F493623
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1395 | 503 | 1364 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0214876|Ga0495686_0214876_110_484 |
| Length | 124 |
| Sequence | MPAKNDAPALPGSRAVAKHVRISPSKARRVVNLVRGLPAKEALTVLQFAPQSASEQVYKVLASAIANAENNHNLDIDALVVAEASVGKSFTMKRFHARGRGKSTQILKPFSRVRIVVREQTEEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 6 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 7 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 8 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 9 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 10 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 11 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 12 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 13 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 14 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 15 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 16 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 17 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 18 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 19 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 20 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 21 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 22 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 23 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 24 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 25 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 26 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 27 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 28 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 29 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 30 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 31 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 32 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 33 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 34 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 35 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 36 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 37 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 38 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 39 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 40 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 41 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 42 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 43 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 44 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 45 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 46 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 47 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 50 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 60 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 111 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 112 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 113 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 127 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 128 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 129 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 134 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 139 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 140 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 159 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 160 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 161 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 162 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 163 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 175 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 182 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 270 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 271 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 272 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 273 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 274 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 275 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 279 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 280 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 281 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 282 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 283 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 284 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 285 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 286 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 287 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 288 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 290 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 298 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 306 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 307 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 308 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 309 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 310 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 311 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 313 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 320 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 321 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 322 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 323 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 324 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 325 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 326 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 327 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 328 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 329 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 330 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 331 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 332 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 333 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 334 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 335 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 336 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 337 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 338 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 339 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 340 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 341 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 342 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 343 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 344 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 345 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 346 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 347 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 348 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 349 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 350 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 351 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 352 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 353 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 354 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 355 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 356 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 357 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 386 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 387 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 388 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 389 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 390 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 391 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 394 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 395 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 396 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 397 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 398 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 399 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 400 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 401 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 402 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 403 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 