ga0075366_10702613 3300006195 Bacteria 628
330 Ga0097621_100162823 3300006237 Bacteria 1918
331 Ga0097621_100458747 3300006237 Bacteria 1149
332 Ga0097621_101459311 3300006237 Bacteria 648
333 Ga0075370_10000004 3300006353 Bacteria 121166
334 Ga0075370_10183052 3300006353 Bacteria 1233
335 Ga0075370_10228277 3300006353 Bacteria 1101
336 Ga0075370_10231904 3300006353 Bacteria 1092
337 Ga0075370_10938159 3300006353 Bacteria 529
338 Ga0068871_101309670 3300006358 Bacteria 681
339 Ga0075428_102319728 3300006844 Bacteria 552
340 Ga0075430_100459554 3300006846 Bacteria 1050
341 Ga0075433_10164065 3300006852 Bacteria 1977
342 Ga0075434_102439173 3300006871 Bacteria 525
343 Ga0068865_100063284 3300006881 Bacteria 2600
344 Ga0068865_100124512 3300006881 Bacteria 1922
345 Ga0068865_100619565 3300006881 Bacteria 917
346 Ga0068865_101114496 3300006881 Bacteria 696
347 Ga0068865_101138857 3300006881 Bacteria 688
348 Ga0068865_101149388 3300006881 Bacteria 686
349 Ga0097620_100006388 3300006931 Bacteria 11959
350 Ga0097620_100030651 3300006931 Bacteria 5398
351 Ga0097620_100323639 3300006931 Bacteria 1636
352 Ga0097620_100440841 3300006931 Bacteria 1399
353 Ga0097620_101116306 3300006931 Bacteria 867
354 Ga0097620_101612395 3300006931 Bacteria 717
355 Ga0097620_101774423 3300006931 Bacteria 681
356 Ga0097620_101995678 3300006931 Bacteria 641
357 Ga0105251_10003119 3300009011 Bacteria 12305
358 Ga0105251_10033975 3300009011 Bacteria 2527
359 Ga0105250_10001130 3300009092 Bacteria 15032
360 Ga0105240_10183284 3300009093 Bacteria 2469
361 Ga0105240_10928947 3300009093 Bacteria 934
362 Ga0105240_12215374 3300009093 Bacteria 570
363 Ga0111539_10637376 3300009094 Bacteria 1241
364 Ga0111539_11626981 3300009094 Bacteria 749
365 Ga0105247_10005639 3300009101 Bacteria 7852
366 Ga0105247_10139623 3300009101 Bacteria 1586
367 Ga0105247_10230726 3300009101 Bacteria 1257
368 Ga0105247_10348022 3300009101 Bacteria 1041
369 Ga0114129_10043173 3300009147 Bacteria 6344
370 Ga0105243_10020823 3300009148 Bacteria 4976
371 Ga0105243_10589560 3300009148 Bacteria 1068
372 Ga0105243_12097989 3300009148 Bacteria 601
373 Ga0105243_12203750 3300009148 Bacteria 588
374 Ga0105243_12262099 3300009148 Bacteria 581
375 Ga0105241_10438812 3300009174 Bacteria 1153
376 Ga0105241_10532747 3300009174 Bacteria 1052
377 Ga0105241_10598323 3300009174 Bacteria 996
378 Ga0105241_10858706 3300009174 Bacteria 840
379 Ga0105241_10936905 3300009174 Bacteria 806
380 Ga0105241_11041831 3300009174 Bacteria 767
381 Ga0105242_10527942 3300009176 Bacteria 1127
382 Ga0105242_11662544 3300009176 Bacteria 674
383 Ga0105248_10000021 3300009177 Bacteria 276159
384 Ga0105248_10003987 3300009177 Bacteria 16323
385 Ga0105248_10021485 3300009177 Bacteria 7149
386 Ga0105248_10022907 3300009177 Bacteria 6935
387 Ga0105248_10100231 3300009177 Bacteria 3264
388 Ga0105248_10106162 3300009177 Bacteria 3167
389 Ga0105248_10341020 3300009177 Bacteria 1687
390 Ga0105248_10424396 3300009177 Bacteria 1498
391 Ga0105248_10736984 3300009177 Bacteria 1112
392 Ga0105248_10976747 3300009177 Bacteria 957
393 Ga0105248_11707590 3300009177 Bacteria 714
394 Ga0105248_12990958 3300009177 Bacteria 538
395 Ga0105237_10002858 3300009545 Bacteria 20999
396 Ga0105237_10186090 3300009545 Bacteria 2077
397 Ga0105237_10449722 3300009545 Bacteria 1294
398 Ga0105237_10604010 3300009545 Bacteria 1104
399 Ga0105237_11513256 3300009545 Bacteria 678
400 Ga0105238_10428911 3300009551 Bacteria 1317
401 Ga0105238_11230877 3300009551 Bacteria 773
402 Ga0105249_10001881 3300009553 Bacteria 18180
403 Ga0105249_10002122 3300009553 Bacteria 17209
404 Ga0105249_10134716 3300009553 Bacteria 2362
405 Ga0105249_11020091 3300009553 Bacteria 896
406 Ga0105249_11228458 3300009553 Bacteria 821
407 Ga0105249_11600721 3300009553 Bacteria 724
408 Ga0105239_10457367 3300010375 Bacteria 1449
409 Ga0105239_10945649 3300010375 Bacteria 990
410 Ga0105239_11059697 3300010375 Bacteria 933
411 Ga0105239_11679028 3300010375 Bacteria 735
412 Ga0105246_10736332 3300011119 Bacteria 868
413 Ga0105246_11372844 3300011119 Bacteria 658
414 Ga0157323_1030989 3300012495 Bacteria 568
415 Ga0157339_1045827 3300012505 Bacteria 563
416 Ga0157315_1005960 3300012508 Bacteria 935
417 Ga0157327_1020413 3300012512 Bacteria 742
418 Ga0157338_1000992 3300012515 Bacteria 1913
419 Ga0157373_10050689 3300013100 Bacteria 2956
420 Ga0157373_10172671 3300013100 Bacteria 1521
421 Ga0157373_10419244 3300013100 Bacteria 961
422 Ga0157373_10973344 3300013100 Bacteria 632
423 Ga0157371_10152944 3300013102 Bacteria 1646
424 Ga0157371_11457855 3300013102 Bacteria 533
425 Ga0157370_10029812 3300013104 Bacteria 5349
426 Ga0157370_10102037 3300013104 Bacteria 2687
427 Ga0157369_10034063 3300013105 Bacteria 5592
428 Ga0157369_10070636 3300013105 Bacteria 3751
429 Ga0157369_10153589 3300013105 Bacteria 2433
430 Ga0157369_10574155 3300013105 Bacteria 1165
431 Ga0157369_10778307 3300013105 Bacteria 984
432 Ga0157369_11859513 3300013105 Bacteria 611
433 Ga0157369_12320254 3300013105 Bacteria 544
434 Ga0157374_10414302 3300013296 Bacteria 1345
435 Ga0157374_10881780 3300013296 Bacteria 912
436 Ga0157374_12289027 3300013296 Bacteria 567
437 Ga0157378_10114310 3300013297 Bacteria 2479
438 Ga0163162_10025756 3300013306 Bacteria 5815
439 Ga0163162_10404008 3300013306 Bacteria 1499
440 Ga0163162_10562907 3300013306 Bacteria 1267
441 Ga0163162_10951462 3300013306 Bacteria 970
442 Ga0163162_12300679 3300013306 Bacteria 619
443 Ga0157372_10078683 3300013307 Bacteria 3726
444 Ga0157372_10427160 3300013307 Bacteria 1544
445 Ga0157372_11844695 3300013307 Bacteria 695
446 Ga0157372_12902238 3300013307 Bacteria 549
447 Ga0157372_13029957 3300013307 Bacteria 537
448 Ga0157375_10007439 3300013308 Bacteria 9585
449 Ga0157375_10105208 3300013308 Bacteria 2912
450 Ga0163163_10020116 3300014325 Bacteria 6282
451 Ga0163163_10313059 3300014325 Bacteria 1623
452 Ga0163163_10314201 3300014325 Bacteria 1620
453 Ga0163163_10360924 3300014325 Bacteria 1509
454 Ga0163163_10584351 3300014325 Bacteria 1180
455 Ga0163163_10591250 3300014325 Bacteria 1173
456 Ga0163163_10861498 3300014325 Bacteria 969
457 Ga0163163_11538253 3300014325 Bacteria 726
458 Ga0157380_10000157 3300014326 Bacteria 39384
459 Ga0157380_10015607 3300014326 Bacteria 5584
460 Ga0157380_10435926 3300014326 Bacteria 1254
461 Ga0157380_10630398 3300014326 Bacteria 1066
462 Ga0157380_10677954 3300014326 Bacteria 1032
463 Ga0157380_11422723 3300014326 Bacteria 744
464 Ga0157380_11475188 3300014326 Bacteria 733
465 Ga0182008_10184377 3300014497 Bacteria 1057
466 Ga0157377_10460577 3300014745 Bacteria 880
467 Ga0157379_10223199 3300014968 Bacteria 1707
468 Ga0157379_10665090 3300014968 Bacteria 976
469 Ga0157379_10766984 3300014968 Bacteria 909
470 Ga0157379_11103336 3300014968 Bacteria 760
471 Ga0157376_10019101 3300014969 Bacteria 5273
472 Ga0157376_10363485 3300014969 Bacteria 1389
473 Ga0163161_10160074 3300017792 Bacteria 1716
474 Ga0163161_10359501 3300017792 Bacteria 1159
475 Ga0163161_10417686 3300017792 Bacteria 1079
476 Ga0163161_10667267 3300017792 Bacteria 863
477 Ga0197907_10673139 3300020069 Bacteria 1094
478 Ga0206356_10532533 3300020070 Bacteria 806
479 Ga0213875_10001626 3300021388 Bacteria 14182
480 Ga0207425_1000049 3300025245 Bacteria 180735
481 Ga0209646_1018464 3300025246 Bacteria 1020
482 Ga0209026_1006530 3300025250 Bacteria 2830
483 Ga0209148_1006654 3300025254 Bacteria 2481
484 Ga0209129_1000471 3300025258 Bacteria 29587
485 Ga0209565_1000985 3300025263 Bacteria 14637
486 Ga0209676_1007313 3300025292 Bacteria 5224
487 Ga0209676_1013004 3300025292 Bacteria 3228
488 Ga0209025_1000068 3300025294 Bacteria 294129
489 Ga0209564_1000335 3300025295 Bacteria 91079
490 Ga0209758_1000004 3300025297 Bacteria 1375322
491 Ga0209758_1002168 3300025297 Bacteria 20636
492 Ga0209050_1000001 3300025298 Bacteria 3563507
493 Ga0209050_1000161 3300025298 Bacteria 155713
494 Ga0209050_1001064 3300025298 Bacteria 33727
495 Ga0209050_1011548 3300025298 Bacteria 4167
496 Ga0209051_1000191 3300025303 Bacteria 108763
497 Ga0209051_1000877 3300025303 Bacteria 30359
498 Ga0209257_1000252 3300025304 Bacteria 123718
499 Ga0209257_1004959 3300025304 Bacteria 9760
500 Ga0209257_1008377 3300025304 Bacteria 5898
501 Ga0207697_10001580 3300025315 Bacteria 12319
502 Ga0207656_10218634 3300025321 Bacteria 925
503 Ga0207696_1000878 3300025711 Bacteria 18741
504 Ga0207713_1000752 3300025735 Bacteria 30172
505 Ga0207682_10006590 3300025893 Bacteria 4672
506 Ga0207682_10286164 3300025893 Bacteria 771
507 Ga0207682_10408647 3300025893 Bacteria 642
508 Ga0207642_10099534 3300025899 Bacteria 1456
509 Ga0207642_10321425 3300025899 Bacteria 904
510 Ga0207642_10435527 3300025899 Bacteria 791
511 Ga0207642_11027184 3300025899 Bacteria 531
512 Ga0207710_10035506 3300025900 Bacteria 2194
513 Ga0207710_10036482 3300025900 Bacteria 2167
514 Ga0207710_10063379 3300025900 Bacteria 1681
515 Ga0207710_10243846 3300025900 Bacteria 897
516 Ga0207688_10113160 3300025901 Bacteria 1577
517 Ga0207688_10225106 3300025901 Bacteria 1131
518 Ga0207688_10433251 3300025901 Bacteria 818
519 Ga0207680_10013949 3300025903 Bacteria 4143
520 Ga0207680_10040390 3300025903 Bacteria 2714
521 Ga0207680_10134575 3300025903 Bacteria 1632
522 Ga0207680_10201861 3300025903 Bacteria 1355
523 Ga0207680_10299365 3300025903 Bacteria 1121
524 Ga0207680_10712458 3300025903 Bacteria 719
525 Ga0207647_10008472 3300025904 Bacteria 7370
526 Ga0207647_10151764 3300025904 Bacteria 1354
527 Ga0207647_10205617 3300025904 Bacteria 1138
528 Ga0207647_10356562 3300025904 Bacteria 828
529 Ga0207645_10014351 3300025907 Bacteria 5302
530 Ga0207645_10329078 3300025907 Bacteria 1020
531 Ga0207645_10372627 3300025907 Bacteria 957
532 Ga0207645_10486385 3300025907 Bacteria 835
533 Ga0207645_10613201 3300025907 Bacteria 739
534 Ga0207645_11106532 3300025907 Bacteria 534
535 Ga0207643_10262364 3300025908 Bacteria 1067
536 Ga0207643_10512962 3300025908 Bacteria 767
537 Ga0207705_10000243 3300025909 Bacteria 53479
538 Ga0207705_10018065 3300025909 Bacteria 5043
539 Ga0207705_10170172 3300025909 Bacteria 1640
540 Ga0207705_10298895 3300025909 Bacteria 1234
541 Ga0207705_10476427 3300025909 Bacteria 969
542 Ga0207705_10678009 3300025909 Bacteria 801
543 Ga0207705_11372488 3300025909 Bacteria 538
544 Ga0207654_10000796 3300025911 Bacteria 17350
545 Ga0207654_10272601 3300025911 Bacteria 1142
546 Ga0207654_10291692 3300025911 Bacteria 1106
547 Ga0207654_10389537 3300025911 Bacteria 967
548 Ga0207654_10679072 3300025911 Bacteria 739
549 Ga0207707_11574258 3300025912 Bacteria 518
550 Ga0207695_10006167 3300025913 Bacteria 15631
551 Ga0207695_10006293 3300025913 Bacteria 15449
552 Ga0207695_10941004 3300025913 Bacteria 744
553 Ga0207671_10003173 3300025914 Bacteria 16603
554 Ga0207671_10043377 3300025914 Bacteria 3326
555 Ga0207671_10403494 3300025914 Bacteria 1087
556 Ga0207671_10540879 3300025914 Bacteria 929
557 Ga0207660_10044818 3300025917 Bacteria 3113
558 Ga0207660_10738150 3300025917 Bacteria 803
559 Ga0207660_11259222 3300025917 Bacteria 601
560 Ga0207662_10447502 3300025918 Bacteria 883
561 Ga0207662_11345789 3300025918 Bacteria 507
562 Ga0207657_10172620 3300025919 Bacteria 1751
563 Ga0207657_10287802 3300025919 Bacteria 1303
564 Ga0207657_10459521 3300025919 Bacteria 999
565 Ga0207657_10622911 3300025919 Bacteria 841
566 Ga0207657_10823517 3300025919 Bacteria 717
567 Ga0207657_10931409 3300025919 Bacteria 668
568 Ga0207657_11142957 3300025919 Bacteria 594
569 Ga0207649_10155614 3300025920 Bacteria 1579
570 Ga0207649_10805784 3300025920 Bacteria 733
571 Ga0207649_11171159 3300025920 Bacteria 607
572 Ga0207652_10843960 3300025921 Bacteria 811
573 Ga0207681_10000005 3300025923 Bacteria 555724
574 Ga0207681_10000109 3300025923 Bacteria 71373
575 Ga0207681_10064025 3300025923 Bacteria 2537
576 Ga0207681_10107677 3300025923 Bacteria 2022
577 Ga0207681_10135208 3300025923 Bacteria 1828
578 Ga0207681_10135695 3300025923 Bacteria 1825
579 Ga0207681_10136951 3300025923 Bacteria 1818
580 Ga0207681_10322916 3300025923 Bacteria 1228
581 Ga0207681_10686576 3300025923 Bacteria 850
582 Ga0207681_10743248 3300025923 Bacteria 817
583 Ga0207694_10002782 3300025924 Bacteria 14124
584 Ga0207694_11268795 3300025924 Bacteria 623
585 Ga0207694_11295342 3300025924 Bacteria 616
586 Ga0207650_10000004 3300025925 Bacteria 743372
587 Ga0207650_10010619 3300025925 Bacteria 6323
588 Ga0207650_10012172 3300025925 Bacteria 5931
589 Ga0207650_10117282 3300025925 Bacteria 2068
590 Ga0207650_10149651 3300025925 Bacteria 1841
591 Ga0207650_10203478 3300025925 Bacteria 1587
592 Ga0207650_10329309 3300025925 Bacteria 1252
593 Ga0207650_10482537 3300025925 Bacteria 1034
594 Ga0207650_11599005 3300025925 Bacteria 553
595 Ga0207659_10001819 3300025926 Bacteria 12629
596 Ga0207659_11189377 3300025926 Bacteria 655
597 Ga0207659_11863388 3300025926 Bacteria 510
598 Ga0207687_11656320 3300025927 Bacteria 549
599 Ga0207700_10348620 3300025928 Bacteria 1289
600 Ga0207664_10033807 3300025929 Bacteria 3933
601 Ga0207664_10407847 3300025929 Bacteria 1209
602 Ga0207644_10000005 3300025931 Bacteria 441948
603 Ga0207644_10002343 3300025931 Bacteria 12231
604 Ga0207644_10013980 3300025931 Bacteria 5364
605 Ga0207644_10015604 3300025931 Bacteria 5101
606 Ga0207644_10265646 3300025931 Bacteria 1373
607 Ga0207644_10536901 3300025931 Bacteria 967
608 Ga0207644_10873001 3300025931 Bacteria 753
609 Ga0207690_10000234 3300025932 Bacteria 41241
610 Ga0207690_10064522 3300025932 Bacteria 2501
611 Ga0207690_10233117 3300025932 Bacteria 1414
612 Ga0207690_10244551 3300025932 Bacteria 1383
613 Ga0207690_10799856 3300025932 Bacteria 779
614 Ga0207690_11074208 3300025932 Bacteria 671
615 Ga0207690_11385288 3300025932 Bacteria 588
616 Ga0207706_10018915 3300025933 Bacteria 6194
617 Ga0207706_10104516 3300025933 Bacteria 2492
618 Ga0207706_10215402 3300025933 Bacteria 1682
619 Ga0207706_10695595 3300025933 Bacteria 869
620 Ga0207706_10788478 3300025933 Bacteria 808
621 Ga0207706_10966870 3300025933 Bacteria 717
622 Ga0207706_11278411 3300025933 Bacteria 607
623 Ga0207686_11238963 3300025934 Bacteria 611
624 Ga0207686_11632044 3300025934 Bacteria 533
625 Ga0207709_10294414 3300025935 Bacteria 1204
626 Ga0207709_10305309 3300025935 Bacteria 1185
627 Ga0207709_10425941 3300025935 Bacteria 1020
628 Ga0207709_11136648 3300025935 Bacteria 642
629 Ga0207709_11393360 3300025935 Bacteria 580
630 Ga0207670_10140665 3300025936 Bacteria 1780
631 Ga0207670_10157716 3300025936 Bacteria 1691
632 Ga0207670_11494504 3300025936 Bacteria 574
633 Ga0207670_11686067 3300025936 Bacteria 539
634 Ga0207669_10012728 3300025937 Bacteria 4147
635 Ga0207669_10172189 3300025937 Bacteria 1542
636 Ga0207669_10188591 3300025937 Bacteria 1485
637 Ga0207669_10793102 3300025937 Bacteria 785
638 Ga0207704_10188806 3300025938 Bacteria 1497
639 Ga0207704_10403625 3300025938 Bacteria 1079
640 Ga0207704_10425485 3300025938 Bacteria 1054
641 Ga0207704_11083677 3300025938 Bacteria 680
642 Ga0207665_10728840 3300025939 Bacteria 780
643 Ga0207691_10017921 3300025940 Bacteria 6710
644 Ga0207691_10443159 3300025940 Bacteria 1105
645 Ga0207691_10565637 3300025940 Bacteria 963
646 Ga0207691_10826742 3300025940 Bacteria 777
647 Ga0207691_10921219 3300025940 Bacteria 731
648 Ga0207691_11405573 3300025940 Bacteria 573
649 Ga0207691_11670538 3300025940 Bacteria 516
650 Ga0207711_10000025 3300025941 Bacteria 289972
651 Ga0207711_10001472 3300025941 Bacteria 21955
652 Ga0207711_10004929 3300025941 Bacteria 11336
653 Ga0207711_10007295 3300025941 Bacteria 9260
654 Ga0207711_10018353 3300025941 Bacteria 5814
655 Ga0207711_10198760 3300025941 Bacteria 1829
656 Ga0207711_10293709 3300025941 Bacteria 1498
657 Ga0207711_10689339 3300025941 Bacteria 953
658 Ga0207711_11171456 3300025941 Bacteria 710
659 Ga0207661_11692701 3300025944 Bacteria 578
660 Ga0207661_12027118 3300025944 Bacteria 521
661 Ga0207679_10000847 3300025945 Bacteria 19669
662 Ga0207679_10024678 3300025945 Bacteria 4124
663 Ga0207679_10169733 3300025945 Bacteria 1795
664 Ga0207679_10523914 3300025945 Bacteria 1060
665 Ga0207679_10976302 3300025945 Bacteria 776
666 Ga0207679_11842983 3300025945 Bacteria 552
667 Ga0207667_10004183 3300025949 Bacteria 17730
668 Ga0207667_10009439 3300025949 Bacteria 11487
669 Ga0207667_10021256 3300025949 Bacteria 7193
670 Ga0207667_10033512 3300025949 Bacteria 5521
671 Ga0207667_10113219 3300025949 Bacteria 2798
672 Ga0207667_10758480 3300025949 Bacteria 969
673 Ga0207667_12045683 3300025949 Bacteria 532
674 Ga0207651_10073408 3300025960 Bacteria 2433
675 Ga0207651_10120124 3300025960 Bacteria 1991
676 Ga0207651_11294335 3300025960 Bacteria 655
677 Ga0207712_10006239 3300025961 Bacteria 7512
678 Ga0207712_10037061 3300025961 Bacteria 3325
679 Ga0207712_10112962 3300025961 Bacteria 2041
680 Ga0207712_10124942 3300025961 Bacteria 1952
681 Ga0207712_10405567 3300025961 Bacteria 1147
682 Ga0207712_10515107 3300025961 Bacteria 1024
683 Ga0207668_10032300 3300025972 Bacteria 3457
684 Ga0207668_10098711 3300025972 Bacteria 2164
685 Ga0207668_10125743 3300025972 Bacteria 1949
686 Ga0207668_10142601 3300025972 Bacteria 1844
687 Ga0207668_10520698 3300025972 Bacteria 1026
688 Ga0207668_10896992 3300025972 Bacteria 789
689 Ga0207668_11544709 3300025972 Bacteria 599
690 Ga0207640_10007440 3300025981 Bacteria 6044
691 Ga0207640_10019616 3300025981 Bacteria 3999
692 Ga0207640_10023695 3300025981 Bacteria 3693
693 Ga0207640_10075290 3300025981 Bacteria 2287
694 Ga0207640_10310522 3300025981 Bacteria 1251
695 Ga0207640_10564709 3300025981 Bacteria 958
696 Ga0207640_11117636 3300025981 Bacteria 698
697 Ga0207658_10000064 3300025986 Bacteria 117779
698 Ga0207658_10004938 3300025986 Bacteria 9199
699 Ga0207658_10005381 3300025986 Bacteria 8790
700 Ga0207658_10245342 3300025986 Bacteria 1519
701 Ga0207658_10289784 3300025986 Bacteria 1406
702 Ga0207658_10310759 3300025986 Bacteria 1361
703 Ga0207658_10336283 3300025986 Bacteria 1311
704 Ga0207677_10456903 3300026023 Bacteria 1095
705 Ga0207703_10187314 3300026035 Bacteria 1830
706 Ga0207703_10465468 3300026035 Bacteria 1183
707 Ga0207703_11092724 3300026035 Bacteria 766
708 Ga0207703_11468793 3300026035 Bacteria 656
709 Ga0207703_11497294 3300026035 Bacteria 649
710 Ga0207639_10019581 3300026041 Bacteria 4829
711 Ga0207639_10250926 3300026041 Bacteria 1543
712 Ga0207639_10341890 3300026041 Bacteria 1334
713 Ga0207639_10371280 3300026041 Bacteria 1282
714 Ga0207639_10467754 3300026041 Bacteria 1147
715 Ga0207639_10749209 3300026041 Bacteria 908
716 Ga0207678_10014182 3300026067 Bacteria 7006
717 Ga0207678_10110312 3300026067 Bacteria 2347
718 Ga0207678_10166893 3300026067 Bacteria 1880
719 Ga0207678_11238296 3300026067 Bacteria 661
720 Ga0207678_11399066 3300026067 Bacteria 618
721 Ga0207678_11670553 3300026067 Bacteria 560
722 Ga0207708_10016146 3300026075 Bacteria 5609
723 Ga0207708_10344216 3300026075 Bacteria 1222
724 Ga0207708_11082489 3300026075 Bacteria 698
725 Ga0207708_11246471 3300026075 Bacteria 651
726 Ga0207702_10003021 3300026078 Bacteria 15630
727 Ga0207702_10005908 3300026078 Bacteria 10645
728 Ga0207702_10613417 3300026078 Bacteria 1068
729 Ga0207641_10003244 3300026088 Bacteria 14521
730 Ga0207641_10101679 3300026088 Bacteria 2533
731 Ga0207641_10127150 3300026088 Bacteria 2283
732 Ga0207641_10150340 3300026088 Bacteria 2108
733 Ga0207641_10323913 3300026088 Bacteria 1462
734 Ga0207641_11820018 3300026088 Bacteria 611
735 Ga0207648_10240702 3300026089 Bacteria 1611
736 Ga0207648_10459080 3300026089 Bacteria 1161
737 Ga0207648_11292458 3300026089 Bacteria 685
738 Ga0207676_10000006 3300026095 Bacteria 681936
739 Ga0207676_10014415 3300026095 Bacteria 5688
740 Ga0207676_10136112 3300026095 Bacteria 2096
741 Ga0207676_10250941 3300026095 Bacteria 1593
742 Ga0207676_10278645 3300026095 Bacteria 1517
743 Ga0207676_10972285 3300026095 Bacteria 835
744 Ga0207676_11582155 3300026095 Bacteria 653
745 Ga0207674_10062161 3300026116 Bacteria 3772
746 Ga0207674_10062748 3300026116 Bacteria 3753
747 Ga0207674_10141809 3300026116 Bacteria 2362
748 Ga0207674_10242234 3300026116 Bacteria 1750
749 Ga0207674_10648444 3300026116 Bacteria 1020
750 Ga0207674_10939193 3300026116 Bacteria 833
751 Ga0207674_11092817 3300026116 Bacteria 767
752 Ga0207675_100001117 3300026118 Bacteria 26571
753 Ga0207675_100022526 3300026118 Bacteria 5865
754 Ga0207675_100155097 3300026118 Bacteria 2182
755 Ga0207675_100877104 3300026118 Bacteria 913
756 Ga0207675_101019576 3300026118 Bacteria 846
757 Ga0207683_10000681 3300026121 Bacteria 31192
758 Ga0207683_10382507 3300026121 Bacteria 1294
759 Ga0207683_10777255 3300026121 Bacteria 889
760 Ga0207683_11466886 3300026121 Bacteria 630
761 Ga0207698_10016673 3300026142 Bacteria 4962
762 Ga0207698_10195073 3300026142 Bacteria 1808
763 Ga0207698_10281969 3300026142 Bacteria 1537
764 Ga0207698_10577682 3300026142 Bacteria 1105
765 Ga0207698_10713984 3300026142 Bacteria 998
766 Ga0207698_11103613 3300026142 Bacteria 806
767 Ga0207698_11288864 3300026142 Bacteria 745
768 Ga0209371_1030624 3300027312 Bacteria 1176
769 Ga0209984_1008264 3300027424 Bacteria 1307
770 Ga0209968_1021665 3300027526 Bacteria 1044
771 Ga0209968_1039141 3300027526 Bacteria 808
772 Ga0209999_1045243 3300027543 Bacteria 828
773 Ga0209982_1015255 3300027552 Bacteria 1165
774 Ga0209970_1056825 3300027614 Bacteria 714
775 Ga0209983_1010835 3300027665 Bacteria 1863
776 Ga0209983_1054690 3300027665 Bacteria 876
777 Ga0209983_1082206 3300027665 Bacteria 722
778 Ga0209998_10099554 3300027717 Bacteria 719
779 Ga0209974_10082069 3300027876 Bacteria 1111
780 Ga0209974_10086086 3300027876 Bacteria 1086
781 Ga0207428_10197963 3300027907 Bacteria 1512
782 Ga0207428_11065529 3300027907 Bacteria 566
783 Ga0268266_10012801 3300028379 Bacteria 7246
784 Ga0268266_10022523 3300028379 Bacteria 5368
785 Ga0268266_10511648 3300028379 Bacteria 1147
786 Ga0268266_10785691 3300028379 Bacteria 919
787 Ga0268265_10000001 3300028380 Bacteria 1230727
788 Ga0268265_10001591 3300028380 Bacteria 18782
789 Ga0268265_10168803 3300028380 Bacteria 1867
790 Ga0268265_10342767 3300028380 Bacteria 1361
791 Ga0268265_10356224 3300028380 Bacteria 1338
792 Ga0268265_10622760 3300028380 Bacteria 1034
793 Ga0268265_12008182 3300028380 Bacteria 585
794 Ga0268264_10000277 3300028381 Bacteria 86740
795 Ga0268264_10015144 3300028381 Bacteria 6326
796 Ga0268264_10058700 3300028381 Bacteria 3223
797 Ga0268264_10102800 3300028381 Bacteria 2487
798 Ga0268264_10177216 3300028381 Bacteria 1933
799 Ga0268264_10505030 3300028381 Bacteria 1180
800 Ga0307511_10006537 3300030521 Bacteria 11736
801 Ga0316177_1214891 3300030731 Bacteria 663
802 Ga0314311_1010360 3300030733 Bacteria 1203
803 Ga0316178_1068395 3300030735 Bacteria 841
804 Ga0307513_10000162 3300031456 Bacteria 96000
805 Ga0307513_10010515 3300031456 Bacteria 11583
806 Ga0307408_100006443 3300031548 Bacteria 7780
807 Ga0307408_100023913 3300031548 Bacteria 4166
808 Ga0307408_100094952 3300031548 Bacteria 2259
809 Ga0307408_100395292 3300031548 Bacteria 1186
810 Ga0307408_100491550 3300031548 Bacteria 1072
811 Ga0307408_100666816 3300031548 Bacteria 931
812 Ga0307408_101072415 3300031548 Bacteria 746
813 Ga0265314_10149514 3300031711 Bacteria 1434
814 Ga0316576_10543318 3300031727 Bacteria 852
815 Ga0307405_10019698 3300031731 Bacteria 3754
816 Ga0307405_10057515 3300031731 Bacteria 2443
817 Ga0307405_10144798 3300031731 Bacteria 1662
818 Ga0307405_10171397 3300031731 Bacteria 1548
819 Ga0307405_10340784 3300031731 Bacteria 1152
820 Ga0307405_10871404 3300031731 Bacteria 759
821 Ga0307405_11653421 3300031731 Bacteria 566
822 Ga0307413_10074509 3300031824 Bacteria 2150
823 Ga0307413_10086312 3300031824 Bacteria 2029
824 Ga0307413_10113610 3300031824 Bacteria 1818
825 Ga0307413_10567311 3300031824 Bacteria 923
826 Ga0307413_10602167 3300031824 Bacteria 899
827 Ga0307413_10699901 3300031824 Bacteria 841
828 Ga0307413_10779755 3300031824 Bacteria 801
829 Ga0307410_10012286 3300031852 Bacteria 4944
830 Ga0307410_10099934 3300031852 Bacteria 2077
831 Ga0307410_10120091 3300031852 Bacteria 1915
832 Ga0307410_10306713 3300031852 Bacteria 1254
833 Ga0307410_10360926 3300031852 Bacteria 1163
834 Ga0307410_10407171 3300031852 Bacteria 1100
835 Ga0307410_10522766 3300031852 Bacteria 979
836 Ga0307410_10606437 3300031852 Bacteria 914
837 Ga0307410_10862790 3300031852 Bacteria 774
838 Ga0307410_10885716 3300031852 Bacteria 764
839 Ga0307410_11274668 3300031852 Bacteria 642
840 Ga0307406_10008913 3300031901 Bacteria 5608
841 Ga0307406_10046990 3300031901 Bacteria 2718
842 Ga0307406_10053412 3300031901 Bacteria 2573
843 Ga0307406_10912592 3300031901 Bacteria 748
844 Ga0307406_11311714 3300031901 Bacteria 632
845 Ga0307407_10002227 3300031903 Bacteria 7491
846 Ga0307407_10070319 3300031903 Bacteria 2080
847 Ga0307407_10315871 3300031903 Bacteria 1094
848 Ga0307407_10520755 3300031903 Bacteria 874
849 Ga0307407_10569608 3300031903 Bacteria 839
850 Ga0307407_10706773 3300031903 Bacteria 760
851 Ga0307407_10788895 3300031903 Bacteria 722
852 Ga0307412_10000330 3300031911 Bacteria 30088
853 Ga0307412_10001378 3300031911 Bacteria 13503
854 Ga0307412_10005349 3300031911 Bacteria 7203
855 Ga0307412_10088494 3300031911 Bacteria 2160
856 Ga0307412_10143230 3300031911 Bacteria 1753
857 Ga0307412_10149070 3300031911 Bacteria 1723
858 Ga0307412_10897320 3300031911 Bacteria 776
859 Ga0307412_10998701 3300031911 Bacteria 739
860 Ga0307409_100054731 3300031995 Bacteria 3075
861 Ga0307409_100120541 3300031995 Bacteria 2220
862 Ga0307409_100468498 3300031995 Bacteria 1219
863 Ga0307409_100499224 3300031995 Bacteria 1184
864 Ga0307409_101199490 3300031995 Bacteria 782
865 Ga0307409_101523219 3300031995 Bacteria 696
866 Ga0307409_101984172 3300031995 Bacteria 611
867 Ga0307416_100005600 3300032002 Bacteria 7741
868 Ga0307416_100007111 3300032002 Bacteria 7076
869 Ga0307416_100015206 3300032002 Bacteria 5305
870 Ga0307416_100343007 3300032002 Bacteria 1508
871 Ga0307416_100420483 3300032002 Bacteria 1380
872 Ga0307416_100716940 3300032002 Bacteria 1090
873 Ga0307416_100904952 3300032002 Bacteria 982
874 Ga0307416_101291913 3300032002 Bacteria 835
875 Ga0307414_10000117 3300032004 Bacteria 56697
876 Ga0307414_10013980 3300032004 Bacteria 4795
877 Ga0307414_10017211 3300032004 Bacteria 4416
878 Ga0307414_10313918 3300032004 Bacteria 1331
879 Ga0307414_10667321 3300032004 Bacteria 938
880 Ga0307414_10708957 3300032004 Bacteria 911
881 Ga0307414_11089132 3300032004 Bacteria 737
882 Ga0307411_10016991 3300032005 Bacteria 4132
883 Ga0307411_10118140 3300032005 Bacteria 1912
884 Ga0307411_10191187 3300032005 Bacteria 1563
885 Ga0307411_10202406 3300032005 Bacteria 1526
886 Ga0307411_10279700 3300032005 Bacteria 1327
887 Ga0307411_10319906 3300032005 Bacteria 1252
888 Ga0307411_10469979 3300032005 Bacteria 1056
889 Ga0307411_10831451 3300032005 Bacteria 815
890 Ga0307411_10911586 3300032005 Bacteria 781
891 Ga0307411_11536867 3300032005 Bacteria 612
892 Ga0307411_11542581 3300032005 Bacteria 611
893 Ga0307415_100006247 3300032126 Bacteria 6400
894 Ga0307415_100011564 3300032126 Bacteria 5056
895 Ga0307415_100013332 3300032126 Bacteria 4795
896 Ga0307415_100169143 3300032126 Bacteria 1702
897 Ga0307415_100188481 3300032126 Bacteria 1625
898 Ga0307415_101289550 3300032126 Bacteria 691
899 Ga0307415_101311329 3300032126 Bacteria 686
900 Ga0307415_101478990 3300032126 Bacteria 649
901 Ga0307415_101868588 3300032126 Bacteria 582
902 Ga0316593_10137165 3300032168 Bacteria 885
903 Ga0307510_10013278 3300033180 Bacteria 9767
904 Ga0307510_10212732 3300033180 Bacteria 1454
905 Ga0373950_0157713 3300034818 Bacteria 523
906 Ga0373949_0162496 3300035090 Bacteria 652
907 Ga0373949_0282794 3300035090 Bacteria 522
908 Ga0373939_0036939 3300035114 Bacteria 1448
909 Ga0373943_0861582 3300035170 Bacteria 540
910 Ga0373955_0225626 3300035172 Bacteria 1120
911 Ga0373962_0088605 3300035242 Bacteria 950
912 Ga0373931_0034960 3300035691 Bacteria 2610
913 Ga0316584_0035209 3300036712 Bacteria 3715
914 Ga0373925_1046502 3300037068 Bacteria 672
915 Ga0395899_0007143 3300037312 Bacteria 8642
916 Ga0395899_0029552 3300037312 Bacteria 4122
917 Ga0395900_0022460 3300037418 Bacteria 6452
918 Ga0395900_0031276 3300037418 Bacteria 5467
919 Ga0395900_0050225 3300037418 Bacteria 4296
920 Ga0395900_0401581 3300037418 Bacteria 1334
921 Ga0395900_0735156 3300037418 Bacteria 918
922 Ga0395898_0017917 3300037466 Bacteria 7225
923 Ga0395898_0381662 3300037466 Bacteria 1344
924 Ga0395898_0522393 3300037466 Bacteria 1128
925 Ga0395898_0653944 3300037466 Bacteria 993
926 Ga0395905_0000031 3300037471 Bacteria 286757
927 Ga0395905_0035925 3300037471 Bacteria 4653
928 Ga0395905_0173828 3300037471 Bacteria 2023
929 Ga0395905_0194372 3300037471 Bacteria 1903
930 Ga0395905_0274258 3300037471 Bacteria 1573
931 Ga0395905_0328510 3300037471 Bacteria 1419
932 Ga0395905_0362780 3300037471 Bacteria 1341
933 Ga0395905_0478760 3300037471 Bacteria 1144
934 Ga0395905_0507598 3300037471 Bacteria 1106
935 Ga0395905_0632069 3300037471 Bacteria 972
936 Ga0395905_0958577 3300037471 Bacteria 758
937 Ga0436364_1065372 3300037853 Bacteria 196587
938 Ga0395901_0029243 3300038443 Bacteria 5670
939 Ga0395901_0052641 3300038443 Bacteria 4231
940 Ga0395901_0053759 3300038443 Bacteria 4184
941 Ga0395901_0263263 3300038443 Bacteria 1794
942 Ga0395901_0598300 3300038443 Bacteria 1112
943 Ga0395901_1159643 3300038443 Bacteria 740
944 Ga0395901_2044905 3300038443 Bacteria 518
945 Ga0400486_32139 3300038742 Bacteria 2745
946 Ga0436365_1297965 3300039437 Bacteria 1126
947 Ga0436365_1769134 3300039437 Bacteria 517
948 Ga0436363_1100502 3300039450 Bacteria 846
949 Ga0436362_0798514 3300039453 Bacteria 3452
950 Ga0439453_0061634 3300041408 Bacteria 778
951 Ga0439465_0070568 3300041413 Bacteria 1170
952 Ga0439465_0156571 3300041413 Bacteria 816
953 Ga0451787_390226 3300041441 Bacteria 553
954 Ga0451790_00316 3300041444 Bacteria 630
955 Ga0451791_0503248 3300041451 Bacteria 653
956 Ga0451791_1104984 3300041451 Bacteria 563
957 Ga0451793_0741227 3300041452 Bacteria 883
958 Ga0451793_1374280 3300041452 Bacteria 577
959 Ga0451798_0619513 3300041458 Bacteria 687
960 Ga0451802_2082364 3300041460 Bacteria 1377
961 Ga0451806_470971 3300041462 Bacteria 943
962 Ga0451806_566321 3300041462 Bacteria 790
963 Ga0451807_0886460 3300041486 Bacteria 770
964 Ga0451833_0002658 3300041491 Bacteria 864
965 Ga0451833_1375293 3300041491 Bacteria 558
966 Ga0451835_0084593 3300041492 Bacteria 687
967 Ga0451835_0542372 3300041492 Bacteria 634
968 Ga0451837_0693834 3300041494 Bacteria 519
969 Ga0451845_0970488 3300041501 Bacteria 525
970 Ga0451851_0815981 3300041507 Bacteria 638
971 Ga0451855_1317451 3300041511 Bacteria 570
972 Ga0451855_1380188 3300041511 Bacteria 995
973 Ga0451853_3932357 3300041512 Bacteria 751
974 Ga0439433_0025105 3300041999 Bacteria 1345
975 Ga0439441_020693 3300042001 Bacteria 1208
976 Ga0439445_0002249 3300042004 Bacteria 4286
977 Ga0439448_0055818 3300042005 Bacteria 1299
978 Ga0439432_106712 3300042006 Bacteria 835
979 Ga0439449_0044016 3300042007 Bacteria 1656
980 Ga0439450_019689 3300042008 Bacteria 1433
981 Ga0439454_067357 3300042011 Bacteria 630
982 Ga0439455_0078878 3300042012 Bacteria 893
983 Ga0450912_000406 3300042116 Bacteria 2080
984 Ga0450917_002616 3300042120 Bacteria 1290
985 Ga0450920_018839 3300042122 Bacteria 1323
986 Ga0450923_015818 3300042125 Bacteria 1415
987 Ga0450894_042600 3300042131 Bacteria 655
988 Ga0450902_055233 3300042137 Bacteria 684
989 Ga0450906_019463 3300042145 Bacteria 1217
990 Ga0439446_0145971 3300042156 Bacteria 775
991 Ga0450918_033244 3300042531 Bacteria 914
992 Ga0451577_0708206 3300042876 Bacteria 912
993 Ga0451577_0940419 3300042876 Bacteria 777
994 Ga0439440_0221149 3300042993 Bacteria 568
995 Ga0466969_0076277 3300044656 Bacteria 1606
996 Ga0466972_0196342 3300044658 Bacteria 946
997 Ga0466972_0209711 3300044658 Bacteria 912
998 Ga0466966_0213565 3300044684 Bacteria 1165
999 Ga0466961_0562513 3300044693 Bacteria 686
1000 Ga0453684_0153114 3300044712 Bacteria 2737
1001 Ga0453684_0589010 3300044712 Bacteria 1220
1002 Ga0466971_0372534 3300044719 Bacteria 693
1003 Ga0466968_0010999 3300044735 Bacteria 3517
1004 Ga0466968_0250288 3300044735 Bacteria 841
1005 Ga0466957_0077343 3300044842 Bacteria 2067
1006 Ga0466957_0553996 3300044842 Bacteria 801
1007 Ga0466957_1061208 3300044842 Bacteria 583
1008 Ga0466960_0738413 3300044901 Bacteria 593
1009 Ga0466959_0263063 3300045049 Bacteria 1187
1010 Ga0466959_0289265 3300045049 Bacteria 1123
1011 Ga0451576_2139109 3300045051 Bacteria 575
1012 Ga0466958_0451214 3300045836 Bacteria 832
1013 Ga0466958_0765460 3300045836 Bacteria 629
1014 Ga0466967_0407001 3300045976 Bacteria 1324
1015 Ga0466967_2488322 3300045976 Bacteria 513
1016 Ga0495590_0158635 3300046457 Bacteria 822
1017 Ga0495590_0241931 3300046457 Bacteria 670
1018 Ga0495638_0115483 3300046460 Bacteria 1591
1019 Ga0495638_0593218 3300046460 Bacteria 545
1020 Ga0495638_0606663 3300046460 Bacteria 537
1021 Ga0495650_0143718 3300046471 Bacteria 861
1022 Ga0495584_0131949 3300046491 Bacteria 1267
1023 Ga0495596_0112786 3300046500 Bacteria 1056
1024 Ga0495632_0246087 3300046519 Bacteria 803
1025 Ga0495632_0312770 3300046519 Bacteria 695
1026 Ga0495663_0078113 3300046525 Bacteria 1062
1027 Ga0495642_0576188 3300046528 Bacteria 500
1028 Ga0495598_0403631 3300046537 Bacteria 534
1029 Ga0495621_0277072 3300046539 Bacteria 690
1030 Ga0495597_0229089 3300046542 Bacteria 736
1031 Ga0495622_0322808 3300046557 Bacteria 671
1032 Ga0495668_0150942 3300046616 Bacteria 1272
1033 Ga0495668_0166107 3300046616 Bacteria 1209
1034 Ga0495668_0280848 3300046616 Bacteria 912
1035 Ga0495668_0416197 3300046616 Bacteria 739
1036 Ga0495669_0116862 3300046684 Bacteria 1248
1037 Ga0495669_0410406 3300046684 Bacteria 657
1038 Ga0495670_0015418 3300046691 Bacteria 3755
1039 Ga0495670_0357840 3300046691 Bacteria 786
1040 Ga0495649_0097490 3300046694 Bacteria 1564