404 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 405 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 406 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 407 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 408 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 409 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 410 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 446 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 447 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 448 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 449 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 450 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 451 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 452 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 458 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 463 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 467 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 468 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 478 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 479 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 480 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 481 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 482 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 483 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 485 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 503 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 3.01 |
| Isolates | 2.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 5.45 |
| Nodule | 0 |
| Rhizoplane | 6.81 |
| Rhizosphere | 81.79 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 5.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1902450 | 2162886007 | Bacteria | 4174 |
| 2 | SwRhRL2b_contig_219213 | 2162886007 | Bacteria | 2451 |
| 3 | SwRhRL2b_contig_90406 | 2162886007 | Bacteria | 2673 |
| 4 | ARcpr5yngRDRAFT_c009192 | 3300000043 | Bacteria | 847 |
| 5 | ARCol0yngRDRAFT_1010664 | 3300000652 | Bacteria | 671 |
| 6 | JGI24736J21556_1000017 | 3300001904 | Bacteria | 28475 |
| 7 | JGI24741J21665_1001831 | 3300001915 | Bacteria | 5816 |
| 8 | JGI24741J21665_1004669 | 3300001915 | Bacteria | 2991 |
| 9 | JGI24740J21852_10023038 | 3300001979 | Bacteria | 2133 |
| 10 | JGI24740J21852_10073730 | 3300001979 | Bacteria | 908 |
| 11 | JGI24740J21852_10098157 | 3300001979 | Bacteria | 748 |
| 12 | JGI24739J22299_10070471 | 3300001989 | Bacteria | 1088 |
| 13 | JGI24739J22299_10119248 | 3300001989 | Bacteria | 789 |
| 14 | JGI24737J22298_10010075 | 3300001990 | Bacteria | 3131 |
| 15 | JGI24737J22298_10022076 | 3300001990 | Bacteria | 2022 |
| 16 | JGI24737J22298_10076884 | 3300001990 | Bacteria | 995 |
| 17 | JGI24737J22298_10197514 | 3300001990 | Bacteria | 594 |
| 18 | JGI24735J21928_10001020 | 3300002067 | Bacteria | 10011 |
| 19 | JGI24735J21928_10003396 | 3300002067 | Bacteria | 5432 |
| 20 | JGI24735J21928_10052944 | 3300002067 | Bacteria | 1170 |
| 21 | JGI24735J21928_10083171 | 3300002067 | Bacteria | 917 |
| 22 | JGI24748J21848_1022174 | 3300002074 | Bacteria | 768 |
| 23 | JGI24738J21930_10002167 | 3300002075 | Bacteria | 5226 |
| 24 | JGI24738J21930_10015293 | 3300002075 | Bacteria | 1635 |
| 25 | JGI24738J21930_10055219 | 3300002075 | Bacteria | 812 |
| 26 | JGI24749J21850_1001152 | 3300002076 | Bacteria | 3752 |
| 27 | JGI24033J26618_1006238 | 3300002155 | Bacteria | 1333 |
| 28 | JGI24033J26618_1032954 | 3300002155 | Bacteria | 702 |
| 29 | JGI24034J26672_10001857 | 3300002239 | Bacteria | 2848 |
| 30 | JGI24034J26672_10004339 | 3300002239 | Bacteria | 2006 |
| 31 | JGI24034J26672_10014590 | 3300002239 | Bacteria | 1199 |
| 32 | JGI24034J26672_10030081 | 3300002239 | Bacteria | 881 |
| 33 | JGI24034J26672_10051630 | 3300002239 | Bacteria | 708 |
| 34 | JGI24751J29686_10000133 | 3300002459 | Bacteria | 37734 |
| 35 | JGI24751J29686_10000325 | 3300002459 | Bacteria | 17611 |
| 36 | JGI24751J29686_10109440 | 3300002459 | Bacteria | 578 |
| 37 | JGI25152J39213_1019543 | 3300002773 | Bacteria | 1230 |
| 38 | JGI25150J39212_1000365 | 3300002774 | Bacteria | 21872 |
| 39 | JGI25151J46595_10034781 | 3300003187 | Bacteria | 1922 |
| 40 | JGI26145J50221_1019280 | 3300003371 | Bacteria | 651 |
| 41 | Ga0055526_1001689 | 3300003771 | Bacteria | 15428 |
| 42 | Ga0055524_1041467 | 3300003775 | Bacteria | 1159 |
| 43 | Ga0055536_1004136 | 3300003781 | Bacteria | 7522 |
| 44 | Ga0055536_1012782 | 3300003781 | Bacteria | 3083 |
| 45 | Ga0055536_1040482 | 3300003781 | Bacteria | 1108 |
| 46 | Ga0055530_10004523 | 3300003791 | Bacteria | 7112 |
| 47 | Ga0055530_10006129 | 3300003791 | Bacteria | 5463 |
| 48 | Ga0055530_10053671 | 3300003791 | Bacteria | 925 |
| 49 | Ga0055540_1000723 | 3300003792 | Bacteria | 22522 |
| 50 | Ga0055540_1050858 | 3300003792 | Bacteria | 856 |
| 51 | Ga0055531_10011237 | 3300003794 | Bacteria | 4347 |
| 52 | Ga0055531_10018292 | 3300003794 | Bacteria | 2900 |
| 53 | Ga0065165_1007044 | 3300005262 | Bacteria | 5660 |
| 54 | Ga0065714_10439110 | 3300005288 | Bacteria | 528 |
| 55 | Ga0065704_10070214 | 3300005289 | Bacteria | 70706 |
| 56 | Ga0065704_10070777 | 3300005289 | Bacteria | 16263 |
| 57 | Ga0065704_10101429 | 3300005289 | Bacteria | 2238 |
| 58 | Ga0065704_10335587 | 3300005289 | Bacteria | 831 |
| 59 | Ga0065712_10044945 | 3300005290 | Bacteria | 836 |
| 60 | Ga0065712_10154061 | 3300005290 | Bacteria | 1348 |
| 61 | Ga0065707_10007537 | 3300005295 | Bacteria | 4124 |
| 62 | Ga0065707_10051097 | 3300005295 | Bacteria | 684 |
| 63 | Ga0065707_10374061 | 3300005295 | Bacteria | 886 |
| 64 | Ga0065707_10492149 | 3300005295 | Bacteria | 764 |
| 65 | Ga0070658_10104595 | 3300005327 | Bacteria | 2342 |
| 66 | Ga0070658_10217697 | 3300005327 | Bacteria | 1614 |
| 67 | Ga0070658_10855387 | 3300005327 | Bacteria | 790 |
| 68 | Ga0070658_11285588 | 3300005327 | Bacteria | 635 |
| 69 | Ga0070676_10010202 | 3300005328 | Bacteria | 5093 |
| 70 | Ga0070676_10114853 | 3300005328 | Bacteria | 1681 |
| 71 | Ga0070676_10396009 | 3300005328 | Bacteria | 960 |
| 72 | Ga0070676_10618497 | 3300005328 | Bacteria | 783 |
| 73 | Ga0070676_10852711 | 3300005328 | Bacteria | 675 |
| 74 | Ga0070683_100888866 | 3300005329 | Bacteria | 854 |
| 75 | Ga0070690_100018053 | 3300005330 | Bacteria | 4254 |
| 76 | Ga0070670_100024275 | 3300005331 | Bacteria | 5215 |
| 77 | Ga0070670_100044177 | 3300005331 | Bacteria | 3831 |
| 78 | Ga0070670_100047139 | 3300005331 | Bacteria | 3707 |
| 79 | Ga0070670_100065360 | 3300005331 | Bacteria | 3121 |
| 80 | Ga0070670_100100471 | 3300005331 | Bacteria | 2490 |
| 81 | Ga0070670_100148526 | 3300005331 | Bacteria | 2028 |
| 82 | Ga0070670_100240682 | 3300005331 | Bacteria | 1575 |
| 83 | Ga0070670_100548160 | 3300005331 | Bacteria | 1031 |
| 84 | Ga0070670_100628039 | 3300005331 | Bacteria | 962 |
| 85 | Ga0070670_100738370 | 3300005331 | Bacteria | 887 |
| 86 | Ga0070670_101368932 | 3300005331 | Bacteria | 648 |
| 87 | Ga0070677_10018552 | 3300005333 | Bacteria | 2506 |
| 88 | Ga0070677_10365215 | 3300005333 | Bacteria | 751 |
| 89 | Ga0068869_100349580 | 3300005334 | Bacteria | 1205 |
| 90 | Ga0068869_100922701 | 3300005334 | Bacteria | 757 |
| 91 | Ga0070666_10007165 | 3300005335 | Bacteria | 6873 |
| 92 | Ga0070666_10054950 | 3300005335 | Bacteria | 2687 |
| 93 | Ga0070666_10179942 | 3300005335 | Bacteria | 1483 |
| 94 | Ga0070666_10271508 | 3300005335 | Bacteria | 1204 |
| 95 | Ga0070666_10525631 | 3300005335 | Bacteria | 859 |
| 96 | Ga0070666_10890077 | 3300005335 | Bacteria | 658 |
| 97 | Ga0070666_11149184 | 3300005335 | Bacteria | 578 |
| 98 | Ga0070666_11161595 | 3300005335 | Bacteria | 575 |
| 99 | Ga0070680_100162100 | 3300005336 | Bacteria | 1879 |
| 100 | Ga0070680_100413449 | 3300005336 | Bacteria | 1150 |
| 101 | Ga0070682_100167589 | 3300005337 | Bacteria | 1523 |
| 102 | Ga0068868_100569237 | 3300005338 | Bacteria | 1000 |
| 103 | Ga0068868_101966217 | 3300005338 | Bacteria | 555 |
| 104 | Ga0070660_100018108 | 3300005339 | Bacteria | 5140 |
| 105 | Ga0070660_100095636 | 3300005339 | Bacteria | 2348 |
| 106 | Ga0070660_100676942 | 3300005339 | Bacteria | 864 |
| 107 | Ga0070660_101411668 | 3300005339 | Bacteria | 591 |
| 108 | Ga0070660_101834420 | 3300005339 | Bacteria | 517 |
| 109 | Ga0070689_100665543 | 3300005340 | Bacteria | 907 |
| 110 | Ga0070689_100764544 | 3300005340 | Bacteria | 848 |