1041 Ga0495589_0122273 3300046794 Bacteria 1253
1042 Ga0495589_0293318 3300046794 Bacteria 755
1043 Ga0495672_0380130 3300047320 Bacteria 650
1044 Ga0495683_0246985 3300047323 Bacteria 785
1045 Ga0495677_0218494 3300047445 Bacteria 742
1046 Ga0495685_217507 3300047447 Bacteria 610
1047 Ga0495673_0098949 3300047469 Bacteria 1182
1048 Ga0495681_0063192 3300047470 Bacteria 1700
1049 Ga0495686_0214876 3300047472 Bacteria 1097
1050 Ga0496100_0017887 3300048903 Bacteria 4193
1051 Ga0496100_0042948 3300048903 Bacteria 2889
1052 Ga0496100_0065395 3300048903 Bacteria 2409
1053 Ga0496100_0072649 3300048903 Bacteria 2300
1054 Ga0496100_0100037 3300048903 Bacteria 1996
1055 Ga0496100_0401531 3300048903 Bacteria 1044
1056 Ga0496101_0007782 3300048904 Bacteria 6963
1057 Ga0496101_0013181 3300048904 Bacteria 5533
1058 Ga0496101_0046999 3300048904 Bacteria 3097
1059 Ga0496101_0060073 3300048904 Bacteria 2757
1060 Ga0496101_0105123 3300048904 Bacteria 2118
1061 Ga0496101_0476988 3300048904 Bacteria 985
1062 Ga0496101_0499073 3300048904 Bacteria 961
1063 Ga0496101_0983045 3300048904 Bacteria 664
1064 Ga0496102_0000345 3300048905 Bacteria 56618
1065 Ga0496102_0001880 3300048905 Bacteria 18093
1066 Ga0496102_0038393 3300048905 Bacteria 4321
1067 Ga0496102_0321597 3300048905 Bacteria 1457
1068 Ga0496102_0362700 3300048905 Bacteria 1364
1069 Ga0496103_0000110 3300048906 Bacteria 90202
1070 Ga0496103_0000276 3300048906 Bacteria 48842
1071 Ga0496103_0010156 3300048906 Bacteria 5567
1072 Ga0496103_0030798 3300048906 Bacteria 3266
1073 Ga0496103_0064863 3300048906 Bacteria 2277
1074 Ga0496103_0193874 3300048906 Bacteria 1306
1075 Ga0496103_0211450 3300048906 Bacteria 1247
1076 Ga0496104_0000047 3300048907 Bacteria 148896
1077 Ga0496104_0015109 3300048907 Bacteria 6988
1078 Ga0496104_0045259 3300048907 Bacteria 4138
1079 Ga0496104_0171951 3300048907 Bacteria 2077
1080 Ga0496104_0471527 3300048907 Bacteria 1167
1081 Ga0496104_1079821 3300048907 Bacteria 706
1082 Ga0496105_0000034 3300048908 Bacteria 127505
1083 Ga0496105_0013990 3300048908 Bacteria 6382
1084 Ga0496105_0071727 3300048908 Bacteria 2862
1085 Ga0496105_0074994 3300048908 Bacteria 2794
1086 Ga0496106_0004127 3300048909 Bacteria 10825
1087 Ga0496106_0087648 3300048909 Bacteria 2398
1088 Ga0496106_0192678 3300048909 Bacteria 1621
1089 Ga0496106_0538407 3300048909 Bacteria 937
1090 Ga0496106_0600882 3300048909 Bacteria 881
1091 Ga0496106_0831324 3300048909 Bacteria 732
1092 Ga0496107_0002978 3300048910 Bacteria 11215
1093 Ga0496107_0065334 3300048910 Bacteria 2637
1094 Ga0496107_0075313 3300048910 Bacteria 2456
1095 Ga0496107_0092297 3300048910 Bacteria 2213
1096 Ga0496107_0114521 3300048910 Bacteria 1984
1097 Ga0496107_0574145 3300048910 Bacteria 834
1098 Ga0496108_0017449 3300048911 Bacteria 5873
1099 Ga0496108_0247391 3300048911 Bacteria 1551
1100 Ga0496109_0006427 3300048912 Bacteria 9898
1101 Ga0496109_0012139 3300048912 Bacteria 7430
1102 Ga0496109_0017285 3300048912 Bacteria 6317
1103 Ga0496109_0347268 3300048912 Bacteria 1401
1104 Ga0496109_0444060 3300048912 Bacteria 1225
1105 Ga0496109_0451919 3300048912 Bacteria 1213
1106 Ga0496110_0032770 3300048913 Bacteria 4491
1107 Ga0496110_0310814 3300048913 Bacteria 1435
1108 Ga0496110_0516261 3300048913 Bacteria 1087
1109 Ga0496110_0712834 3300048913 Bacteria 905
1110 Ga0496110_0958406 3300048913 Bacteria 762
1111 Ga0496111_0056586 3300048914 Bacteria 2837
1112 Ga0496111_0515411 3300048914 Bacteria 880
1113 Ga0496111_0535498 3300048914 Bacteria 860
1114 Ga0496111_1019852 3300048914 Bacteria 592
1115 Ga0496112_0030279 3300048915 Bacteria 5236
1116 Ga0496112_0038752 3300048915 Bacteria 4655
1117 Ga0496112_0046698 3300048915 Bacteria 4248
1118 Ga0496112_0094664 3300048915 Bacteria 2957
1119 Ga0496113_0011540 3300048916 Bacteria 5901
1120 Ga0496113_0011673 3300048916 Bacteria 5875
1121 Ga0496113_0014734 3300048916 Bacteria 5347
1122 Ga0496113_0086466 3300048916 Bacteria 2409
1123 Ga0496113_1320023 3300048916 Bacteria 561
1124 Ga0496114_0029773 3300048917 Bacteria 4488
1125 Ga0496114_0062704 3300048917 Bacteria 3111
1126 Ga0496114_0104199 3300048917 Bacteria 2425
1127 Ga0496114_0267595 3300048917 Bacteria 1506
1128 Ga0496114_0475808 3300048917 Bacteria 1105
1129 Ga0496115_0007121 3300048918 Bacteria 8213
1130 Ga0496115_0030807 3300048918 Bacteria 4223
1131 Ga0496115_0179827 3300048918 Bacteria 1749
1132 Ga0496115_0563570 3300048918 Bacteria 909
1133 Ga0496116_0000035 3300048919 Bacteria 402424
1134 Ga0496116_0006727 3300048919 Bacteria 10350
1135 Ga0496116_0162835 3300048919 Bacteria 1221
1136 Ga0496116_0478282 3300048919 Bacteria 525
1137 Ga0496117_0000146 3300048920 Bacteria 152244
1138 Ga0496117_0000633 3300048920 Bacteria 56618
1139 Ga0496117_0056690 3300048920 Bacteria 2727
1140 Ga0496117_0104942 3300048920 Bacteria 1777
1141 Ga0496117_0198027 3300048920 Bacteria 1137
1142 Ga0496118_0000654 3300048921 Bacteria 56618
1143 Ga0496118_0001846 3300048921 Bacteria 30336
1144 Ga0496118_0083807 3300048921 Bacteria 2227
1145 Ga0496119_0000057 3300048922 Bacteria 173746
1146 Ga0496119_0107924 3300048922 Bacteria 1551
1147 Ga0496120_0000686 3300048923 Bacteria 49719
1148 Ga0496121_0002302 3300048924 Bacteria 29625
1149 Ga0496121_0004567 3300048924 Bacteria 18461
1150 Ga0496121_0127343 3300048924 Bacteria 1912
1151 Ga0496122_0000723 3300048925 Bacteria 64694
1152 Ga0496122_0009631 3300048925 Bacteria 10115
1153 Ga0496122_0115844 3300048925 Bacteria 1744
1154 Ga0496123_0003623 3300048926 Bacteria 17095
1155 Ga0496123_0005637 3300048926 Bacteria 12503
1156 Ga0496123_0072757 3300048926 Bacteria 2137
1157 Ga0496124_0000664 3300048927 Bacteria 56618
1158 Ga0496124_0005247 3300048927 Bacteria 14676
1159 Ga0496124_0005829 3300048927 Bacteria 13673
1160 Ga0496124_0008523 3300048927 Bacteria 10701
1161 Ga0496124_0061846 3300048927 Bacteria 3136
1162 Ga0496124_0299375 3300048927 Bacteria 1163
1163 Ga0496125_0003283 3300048928 Bacteria 19867
1164 Ga0496125_0018829 3300048928 Bacteria 6538
1165 Ga0496125_0035566 3300048928 Bacteria 4365
1166 Ga0496125_0038992 3300048928 Bacteria 4100
1167 Ga0496125_0152988 3300048928 Bacteria 1581
1168 Ga0496125_0377163 3300048928 Bacteria 837
1169 Ga0496126_0000028 3300048929 Bacteria 394082
1170 Ga0496126_0000084 3300048929 Bacteria 217111
1171 Ga0496126_0049088 3300048929 Bacteria 3854
1172 Ga0496126_0396529 3300048929 Bacteria 1120
1173 Ga0501306_028173 3300049127 Bacteria 821
1174 Ga0501306_048947 3300049127 Bacteria 674
1175 Ga0501306_051230 3300049127 Bacteria 662
1176 Ga0501305_057482 3300049161 Bacteria 664
1177 Ga0501305_116221 3300049161 Bacteria 510
1178 Ga0501307_077067 3300049162 Bacteria 539
1179 Ga0501312_018590 3300049528 Bacteria 1013
1180 Ga0501312_074784 3300049528 Bacteria 605
1181 Ga0501314_000002 3300049530 Bacteria 13192
1182 Ga0501315_017306 3300049531 Bacteria 941
1183 Ga0501317_019109 3300049533 Bacteria 912
1184 Ga0501317_055003 3300049533 Bacteria 641
1185 Ga0501323_031592 3300049539 Bacteria 746
1186 Ga0501323_088693 3300049539 Bacteria 513
1187 Ga0501335_007167 3300049551 Bacteria 1026
1188 Ga0501335_014667 3300049551 Bacteria 793
1189 Ga0501031_0126555 3300049568 Bacteria 1669
1190 Ga0501031_0241885 3300049568 Bacteria 1173
1191 Ga0501031_0765269 3300049568 Bacteria 619
1192 Ga0501032_0208418 3300049569 Bacteria 1275
1193 Ga0501032_0415952 3300049569 Bacteria 863
1194 Ga0501032_0508991 3300049569 Bacteria 769
1195 Ga0501033_0172227 3300049570 Bacteria 1554
1196 Ga0501033_0270797 3300049570 Bacteria 1200
1197 Ga0501033_0281342 3300049570 Bacteria 1174
1198 Ga0501033_0838230 3300049570 Bacteria 620
1199 Ga0501034_0025412 3300049571 Bacteria 6029
1200 Ga0501034_0247035 3300049571 Bacteria 1729
1201 Ga0501034_0478339 3300049571 Bacteria 1161
1202 Ga0501034_0729840 3300049571 Bacteria 887
1203 Ga0501036_0018306 3300049572 Bacteria 5865
1204 Ga0501036_0042635 3300049572 Bacteria 3841
1205 Ga0501036_0165512 3300049572 Bacteria 1864
1206 Ga0501036_0813227 3300049572 Bacteria 769
1207 Ga0501037_0138294 3300049573 Bacteria 1744
1208 Ga0501037_0194822 3300049573 Bacteria 1434
1209 Ga0501037_0268954 3300049573 Bacteria 1190
1210 Ga0501037_0668128 3300049573 Bacteria 693
1211 Ga0501037_0848222 3300049573 Bacteria 601
1212 Ga0501038_0078858 3300049574 Bacteria 2778
1213 Ga0501038_0099119 3300049574 Bacteria 2429
1214 Ga0501038_0460347 3300049574 Bacteria 977
1215 Ga0501038_0708435 3300049574 Bacteria 754
1216 Ga0501039_0099065 3300049575 Bacteria 2274
1217 Ga0501039_1017715 3300049575 Bacteria 643
1218 Ga0501040_0092275 3300049576 Bacteria 2105
1219 Ga0501040_0099905 3300049576 Bacteria 2022
1220 Ga0501041_0030131 3300049577 Bacteria 3275
1221 Ga0501041_0078054 3300049577 Bacteria 2037
1222 Ga0501042_0049150 3300049578 Bacteria 3008
1223 Ga0501042_0217545 3300049578 Bacteria 1378
1224 Ga0501042_1082022 3300049578 Bacteria 584
1225 Ga0501042_1145601 3300049578 Bacteria 567
1226 Ga0501043_0303623 3300049579 Bacteria 1219
1227 Ga0501043_0449366 3300049579 Bacteria 968
1228 Ga0501043_0454212 3300049579 Bacteria 962
1229 Ga0501046_0013319 3300049580 Bacteria 6966
1230 Ga0501046_0084789 3300049580 Bacteria 2443
1231 Ga0501046_0661801 3300049580 Bacteria 738
1232 Ga0501047_0343378 3300049581 Bacteria 1330
1233 Ga0501047_0514337 3300049581 Bacteria 1023
1234 Ga0501047_0960007 3300049581 Bacteria 668
1235 Ga0501048_0229422 3300049582 Bacteria 1317
1236 Ga0501048_0253661 3300049582 Bacteria 1249
1237 Ga0501048_0686070 3300049582 Bacteria 735
1238 Ga0501048_1305937 3300049582 Bacteria 522
1239 Ga0501067_0019787 3300049583 Bacteria 3726
1240 Ga0501067_0207443 3300049583 Bacteria 1091
1241 Ga0501068_0030631 3300049584 Bacteria 3193
1242 Ga0501068_0122438 3300049584 Bacteria 1623
1243 Ga0501068_0582926 3300049584 Bacteria 728
1244 Ga0501069_0010393 3300049585 Bacteria 4925
1245 Ga0501069_0488905 3300049585 Bacteria 734
1246 Ga0501069_0776948 3300049585 Bacteria 580
1247 Ga0501070_0014243 3300049586 Bacteria 6692
1248 Ga0501070_0371806 3300049586 Bacteria 1159
1249 Ga0501070_0587267 3300049586 Bacteria 889
1250 Ga0501070_0911750 3300049586 Bacteria 685
1251 Ga0501070_1180823 3300049586 Bacteria 588
1252 Ga0501071_0017063 3300049587 Bacteria 5001
1253 Ga0501071_0330706 3300049587 Bacteria 1158
1254 Ga0501072_0025429 3300049588 Bacteria 4612
1255 Ga0501072_0242569 3300049588 Bacteria 1435
1256 Ga0501072_0245070 3300049588 Bacteria 1427
1257 Ga0501072_0900024 3300049588 Bacteria 691
1258 Ga0501074_0110230 3300049590 Bacteria 1969
1259 Ga0501074_0610191 3300049590 Bacteria 771
1260 Ga0501074_0887198 3300049590 Bacteria 628
1261 Ga0501075_0013808 3300049591 Bacteria 5774
1262 Ga0501075_0224856 3300049591 Bacteria 1431
1263 Ga0501076_0000421 3300049592 Bacteria 26662
1264 Ga0501076_0094632 3300049592 Bacteria 2405
1265 Ga0501076_0733278 3300049592 Bacteria 816
1266 Ga0501076_0965506 3300049592 Bacteria 702
1267 Ga0501077_0022721 3300049593 Bacteria 3974
1268 Ga0501077_0067033 3300049593 Bacteria 2276
1269 Ga0501223_000394 3300049663 Bacteria 10743
1270 Ga0501224_000009 3300049664 Bacteria 107191
1271 Ga0501233_000604 3300049668 Bacteria 5865
1272 Ga0501235_004379 3300049669 Bacteria 3054
1273 Ga0501239_007192 3300049672 Bacteria 1161
1274 Ga0501252_066287 3300049682 Bacteria 574
1275 Ga0501257_074213 3300049686 Bacteria 872
1276 Ga0501259_155413 3300049688 Bacteria 569
1277 Ga0501225_0000094 3300049705 Bacteria 28402
1278 Ga0501079_0013561 3300049741 Bacteria 6216
1279 Ga0501079_0166268 3300049741 Bacteria 1720
1280 Ga0501079_0439844 3300049741 Bacteria 1024
1281 Ga0501079_1267185 3300049741 Bacteria 580
1282 Ga0501080_0027711 3300049742 Bacteria 5268
1283 Ga0501080_0306890 3300049742 Bacteria 1439
1284 Ga0501081_0063944 3300049743 Bacteria 2554
1285 Ga0501081_0207993 3300049743 Bacteria 1420
1286 Ga0501083_0027038 3300049744 Bacteria 3961
1287 Ga0501083_0121106 3300049744 Bacteria 1716
1288 Ga0501083_0122165 3300049744 Bacteria 1708
1289 Ga0501268_060531 3300049765 Bacteria 749
1290 Ga0501270_042241 3300049767 Bacteria 798
1291 Ga0501035_0331354 3300049822 Bacteria 1277
1292 Ga0501035_0571172 3300049822 Bacteria 924
1293 Ga0501044_0032239 3300049823 Bacteria 5509
1294 Ga0501044_0791978 3300049823 Bacteria 828
1295 Ga0501044_0937891 3300049823 Bacteria 739
1296 Ga0501045_0139388 3300049824 Bacteria 1803
1297 Ga0501045_0323542 3300049824 Bacteria 1147
1298 Ga0501045_0873588 3300049824 Bacteria 661
1299 Ga0501226_000076 3300049853 Bacteria 29950
1300 nmdc:mga03683_31_c1 3300050489 Bacteria 69502
1301 nmdc:mga03683_47433_c1 3300050489 Bacteria 1783
1302 nmdc:mga03n38_4566_c1 3300050490 Bacteria 4608
1303 nmdc:mga00v17_110640_c1 3300050491 Bacteria 1742
1304 nmdc:mga0yw44_461045_c2 3300050492 Bacteria 500
1305 nmdc:mga0yw44_767745_c1 3300050492 Bacteria 655
1306 nmdc:mga0k408_125335_c2 3300050493 Bacteria 734
1307 nmdc:mga0k408_538_c1 3300050493 Bacteria 20859
1308 nmdc:mga06z11_260048_c1 3300050494 Bacteria 1024
1309 nmdc:mga07m45_176045_c1 3300050496 Bacteria 1244
1310 nmdc:mga07m45_19_c1 3300050496 Bacteria 133476
1311 nmdc:mga07m45_406701_c1 3300050496 Bacteria 790
1312 nmdc:mga07m45_745415_c1 3300050496 Bacteria 562
1313 nmdc:mga05p37_49513_c1 3300050507 Bacteria 5168
1314 nmdc:mga06r32_274856_c1 3300050510 Bacteria 1672
1315 nmdc:mga06r32_328722_c1 3300050510 Bacteria 1514
1316 nmdc:mga08y16_1330190_c1 3300050511 Bacteria 684
1317 nmdc:mga08y16_343991_c1 3300050511 Bacteria 1533
1318 nmdc:mga08y16_531895_c1 3300050511 Bacteria 1191
1319 nmdc:mga0n895_2125338_c1 3300050512 Bacteria 518
1320 nmdc:mga0sz30_17138_c1 3300050516 Bacteria 2887
1321 Ga0500643_013492 3300053087 Bacteria 2882
1322 Ga0500641_0426902 3300053096 Bacteria 516
1323 Ga0500621_165805 3300053126 Bacteria 815
1324 Ga0500588_0155506 3300053146 Bacteria 829
1325 Ga0500616_0047381 3300053153 Bacteria 2282
1326 Ga0500616_0154340 3300053153 Bacteria 1059
1327 Ga0500616_0220183 3300053153 Bacteria 828
1328 Ga0500619_258443 3300053154 Bacteria 572
1329 Ga0500624_000023 3300053157 Bacteria 114997
1330 Ga0500637_0000611 3300053178 Bacteria 14096
1331 Ga0501084_0010490 3300054114 Bacteria 7658
1332 Ga0501084_0098690 3300054114 Bacteria 2452
1333 Ga0501084_0161123 3300054114 Bacteria 1892
1334 Ga0501084_1325812 3300054114 Bacteria 603
1335 Ga0590075_187193 3300059424 Bacteria 548
1336 Ga0587070_038788 3300059491 Bacteria 901
1337 Ga0587070_111858 3300059491 Bacteria 642
1338 Ga0587073_0091319 3300059492 Bacteria 775
1339 Ga0587077_059136 3300059493 Bacteria 825
1340 Ga0587077_081924 3300059493 Bacteria 742
1341 Ga0587077_131644 3300059493 Bacteria 635
1342 Ga0587080_142361 3300059503 Bacteria 549
1343 Ga0587083_0053536 3300059505 Bacteria 888
1344 Ga0587085_149409 3300059506 Bacteria 537
1345 Ga0587109_056339 3300059624 Bacteria 818
1346 Ga0587128_135039 3300059630 Bacteria 549
1347 Ga0587068_017978 3300059641 Bacteria 1135
1348 Ga0587068_065334 3300059641 Bacteria 708
1349 Ga0587072_057219 3300059643 Bacteria 795
1350 Ga0587076_007008 3300059645 Bacteria 1525
1351 Ga0587105_001817 3300059651 Bacteria 1154
1352 Ga0587108_006900 3300059653 Bacteria 889
1353 Ga0587110_030666 3300059654 Bacteria 654
1354 Ga0587071_036914 3300060344 Bacteria 965
1355 Ga0587071_123092 3300060344 Bacteria 622
1356 Ga0587111_0038388 3300060346 Bacteria 1010
1357 Ga0587111_0215808 3300060346 Bacteria 551
1358 Ga0501082_0015085 3300060353 Bacteria 6656
1359 Ga0501082_0016074 3300060353 Bacteria 6437
1360 Ga0501082_0173837 3300060353 Bacteria 1873
1361 Ga0501082_0282211 3300060353 Bacteria 1445
1362 Ga0501082_1793504 3300060353 Bacteria 535
1363 Ga0530510_0006306 3300061734 Bacteria 8251
1364 Ga0530510_0041695 3300061734 Bacteria 3314

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_47433_c1 nmdc:mga03683_47433_c1_1455_1772 103
2 3300035090 Ga0373949_0282794 Ga0373949_0282794_56_373 104
3 3300042993 Ga0439440_0221149 Ga0439440_0221149_220_537 104
4 3300046519 Ga0495632_0312770 Ga0495632_0312770_270_605 104
5 3300046616 Ga0495668_0280848 Ga0495668_0280848_25_360 104
6 3300049578 Ga0501042_1082022 Ga0501042_1082022_254_571 104
7 3300050510 nmdc:mga06r32_328722_c1 nmdc:mga06r32_328722_c1_33_350 104
8 3300037466 Ga0395898_0381662 Ga0395898_0381662_13_330 105
9 3300046537 Ga0495598_0403631 Ga0495598_0403631_199_516 105
10 3300048916 Ga0496113_1320023 Ga0496113_1320023_11_337 105
11 3300049533 Ga0501317_019109 Ga0501317_019109_581_901 105
12 3300049578 Ga0501042_0217545 Ga0501042_0217545_48_374 105
13 3300049586 Ga0501070_1180823 Ga0501070_1180823_36_362 105
14 3300050492 nmdc:mga0yw44_461045_c2 nmdc:mga0yw44_461045_c2_158_481 105
15 3300050496 nmdc:mga07m45_745415_c1 nmdc:mga07m45_745415_c1_33_356 105
16 3300002067 JGI24735J21928_10001020 JGI24735J21928_100010201 108
17 3300048904 Ga0496101_0499073 Ga0496101_0499073_610_939 108
18 3300049822 Ga0501035_0571172 Ga0501035_0571172_14_343 108
19 3300053126 Ga0500621_165805 Ga0500621_165805_11_340 108
20 3300027543 Ga0209999_1045243 Ga0209999_10452432 113
21 3300003781 Ga0055536_1012782 Ga0055536_10127823 116
22 3300037312 Ga0395899_0007143 Ga0395899_0007143_4932_5282 116