| 111 | Ga0070689_101589165 | 3300005340 | Bacteria | 594 |
| 112 | Ga0070691_10023128 | 3300005341 | Bacteria | 2885 |
| 113 | Ga0070691_10093826 | 3300005341 | Bacteria | 1483 |
| 114 | Ga0070661_100241777 | 3300005344 | Bacteria | 1390 |
| 115 | Ga0070661_100577775 | 3300005344 | Bacteria | 907 |
| 116 | Ga0070661_100614891 | 3300005344 | Bacteria | 879 |
| 117 | Ga0070661_101625825 | 3300005344 | Bacteria | 546 |
| 118 | Ga0070692_10354552 | 3300005345 | Bacteria | 913 |
| 119 | Ga0070692_11190734 | 3300005345 | Bacteria | 542 |
| 120 | Ga0070668_100017451 | 3300005347 | Bacteria | 5380 |
| 121 | Ga0070668_100396570 | 3300005347 | Bacteria | 1177 |
| 122 | Ga0070668_100478984 | 3300005347 | Bacteria | 1074 |
| 123 | Ga0070668_101335208 | 3300005347 | Bacteria | 652 |
| 124 | Ga0070668_101983076 | 3300005347 | Bacteria | 537 |
| 125 | Ga0070668_102028746 | 3300005347 | Bacteria | 531 |
| 126 | Ga0070669_100004937 | 3300005353 | Bacteria | 9634 |
| 127 | Ga0070669_100005654 | 3300005353 | Bacteria | 9030 |
| 128 | Ga0070669_100014400 | 3300005353 | Bacteria | 5629 |
| 129 | Ga0070669_100033975 | 3300005353 | Bacteria | 3691 |
| 130 | Ga0070669_100264859 | 3300005353 | Bacteria | 1373 |
| 131 | Ga0070669_100334722 | 3300005353 | Bacteria | 1225 |
| 132 | Ga0070669_100380842 | 3300005353 | Bacteria | 1150 |
| 133 | Ga0070669_100492436 | 3300005353 | Bacteria | 1016 |
| 134 | Ga0070669_100527333 | 3300005353 | Bacteria | 982 |
| 135 | Ga0070669_100557818 | 3300005353 | Bacteria | 956 |
| 136 | Ga0070675_100021317 | 3300005354 | Bacteria | 5177 |
| 137 | Ga0070675_100282639 | 3300005354 | Bacteria | 1458 |
| 138 | Ga0070675_100660469 | 3300005354 | Bacteria | 950 |
| 139 | Ga0070675_101392207 | 3300005354 | Bacteria | 647 |
| 140 | Ga0070675_101761456 | 3300005354 | Bacteria | 571 |
| 141 | Ga0070675_101826824 | 3300005354 | Bacteria | 561 |
| 142 | Ga0070671_100001718 | 3300005355 | Bacteria | 16629 |
| 143 | Ga0070671_100052885 | 3300005355 | Bacteria | 3376 |
| 144 | Ga0070671_100071036 | 3300005355 | Bacteria | 2905 |
| 145 | Ga0070671_100075094 | 3300005355 | Bacteria | 2823 |
| 146 | Ga0070671_100149996 | 3300005355 | Bacteria | 1968 |
| 147 | Ga0070671_100230557 | 3300005355 | Bacteria | 1571 |
| 148 | Ga0070671_100243374 | 3300005355 | Bacteria | 1527 |
| 149 | Ga0070671_101271800 | 3300005355 | Bacteria | 648 |
| 150 | Ga0070671_102056963 | 3300005355 | Bacteria | 509 |
| 151 | Ga0070674_100065137 | 3300005356 | Bacteria | 2556 |
| 152 | Ga0070674_100101471 | 3300005356 | Bacteria | 2097 |
| 153 | Ga0070674_101294936 | 3300005356 | Bacteria | 650 |
| 154 | Ga0070674_101384186 | 3300005356 | Bacteria | 629 |
| 155 | Ga0070673_100034662 | 3300005364 | Bacteria | 3821 |
| 156 | Ga0070673_101239019 | 3300005364 | Bacteria | 700 |
| 157 | Ga0070688_100364027 | 3300005365 | Bacteria | 1062 |
| 158 | Ga0070659_100052713 | 3300005366 | Bacteria | 3200 |
| 159 | Ga0070659_100180084 | 3300005366 | Bacteria | 1734 |
| 160 | Ga0070659_100310110 | 3300005366 | Bacteria | 1317 |
| 161 | Ga0070659_100368816 | 3300005366 | Bacteria | 1207 |
| 162 | Ga0070659_100902102 | 3300005366 | Bacteria | 772 |
| 163 | Ga0070659_101601104 | 3300005366 | Bacteria | 581 |
| 164 | Ga0070667_100000088 | 3300005367 | Bacteria | 113956 |
| 165 | Ga0070667_100001059 | 3300005367 | Bacteria | 25137 |
| 166 | Ga0070667_100141917 | 3300005367 | Bacteria | 2104 |
| 167 | Ga0070667_100508657 | 3300005367 | Bacteria | 1104 |
| 168 | Ga0070667_100692723 | 3300005367 | Bacteria | 942 |
| 169 | Ga0070714_100056706 | 3300005435 | Bacteria | 3351 |
| 170 | Ga0070714_100446850 | 3300005435 | Bacteria | 1227 |
| 171 | Ga0070713_100050613 | 3300005436 | Bacteria | 3432 |
| 172 | Ga0070701_10543196 | 3300005438 | Bacteria | 761 |
| 173 | Ga0070705_100529297 | 3300005440 | Bacteria | 900 |
| 174 | Ga0070700_100044432 | 3300005441 | Bacteria | 2736 |
| 175 | Ga0070700_100904716 | 3300005441 | Bacteria | 719 |
| 176 | Ga0070694_100564632 | 3300005444 | Bacteria | 913 |
| 177 | Ga0070663_100082480 | 3300005455 | Bacteria | 2365 |
| 178 | Ga0070663_100155543 | 3300005455 | Bacteria | 1756 |
| 179 | Ga0070663_100388956 | 3300005455 | Bacteria | 1137 |