23 3300037418 Ga0395900_0050225 Ga0395900_0050225_1566_1916 116
24 3300037466 Ga0395898_0017917 Ga0395898_0017917_1401_1751 116
25 3300037471 Ga0395905_0000031 Ga0395905_0000031_3526_3876 116
26 3300038443 Ga0395901_0053759 Ga0395901_0053759_1401_1751 116
27 3300049161 Ga0501305_116221 Ga0501305_116221_14_364 116
28 3300049570 Ga0501033_0838230 Ga0501033_0838230_10_360 116
29 3300049590 Ga0501074_0887198 Ga0501074_0887198_14_364 116
30 3300048906 Ga0496103_0211450 Ga0496103_0211450_558_914 118
31 3300038742 Ga0400486_32139 Ga0400486_32139_945_1325 120
32 iso_pu_bacteria 2510917021 2511127733 121
33 iso_pu_bacteria 2523231067 2523469237 121
34 iso_pu_bacteria 2599185359 2600225728 121
35 iso_pu_bacteria 2643221622 2644125945 121
36 iso_pu_bacteria 2738541275 2738709641 121
37 iso_pu_bacteria 2738541301 2738848066 121
38 iso_pu_bacteria 2738541304 2738863795 121
39 iso_pu_bacteria 2738543022 2739296313 121
40 iso_pu_bacteria 2738543031 2739347264 121
41 iso_pu_bacteria 2738543033 2739357991 121
42 iso_pu_bacteria 2739367664 2739651893 121
43 iso_pu_bacteria 2739367865 2740030367 121
44 iso_pu_bacteria 2818991438 2819552567 121
45 iso_pu_bacteria 2818991466 2819716470 121
46 iso_pu_bacteria 2830075706 2830079056 121
47 iso_pu_bacteria 2848297114 2848298233 121
48 iso_pu_bacteria 2879163058 2879165245 121
49 iso_pu_bacteria 2885427238 2885427575 121
50 iso_pu_bacteria 2896253425 2896255631 121
51 iso_pu_bacteria 2917554339 2917555104 121
52 iso_pu_bacteria 2919138771 2919141408 121
53 iso_pu_bacteria 2928027323 2928028508 121
54 iso_pu_bacteria 2928100450 2928101197 121
55 iso_pu_bacteria 2928526807 2928528721 121
56 iso_pu_bacteria 2928959182 2928960393 121
57 iso_pu_bacteria 2928968154 2928970273 121
58 iso_pu_bacteria 2946787523 2946787681 121
59 iso_pu_bacteria 2984555340 2984555916 121
60 iso_pu_bacteria 2984564862 2984565978 121
61 iso_pu_bacteria 2993356040 2993356987 121
62 iso_pu_bacteria 8054302542 8054304444 121
63 3300047472 Ga0495686_0214876 Ga0495686_0214876_110_484 122
64 3300049744 Ga0501083_0121106 Ga0501083_0121106_128_517 123
65 3300053153 Ga0500616_0220183 Ga0500616_0220183_45_431 123
66 3300003775 Ga0055524_1041467 Ga0055524_10414673 124
67 3300003781 Ga0055536_1040482 Ga0055536_10404822 124
68 3300003791 Ga0055530_10004523 Ga0055530_100045239 124
69 3300003791 Ga0055530_10053671 Ga0055530_100536712 124
70 3300003792 Ga0055540_1050858 Ga0055540_10508583 124
71 3300003794 Ga0055531_10011237 Ga0055531_100112373 124
72 3300003794 Ga0055531_10018292 Ga0055531_100182924 124
73 3300005262 Ga0065165_1007044 Ga0065165_10070441 124
74 3300005328 Ga0070676_10852711 Ga0070676_108527112 124
75 3300005338 Ga0068868_101966217 Ga0068868_1019662171 124
76 3300005340 Ga0070689_100764544 Ga0070689_1007645442 124
77 3300005340 Ga0070689_101589165 Ga0070689_1015891652 124
78 3300005354 Ga0070675_100282639 Ga0070675_1002826392 124
79 3300005356 Ga0070674_101294936 Ga0070674_1012949362 124
80 3300005367 Ga0070667_100692723 Ga0070667_1006927232 124
81 3300005456 Ga0070678_100926518 Ga0070678_1009265182 124
82 3300005539 Ga0068853_100134014 Ga0068853_1001340144 124
83 3300005548 Ga0070665_100107634 Ga0070665_1001076345 124
84 3300005577 Ga0068857_101288741 Ga0068857_1012887411 124
85 3300005616 Ga0068852_101918233 Ga0068852_1019182331 124
86 3300005617 Ga0068859_101774425 Ga0068859_1017744252 124
87 3300005618 Ga0068864_101664716 Ga0068864_1016647161 124
88 3300005719 Ga0068861_101079403 Ga0068861_1010794032 124
89 3300005844 Ga0068862_101527106 Ga0068862_1015271061 124
90 3300006038 Ga0075365_11071766 Ga0075365_110717661 124
91 3300006048 Ga0075363_100007657 Ga0075363_10000765711 124
92 3300006178 Ga0075367_10151422 Ga0075367_101514222 124
93 3300006186 Ga0075369_10017872 Ga0075369_100178726 124
94 3300006195 Ga0075366_10688912 Ga0075366_106889121 124
95 3300006353 Ga0075370_10228277 Ga0075370_102282772 124
96 3300006353 Ga0075370_10231904 Ga0075370_102319042 124
97 3300006353 Ga0075370_10938159 Ga0075370_109381592 124
98 3300006881 Ga0068865_100619565 Ga0068865_1006195651 124
99 3300006881 Ga0068865_101149388 Ga0068865_1011493882 124
100 3300006931 Ga0097620_101774423 Ga0097620_1017744232 124
101 3300009093 Ga0105240_10928947 Ga0105240_109289472 124
102 3300009094 Ga0111539_11626981 Ga0111539_116269812 124
103 3300009176 Ga0105242_11662544 Ga0105242_116625442 124
104 3300009177 Ga0105248_12990958 Ga0105248_129909582 124
105 3300009551 Ga0105238_10428911 Ga0105238_104289112 124
106 3300013105 Ga0157369_11859513 Ga0157369_118595131 124
107 3300014325 Ga0163163_10861498 Ga0163163_108614982 124
108 3300020070 Ga0206356_10532533 Ga0206356_105325331 124
109 3300025246 Ga0209646_1018464 Ga0209646_10184641 124
110 3300025250 Ga0209026_1006530 Ga0209026_10065304 124
111 3300025292 Ga0209676_1013004 Ga0209676_10130047 124
112 3300025297 Ga0209758_1002168 Ga0209758_100216810 124
113 3300025298 Ga0209050_1000161 Ga0209050_100016192 124
114 3300025298 Ga0209050_1011548 Ga0209050_10115489 124
115 3300025303 Ga0209051_1000877 Ga0209051_100087720 124
116 3300025304 Ga0209257_1000252 Ga0209257_100025284 124
117 3300025304 Ga0209257_1008377 Ga0209257_10083777 124
118 3300025899 Ga0207642_10435527 Ga0207642_104355272 124
119 3300025909 Ga0207705_10678009 Ga0207705_106780092 124
120 3300025913 Ga0207695_10941004 Ga0207695_109410042 124
121 3300025924 Ga0207694_11268795 Ga0207694_112687951 124
122 3300025927 Ga0207687_11656320 Ga0207687_116563201 124
123 3300025931 Ga0207644_10536901 Ga0207644_105369012 124
124 3300025936 Ga0207670_11494504 Ga0207670_114945042 124
125 3300025936 Ga0207670_11686067 Ga0207670_116860672 124
126 3300025944 Ga0207661_11692701 Ga0207661_116927011 124
127 3300025986 Ga0207658_10310759 Ga0207658_103107592 124
128 3300026041 Ga0207639_10749209 Ga0207639_107492092 124
129 3300026095 Ga0207676_11582155 Ga0207676_115821551 124
130 3300026116 Ga0207674_10242234 Ga0207674_102422342 124
131 3300030521 Ga0307511_10006537 Ga0307511_100065379 124
132 3300031456 Ga0307513_10000162 Ga0307513_100001629 124
133 3300031456 Ga0307513_10010515 Ga0307513_100105158 124
134 3300031548 Ga0307408_100395292 Ga0307408_1003952923 124
135 3300031548 Ga0307408_101072415 Ga0307408_1010724152 124
136 3300031852 Ga0307410_10606437 Ga0307410_106064372 124
137 3300031901 Ga0307406_11311714 Ga0307406_113117142 124
138 3300031903 Ga0307407_10706773 Ga0307407_107067732 124
139 3300033180 Ga0307510_10212732 Ga0307510_102127322 124
140 3300037471 Ga0395905_0632069 Ga0395905_0632069_396_776 124
141 3300039437 Ga0436365_1769134 Ga0436365_1769134_112_492 124
142 3300041441 Ga0451787_390226 Ga0451787_390226_154_534 124
143 3300041451 Ga0451791_1104984 Ga0451791_1104984_109_489 124
144 3300041491 Ga0451833_1375293 Ga0451833_1375293_160_540 124
145 3300041492 Ga0451835_0084593 Ga0451835_0084593_218_598 124
146 3300041494 Ga0451837_0693834 Ga0451837_0693834_21_401 124
147 3300041501 Ga0451845_0970488 Ga0451845_0970488_135_515 124
148 3300042131 Ga0450894_042600 Ga0450894_042600_23_403 124
149 3300042876 Ga0451577_0708206 Ga0451577_0708206_327_707 124
150 3300044658 Ga0466972_0196342 Ga0466972_0196342_301_681 124
151 3300044693 Ga0466961_0562513 Ga0466961_0562513_204_584 124
152 3300044735 Ga0466968_0250288 Ga0466968_0250288_174_554 124
153 3300044842 Ga0466957_0077343 Ga0466957_0077343_885_1265 124
154 3300044901 Ga0466960_0738413 Ga0466960_0738413_44_424 124
155 3300045976 Ga0466967_2488322 Ga0466967_2488322_25_405 124
156 3300046457 Ga0495590_0158635 Ga0495590_0158635_419_799 124
157 3300046460 Ga0495638_0593218 Ga0495638_0593218_150_530 124
158 3300046471 Ga0495650_0143718 Ga0495650_0143718_412_792 124
159 3300046500 Ga0495596_0112786 Ga0495596_0112786_460_840 124
160 3300046539 Ga0495621_0277072 Ga0495621_0277072_68_448 124
161 3300046616 Ga0495668_0150942 Ga0495668_0150942_353_733 124
162 3300047320 Ga0495672_0380130 Ga0495672_0380130_210_605 124
163 3300048927 Ga0496124_0061846 Ga0496124_0061846_1908_2288 124
164 3300048928 Ga0496125_0035566 Ga0496125_0035566_104_484 124
165 3300048929 Ga0496126_0049088 Ga0496126_0049088_1973_2353 124
166 3300049528 Ga0501312_018590 Ga0501312_018590_115_495 124
167 3300049569 Ga0501032_0508991 Ga0501032_0508991_30_410 124
168 3300049570 Ga0501033_0281342 Ga0501033_0281342_337_717 124
169 3300049571 Ga0501034_0478339 Ga0501034_0478339_654_1034 124
170 3300049571 Ga0501034_0729840 Ga0501034_0729840_102_482 124
171 3300049573 Ga0501037_0268954 Ga0501037_0268954_618_998 124
172 3300049575 Ga0501039_1017715 Ga0501039_1017715_131_511 124
173 3300049578 Ga0501042_1145601 Ga0501042_1145601_144_524 124
174 3300049579 Ga0501043_0303623 Ga0501043_0303623_296_676 124
175 3300049581 Ga0501047_0514337 Ga0501047_0514337_399_779 124
176 3300049583 Ga0501067_0019787 Ga0501067_0019787_1514_1909 124
177 3300049588 Ga0501072_0025429 Ga0501072_0025429_1238_1633 124
178 3300049590 Ga0501074_0610191 Ga0501074_0610191_114_509 124
179 3300049742 Ga0501080_0027711 Ga0501080_0027711_1394_1789 124
180 3300049744 Ga0501083_0027038 Ga0501083_0027038_673_1068 124
181 3300049823 Ga0501044_0032239 Ga0501044_0032239_822_1202 124
182 3300050492 nmdc:mga0yw44_767745_c1 nmdc:mga0yw44_767745_c1_246_626 124
183 3300050496 nmdc:mga07m45_176045_c1 nmdc:mga07m45_176045_c1_310_690 124
184 3300050496 nmdc:mga07m45_406701_c1 nmdc:mga07m45_406701_c1_25_405 124
185 3300050511 nmdc:mga08y16_1330190_c1 nmdc:mga08y16_1330190_c1_68_448 124
186 3300050516 nmdc:mga0sz30_17138_c1 nmdc:mga0sz30_17138_c1_534_914 124
187 3300053153 Ga0500616_0154340 Ga0500616_0154340_232_612 124
188 3300053154 Ga0500619_258443 Ga0500619_258443_102_482 124
189 3300054114 Ga0501084_0098690 Ga0501084_0098690_1559_1954 124
190 3300059491 Ga0587070_038788 Ga0587070_038788_247_627 124
191 3300059491 Ga0587070_111858 Ga0587070_111858_218_598 124
192 3300059492 Ga0587073_0091319 Ga0587073_0091319_29_409 124
193 3300059493 Ga0587077_081924 Ga0587077_081924_32_412 124
194 3300059503 Ga0587080_142361 Ga0587080_142361_106_486 124
195 3300059505 Ga0587083_0053536 Ga0587083_0053536_218_598 124
196 3300059506 Ga0587085_149409 Ga0587085_149409_27_407 124
197 3300059624 Ga0587109_056339 Ga0587109_056339_172_552 124
198 3300059641 Ga0587068_065334 Ga0587068_065334_29_409 124
199 3300059643 Ga0587072_057219 Ga0587072_057219_326_706 124
200 3300059645 Ga0587076_007008 Ga0587076_007008_1102_1482 124
201 3300059651 Ga0587105_001817 Ga0587105_001817_232_612 124
202 3300059653 Ga0587108_006900 Ga0587108_006900_278_658 124
203 3300059654 Ga0587110_030666 Ga0587110_030666_229_609 124
204 3300060346 Ga0587111_0038388 Ga0587111_0038388_336_716 124
205 3300060346 Ga0587111_0215808 Ga0587111_0215808_117_497 124
206 3300060353 Ga0501082_0016074 Ga0501082_0016074_1360_1755 124
207 2162886007 SwRhRL2b_contig_1902450 SwRhRL2b_0970.00001750 125
208 2162886007 SwRhRL2b_contig_219213 SwRhRL2b_0257.00001430 125
209 2162886007 SwRhRL2b_contig_90406 SwRhRL2b_0963.00000460 125
210 3300000043 ARcpr5yngRDRAFT_c009192 ARcpr5yngRDRAFT_0091922 125
211 3300000652 ARCol0yngRDRAFT_1010664 ARCol0yngRDRAFT_10106642 125
212 3300001904 JGI24736J21556_1000017 JGI24736J21556_10000173 125
213 3300001915 JGI24741J21665_1001831 JGI24741J21665_10018316 125
214 3300001915 JGI24741J21665_1004669 JGI24741J21665_10046697 125
215 3300001979 JGI24740J21852_10023038 JGI24740J21852_100230384 125
216 3300001979 JGI24740J21852_10073730 JGI24740J21852_100737302 125
217 3300001979 JGI24740J21852_10098157 JGI24740J21852_100981571 125
218 3300001989 JGI24739J22299_10070471 JGI24739J22299_100704712 125
219 3300001989 JGI24739J22299_10119248 JGI24739J22299_101192482 125
220 3300001990 JGI24737J22298_10010075 JGI24737J22298_100100754 125
221 3300001990 JGI24737J22298_10022076 JGI24737J22298_100220764 125
222 3300001990 JGI24737J22298_10076884 JGI24737J22298_100768842 125
223 3300001990 JGI24737J22298_10197514 JGI24737J22298_101975141 125
224 3300002067 JGI24735J21928_10003396 JGI24735J21928_100033965 125
225 3300002067 JGI24735J21928_10052944 JGI24735J21928_100529442 125
226 3300002067 JGI24735J21928_10083171 JGI24735J21928_100831712 125
227 3300002074 JGI24748J21848_1022174 JGI24748J21848_10221742 125
228 3300002075 JGI24738J21930_10002167 JGI24738J21930_100021676 125
229 3300002075 JGI24738J21930_10015293 JGI24738J21930_100152932 125
230 3300002075 JGI24738J21930_10055219 JGI24738J21930_100552192 125
231 3300002076 JGI24749J21850_1001152 JGI24749J21850_10011525 125
232 3300002155 JGI24033J26618_1006238 JGI24033J26618_10062383 125
233 3300002155 JGI24033J26618_1032954 JGI24033J26618_10329542 125
234 3300002239 JGI24034J26672_10001857 JGI24034J26672_100018576 125
235 3300002239 JGI24034J26672_10004339 JGI24034J26672_100043392 125
236 3300002239 JGI24034J26672_10014590 JGI24034J26672_100145902 125
237 3300002239 JGI24034J26672_10030081 JGI24034J26672_100300811 125
238 3300002239 JGI24034J26672_10051630 JGI24034J26672_100516301 125
239 3300002459 JGI24751J29686_10000133 JGI24751J29686_1000013312 125
240 3300002459 JGI24751J29686_10000325 JGI24751J29686_100003255 125
241 3300002459 JGI24751J29686_10109440 JGI24751J29686_101094402 125
242 3300002773 JGI25152J39213_1019543 JGI25152J39213_10195432 125
243 3300002774 JGI25150J39212_1000365 JGI25150J39212_100036520 125
244 3300003187 JGI25151J46595_10034781 JGI25151J46595_100347813 125
245 3300003371 JGI26145J50221_1019280 JGI26145J50221_10192801 125
246 3300003771 Ga0055526_1001689 Ga0055526_100168910 125
247 3300003781 Ga0055536_1004136 Ga0055536_10041363 125
248 3300003791 Ga0055530_10006129 Ga0055530_1000612913 125
249 3300003792 Ga0055540_1000723 Ga0055540_10007236 125
250 3300005288 Ga0065714_10439110 Ga0065714_104391101 125
251 3300005289 Ga0065704_10070214 Ga0065704_1007021435 125
252 3300005289 Ga0065704_10070777 Ga0065704_1007077713 125
253 3300005289 Ga0065704_10101429 Ga0065704_101014293 125
254 3300005289 Ga0065704_10335587 Ga0065704_103355872 125
255 3300005290 Ga0065712_10044945 Ga0065712_100449452 125
256 3300005290 Ga0065712_10154061 Ga0065712_101540612 125
257 3300005295 Ga0065707_10007537 Ga0065707_100075371 125
258 3300005295 Ga0065707_10051097 Ga0065707_100510972 125
259 3300005295 Ga0065707_10374061 Ga0065707_103740611 125
260 3300005295 Ga0065707_10492149 Ga0065707_104921492 125
261 3300005327 Ga0070658_10104595 Ga0070658_101045952 125
262 3300005327 Ga0070658_10217697 Ga0070658_102176973 125
263 3300005327 Ga0070658_10855387 Ga0070658_108553872 125
264 3300005327 Ga0070658_11285588 Ga0070658_112855882 125
265 3300005328 Ga0070676_10010202 Ga0070676_1001020211 125
266 3300005328 Ga0070676_10114853 Ga0070676_101148532 125
267 3300005328 Ga0070676_10396009 Ga0070676_103960092 125
268 3300005328 Ga0070676_10618497 Ga0070676_106184972 125
269 3300005329 Ga0070683_100888866 Ga0070683_1008888662 125
270 3300005330 Ga0070690_100018053 Ga0070690_1000180539 125
271 3300005331 Ga0070670_100024275 Ga0070670_1000242755 125
272 3300005331 Ga0070670_100044177 Ga0070670_1000441778 125
273 3300005331 Ga0070670_100047139 Ga0070670_1000471398 125
274 3300005331 Ga0070670_100065360 Ga0070670_1000653607 125
275 3300005331 Ga0070670_100100471 Ga0070670_1001004712 125
276 3300005331 Ga0070670_100148526 Ga0070670_1001485264 125
277 3300005331 Ga0070670_100240682 Ga0070670_1002406822 125
278 3300005331 Ga0070670_100548160 Ga0070670_1005481601 125
279 3300005331 Ga0070670_100628039 Ga0070670_1006280392 125
280 3300005331 Ga0070670_100738370 Ga0070670_1007383701 125
281 3300005331 Ga0070670_101368932 Ga0070670_1013689322 125
282 3300005333 Ga0070677_10018552 Ga0070677_100185522 125
283 3300005333 Ga0070677_10365215 Ga0070677_103652151 125
284 3300005334 Ga0068869_100349580 Ga0068869_1003495802 125
285 3300005334 Ga0068869_100922701 Ga0068869_1009227012 125
286 3300005335 Ga0070666_10007165 Ga0070666_1000716515 125
287 3300005335 Ga0070666_10054950 Ga0070666_100549503 125
288 3300005335 Ga0070666_10179942 Ga0070666_101799422 125
289 3300005335 Ga0070666_10271508 Ga0070666_102715082 125
290 3300005335 Ga0070666_10525631 Ga0070666_105256312 125
291 3300005335 Ga0070666_10890077 Ga0070666_108900772 125
292 3300005335 Ga0070666_11149184 Ga0070666_111491841 125
293 3300005335 Ga0070666_11161595 Ga0070666_111615952 125
294 3300005336 Ga0070680_100162100 Ga0070680_1001621003 125
295 3300005336 Ga0070680_100413449 Ga0070680_1004134492 125
296 3300005337 Ga0070682_100167589 Ga0070682_1001675893 125
297 3300005338 Ga0068868_100569237 Ga0068868_1005692372 125
298 3300005339 Ga0070660_100018108 Ga0070660_1000181082 125
299 3300005339 Ga0070660_100095636 Ga0070660_1000956365 125
300 3300005339 Ga0070660_100676942 Ga0070660_1006769422 125
301 3300005339 Ga0070660_101411668 Ga0070660_1014116681 125
302 3300005339 Ga0070660_101834420 Ga0070660_1018344201 125
303 3300005340 Ga0070689_100665543 Ga0070689_1006655432 125
304 3300005341 Ga0070691_10023128 Ga0070691_100231282 125
305 3300005341 Ga0070691_10093826 Ga0070691_100938263 125
306 3300005344 Ga0070661_100241777 Ga0070661_1002417771 125
307 3300005344 Ga0070661_100577775 Ga0070661_1005777752 125
308 3300005344 Ga0070661_100614891 Ga0070661_1006148912 125
309 3300005344 Ga0070661_101625825 Ga0070661_1016258251 125
310 3300005345 Ga0070692_10354552 Ga0070692_103545522 125
311 3300005345 Ga0070692_11190734 Ga0070692_111907341 125
312 3300005347 Ga0070668_100017451 Ga0070668_10001745112 125
313 3300005347 Ga0070668_100396570 Ga0070668_1003965701 125
314 3300005347 Ga0070668_100478984 Ga0070668_1004789842 125
315 3300005347 Ga0070668_101335208 Ga0070668_1013352081 125
316 3300005347 Ga0070668_101983076 Ga0070668_1019830762 125
317 3300005347 Ga0070668_102028746 Ga0070668_1020287461 125
318 3300005353 Ga0070669_100004937 Ga0070669_1000049376 125
319 3300005353 Ga0070669_100005654 Ga0070669_1000056545 125
320 3300005353 Ga0070669_100014400 Ga0070669_1000144003 125
321 3300005353 Ga0070669_100033975 Ga0070669_1000339755 125
322 3300005353 Ga0070669_100264859 Ga0070669_1002648593 125
323 3300005353 Ga0070669_100334722 Ga0070669_1003347223 125
324 3300005353 Ga0070669_100380842 Ga0070669_1003808422 125
325 3300005353 Ga0070669_100492436 Ga0070669_1004924363 125
326 3300005353 Ga0070669_100527333 Ga0070669_1005273332 125
327 3300005353 Ga0070669_100557818 Ga0070669_1005578182 125
328 3300005354 Ga0070675_100021317 Ga0070675_1000213178 125
329 3300005354 Ga0070675_100660469 Ga0070675_1006604692 125
330 3300005354 Ga0070675_101392207 Ga0070675_1013922071 125
331 3300005354 Ga0070675_101761456 Ga0070675_1017614562 125
332 3300005354 Ga0070675_101826824 Ga0070675_1018268241 125
333 3300005355 Ga0070671_100001718 Ga0070671_1000017188 125
334 3300005355 Ga0070671_100052885 Ga0070671_1000528858 125
335 3300005355 Ga0070671_100071036 Ga0070671_1000710366 125
336 3300005355 Ga0070671_100075094 Ga0070671_1000750945 125
337 3300005355 Ga0070671_100149996 Ga0070671_1001499962 125
338 3300005355 Ga0070671_100230557 Ga0070671_1002305572 125
339 3300005355 Ga0070671_100243374 Ga0070671_1002433743 125
340 3300005355 Ga0070671_101271800 Ga0070671_1012718002 125
341 3300005355 Ga0070671_102056963 Ga0070671_1020569631 125
342 3300005356 Ga0070674_100065137 Ga0070674_1000651374 125
343 3300005356 Ga0070674_100101471 Ga0070674_1001014712 125
344 3300005356 Ga0070674_101384186 Ga0070674_1013841861 125
345 3300005364 Ga0070673_100034662 Ga0070673_1000346626 125
346 3300005364 Ga0070673_101239019 Ga0070673_1012390191 125
347 3300005365 Ga0070688_100364027 Ga0070688_1003640273 125
348 3300005366 Ga0070659_100052713 Ga0070659_1000527137 125
349 3300005366 Ga0070659_100180084 Ga0070659_1001800843 125
350 3300005366 Ga0070659_100310110 Ga0070659_1003101102 125
351 3300005366 Ga0070659_100368816 Ga0070659_1003688163 125
352 3300005366 Ga0070659_100902102 Ga0070659_1009021022 125
353 3300005366 Ga0070659_101601104 Ga0070659_1016011041 125
354 3300005367 Ga0070667_100000088 Ga0070667_10000008861 125
355 3300005367 Ga0070667_100001059 Ga0070667_1000010596 125
356 3300005367 Ga0070667_100141917 Ga0070667_1001419174 125
357 3300005367 Ga0070667_100508657 Ga0070667_1005086571 125
358 3300005435 Ga0070714_100056706 Ga0070714_1000567065 125
359 3300005435 Ga0070714_100446850 Ga0070714_1004468503 125
360 3300005436 Ga0070713_100050613 Ga0070713_1000506133 125
361 3300005438 Ga0070701_10543196 Ga0070701_105431961 125
362 3300005440 Ga0070705_100529297 Ga0070705_1005292972 125
363 3300005441 Ga0070700_100044432 Ga0070700_1000444323 125
364 3300005441 Ga0070700_100904716 Ga0070700_1009047161 125
365 3300005444 Ga0070694_100564632 Ga0070694_1005646322 125
366 3300005455 Ga0070663_100082480 Ga0070663_1000824803 125
367 3300005455 Ga0070663_100155543 Ga0070663_1001555432 125
368 3300005455 Ga0070663_100388956 Ga0070663_1003889562 125
369 3300005455 Ga0070663_100439922 Ga0070663_1004399222 125
370 3300005455 Ga0070663_100738153 Ga0070663_1007381532 125
371 3300005455 Ga0070663_100820918 Ga0070663_1008209182 125
372 3300005455 Ga0070663_101654665 Ga0070663_1016546652 125
373 3300005456 Ga0070678_100020582 Ga0070678_1000205823 125
374 3300005456 Ga0070678_100204291 Ga0070678_1002042911 125
375 3300005456 Ga0070678_100228696 Ga0070678_1002286963 125
376 3300005456 Ga0070678_100446078 Ga0070678_1004460781 125
377 3300005456 Ga0070678_101187273 Ga0070678_1011872731 125
378 3300005457 Ga0070662_100249078 Ga0070662_1002490783 125
379 3300005457 Ga0070662_100329829 Ga0070662_1003298291 125
380 3300005457 Ga0070662_100343467 Ga0070662_1003434672 125
381 3300005457 Ga0070662_100834265 Ga0070662_1008342651 125
382 3300005457 Ga0070662_101608754 Ga0070662_1016087541 125
383 3300005457 Ga0070662_101683119 Ga0070662_1016831192 125
384 3300005457 Ga0070662_101745263 Ga0070662_1017452631 125
385 3300005458 Ga0070681_10842690 Ga0070681_108426902 125
386 3300005458 Ga0070681_11187871 Ga0070681_111878712 125
387 3300005458 Ga0070681_11666624 Ga0070681_116666242 125
388 3300005459 Ga0068867_100167090 Ga0068867_1001670903 125
389 3300005459 Ga0068867_100239469 Ga0068867_1002394693 125
390 3300005459 Ga0068867_100339305 Ga0068867_1003393052 125
391 3300005459 Ga0068867_100608690 Ga0068867_1006086901 125
392 3300005459 Ga0068867_100858773 Ga0068867_1008587732 125
393 3300005518 Ga0070699_101902222 Ga0070699_1019022221 125
394 3300005530 Ga0070679_101027471 Ga0070679_1010274711 125
395 3300005530 Ga0070679_102141505 Ga0070679_1021415051 125
396 3300005535 Ga0070684_100038268 Ga0070684_1000382688 125
397 3300005536 Ga0070697_100271153 Ga0070697_1002711532 125
398 3300005539 Ga0068853_100100537 Ga0068853_1001005372 125
399 3300005539 Ga0068853_100413468 Ga0068853_1004134683 125
400 3300005539 Ga0068853_100965538 Ga0068853_1009655381 125
401 3300005539 Ga0068853_101107283 Ga0068853_1011072832 125
402 3300005539 Ga0068853_101923504 Ga0068853_1019235042 125
403 3300005543 Ga0070672_100034217 Ga0070672_1000342175 125
404 3300005543 Ga0070672_100627533 Ga0070672_1006275332 125
405 3300005543 Ga0070672_100817407 Ga0070672_1008174073 125
406 3300005543 Ga0070672_100841589 Ga0070672_1008415892 125
407 3300005543 Ga0070672_101407993 Ga0070672_1014079931 125
408 3300005543 Ga0070672_102153785 Ga0070672_1021537852 125
409 3300005544 Ga0070686_100162697 Ga0070686_1001626973 125
410 3300005544 Ga0070686_100312950 Ga0070686_1003129502 125
411 3300005546 Ga0070696_100274635 Ga0070696_1002746353 125
412 3300005547 Ga0070693_100090075 Ga0070693_1000900753 125
413 3300005547 Ga0070693_100280396 Ga0070693_1002803961 125
414 3300005547 Ga0070693_101054800 Ga0070693_1010548002 125
415 3300005548 Ga0070665_100017754 Ga0070665_1000177547 125
416 3300005548 Ga0070665_100043393 Ga0070665_1000433932 125
417 3300005548 Ga0070665_100080805 Ga0070665_1000808056 125
418 3300005548 Ga0070665_101362015 Ga0070665_1013620152 125
419 3300005548 Ga0070665_101775586 Ga0070665_1017755862 125
420 3300005549 Ga0070704_100284431 Ga0070704_1002844313 125
421 3300005549 Ga0070704_101993804 Ga0070704_1019938041 125
422 3300005563 Ga0068855_100042514 Ga0068855_1000425144 125
423 3300005563 Ga0068855_100080645 Ga0068855_1000806452 125
424 3300005563 Ga0068855_100269053 Ga0068855_1002690532 125
425 3300005563 Ga0068855_100820305 Ga0068855_1008203052 125
426 3300005563 Ga0068855_100932750 Ga0068855_1009327503 125
427 3300005563 Ga0068855_100998628 Ga0068855_1009986282 125
428 3300005564 Ga0070664_100036985 Ga0070664_1000369859 125
429 3300005564 Ga0070664_100070110 Ga0070664_1000701103 125
430 3300005564 Ga0070664_100253451 Ga0070664_1002534512 125
431 3300005564 Ga0070664_100464231 Ga0070664_1004642312 125
432 3300005564 Ga0070664_100976480 Ga0070664_1009764802 125
433 3300005564 Ga0070664_101382016 Ga0070664_1013820162 125
434 3300005564 Ga0070664_101968684 Ga0070664_1019686842 125
435 3300005564 Ga0070664_102158471 Ga0070664_1021584712 125
436 3300005577 Ga0068857_100026049 Ga0068857_1000260496 125
437 3300005577 Ga0068857_100359493 Ga0068857_1003594933 125
438 3300005577 Ga0068857_100764880 Ga0068857_1007648802 125
439 3300005577 Ga0068857_101691162 Ga0068857_1016911622 125
440 3300005578 Ga0068854_100097571 Ga0068854_1000975715 125
441 3300005578 Ga0068854_100175422 Ga0068854_1001754223 125
442 3300005578 Ga0068854_101151278 Ga0068854_1011512781 125
443 3300005578 Ga0068854_102143988 Ga0068854_1021439881 125
444 3300005614 Ga0068856_100058104 Ga0068856_1000581042 125
445 3300005614 Ga0068856_100364986 Ga0068856_1003649862 125
446 3300005614 Ga0068856_101251499 Ga0068856_1012514992 125
447 3300005615 Ga0070702_100090393 Ga0070702_1000903932 125
448 3300005615 Ga0070702_100379736 Ga0070702_1003797362 125
449 3300005616 Ga0068852_100343494 Ga0068852_1003434942 125
450 3300005616 Ga0068852_100448060 Ga0068852_1004480601 125
451 3300005616 Ga0068852_101538415 Ga0068852_1015384152 125
452 3300005616 Ga0068852_102079416 Ga0068852_1020794161 125
453 3300005617 Ga0068859_100006387 Ga0068859_10000638713 125
454 3300005617 Ga0068859_100030651 Ga0068859_1000306516 125
455 3300005617 Ga0068859_100323648 Ga0068859_1003236483 125
456 3300005617 Ga0068859_100440837 Ga0068859_1004408373 125
457 3300005617 Ga0068859_101116349 Ga0068859_1011163493 125
458 3300005617 Ga0068859_101612409 Ga0068859_1016124092 125
459 3300005618 Ga0068864_100014199 Ga0068864_1000141998 125
460 3300005618 Ga0068864_100081298 Ga0068864_1000812983 125
461 3300005618 Ga0068864_100599726 Ga0068864_1005997262 125
462 3300005618 Ga0068864_100649123 Ga0068864_1006491232 125
463 3300005618 Ga0068864_100832313 Ga0068864_1008323133 125
464 3300005718 Ga0068866_10028552 Ga0068866_100285523 125
465 3300005718 Ga0068866_11315034 Ga0068866_113150341 125
466 3300005719 Ga0068861_100002700 Ga0068861_1000027002 125
467 3300005719 Ga0068861_100039077 Ga0068861_1000390773 125
468 3300005719 Ga0068861_100134622 Ga0068861_1001346223 125
469 3300005719 Ga0068861_101285918 Ga0068861_1012859182 125
470 3300005834 Ga0068851_10039033 Ga0068851_100390332 125
471 3300005834 Ga0068851_10109610 Ga0068851_101096102 125
472 3300005840 Ga0068870_10196609 Ga0068870_101966091 125
473 3300005840 Ga0068870_10230894 Ga0068870_102308942 125
474 3300005840 Ga0068870_10594405 Ga0068870_105944052 125
475 3300005840 Ga0068870_10676704 Ga0068870_106767042 125
476 3300005841 Ga0068863_100007187 Ga0068863_10000718711 125
477 3300005841 Ga0068863_100008669 Ga0068863_1000086696 125
478 3300005841 Ga0068863_100080807 Ga0068863_1000808076 125
479 3300005841 Ga0068863_100388526 Ga0068863_1003885263 125
480 3300005841 Ga0068863_101323670 Ga0068863_1013236702 125
481 3300005842 Ga0068858_100141594 Ga0068858_1001415943 125
482 3300005842 Ga0068858_100305438 Ga0068858_1003054381 125
483 3300005842 Ga0068858_101424513 Ga0068858_1014245132 125
484 3300005843 Ga0068860_100000220 Ga0068860_10000022033 125
485 3300005843 Ga0068860_100009418 Ga0068860_1000094188 125
486 3300005843 Ga0068860_100290484 Ga0068860_1002904842 125
487 3300005843 Ga0068860_100365743 Ga0068860_1003657432 125
488 3300005843 Ga0068860_100683453 Ga0068860_1006834533 125
489 3300005844 Ga0068862_100000126 Ga0068862_1000001266 125
490 3300005844 Ga0068862_100002931 Ga0068862_10000293115 125
491 3300005844 Ga0068862_100136266 Ga0068862_1001362663 125
492 3300005844 Ga0068862_100188127 Ga0068862_1001881272 125
493 3300005844 Ga0068862_100355311 Ga0068862_1003553112 125
494 3300005844 Ga0068862_100383926 Ga0068862_1003839263 125
495 3300005844 Ga0068862_100849430 Ga0068862_1008494302 125
496 3300006028 Ga0070717_10009669 Ga0070717_100096692 125
497 3300006048 Ga0075363_100000434 Ga0075363_10000043412 125
498 3300006051 Ga0075364_10154814 Ga0075364_101548142 125
499 3300006051 Ga0075364_10389625 Ga0075364_103896252 125
500 3300006175 Ga0070712_100734954 Ga0070712_1007349542 125
501 3300006177 Ga0075362_10001156 Ga0075362_1000115610 125
502 3300006177 Ga0075362_10143859 Ga0075362_101438593 125
503 3300006195 Ga0075366_10043854 Ga0075366_100438543 125
504 3300006195 Ga0075366_10702613 Ga0075366_107026131 125
505 3300006237 Ga0097621_100162823 Ga0097621_1001628232 125
506 3300006237 Ga0097621_100458747 Ga0097621_1004587472 125
507 3300006237 Ga0097621_101459311 Ga0097621_1014593112 125
508 3300006353 Ga0075370_10000004 Ga0075370_10000004105 125
509 3300006353 Ga0075370_10183052 Ga0075370_101830522 125
510 3300006358 Ga0068871_101309670 Ga0068871_1013096702 125
511 3300006844 Ga0075428_102319728 Ga0075428_1023197282 125
512 3300006846 Ga0075430_100459554 Ga0075430_1004595541 125
513 3300006852 Ga0075433_10164065 Ga0075433_101640654 125
514 3300006871 Ga0075434_102439173 Ga0075434_1024391731 125
515 3300006881 Ga0068865_100063284 Ga0068865_1000632842 125
516 3300006881 Ga0068865_100124512 Ga0068865_1001245123 125
517 3300006881 Ga0068865_101114496 Ga0068865_1011144962 125
518 3300006881 Ga0068865_101138857 Ga0068865_1011388572 125
519 3300006931 Ga0097620_100006388 Ga0097620_10000638813 125
520 3300006931 Ga0097620_100030651 Ga0097620_1000306518 125
521 3300006931 Ga0097620_100323639 Ga0097620_1003236393 125
522 3300006931 Ga0097620_100440841 Ga0097620_1004408411 125
523 3300006931 Ga0097620_101116306 Ga0097620_1011163062 125
524 3300006931 Ga0097620_101612395 Ga0097620_1016123952 125
525 3300006931 Ga0097620_101995678 Ga0097620_1019956782 125
526 3300009011 Ga0105251_10003119 Ga0105251_1000311914 125
527 3300009011 Ga0105251_10033975 Ga0105251_100339752 125
528 3300009092 Ga0105250_10001130 Ga0105250_1000113014 125
529 3300009093 Ga0105240_10183284 Ga0105240_101832841 125
530 3300009093 Ga0105240_12215374 Ga0105240_122153741 125
531 3300009094 Ga0111539_10637376 Ga0111539_106373762 125
532 3300009101 Ga0105247_10005639 Ga0105247_1000563913 125
533 3300009101 Ga0105247_10139623 Ga0105247_101396233 125
534 3300009101 Ga0105247_10230726 Ga0105247_102307263 125
535 3300009101 Ga0105247_10348022 Ga0105247_103480222 125
536 3300009147 Ga0114129_10043173 Ga0114129_100431737 125
537 3300009148 Ga0105243_10020823 Ga0105243_100208236 125
538 3300009148 Ga0105243_10589560 Ga0105243_105895602 125
539 3300009148 Ga0105243_12097989 Ga0105243_120979892 125
540 3300009148 Ga0105243_12203750 Ga0105243_122037502 125
541 3300009148 Ga0105243_12262099 Ga0105243_122620992 125
542 3300009174 Ga0105241_10438812 Ga0105241_104388121 125
543 3300009174 Ga0105241_10532747 Ga0105241_105327471 125
544 3300009174 Ga0105241_10598323 Ga0105241_105983232 125
545 3300009174 Ga0105241_10858706 Ga0105241_108587062 125
546 3300009174 Ga0105241_10936905 Ga0105241_109369052 125
547 3300009174 Ga0105241_11041831 Ga0105241_110418311 125
548 3300009176 Ga0105242_10527942 Ga0105242_105279423 125
549 3300009177 Ga0105248_10000021 Ga0105248_10000021128 125
550 3300009177 Ga0105248_10003987 Ga0105248_100039872 125
551 3300009177 Ga0105248_10021485 Ga0105248_100214855 125
552 3300009177 Ga0105248_10022907 Ga0105248_1002290712 125
553 3300009177 Ga0105248_10100231 Ga0105248_101002312 125
554 3300009177 Ga0105248_10106162 Ga0105248_101061623 125
555 3300009177 Ga0105248_10341020 Ga0105248_103410202 125
556 3300009177 Ga0105248_10424396 Ga0105248_104243963 125
557 3300009177 Ga0105248_10736984 Ga0105248_107369843 125
558 3300009177 Ga0105248_10976747 Ga0105248_109767472 125
559 3300009177 Ga0105248_11707590 Ga0105248_117075902 125
560 3300009545 Ga0105237_10002858 Ga0105237_1000285820 125
561 3300009545 Ga0105237_10186090 Ga0105237_101860903 125
562 3300009545 Ga0105237_10449722 Ga0105237_104497223 125
563 3300009545 Ga0105237_10604010 Ga0105237_106040102 125
564 3300009545 Ga0105237_11513256 Ga0105237_115132562 125
565 3300009551 Ga0105238_11230877 Ga0105238_112308773 125
566 3300009553 Ga0105249_10001881 Ga0105249_1000188125 125
567 3300009553 Ga0105249_10002122 Ga0105249_1000212224 125
568 3300009553 Ga0105249_10134716 Ga0105249_101347162 125
569 3300009553 Ga0105249_11020091 Ga0105249_110200912 125
570 3300009553 Ga0105249_11228458 Ga0105249_112284582 125
571 3300009553 Ga0105249_11600721 Ga0105249_116007212 125
572 3300010375 Ga0105239_10457367 Ga0105239_104573672 125
573 3300010375 Ga0105239_10945649 Ga0105239_109456492 125
574 3300010375 Ga0105239_11059697 Ga0105239_110596973 125
575 3300010375 Ga0105239_11679028 Ga0105239_116790282 125
576 3300011119 Ga0105246_10736332 Ga0105246_107363322 125
577 3300011119 Ga0105246_11372844 Ga0105246_113728442 125
578 3300012495 Ga0157323_1030989 Ga0157323_10309892 125
579 3300012505 Ga0157339_1045827 Ga0157339_10458272 125
580 3300012508 Ga0157315_1005960 Ga0157315_10059602 125
581 3300012512 Ga0157327_1020413 Ga0157327_10204132 125
582 3300012515 Ga0157338_1000992 Ga0157338_10009924 125
583 3300013100 Ga0157373_10050689 Ga0157373_100506892 125
584 3300013100 Ga0157373_10172671 Ga0157373_101726712 125
585 3300013100 Ga0157373_10419244 Ga0157373_104192443 125
586 3300013100 Ga0157373_10973344 Ga0157373_109733442 125
587 3300013102 Ga0157371_10152944 Ga0157371_101529442 125
588 3300013102 Ga0157371_11457855 Ga0157371_114578552 125
589 3300013104 Ga0157370_10029812 Ga0157370_100298128 125
590 3300013104 Ga0157370_10102037 Ga0157370_101020372 125
591 3300013105 Ga0157369_10034063 Ga0157369_100340638 125
592 3300013105 Ga0157369_10070636 Ga0157369_100706363 125