| 180 | Ga0070663_100439922 | 3300005455 | Bacteria | 1073 |
| 181 | Ga0070663_100738153 | 3300005455 | Bacteria | 840 |
| 182 | Ga0070663_100820918 | 3300005455 | Bacteria | 798 |
| 183 | Ga0070663_101654665 | 3300005455 | Bacteria | 572 |
| 184 | Ga0070678_100020582 | 3300005456 | Bacteria | 4331 |
| 185 | Ga0070678_100204291 | 3300005456 | Bacteria | 1633 |
| 186 | Ga0070678_100228696 | 3300005456 | Bacteria | 1549 |
| 187 | Ga0070678_100446078 | 3300005456 | Bacteria | 1133 |
| 188 | Ga0070678_100926518 | 3300005456 | Bacteria | 798 |
| 189 | Ga0070678_101187273 | 3300005456 | Bacteria | 707 |
| 190 | Ga0070662_100249078 | 3300005457 | Bacteria | 1427 |
| 191 | Ga0070662_100329829 | 3300005457 | Bacteria | 1246 |
| 192 | Ga0070662_100343467 | 3300005457 | Bacteria | 1222 |
| 193 | Ga0070662_100834265 | 3300005457 | Bacteria | 784 |
| 194 | Ga0070662_101608754 | 3300005457 | Bacteria | 561 |
| 195 | Ga0070662_101683119 | 3300005457 | Bacteria | 548 |
| 196 | Ga0070662_101745263 | 3300005457 | Bacteria | 538 |
| 197 | Ga0070681_10842690 | 3300005458 | Bacteria | 834 |
| 198 | Ga0070681_11187871 | 3300005458 | Bacteria | 685 |
| 199 | Ga0070681_11666624 | 3300005458 | Bacteria | 564 |
| 200 | Ga0068867_100167090 | 3300005459 | Bacteria | 1739 |
| 201 | Ga0068867_100239469 | 3300005459 | Bacteria | 1471 |
| 202 | Ga0068867_100339305 | 3300005459 | Bacteria | 1250 |
| 203 | Ga0068867_100608690 | 3300005459 | Bacteria | 954 |
| 204 | Ga0068867_100858773 | 3300005459 | Bacteria | 814 |
| 205 | Ga0070699_101902222 | 3300005518 | Bacteria | 544 |
| 206 | Ga0070679_101027471 | 3300005530 | Bacteria | 768 |
| 207 | Ga0070679_102141505 | 3300005530 | Bacteria | 509 |
| 208 | Ga0070684_100038268 | 3300005535 | Bacteria | 4119 |
| 209 | Ga0070697_100271153 | 3300005536 | Bacteria | 1455 |
| 210 | Ga0068853_100100537 | 3300005539 | Bacteria | 2556 |
| 211 | Ga0068853_100134014 | 3300005539 | Bacteria | 2219 |
| 212 | Ga0068853_100413468 | 3300005539 | Bacteria | 1264 |
| 213 | Ga0068853_100965538 | 3300005539 | Bacteria | 820 |
| 214 | Ga0068853_101107283 | 3300005539 | Bacteria | 764 |
| 215 | Ga0068853_101923504 | 3300005539 | Bacteria | 573 |
| 216 | Ga0070672_100034217 | 3300005543 | Bacteria | 3855 |
| 217 | Ga0070672_100627533 | 3300005543 | Bacteria | 937 |
| 218 | Ga0070672_100817407 | 3300005543 | Bacteria | 821 |
| 219 | Ga0070672_100841589 | 3300005543 | Bacteria | 808 |
| 220 | Ga0070672_101407993 | 3300005543 | Bacteria | 624 |
| 221 | Ga0070672_102153785 | 3300005543 | Bacteria | 503 |
| 222 | Ga0070686_100162697 | 3300005544 | Bacteria | 1573 |
| 223 | Ga0070686_100312950 | 3300005544 | Bacteria | 1168 |
| 224 | Ga0070696_100274635 | 3300005546 | Bacteria | 1283 |
| 225 | Ga0070693_100090075 | 3300005547 | Bacteria | 1847 |
| 226 | Ga0070693_100280396 | 3300005547 | Bacteria | 1116 |
| 227 | Ga0070693_101054800 | 3300005547 | Bacteria | 618 |
| 228 | Ga0070665_100017754 | 3300005548 | Bacteria | 7145 |
| 229 | Ga0070665_100043393 | 3300005548 | Bacteria | 4519 |
| 230 | Ga0070665_100080805 | 3300005548 | Bacteria | 3256 |
| 231 | Ga0070665_100107634 | 3300005548 | Bacteria | 2790 |
| 232 | Ga0070665_101362015 | 3300005548 | Bacteria | 719 |
| 233 | Ga0070665_101775586 | 3300005548 | Bacteria | 623 |
| 234 | Ga0070704_100284431 | 3300005549 | Bacteria | 1371 |
| 235 | Ga0070704_101993804 | 3300005549 | Bacteria | 539 |
| 236 | Ga0068855_100042514 | 3300005563 | Bacteria | 5384 |
| 237 | Ga0068855_100080645 | 3300005563 | Bacteria | 3773 |
| 238 | Ga0068855_100269053 | 3300005563 | Bacteria | 1895 |
| 239 | Ga0068855_100820305 | 3300005563 | Bacteria | 987 |
| 240 | Ga0068855_100932750 | 3300005563 | Bacteria | 915 |
| 241 | Ga0068855_100998628 | 3300005563 | Bacteria | 879 |
| 242 | Ga0070664_100036985 | 3300005564 | Bacteria | 4103 |
| 243 | Ga0070664_100070110 | 3300005564 | Bacteria | 3001 |
| 244 | Ga0070664_100253451 | 3300005564 | Bacteria | 1582 |
| 245 | Ga0070664_100464231 | 3300005564 | Bacteria | 1164 |
| 246 | Ga0070664_100976480 | 3300005564 | Bacteria | 796 |
| 247 | Ga0070664_101382016 | 3300005564 | Bacteria | 665 |
| 248 | Ga0070664_101968684 | 3300005564 | Bacteria | 554 |