593 3300013105 Ga0157369_10153589 Ga0157369_101535895 125
594 3300013105 Ga0157369_10574155 Ga0157369_105741552 125
595 3300013105 Ga0157369_10778307 Ga0157369_107783073 125
596 3300013105 Ga0157369_12320254 Ga0157369_123202542 125
597 3300013296 Ga0157374_10414302 Ga0157374_104143022 125
598 3300013296 Ga0157374_10881780 Ga0157374_108817803 125
599 3300013296 Ga0157374_12289027 Ga0157374_122890272 125
600 3300013297 Ga0157378_10114310 Ga0157378_101143102 125
601 3300013306 Ga0163162_10025756 Ga0163162_100257565 125
602 3300013306 Ga0163162_10404008 Ga0163162_104040083 125
603 3300013306 Ga0163162_10562907 Ga0163162_105629072 125
604 3300013306 Ga0163162_10951462 Ga0163162_109514622 125
605 3300013306 Ga0163162_12300679 Ga0163162_123006791 125
606 3300013307 Ga0157372_10078683 Ga0157372_100786832 125
607 3300013307 Ga0157372_10427160 Ga0157372_104271602 125
608 3300013307 Ga0157372_11844695 Ga0157372_118446952 125
609 3300013307 Ga0157372_12902238 Ga0157372_129022382 125
610 3300013307 Ga0157372_13029957 Ga0157372_130299572 125
611 3300013308 Ga0157375_10007439 Ga0157375_100074395 125
612 3300013308 Ga0157375_10105208 Ga0157375_101052082 125
613 3300014325 Ga0163163_10020116 Ga0163163_1002011613 125
614 3300014325 Ga0163163_10313059 Ga0163163_103130592 125
615 3300014325 Ga0163163_10314201 Ga0163163_103142013 125
616 3300014325 Ga0163163_10360924 Ga0163163_103609242 125
617 3300014325 Ga0163163_10584351 Ga0163163_105843512 125
618 3300014325 Ga0163163_10591250 Ga0163163_105912503 125
619 3300014325 Ga0163163_11538253 Ga0163163_115382532 125
620 3300014326 Ga0157380_10000157 Ga0157380_100001572 125
621 3300014326 Ga0157380_10015607 Ga0157380_100156076 125
622 3300014326 Ga0157380_10435926 Ga0157380_104359262 125
623 3300014326 Ga0157380_10630398 Ga0157380_106303983 125
624 3300014326 Ga0157380_10677954 Ga0157380_106779541 125
625 3300014326 Ga0157380_11422723 Ga0157380_114227232 125
626 3300014326 Ga0157380_11475188 Ga0157380_114751882 125
627 3300014497 Ga0182008_10184377 Ga0182008_101843772 125
628 3300014745 Ga0157377_10460577 Ga0157377_104605772 125
629 3300014968 Ga0157379_10223199 Ga0157379_102231994 125
630 3300014968 Ga0157379_10665090 Ga0157379_106650902 125
631 3300014968 Ga0157379_10766984 Ga0157379_107669841 125
632 3300014968 Ga0157379_11103336 Ga0157379_111033362 125
633 3300014969 Ga0157376_10019101 Ga0157376_100191018 125
634 3300014969 Ga0157376_10363485 Ga0157376_103634852 125
635 3300017792 Ga0163161_10160074 Ga0163161_101600743 125
636 3300017792 Ga0163161_10359501 Ga0163161_103595012 125
637 3300017792 Ga0163161_10417686 Ga0163161_104176862 125
638 3300017792 Ga0163161_10667267 Ga0163161_106672672 125
639 3300020069 Ga0197907_10673139 Ga0197907_106731392 125
640 3300021388 Ga0213875_10001626 Ga0213875_100016268 125
641 3300025245 Ga0207425_1000049 Ga0207425_1000049172 125
642 3300025254 Ga0209148_1006654 Ga0209148_10066543 125
643 3300025258 Ga0209129_1000471 Ga0209129_100047121 125
644 3300025263 Ga0209565_1000985 Ga0209565_10009853 125
645 3300025292 Ga0209676_1007313 Ga0209676_10073136 125
646 3300025294 Ga0209025_1000068 Ga0209025_1000068144 125
647 3300025295 Ga0209564_1000335 Ga0209564_100033587 125
648 3300025297 Ga0209758_1000004 Ga0209758_100000443 125
649 3300025298 Ga0209050_1000001 Ga0209050_10000011974 125
650 3300025298 Ga0209050_1001064 Ga0209050_100106414 125
651 3300025303 Ga0209051_1000191 Ga0209051_100019195 125
652 3300025304 Ga0209257_1004959 Ga0209257_10049596 125
653 3300025315 Ga0207697_10001580 Ga0207697_100015803 125
654 3300025321 Ga0207656_10218634 Ga0207656_102186342 125
655 3300025711 Ga0207696_1000878 Ga0207696_100087812 125
656 3300025735 Ga0207713_1000752 Ga0207713_100075223 125
657 3300025893 Ga0207682_10006590 Ga0207682_100065901 125
658 3300025893 Ga0207682_10286164 Ga0207682_102861642 125
659 3300025893 Ga0207682_10408647 Ga0207682_104086472 125
660 3300025899 Ga0207642_10099534 Ga0207642_100995342 125
661 3300025899 Ga0207642_10321425 Ga0207642_103214252 125
662 3300025899 Ga0207642_11027184 Ga0207642_110271841 125
663 3300025900 Ga0207710_10035506 Ga0207710_100355065 125
664 3300025900 Ga0207710_10036482 Ga0207710_100364824 125
665 3300025900 Ga0207710_10063379 Ga0207710_100633792 125
666 3300025900 Ga0207710_10243846 Ga0207710_102438462 125
667 3300025901 Ga0207688_10113160 Ga0207688_101131603 125
668 3300025901 Ga0207688_10225106 Ga0207688_102251062 125
669 3300025901 Ga0207688_10433251 Ga0207688_104332512 125
670 3300025903 Ga0207680_10013949 Ga0207680_100139492 125
671 3300025903 Ga0207680_10040390 Ga0207680_100403902 125
672 3300025903 Ga0207680_10134575 Ga0207680_101345751 125
673 3300025903 Ga0207680_10201861 Ga0207680_102018612 125
674 3300025903 Ga0207680_10299365 Ga0207680_102993652 125
675 3300025903 Ga0207680_10712458 Ga0207680_107124582 125
676 3300025904 Ga0207647_10008472 Ga0207647_100084729 125
677 3300025904 Ga0207647_10151764 Ga0207647_101517643 125
678 3300025904 Ga0207647_10205617 Ga0207647_102056173 125
679 3300025904 Ga0207647_10356562 Ga0207647_103565622 125
680 3300025907 Ga0207645_10014351 Ga0207645_1001435111 125
681 3300025907 Ga0207645_10329078 Ga0207645_103290783 125
682 3300025907 Ga0207645_10372627 Ga0207645_103726272 125
683 3300025907 Ga0207645_10486385 Ga0207645_104863852 125
684 3300025907 Ga0207645_10613201 Ga0207645_106132012 125
685 3300025907 Ga0207645_11106532 Ga0207645_111065321 125
686 3300025908 Ga0207643_10262364 Ga0207643_102623643 125
687 3300025908 Ga0207643_10512962 Ga0207643_105129622 125
688 3300025909 Ga0207705_10000243 Ga0207705_1000024330 125
689 3300025909 Ga0207705_10018065 Ga0207705_1001806510 125
690 3300025909 Ga0207705_10170172 Ga0207705_101701722 125
691 3300025909 Ga0207705_10298895 Ga0207705_102988953 125
692 3300025909 Ga0207705_10476427 Ga0207705_104764272 125
693 3300025909 Ga0207705_11372488 Ga0207705_113724881 125
694 3300025911 Ga0207654_10000796 Ga0207654_1000079623 125
695 3300025911 Ga0207654_10272601 Ga0207654_102726012 125
696 3300025911 Ga0207654_10291692 Ga0207654_102916922 125
697 3300025911 Ga0207654_10389537 Ga0207654_103895372 125
698 3300025911 Ga0207654_10679072 Ga0207654_106790722 125
699 3300025912 Ga0207707_11574258 Ga0207707_115742581 125
700 3300025913 Ga0207695_10006167 Ga0207695_1000616718 125
701 3300025913 Ga0207695_10006293 Ga0207695_1000629311 125
702 3300025914 Ga0207671_10003173 Ga0207671_100031739 125
703 3300025914 Ga0207671_10043377 Ga0207671_100433776 125
704 3300025914 Ga0207671_10403494 Ga0207671_104034943 125
705 3300025914 Ga0207671_10540879 Ga0207671_105408791 125
706 3300025917 Ga0207660_10044818 Ga0207660_100448187 125
707 3300025917 Ga0207660_10738150 Ga0207660_107381502 125
708 3300025917 Ga0207660_11259222 Ga0207660_112592222 125
709 3300025918 Ga0207662_10447502 Ga0207662_104475022 125
710 3300025918 Ga0207662_11345789 Ga0207662_113457892 125
711 3300025919 Ga0207657_10172620 Ga0207657_101726201 125
712 3300025919 Ga0207657_10287802 Ga0207657_102878022 125
713 3300025919 Ga0207657_10459521 Ga0207657_104595212 125
714 3300025919 Ga0207657_10622911 Ga0207657_106229112 125
715 3300025919 Ga0207657_10823517 Ga0207657_108235172 125
716 3300025919 Ga0207657_10931409 Ga0207657_109314092 125
717 3300025919 Ga0207657_11142957 Ga0207657_111429571 125
718 3300025920 Ga0207649_10155614 Ga0207649_101556143 125
719 3300025920 Ga0207649_10805784 Ga0207649_108057842 125
720 3300025920 Ga0207649_11171159 Ga0207649_111711592 125
721 3300025921 Ga0207652_10843960 Ga0207652_108439603 125
722 3300025923 Ga0207681_10000005 Ga0207681_1000000567 125
723 3300025923 Ga0207681_10000109 Ga0207681_1000010954 125
724 3300025923 Ga0207681_10064025 Ga0207681_100640253 125
725 3300025923 Ga0207681_10107677 Ga0207681_101076771 125
726 3300025923 Ga0207681_10135208 Ga0207681_101352083 125
727 3300025923 Ga0207681_10135695 Ga0207681_101356954 125
728 3300025923 Ga0207681_10136951 Ga0207681_101369513 125
729 3300025923 Ga0207681_10322916 Ga0207681_103229162 125
730 3300025923 Ga0207681_10686576 Ga0207681_106865762 125
731 3300025923 Ga0207681_10743248 Ga0207681_107432482 125
732 3300025924 Ga0207694_10002782 Ga0207694_100027829 125
733 3300025924 Ga0207694_11295342 Ga0207694_112953421 125
734 3300025925 Ga0207650_10000004 Ga0207650_10000004654 125
735 3300025925 Ga0207650_10010619 Ga0207650_100106193 125
736 3300025925 Ga0207650_10012172 Ga0207650_100121722 125
737 3300025925 Ga0207650_10117282 Ga0207650_101172823 125
738 3300025925 Ga0207650_10149651 Ga0207650_101496514 125
739 3300025925 Ga0207650_10203478 Ga0207650_102034782 125
740 3300025925 Ga0207650_10329309 Ga0207650_103293092 125
741 3300025925 Ga0207650_10482537 Ga0207650_104825372 125
742 3300025925 Ga0207650_11599005 Ga0207650_115990051 125
743 3300025926 Ga0207659_10001819 Ga0207659_100018194 125
744 3300025926 Ga0207659_11189377 Ga0207659_111893772 125
745 3300025926 Ga0207659_11863388 Ga0207659_118633881 125
746 3300025928 Ga0207700_10348620 Ga0207700_103486202 125
747 3300025929 Ga0207664_10033807 Ga0207664_100338076 125
748 3300025929 Ga0207664_10407847 Ga0207664_104078472 125
749 3300025931 Ga0207644_10000005 Ga0207644_10000005326 125
750 3300025931 Ga0207644_10002343 Ga0207644_1000234320 125
751 3300025931 Ga0207644_10013980 Ga0207644_1001398011 125
752 3300025931 Ga0207644_10015604 Ga0207644_100156046 125
753 3300025931 Ga0207644_10265646 Ga0207644_102656463 125
754 3300025931 Ga0207644_10873001 Ga0207644_108730012 125
755 3300025932 Ga0207690_10000234 Ga0207690_100002343 125
756 3300025932 Ga0207690_10064522 Ga0207690_100645222 125
757 3300025932 Ga0207690_10233117 Ga0207690_102331172 125
758 3300025932 Ga0207690_10244551 Ga0207690_102445512 125
759 3300025932 Ga0207690_10799856 Ga0207690_107998561 125
760 3300025932 Ga0207690_11074208 Ga0207690_110742081 125
761 3300025932 Ga0207690_11385288 Ga0207690_113852882 125
762 3300025933 Ga0207706_10018915 Ga0207706_100189156 125
763 3300025933 Ga0207706_10104516 Ga0207706_101045162 125
764 3300025933 Ga0207706_10215402 Ga0207706_102154023 125
765 3300025933 Ga0207706_10695595 Ga0207706_106955952 125
766 3300025933 Ga0207706_10788478 Ga0207706_107884782 125
767 3300025933 Ga0207706_10966870 Ga0207706_109668701 125
768 3300025933 Ga0207706_11278411 Ga0207706_112784112 125
769 3300025934 Ga0207686_11238963 Ga0207686_112389632 125
770 3300025934 Ga0207686_11632044 Ga0207686_116320441 125
771 3300025935 Ga0207709_10294414 Ga0207709_102944142 125
772 3300025935 Ga0207709_10305309 Ga0207709_103053092 125
773 3300025935 Ga0207709_10425941 Ga0207709_104259412 125
774 3300025935 Ga0207709_11136648 Ga0207709_111366482 125
775 3300025935 Ga0207709_11393360 Ga0207709_113933602 125
776 3300025936 Ga0207670_10140665 Ga0207670_101406653 125
777 3300025936 Ga0207670_10157716 Ga0207670_101577163 125
778 3300025937 Ga0207669_10012728 Ga0207669_100127286 125
779 3300025937 Ga0207669_10172189 Ga0207669_101721893 125
780 3300025937 Ga0207669_10188591 Ga0207669_101885913 125
781 3300025937 Ga0207669_10793102 Ga0207669_107931021 125
782 3300025938 Ga0207704_10188806 Ga0207704_101888063 125
783 3300025938 Ga0207704_10403625 Ga0207704_104036252 125
784 3300025938 Ga0207704_10425485 Ga0207704_104254852 125
785 3300025938 Ga0207704_11083677 Ga0207704_110836772 125
786 3300025939 Ga0207665_10728840 Ga0207665_107288402 125
787 3300025940 Ga0207691_10017921 Ga0207691_1001792110 125
788 3300025940 Ga0207691_10443159 Ga0207691_104431592 125
789 3300025940 Ga0207691_10565637 Ga0207691_105656373 125
790 3300025940 Ga0207691_10826742 Ga0207691_108267422 125
791 3300025940 Ga0207691_10921219 Ga0207691_109212191 125
792 3300025940 Ga0207691_11405573 Ga0207691_114055731 125
793 3300025940 Ga0207691_11670538 Ga0207691_116705381 125
794 3300025941 Ga0207711_10000025 Ga0207711_10000025168 125
795 3300025941 Ga0207711_10001472 Ga0207711_100014725 125
796 3300025941 Ga0207711_10004929 Ga0207711_100049293 125
797 3300025941 Ga0207711_10007295 Ga0207711_100072958 125
798 3300025941 Ga0207711_10018353 Ga0207711_100183537 125
799 3300025941 Ga0207711_10198760 Ga0207711_101987602 125
800 3300025941 Ga0207711_10293709 Ga0207711_102937092 125
801 3300025941 Ga0207711_10689339 Ga0207711_106893392 125
802 3300025941 Ga0207711_11171456 Ga0207711_111714562 125
803 3300025944 Ga0207661_12027118 Ga0207661_120271181 125
804 3300025945 Ga0207679_10000847 Ga0207679_1000084721 125
805 3300025945 Ga0207679_10024678 Ga0207679_100246786 125
806 3300025945 Ga0207679_10169733 Ga0207679_101697333 125
807 3300025945 Ga0207679_10523914 Ga0207679_105239142 125
808 3300025945 Ga0207679_10976302 Ga0207679_109763022 125
809 3300025945 Ga0207679_11842983 Ga0207679_118429831 125
810 3300025949 Ga0207667_10004183 Ga0207667_100041839 125
811 3300025949 Ga0207667_10009439 Ga0207667_1000943916 125
812 3300025949 Ga0207667_10021256 Ga0207667_100212568 125
813 3300025949 Ga0207667_10033512 Ga0207667_1003351213 125
814 3300025949 Ga0207667_10113219 Ga0207667_101132195 125
815 3300025949 Ga0207667_10758480 Ga0207667_107584802 125
816 3300025949 Ga0207667_12045683 Ga0207667_120456832 125
817 3300025960 Ga0207651_10073408 Ga0207651_100734082 125
818 3300025960 Ga0207651_10120124 Ga0207651_101201241 125
819 3300025960 Ga0207651_11294335 Ga0207651_112943352 125
820 3300025961 Ga0207712_10006239 Ga0207712_100062396 125
821 3300025961 Ga0207712_10037061 Ga0207712_100370613 125
822 3300025961 Ga0207712_10112962 Ga0207712_101129622 125
823 3300025961 Ga0207712_10124942 Ga0207712_101249422 125
824 3300025961 Ga0207712_10405567 Ga0207712_104055671 125
825 3300025961 Ga0207712_10515107 Ga0207712_105151072 125
826 3300025972 Ga0207668_10032300 Ga0207668_100323008 125
827 3300025972 Ga0207668_10098711 Ga0207668_100987112 125
828 3300025972 Ga0207668_10125743 Ga0207668_101257432 125
829 3300025972 Ga0207668_10142601 Ga0207668_101426013 125
830 3300025972 Ga0207668_10520698 Ga0207668_105206983 125
831 3300025972 Ga0207668_10896992 Ga0207668_108969921 125
832 3300025972 Ga0207668_11544709 Ga0207668_115447092 125
833 3300025981 Ga0207640_10007440 Ga0207640_100074406 125
834 3300025981 Ga0207640_10019616 Ga0207640_100196166 125
835 3300025981 Ga0207640_10023695 Ga0207640_100236956 125
836 3300025981 Ga0207640_10075290 Ga0207640_100752902 125
837 3300025981 Ga0207640_10310522 Ga0207640_103105221 125
838 3300025981 Ga0207640_10564709 Ga0207640_105647092 125
839 3300025981 Ga0207640_11117636 Ga0207640_111176361 125
840 3300025986 Ga0207658_10000064 Ga0207658_1000006456 125
841 3300025986 Ga0207658_10004938 Ga0207658_100049389 125
842 3300025986 Ga0207658_10005381 Ga0207658_100053812 125
843 3300025986 Ga0207658_10245342 Ga0207658_102453423 125
844 3300025986 Ga0207658_10289784 Ga0207658_102897842 125
845 3300025986 Ga0207658_10336283 Ga0207658_103362833 125
846 3300026023 Ga0207677_10456903 Ga0207677_104569032 125
847 3300026035 Ga0207703_10187314 Ga0207703_101873142 125
848 3300026035 Ga0207703_10465468 Ga0207703_104654682 125
849 3300026035 Ga0207703_11092724 Ga0207703_110927241 125
850 3300026035 Ga0207703_11468793 Ga0207703_114687932 125
851 3300026035 Ga0207703_11497294 Ga0207703_114972942 125
852 3300026041 Ga0207639_10019581 Ga0207639_100195813 125
853 3300026041 Ga0207639_10250926 Ga0207639_102509263 125
854 3300026041 Ga0207639_10341890 Ga0207639_103418901 125
855 3300026041 Ga0207639_10371280 Ga0207639_103712803 125
856 3300026041 Ga0207639_10467754 Ga0207639_104677541 125
857 3300026067 Ga0207678_10014182 Ga0207678_100141826 125
858 3300026067 Ga0207678_10110312 Ga0207678_101103122 125
859 3300026067 Ga0207678_10166893 Ga0207678_101668933 125
860 3300026067 Ga0207678_11238296 Ga0207678_112382962 125
861 3300026067 Ga0207678_11399066 Ga0207678_113990662 125
862 3300026067 Ga0207678_11670553 Ga0207678_116705532 125
863 3300026075 Ga0207708_10016146 Ga0207708_1001614611 125
864 3300026075 Ga0207708_10344216 Ga0207708_103442162 125
865 3300026075 Ga0207708_11082489 Ga0207708_110824892 125
866 3300026075 Ga0207708_11246471 Ga0207708_112464711 125
867 3300026078 Ga0207702_10003021 Ga0207702_100030219 125
868 3300026078 Ga0207702_10005908 Ga0207702_100059088 125
869 3300026078 Ga0207702_10613417 Ga0207702_106134172 125
870 3300026088 Ga0207641_10003244 Ga0207641_100032443 125
871 3300026088 Ga0207641_10101679 Ga0207641_101016792 125
872 3300026088 Ga0207641_10127150 Ga0207641_101271504 125
873 3300026088 Ga0207641_10150340 Ga0207641_101503403 125
874 3300026088 Ga0207641_10323913 Ga0207641_103239132 125
875 3300026088 Ga0207641_11820018 Ga0207641_118200182 125
876 3300026089 Ga0207648_10240702 Ga0207648_102407023 125
877 3300026089 Ga0207648_10459080 Ga0207648_104590803 125
878 3300026089 Ga0207648_11292458 Ga0207648_112924582 125
879 3300026095 Ga0207676_10000006 Ga0207676_1000000658 125
880 3300026095 Ga0207676_10014415 Ga0207676_100144158 125
881 3300026095 Ga0207676_10136112 Ga0207676_101361125 125
882 3300026095 Ga0207676_10250941 Ga0207676_102509413 125
883 3300026095 Ga0207676_10278645 Ga0207676_102786452 125
884 3300026095 Ga0207676_10972285 Ga0207676_109722851 125
885 3300026116 Ga0207674_10062161 Ga0207674_100621614 125
886 3300026116 Ga0207674_10062748 Ga0207674_100627488 125
887 3300026116 Ga0207674_10141809 Ga0207674_101418095 125
888 3300026116 Ga0207674_10648444 Ga0207674_106484443 125
889 3300026116 Ga0207674_10939193 Ga0207674_109391932 125
890 3300026116 Ga0207674_11092817 Ga0207674_110928172 125
891 3300026118 Ga0207675_100001117 Ga0207675_10000111728 125
892 3300026118 Ga0207675_100022526 Ga0207675_10002252611 125
893 3300026118 Ga0207675_100155097 Ga0207675_1001550975 125
894 3300026118 Ga0207675_100877104 Ga0207675_1008771042 125
895 3300026118 Ga0207675_101019576 Ga0207675_1010195762 125
896 3300026121 Ga0207683_10000681 Ga0207683_100006813 125
897 3300026121 Ga0207683_10382507 Ga0207683_103825072 125
898 3300026121 Ga0207683_10777255 Ga0207683_107772552 125
899 3300026121 Ga0207683_11466886 Ga0207683_114668862 125
900 3300026142 Ga0207698_10016673 Ga0207698_100166736 125
901 3300026142 Ga0207698_10195073 Ga0207698_101950732 125
902 3300026142 Ga0207698_10281969 Ga0207698_102819692 125
903 3300026142 Ga0207698_10577682 Ga0207698_105776823 125
904 3300026142 Ga0207698_10713984 Ga0207698_107139842 125
905 3300026142 Ga0207698_11103613 Ga0207698_111036131 125
906 3300026142 Ga0207698_11288864 Ga0207698_112888642 125
907 3300027312 Ga0209371_1030624 Ga0209371_10306243 125
908 3300027424 Ga0209984_1008264 Ga0209984_10082643 125
909 3300027526 Ga0209968_1021665 Ga0209968_10216653 125
910 3300027526 Ga0209968_1039141 Ga0209968_10391412 125
911 3300027552 Ga0209982_1015255 Ga0209982_10152552 125
912 3300027614 Ga0209970_1056825 Ga0209970_10568252 125
913 3300027665 Ga0209983_1010835 Ga0209983_10108352 125
914 3300027665 Ga0209983_1054690 Ga0209983_10546902 125
915 3300027665 Ga0209983_1082206 Ga0209983_10822061 125
916 3300027717 Ga0209998_10099554 Ga0209998_100995542 125
917 3300027876 Ga0209974_10082069 Ga0209974_100820692 125
918 3300027876 Ga0209974_10086086 Ga0209974_100860863 125
919 3300027907 Ga0207428_10197963 Ga0207428_101979631 125
920 3300027907 Ga0207428_11065529 Ga0207428_110655292 125
921 3300028379 Ga0268266_10012801 Ga0268266_100128017 125
922 3300028379 Ga0268266_10022523 Ga0268266_100225237 125
923 3300028379 Ga0268266_10511648 Ga0268266_105116483 125
924 3300028379 Ga0268266_10785691 Ga0268266_107856912 125
925 3300028380 Ga0268265_10000001 Ga0268265_100000011120 125
926 3300028380 Ga0268265_10001591 Ga0268265_1000159114 125
927 3300028380 Ga0268265_10168803 Ga0268265_101688033 125
928 3300028380 Ga0268265_10342767 Ga0268265_103427672 125
929 3300028380 Ga0268265_10356224 Ga0268265_103562243 125
930 3300028380 Ga0268265_10622760 Ga0268265_106227602 125
931 3300028380 Ga0268265_12008182 Ga0268265_120081821 125
932 3300028381 Ga0268264_10000277 Ga0268264_10000277100 125
933 3300028381 Ga0268264_10015144 Ga0268264_1001514413 125
934 3300028381 Ga0268264_10058700 Ga0268264_100587006 125
935 3300028381 Ga0268264_10102800 Ga0268264_101028002 125
936 3300028381 Ga0268264_10177216 Ga0268264_101772163 125
937 3300028381 Ga0268264_10505030 Ga0268264_105050301 125
938 3300030731 Ga0316177_1214891 Ga0316177_12148912 125
939 3300030733 Ga0314311_1010360 Ga0314311_10103603 125
940 3300030735 Ga0316178_1068395 Ga0316178_10683952 125
941 3300031548 Ga0307408_100006443 Ga0307408_1000064439 125
942 3300031548 Ga0307408_100023913 Ga0307408_1000239131 125
943 3300031548 Ga0307408_100094952 Ga0307408_1000949522 125
944 3300031548 Ga0307408_100491550 Ga0307408_1004915503 125
945 3300031548 Ga0307408_100666816 Ga0307408_1006668162 125
946 3300031711 Ga0265314_10149514 Ga0265314_101495141 125
947 3300031727 Ga0316576_10543318 Ga0316576_105433182 125
948 3300031731 Ga0307405_10019698 Ga0307405_100196982 125
949 3300031731 Ga0307405_10057515 Ga0307405_100575152 125
950 3300031731 Ga0307405_10144798 Ga0307405_101447983 125
951 3300031731 Ga0307405_10171397 Ga0307405_101713972 125
952 3300031731 Ga0307405_10340784 Ga0307405_103407842 125
953 3300031731 Ga0307405_10871404 Ga0307405_108714042 125
954 3300031731 Ga0307405_11653421 Ga0307405_116534212 125
955 3300031824 Ga0307413_10074509 Ga0307413_100745095 125
956 3300031824 Ga0307413_10086312 Ga0307413_100863123 125
957 3300031824 Ga0307413_10113610 Ga0307413_101136104 125
958 3300031824 Ga0307413_10567311 Ga0307413_105673113 125
959 3300031824 Ga0307413_10602167 Ga0307413_106021673 125
960 3300031824 Ga0307413_10699901 Ga0307413_106999012 125
961 3300031824 Ga0307413_10779755 Ga0307413_107797552 125
962 3300031852 Ga0307410_10012286 Ga0307410_100122862 125
963 3300031852 Ga0307410_10099934 Ga0307410_100999344 125
964 3300031852 Ga0307410_10120091 Ga0307410_101200912 125
965 3300031852 Ga0307410_10306713 Ga0307410_103067133 125
966 3300031852 Ga0307410_10360926 Ga0307410_103609262 125
967 3300031852 Ga0307410_10407171 Ga0307410_104071713 125
968 3300031852 Ga0307410_10522766 Ga0307410_105227661 125
969 3300031852 Ga0307410_10862790 Ga0307410_108627902 125
970 3300031852 Ga0307410_10885716 Ga0307410_108857162 125
971 3300031852 Ga0307410_11274668 Ga0307410_112746681 125
972 3300031901 Ga0307406_10008913 Ga0307406_100089132 125
973 3300031901 Ga0307406_10046990 Ga0307406_100469905 125
974 3300031901 Ga0307406_10053412 Ga0307406_100534124 125
975 3300031901 Ga0307406_10912592 Ga0307406_109125922 125
976 3300031903 Ga0307407_10002227 Ga0307407_100022273 125
977 3300031903 Ga0307407_10070319 Ga0307407_100703195 125
978 3300031903 Ga0307407_10315871 Ga0307407_103158713 125
979 3300031903 Ga0307407_10520755 Ga0307407_105207552 125
980 3300031903 Ga0307407_10569608 Ga0307407_105696081 125
981 3300031903 Ga0307407_10788895 Ga0307407_107888952 125
982 3300031911 Ga0307412_10000330 Ga0307412_1000033024 125
983 3300031911 Ga0307412_10001378 Ga0307412_1000137813 125
984 3300031911 Ga0307412_10005349 Ga0307412_100053498 125
985 3300031911 Ga0307412_10088494 Ga0307412_100884941 125
986 3300031911 Ga0307412_10143230 Ga0307412_101432302 125
987 3300031911 Ga0307412_10149070 Ga0307412_101490703 125
988 3300031911 Ga0307412_10897320 Ga0307412_108973202 125
989 3300031911 Ga0307412_10998701 Ga0307412_109987012 125
990 3300031995 Ga0307409_100054731 Ga0307409_1000547315 125
991 3300031995 Ga0307409_100120541 Ga0307409_1001205413 125
992 3300031995 Ga0307409_100468498 Ga0307409_1004684982 125
993 3300031995 Ga0307409_100499224 Ga0307409_1004992243 125
994 3300031995 Ga0307409_101199490 Ga0307409_1011994902 125
995 3300031995 Ga0307409_101523219 Ga0307409_1015232192 125
996 3300031995 Ga0307409_101984172 Ga0307409_1019841722 125
997 3300032002 Ga0307416_100005600 Ga0307416_1000056005 125
998 3300032002 Ga0307416_100007111 Ga0307416_1000071118 125
999 3300032002 Ga0307416_100015206 Ga0307416_1000152068 125
1000 3300032002 Ga0307416_100343007 Ga0307416_1003430072 125
1001 3300032002 Ga0307416_100420483 Ga0307416_1004204833 125
1002 3300032002 Ga0307416_100716940 Ga0307416_1007169403 125
1003 3300032002 Ga0307416_100904952 Ga0307416_1009049522 125
1004 3300032002 Ga0307416_101291913 Ga0307416_1012919132 125
1005 3300032004 Ga0307414_10000117 Ga0307414_1000011743 125
1006 3300032004 Ga0307414_10013980 Ga0307414_100139808 125
1007 3300032004 Ga0307414_10017211 Ga0307414_100172116 125
1008 3300032004 Ga0307414_10313918 Ga0307414_103139183 125
1009 3300032004 Ga0307414_10667321 Ga0307414_106673212 125
1010 3300032004 Ga0307414_10708957 Ga0307414_107089573 125
1011 3300032004 Ga0307414_11089132 Ga0307414_110891322 125
1012 3300032005 Ga0307411_10016991 Ga0307411_100169913 125
1013 3300032005 Ga0307411_10118140 Ga0307411_101181401 125
1014 3300032005 Ga0307411_10191187 Ga0307411_101911872 125
1015 3300032005 Ga0307411_10202406 Ga0307411_102024063 125
1016 3300032005 Ga0307411_10279700 Ga0307411_102797003 125
1017 3300032005 Ga0307411_10319906 Ga0307411_103199063 125
1018 3300032005 Ga0307411_10469979 Ga0307411_104699792 125
1019 3300032005 Ga0307411_10831451 Ga0307411_108314512 125
1020 3300032005 Ga0307411_10911586 Ga0307411_109115863 125
1021 3300032005 Ga0307411_11536867 Ga0307411_115368672 125
1022 3300032005 Ga0307411_11542581 Ga0307411_115425812 125
1023 3300032126 Ga0307415_100006247 Ga0307415_1000062478 125
1024 3300032126 Ga0307415_100011564 Ga0307415_1000115643 125
1025 3300032126 Ga0307415_100013332 Ga0307415_10001333211 125
1026 3300032126 Ga0307415_100169143 Ga0307415_1001691431 125
1027 3300032126 Ga0307415_100188481 Ga0307415_1001884812 125
1028 3300032126 Ga0307415_101289550 Ga0307415_1012895502 125
1029 3300032126 Ga0307415_101311329 Ga0307415_1013113292 125
1030 3300032126 Ga0307415_101478990 Ga0307415_1014789901 125
1031 3300032126 Ga0307415_101868588 Ga0307415_1018685882 125
1032 3300032168 Ga0316593_10137165 Ga0316593_101371651 125
1033 3300033180 Ga0307510_10013278 Ga0307510_1001327810 125
1034 3300034818 Ga0373950_0157713 Ga0373950_0157713_23_400 125
1035 3300035090 Ga0373949_0162496 Ga0373949_0162496_82_459 125
1036 3300035114 Ga0373939_0036939 Ga0373939_0036939_945_1322 125
1037 3300035170 Ga0373943_0861582 Ga0373943_0861582_140_517 125
1038 3300035172 Ga0373955_0225626 Ga0373955_0225626_50_427 125
1039 3300035242 Ga0373962_0088605 Ga0373962_0088605_526_903 125
1040 3300035691 Ga0373931_0034960 Ga0373931_0034960_616_993 125
1041 3300036712 Ga0316584_0035209 Ga0316584_0035209_2722_3099 125
1042 3300037068 Ga0373925_1046502 Ga0373925_1046502_149_529 125
1043 3300037312 Ga0395899_0029552 Ga0395899_0029552_363_740 125
1044 3300037418 Ga0395900_0022460 Ga0395900_0022460_455_832 125
1045 3300037418 Ga0395900_0031276 Ga0395900_0031276_4742_5125 125
1046 3300037418 Ga0395900_0401581 Ga0395900_0401581_559_936 125
1047 3300037418 Ga0395900_0735156 Ga0395900_0735156_202_579 125
1048 3300037466 Ga0395898_0522393 Ga0395898_0522393_95_472 125
1049 3300037466 Ga0395898_0653944 Ga0395898_0653944_161_538 125
1050 3300037471 Ga0395905_0035925 Ga0395905_0035925_3350_3727 125
1051 3300037471 Ga0395905_0173828 Ga0395905_0173828_1489_1866 125
1052 3300037471 Ga0395905_0194372 Ga0395905_0194372_582_959 125
1053 3300037471 Ga0395905_0274258 Ga0395905_0274258_319_696 125
1054 3300037471 Ga0395905_0328510 Ga0395905_0328510_586_963 125
1055 3300037471 Ga0395905_0362780 Ga0395905_0362780_771_1148 125
1056 3300037471 Ga0395905_0478760 Ga0395905_0478760_697_1074 125
1057 3300037471 Ga0395905_0507598 Ga0395905_0507598_391_768 125
1058 3300037471 Ga0395905_0958577 Ga0395905_0958577_30_407 125
1059 3300037853 Ga0436364_1065372 Ga0436364_1065372_104029_104406 125
1060 3300038443 Ga0395901_0029243 Ga0395901_0029243_5201_5578 125
1061 3300038443 Ga0395901_0052641 Ga0395901_0052641_2665_3048 125
1062 3300038443 Ga0395901_0263263 Ga0395901_0263263_988_1365 125
1063 3300038443 Ga0395901_0598300 Ga0395901_0598300_725_1102 125
1064 3300038443 Ga0395901_1159643 Ga0395901_1159643_336_713 125
1065 3300038443 Ga0395901_2044905 Ga0395901_2044905_81_458 125
1066 3300039437 Ga0436365_1297965 Ga0436365_1297965_113_490 125
1067 3300039450 Ga0436363_1100502 Ga0436363_1100502_342_737 125
1068 3300039453 Ga0436362_0798514 Ga0436362_0798514_1985_2362 125
1069 3300041408 Ga0439453_0061634 Ga0439453_0061634_198_578 125
1070 3300041413 Ga0439465_0070568 Ga0439465_0070568_720_1097 125
1071 3300041413 Ga0439465_0156571 Ga0439465_0156571_65_442 125
1072 3300041444 Ga0451790_00316 Ga0451790_00316_224_604 125
1073 3300041451 Ga0451791_0503248 Ga0451791_0503248_196_579 125
1074 3300041452 Ga0451793_0741227 Ga0451793_0741227_144_521 125
1075 3300041452 Ga0451793_1374280 Ga0451793_1374280_118_495 125
1076 3300041458 Ga0451798_0619513 Ga0451798_0619513_90_467 125
1077 3300041460 Ga0451802_2082364 Ga0451802_2082364_561_938 125
1078 3300041462 Ga0451806_470971 Ga0451806_470971_411_788 125
1079 3300041462 Ga0451806_566321 Ga0451806_566321_147_524 125
1080 3300041486 Ga0451807_0886460 Ga0451807_0886460_90_467 125
1081 3300041491 Ga0451833_0002658 Ga0451833_0002658_279_656 125
1082 3300041492 Ga0451835_0542372 Ga0451835_0542372_22_399 125
1083 3300041507 Ga0451851_0815981 Ga0451851_0815981_91_468 125
1084 3300041511 Ga0451855_1317451 Ga0451855_1317451_176_559 125
1085 3300041511 Ga0451855_1380188 Ga0451855_1380188_333_710 125
1086 3300041512 Ga0451853_3932357 Ga0451853_3932357_298_675 125
1087 3300041999 Ga0439433_0025105 Ga0439433_0025105_301_678 125
1088 3300042001 Ga0439441_020693 Ga0439441_020693_522_899 125
1089 3300042004 Ga0439445_0002249 Ga0439445_0002249_752_1129 125
1090 3300042005 Ga0439448_0055818 Ga0439448_0055818_332_709 125
1091 3300042006 Ga0439432_106712 Ga0439432_106712_83_460 125
1092 3300042007 Ga0439449_0044016 Ga0439449_0044016_575_952 125
1093 3300042008 Ga0439450_019689 Ga0439450_019689_360_740 125
1094 3300042011 Ga0439454_067357 Ga0439454_067357_144_521 125
1095 3300042012 Ga0439455_0078878 Ga0439455_0078878_370_747 125
1096 3300042116 Ga0450912_000406 Ga0450912_000406_1545_1922 125
1097 3300042120 Ga0450917_002616 Ga0450917_002616_444_824 125
1098 3300042122 Ga0450920_018839 Ga0450920_018839_421_798 125
1099 3300042125 Ga0450923_015818 Ga0450923_015818_853_1230 125
1100 3300042137 Ga0450902_055233 Ga0450902_055233_167_544 125
1101 3300042145 Ga0450906_019463 Ga0450906_019463_161_538 125
1102 3300042156 Ga0439446_0145971 Ga0439446_0145971_177_554 125
1103 3300042531 Ga0450918_033244 Ga0450918_033244_379_756 125
1104 3300042876 Ga0451577_0940419 Ga0451577_0940419_244_621 125
1105 3300044656 Ga0466969_0076277 Ga0466969_0076277_1216_1593 125
1106 3300044658 Ga0466972_0209711 Ga0466972_0209711_321_698 125
1107 3300044684 Ga0466966_0213565 Ga0466966_0213565_644_1021 125
1108 3300044712 Ga0453684_0153114 Ga0453684_0153114_865_1242 125
1109 3300044712 Ga0453684_0589010 Ga0453684_0589010_544_921 125
1110 3300044719 Ga0466971_0372534 Ga0466971_0372534_203_580 125
1111 3300044735 Ga0466968_0010999 Ga0466968_0010999_1387_1764 125
1112 3300044842 Ga0466957_0553996 Ga0466957_0553996_282_659 125
1113 3300044842 Ga0466957_1061208 Ga0466957_1061208_164_541 125
1114 3300045049 Ga0466959_0263063 Ga0466959_0263063_10_387 125
1115 3300045049 Ga0466959_0289265 Ga0466959_0289265_182_559 125
1116 3300045051 Ga0451576_2139109 Ga0451576_2139109_144_521 125
1117 3300045836 Ga0466958_0451214 Ga0466958_0451214_12_389 125
1118 3300045836 Ga0466958_0765460 Ga0466958_0765460_136_513 125
1119 3300045976 Ga0466967_0407001 Ga0466967_0407001_808_1185 125
1120 3300046457 Ga0495590_0241931 Ga0495590_0241931_160_537 125
1121 3300046460 Ga0495638_0115483 Ga0495638_0115483_859_1236 125
1122 3300046460 Ga0495638_0606663 Ga0495638_0606663_89_466 125
1123 3300046491 Ga0495584_0131949 Ga0495584_0131949_27_407 125
1124 3300046519 Ga0495632_0246087 Ga0495632_0246087_260_637 125
1125 3300046525 Ga0495663_0078113 Ga0495663_0078113_375_752 125
1126 3300046528 Ga0495642_0576188 Ga0495642_0576188_66_443 125
1127 3300046542 Ga0495597_0229089 Ga0495597_0229089_229_606 125
1128 3300046557 Ga0495622_0322808 Ga0495622_0322808_176_556 125
1129 3300046616 Ga0495668_0166107 Ga0495668_0166107_64_444 125
1130 3300046616 Ga0495668_0416197 Ga0495668_0416197_171_548 125
1131 3300046684 Ga0495669_0116862 Ga0495669_0116862_570_947 125
1132 3300046684 Ga0495669_0410406 Ga0495669_0410406_138_515 125
1133 3300046691 Ga0495670_0015418 Ga0495670_0015418_408_788 125
1134 3300046691 Ga0495670_0357840 Ga0495670_0357840_151_531 125
1135 3300046694 Ga0495649_0097490 Ga0495649_0097490_536_913 125
1136 3300046794 Ga0495589_0122273 Ga0495589_0122273_636_1016 125
1137 3300046794 Ga0495589_0293318 Ga0495589_0293318_331_708 125
1138 3300047323 Ga0495683_0246985 Ga0495683_0246985_27_404 125
1139 3300047445 Ga0495677_0218494 Ga0495677_0218494_258_635 125
1140 3300047447 Ga0495685_217507 Ga0495685_217507_131_508 125
1141 3300047469 Ga0495673_0098949 Ga0495673_0098949_680_1060 125
1142 3300047470 Ga0495681_0063192 Ga0495681_0063192_837_1214 125
1143 3300048903 Ga0496100_0017887 Ga0496100_0017887_511_888 125
1144 3300048903 Ga0496100_0042948 Ga0496100_0042948_1189_1572 125
1145 3300048903 Ga0496100_0065395 Ga0496100_0065395_1155_1532 125
1146 3300048903 Ga0496100_0072649 Ga0496100_0072649_738_1118 125
1147 3300048903 Ga0496100_0100037 Ga0496100_0100037_1476_1856 125
1148 3300048903 Ga0496100_0401531 Ga0496100_0401531_431_808 125
1149 3300048904 Ga0496101_0007782 Ga0496101_0007782_6527_6904 125
1150 3300048904 Ga0496101_0013181 Ga0496101_0013181_3759_4139 125
1151 3300048904 Ga0496101_0046999 Ga0496101_0046999_1150_1533 125
1152 3300048904 Ga0496101_0060073 Ga0496101_0060073_196_576 125
1153 3300048904 Ga0496101_0105123 Ga0496101_0105123_832_1209 125
1154 3300048904 Ga0496101_0476988 Ga0496101_0476988_95_478 125
1155 3300048904 Ga0496101_0983045 Ga0496101_0983045_67_444 125
1156 3300048905 Ga0496102_0000345 Ga0496102_0000345_36054_36437 125
1157 3300048905 Ga0496102_0001880 Ga0496102_0001880_5308_5685 125
1158 3300048905 Ga0496102_0038393 Ga0496102_0038393_1458_1841 125
1159 3300048905 Ga0496102_0321597 Ga0496102_0321597_1036_1416 125
1160 3300048905 Ga0496102_0362700 Ga0496102_0362700_710_1087 125
1161 3300048906 Ga0496103_0000110 Ga0496103_0000110_73908_74285 125
1162 3300048906 Ga0496103_0000276 Ga0496103_0000276_12425_12808 125
1163 3300048906 Ga0496103_0010156 Ga0496103_0010156_5150_5533 125
1164 3300048906 Ga0496103_0030798 Ga0496103_0030798_1819_2199 125
1165 3300048906 Ga0496103_0064863 Ga0496103_0064863_248_628 125
1166 3300048906 Ga0496103_0193874 Ga0496103_0193874_675_1055 125
1167 3300048907 Ga0496104_0000047 Ga0496104_0000047_15829_16206 125
1168 3300048907 Ga0496104_0015109 Ga0496104_0015109_833_1216 125
1169 3300048907 Ga0496104_0045259 Ga0496104_0045259_3092_3472 125
1170 3300048907 Ga0496104_0171951 Ga0496104_0171951_1470_1850 125
1171 3300048907 Ga0496104_0471527 Ga0496104_0471527_576_956 125
1172 3300048907 Ga0496104_1079821 Ga0496104_1079821_11_400 125
1173 3300048908 Ga0496105_0000034 Ga0496105_0000034_123441_123818 125
1174 3300048908 Ga0496105_0013990 Ga0496105_0013990_2041_2424 125
1175 3300048908 Ga0496105_0071727 Ga0496105_0071727_306_686 125
1176 3300048908 Ga0496105_0074994 Ga0496105_0074994_2366_2746 125
1177 3300048909 Ga0496106_0004127 Ga0496106_0004127_5535_5918 125
1178 3300048909 Ga0496106_0087648 Ga0496106_0087648_14_394 125
1179 3300048909 Ga0496106_0192678 Ga0496106_0192678_318_695 125
1180 3300048909 Ga0496106_0538407 Ga0496106_0538407_462_839 125
1181 3300048909 Ga0496106_0600882 Ga0496106_0600882_475_852 125
1182 3300048909 Ga0496106_0831324 Ga0496106_0831324_302_682 125
1183 3300048910 Ga0496107_0002978 Ga0496107_0002978_9453_9833 125
1184 3300048910 Ga0496107_0065334 Ga0496107_0065334_2128_2505 125
1185 3300048910 Ga0496107_0075313 Ga0496107_0075313_1570_1953 125
1186 3300048910 Ga0496107_0092297 Ga0496107_0092297_1556_1936 125
1187 3300048910 Ga0496107_0114521 Ga0496107_0114521_879_1256 125
1188 3300048910 Ga0496107_0574145 Ga0496107_0574145_255_632 125
1189 3300048911 Ga0496108_0017449 Ga0496108_0017449_270_653 125
1190 3300048911 Ga0496108_0247391 Ga0496108_0247391_211_591 125
1191 3300048912 Ga0496109_0006427 Ga0496109_0006427_2321_2698 125
1192 3300048912 Ga0496109_0012139 Ga0496109_0012139_5164_5544 125
1193 3300048912 Ga0496109_0017285 Ga0496109_0017285_1576_1956 125
1194 3300048912 Ga0496109_0347268 Ga0496109_0347268_997_1377 125
1195 3300048912 Ga0496109_0444060 Ga0496109_0444060_406_783 125
1196 3300048912 Ga0496109_0451919 Ga0496109_0451919_459_842 125
1197 3300048913 Ga0496110_0032770 Ga0496110_0032770_330_713 125
1198 3300048913 Ga0496110_0310814 Ga0496110_0310814_276_653 125
1199 3300048913 Ga0496110_0516261 Ga0496110_0516261_551_928 125
1200 3300048913 Ga0496110_0712834 Ga0496110_0712834_358_735 125
1201 3300048913 Ga0496110_0958406 Ga0496110_0958406_64_441 125
1202 3300048914 Ga0496111_0056586 Ga0496111_0056586_2149_2532 125
1203 3300048914 Ga0496111_0515411 Ga0496111_0515411_445_822 125
1204 3300048914 Ga0496111_0535498 Ga0496111_0535498_460_837 125
1205 3300048914 Ga0496111_1019852 Ga0496111_1019852_32_409 125
1206 3300048915 Ga0496112_0030279 Ga0496112_0030279_1499_1876 125
1207 3300048915 Ga0496112_0038752 Ga0496112_0038752_3295_3678 125
1208 3300048915 Ga0496112_0046698 Ga0496112_0046698_2511_2888 125
1209 3300048915 Ga0496112_0094664 Ga0496112_0094664_2029_2409 125
1210 3300048916 Ga0496113_0011540 Ga0496113_0011540_2396_2779 125
1211 3300048916 Ga0496113_0011673 Ga0496113_0011673_211_588 125
1212 3300048916 Ga0496113_0014734 Ga0496113_0014734_3393_3773 125
1213 3300048916 Ga0496113_0086466 Ga0496113_0086466_1172_1549 125
1214 3300048917 Ga0496114_0029773 Ga0496114_0029773_2935_3312 125
1215 3300048917 Ga0496114_0062704 Ga0496114_0062704_2192_2572 125
1216 3300048917 Ga0496114_0104199 Ga0496114_0104199_1977_2357 125
1217 3300048917 Ga0496114_0267595 Ga0496114_0267595_833_1213 125
1218 3300048917 Ga0496114_0475808 Ga0496114_0475808_86_469 125
1219 3300048918 Ga0496115_0007121 Ga0496115_0007121_5452_5832 125
1220 3300048918 Ga0496115_0030807 Ga0496115_0030807_454_834 125
1221 3300048918 Ga0496115_0179827 Ga0496115_0179827_1319_1696 125
1222 3300048918 Ga0496115_0563570 Ga0496115_0563570_413_793 125
1223 3300048919 Ga0496116_0000035 Ga0496116_0000035_160778_161155 125
1224 3300048919 Ga0496116_0006727 Ga0496116_0006727_5378_5755 125
1225 3300048919 Ga0496116_0162835 Ga0496116_0162835_203_586 125
1226 3300048919 Ga0496116_0478282 Ga0496116_0478282_96_473 125
1227 3300048920 Ga0496117_0000146 Ga0496117_0000146_62358_62735 125
1228 3300048920 Ga0496117_0000633 Ga0496117_0000633_20182_20565 125
1229 3300048920 Ga0496117_0056690 Ga0496117_0056690_1653_2030 125
1230 3300048920 Ga0496117_0104942 Ga0496117_0104942_603_980 125
1231 3300048920 Ga0496117_0198027 Ga0496117_0198027_28_405 125
1232 3300048921 Ga0496118_0000654 Ga0496118_0000654_36054_36437 125
1233 3300048921 Ga0496118_0001846 Ga0496118_0001846_24582_24959 125
1234 3300048921 Ga0496118_0083807 Ga0496118_0083807_1557_1934 125
1235 3300048922 Ga0496119_0000057 Ga0496119_0000057_49929_50306 125
1236 3300048922 Ga0496119_0107924 Ga0496119_0107924_91_468 125
1237 3300048923 Ga0496120_0000686 Ga0496120_0000686_33528_33905 125
1238 3300048924 Ga0496121_0002302 Ga0496121_0002302_1078_1455 125
1239 3300048924 Ga0496121_0004567 Ga0496121_0004567_15494_15871 125
1240 3300048924 Ga0496121_0127343 Ga0496121_0127343_584_961 125
1241 3300048925 Ga0496122_0000723 Ga0496122_0000723_9311_9688 125
1242 3300048925 Ga0496122_0009631 Ga0496122_0009631_1790_2167 125
1243 3300048925 Ga0496122_0115844 Ga0496122_0115844_546_923 125
1244 3300048926 Ga0496123_0003623 Ga0496123_0003623_5240_5617 125
1245 3300048926 Ga0496123_0005637 Ga0496123_0005637_8472_8849 125
1246 3300048926 Ga0496123_0072757 Ga0496123_0072757_246_623 125
1247 3300048927 Ga0496124_0000664 Ga0496124_0000664_36054_36437 125
1248 3300048927 Ga0496124_0005247 Ga0496124_0005247_9360_9737 125
1249 3300048927 Ga0496124_0005829 Ga0496124_0005829_10638_11015 125
1250 3300048927 Ga0496124_0008523 Ga0496124_0008523_4375_4752 125
1251 3300048927 Ga0496124_0299375 Ga0496124_0299375_433_810 125
1252 3300048928 Ga0496125_0003283 Ga0496125_0003283_3655_4032 125
1253 3300048928 Ga0496125_0018829 Ga0496125_0018829_1001_1384 125
1254 3300048928 Ga0496125_0038992 Ga0496125_0038992_475_852 125
1255 3300048928 Ga0496125_0152988 Ga0496125_0152988_525_902 125
1256 3300048928 Ga0496125_0377163 Ga0496125_0377163_247_624 125
1257 3300048929 Ga0496126_0000028 Ga0496126_0000028_68288_68665 125
1258 3300048929 Ga0496126_0000084 Ga0496126_0000084_72902_73279 125
1259 3300048929 Ga0496126_0396529 Ga0496126_0396529_170_547 125
1260 3300049127 Ga0501306_028173 Ga0501306_028173_97_474 125
1261 3300049127 Ga0501306_048947 Ga0501306_048947_81_458 125
1262 3300049127 Ga0501306_051230 Ga0501306_051230_65_442 125
1263 3300049161 Ga0501305_057482 Ga0501305_057482_239_616 125
1264 3300049162 Ga0501307_077067 Ga0501307_077067_78_455 125
1265 3300049528 Ga0501312_074784 Ga0501312_074784_53_430 125
1266 3300049530 Ga0501314_000002 Ga0501314_000002_5749_6132 125
1267 3300049531 Ga0501315_017306 Ga0501315_017306_69_446 125
1268 3300049533 Ga0501317_055003 Ga0501317_055003_34_417 125
1269 3300049539 Ga0501323_031592 Ga0501323_031592_299_676 125
1270 3300049539 Ga0501323_088693 Ga0501323_088693_116_493 125
1271 3300049551 Ga0501335_007167 Ga0501335_007167_214_591 125
1272 3300049551 Ga0501335_014667 Ga0501335_014667_364_741 125
1273 3300049568 Ga0501031_0126555 Ga0501031_0126555_757_1137 125
1274 3300049568 Ga0501031_0241885 Ga0501031_0241885_626_1006 125
1275 3300049568 Ga0501031_0765269 Ga0501031_0765269_104_484 125
1276 3300049569 Ga0501032_0208418 Ga0501032_0208418_226_603 125
1277 3300049569 Ga0501032_0415952 Ga0501032_0415952_186_566 125
1278 3300049570 Ga0501033_0172227 Ga0501033_0172227_1071_1451 125
1279 3300049570 Ga0501033_0270797 Ga0501033_0270797_161_541 125
1280 3300049571 Ga0501034_0025412 Ga0501034_0025412_2157_2540 125
1281 3300049571 Ga0501034_0247035 Ga0501034_0247035_453_830 125
1282 3300049572 Ga0501036_0018306 Ga0501036_0018306_4245_4625 125
1283 3300049572 Ga0501036_0042635 Ga0501036_0042635_2751_3131 125
1284 3300049572 Ga0501036_0165512 Ga0501036_0165512_995_1375 125
1285 3300049572 Ga0501036_0813227 Ga0501036_0813227_322_702 125
1286 3300049573 Ga0501037_0138294 Ga0501037_0138294_472_852 125
1287 3300049573 Ga0501037_0194822 Ga0501037_0194822_588_968 125
1288 3300049573 Ga0501037_0668128 Ga0501037_0668128_212_589 125
1289 3300049573 Ga0501037_0848222 Ga0501037_0848222_128_505 125
1290 3300049574 Ga0501038_0078858 Ga0501038_0078858_209_589 125
1291 3300049574 Ga0501038_0099119 Ga0501038_0099119_1585_1965 125
1292 3300049574 Ga0501038_0460347 Ga0501038_0460347_82_459 125
1293 3300049574 Ga0501038_0708435 Ga0501038_0708435_110_490 125
1294 3300049575 Ga0501039_0099065 Ga0501039_0099065_212_592 125
1295 3300049576 Ga0501040_0092275 Ga0501040_0092275_274_654 125
1296 3300049576 Ga0501040_0099905 Ga0501040_0099905_1470_1850 125
1297 3300049577 Ga0501041_0030131 Ga0501041_0030131_2469_2849 125
1298 3300049577 Ga0501041_0078054 Ga0501041_0078054_1397_1777 125
1299 3300049578 Ga0501042_0049150 Ga0501042_0049150_631_1011 125
1300 3300049579 Ga0501043_0449366 Ga0501043_0449366_210_590 125
1301 3300049579 Ga0501043_0454212 Ga0501043_0454212_113_490 125
1302 3300049580 Ga0501046_0013319 Ga0501046_0013319_345_725 125
1303 3300049580 Ga0501046_0084789 Ga0501046_0084789_1063_1443 125
1304 3300049580 Ga0501046_0661801 Ga0501046_0661801_313_690 125
1305 3300049581 Ga0501047_0343378 Ga0501047_0343378_313_690 125
1306 3300049581 Ga0501047_0960007 Ga0501047_0960007_250_639 125
1307 3300049582 Ga0501048_0229422 Ga0501048_0229422_511_891 125
1308 3300049582 Ga0501048_0253661 Ga0501048_0253661_752_1132 125
1309 3300049582 Ga0501048_0686070 Ga0501048_0686070_328_708 125
1310 3300049582 Ga0501048_1305937 Ga0501048_1305937_128_505 125
1311 3300049583 Ga0501067_0207443 Ga0501067_0207443_64_441 125
1312 3300049584 Ga0501068_0030631 Ga0501068_0030631_129_509 125
1313 3300049584 Ga0501068_0122438 Ga0501068_0122438_71_451 125
1314 3300049584 Ga0501068_0582926 Ga0501068_0582926_220_597 125
1315 3300049585 Ga0501069_0010393 Ga0501069_0010393_818_1195 125
1316 3300049585 Ga0501069_0488905 Ga0501069_0488905_164_544 125
1317 3300049585 Ga0501069_0776948 Ga0501069_0776948_125_502 125
1318 3300049586 Ga0501070_0014243 Ga0501070_0014243_3678_4055 125
1319 3300049586 Ga0501070_0371806 Ga0501070_0371806_247_624 125
1320 3300049586 Ga0501070_0587267 Ga0501070_0587267_166_546 125
1321 3300049586 Ga0501070_0911750 Ga0501070_0911750_129_509 125
1322 3300049587 Ga0501071_0017063 Ga0501071_0017063_2338_2718 125
1323 3300049587 Ga0501071_0330706 Ga0501071_0330706_637_1014 125
1324 3300049588 Ga0501072_0242569 Ga0501072_0242569_906_1286 125
1325 3300049588 Ga0501072_0245070 Ga0501072_0245070_998_1378 125
1326 3300049588 Ga0501072_0900024 Ga0501072_0900024_55_435 125
1327 3300049590 Ga0501074_0110230 Ga0501074_0110230_23_403 125
1328 3300049591 Ga0501075_0013808 Ga0501075_0013808_5223_5603 125
1329 3300049591 Ga0501075_0224856 Ga0501075_0224856_345_725 125
1330 3300049592 Ga0501076_0000421 Ga0501076_0000421_18582_18962 125
1331 3300049592 Ga0501076_0094632 Ga0501076_0094632_156_536 125
1332 3300049592 Ga0501076_0733278 Ga0501076_0733278_198_575 125
1333 3300049592 Ga0501076_0965506 Ga0501076_0965506_254_634 125
1334 3300049593 Ga0501077_0022721 Ga0501077_0022721_880_1260 125
1335 3300049593 Ga0501077_0067033 Ga0501077_0067033_1762_2142 125
1336 3300049663 Ga0501223_000394 Ga0501223_000394_5471_5854 125
1337 3300049664 Ga0501224_000009 Ga0501224_000009_5474_5857 125
1338 3300049668 Ga0501233_000604 Ga0501233_000604_2016_2399 125
1339 3300049669 Ga0501235_004379 Ga0501235_004379_1013_1396 125
1340 3300049672 Ga0501239_007192 Ga0501239_007192_148_525 125
1341 3300049682 Ga0501252_066287 Ga0501252_066287_52_429 125
1342 3300049686 Ga0501257_074213 Ga0501257_074213_288_665 125
1343 3300049688 Ga0501259_155413 Ga0501259_155413_17_394 125
1344 3300049705 Ga0501225_0000094 Ga0501225_0000094_21288_21671 125
1345 3300049741 Ga0501079_0013561 Ga0501079_0013561_5703_6083 125
1346 3300049741 Ga0501079_0166268 Ga0501079_0166268_1164_1544 125
1347 3300049741 Ga0501079_0439844 Ga0501079_0439844_273_653 125
1348 3300049741 Ga0501079_1267185 Ga0501079_1267185_97_477 125
1349 3300049742 Ga0501080_0306890 Ga0501080_0306890_1001_1381 125
1350 3300049743 Ga0501081_0063944 Ga0501081_0063944_1478_1858 125
1351 3300049743 Ga0501081_0207993 Ga0501081_0207993_614_994 125
1352 3300049744 Ga0501083_0122165 Ga0501083_0122165_1260_1640 125
1353 3300049765 Ga0501268_060531 Ga0501268_060531_228_605 125
1354 3300049767 Ga0501270_042241 Ga0501270_042241_57_434 125
1355 3300049822 Ga0501035_0331354 Ga0501035_0331354_137_517 125
1356 3300049823 Ga0501044_0791978 Ga0501044_0791978_153_533 125
1357 3300049823 Ga0501044_0937891 Ga0501044_0937891_172_552 125
1358 3300049824 Ga0501045_0139388 Ga0501045_0139388_844_1224 125
1359 3300049824 Ga0501045_0323542 Ga0501045_0323542_683_1063 125
1360 3300049824 Ga0501045_0873588 Ga0501045_0873588_143_520 125
1361 3300049853 Ga0501226_000076 Ga0501226_000076_24403_24786 125
1362 3300050489 nmdc:mga03683_31_c1 nmdc:mga03683_31_c1_19355_19732 125
1363 3300050490 nmdc:mga03n38_4566_c1 nmdc:mga03n38_4566_c1_4080_4457 125
1364 3300050491 nmdc:mga00v17_110640_c1 nmdc:mga00v17_110640_c1_442_819 125
1365 3300050493 nmdc:mga0k408_125335_c2 nmdc:mga0k408_125335_c2_220_597 125
1366 3300050493 nmdc:mga0k408_538_c1 nmdc:mga0k408_538_c1_1104_1481 125
1367 3300050494 nmdc:mga06z11_260048_c1 nmdc:mga06z11_260048_c1_186_563 125
1368 3300050496 nmdc:mga07m45_19_c1 nmdc:mga07m45_19_c1_19449_19826 125
1369 3300050507 nmdc:mga05p37_49513_c1 nmdc:mga05p37_49513_c1_2721_3101 125
1370 3300050510 nmdc:mga06r32_274856_c1 nmdc:mga06r32_274856_c1_358_738 125
1371 3300050511 nmdc:mga08y16_343991_c1 nmdc:mga08y16_343991_c1_942_1319 125
1372 3300050511 nmdc:mga08y16_531895_c1 nmdc:mga08y16_531895_c1_49_429 125
1373 3300050512 nmdc:mga0n895_2125338_c1 nmdc:mga0n895_2125338_c1_83_460 125
1374 3300053087 Ga0500643_013492 Ga0500643_013492_149_526 125
1375 3300053096 Ga0500641_0426902 Ga0500641_0426902_60_437 125
1376 3300053146 Ga0500588_0155506 Ga0500588_0155506_337_714 125
1377 3300053153 Ga0500616_0047381 Ga0500616_0047381_1227_1604 125
1378 3300053157 Ga0500624_000023 Ga0500624_000023_9427_9810 125
1379 3300053178 Ga0500637_0000611 Ga0500637_0000611_4330_4713 125
1380 3300054114 Ga0501084_0010490 Ga0501084_0010490_1600_1980 125
1381 3300054114 Ga0501084_0161123 Ga0501084_0161123_134_514 125
1382 3300054114 Ga0501084_1325812 Ga0501084_1325812_99_479 125
1383 3300059424 Ga0590075_187193 Ga0590075_187193_63_440 125
1384 3300059493 Ga0587077_059136 Ga0587077_059136_319_696 125
1385 3300059493 Ga0587077_131644 Ga0587077_131644_16_393 125
1386 3300059630 Ga0587128_135039 Ga0587128_135039_95_472 125
1387 3300059641 Ga0587068_017978 Ga0587068_017978_373_753 125
1388 3300060344 Ga0587071_036914 Ga0587071_036914_278_658 125
1389 3300060344 Ga0587071_123092 Ga0587071_123092_204_581 125
1390 3300060353 Ga0501082_0015085 Ga0501082_0015085_579_959 125
1391 3300060353 Ga0501082_0173837 Ga0501082_0173837_233_613 125
1392 3300060353 Ga0501082_0282211 Ga0501082_0282211_824_1204 125
1393 3300060353 Ga0501082_1793504 Ga0501082_1793504_79_459 125
1394 3300061734 Ga0530510_0006306 Ga0530510_0006306_5493_5873 125
1395 3300061734 Ga0530510_0041695 Ga0530510_0041695_432_812 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00237

Ribosomal_L22

Ribosomal protein L22p/L17e

15

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9333 14 119
8c95-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9236 14 122
8c9a-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9234 15 119
6pvk-assembly1.cif.gz_S bacterial 45srbga ribosomal particle class a 0.9176 15 122
8c94-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9087 14 119
ID Description Score Start End Superfamily
5mmiT00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8717 14 122 3.90.470.10
4g5uS00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8694 14 125 3.90.470.10
af_O74464_102_233_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8693 13 121 3.90.470.10
af_I1K1P2_86_208_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8675 14 125 3.90.470.10
af_P56795_7_145_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8668 9 121 3.90.470.10
ID Description Score Start End GO Terms
AF-A0A2N6AF95-F1-model_v4 Large ribosomal subunit protein uL22 0.9006 7 125 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A3R8A008-F1-model_v4 Large ribosomal subunit protein uL22 0.8941 13 124 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1I5NCQ9-F1-model_v4 50S ribosomal protein L22 0.8917 1 123 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1Y1HXX3-F1-model_v4 Large ribosomal subunit protein uL22c 0.8884 12 124 GO:0003735
GO:0005762
GO:0006412
AF-A0A424KJ66-F1-model_v4 Large ribosomal subunit protein uL22 0.8863 13 125 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
91.16 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map