| 249 | Ga0070664_102158471 | 3300005564 | Bacteria | 528 |
| 250 | Ga0068857_100026049 | 3300005577 | Bacteria | 5151 |
| 251 | Ga0068857_100359493 | 3300005577 | Bacteria | 1349 |
| 252 | Ga0068857_100764880 | 3300005577 | Bacteria | 921 |
| 253 | Ga0068857_101288741 | 3300005577 | Bacteria | 709 |
| 254 | Ga0068857_101691162 | 3300005577 | Bacteria | 618 |
| 255 | Ga0068854_100097571 | 3300005578 | Bacteria | 2197 |
| 256 | Ga0068854_100175422 | 3300005578 | Bacteria | 1671 |
| 257 | Ga0068854_101151278 | 3300005578 | Bacteria | 693 |
| 258 | Ga0068854_102143988 | 3300005578 | Bacteria | 516 |
| 259 | Ga0068856_100058104 | 3300005614 | Bacteria | 3820 |
| 260 | Ga0068856_100364986 | 3300005614 | Bacteria | 1463 |
| 261 | Ga0068856_101251499 | 3300005614 | Bacteria | 758 |
| 262 | Ga0070702_100090393 | 3300005615 | Bacteria | 1856 |
| 263 | Ga0070702_100379736 | 3300005615 | Bacteria | 1004 |
| 264 | Ga0068852_100343494 | 3300005616 | Bacteria | 1455 |
| 265 | Ga0068852_100448060 | 3300005616 | Bacteria | 1277 |
| 266 | Ga0068852_101538415 | 3300005616 | Bacteria | 688 |
| 267 | Ga0068852_101918233 | 3300005616 | Bacteria | 614 |
| 268 | Ga0068852_102079416 | 3300005616 | Bacteria | 590 |
| 269 | Ga0068859_100006387 | 3300005617 | Bacteria | 11959 |
| 270 | Ga0068859_100030651 | 3300005617 | Bacteria | 5398 |
| 271 | Ga0068859_100323648 | 3300005617 | Bacteria | 1636 |
| 272 | Ga0068859_100440837 | 3300005617 | Bacteria | 1399 |
| 273 | Ga0068859_101116349 | 3300005617 | Bacteria | 867 |
| 274 | Ga0068859_101612409 | 3300005617 | Bacteria | 717 |
| 275 | Ga0068859_101774425 | 3300005617 | Bacteria | 681 |
| 276 | Ga0068864_100014199 | 3300005618 | Bacteria | 6612 |
| 277 | Ga0068864_100081298 | 3300005618 | Bacteria | 2840 |
| 278 | Ga0068864_100599726 | 3300005618 | Bacteria | 1069 |
| 279 | Ga0068864_100649123 | 3300005618 | Bacteria | 1027 |
| 280 | Ga0068864_100832313 | 3300005618 | Bacteria | 909 |
| 281 | Ga0068864_101664716 | 3300005618 | Bacteria | 642 |
| 282 | Ga0068866_10028552 | 3300005718 | Bacteria | 2660 |
| 283 | Ga0068866_11315034 | 3300005718 | Bacteria | 526 |
| 284 | Ga0068861_100002700 | 3300005719 | Bacteria | 11613 |
| 285 | Ga0068861_100039077 | 3300005719 | Bacteria | 3540 |
| 286 | Ga0068861_100134622 | 3300005719 | Bacteria | 2009 |
| 287 | Ga0068861_101079403 | 3300005719 | Bacteria | 770 |
| 288 | Ga0068861_101285918 | 3300005719 | Bacteria | 711 |
| 289 | Ga0068851_10039033 | 3300005834 | Bacteria | 2384 |
| 290 | Ga0068851_10109610 | 3300005834 | Bacteria | 1473 |
| 291 | Ga0068870_10196609 | 3300005840 | Bacteria | 1220 |
| 292 | Ga0068870_10230894 | 3300005840 | Bacteria | 1138 |
| 293 | Ga0068870_10594405 | 3300005840 | Bacteria | 751 |
| 294 | Ga0068870_10676704 | 3300005840 | Bacteria | 709 |
| 295 | Ga0068863_100007187 | 3300005841 | Bacteria | 10925 |
| 296 | Ga0068863_100008669 | 3300005841 | Bacteria | 9938 |
| 297 | Ga0068863_100080807 | 3300005841 | Bacteria | 3079 |
| 298 | Ga0068863_100388526 | 3300005841 | Bacteria | 1363 |
| 299 | Ga0068863_101323670 | 3300005841 | Bacteria | 727 |
| 300 | Ga0068858_100141594 | 3300005842 | Bacteria | 2258 |
| 301 | Ga0068858_100305438 | 3300005842 | Bacteria | 1518 |
| 302 | Ga0068858_101424513 | 3300005842 | Bacteria | 683 |
| 303 | Ga0068860_100000220 | 3300005843 | Bacteria | 89460 |
| 304 | Ga0068860_100009418 | 3300005843 | Bacteria | 9706 |
| 305 | Ga0068860_100290484 | 3300005843 | Bacteria | 1600 |
| 306 | Ga0068860_100365743 | 3300005843 | Bacteria | 1422 |
| 307 | Ga0068860_100683453 | 3300005843 | Bacteria | 1035 |
| 308 | Ga0068862_100000126 | 3300005844 | Bacteria | 89210 |
| 309 | Ga0068862_100002931 | 3300005844 | Bacteria | 14924 |
| 310 | Ga0068862_100136266 | 3300005844 | Bacteria | 2175 |
| 311 | Ga0068862_100188127 | 3300005844 | Bacteria | 1856 |
| 312 | Ga0068862_100355311 | 3300005844 | Bacteria | 1360 |
| 313 | Ga0068862_100383926 | 3300005844 | Bacteria | 1311 |
| 314 | Ga0068862_100849430 | 3300005844 | Bacteria | 895 |
| 315 | Ga0068862_101527106 | 3300005844 | Bacteria | 674 |
| 316 | Ga0070717_10009669 | 3300006028 | Bacteria | 7259 |
| 317 | Ga0075365_11071766 | 3300006038 | Bacteria | 567 |
| 318 | Ga0075363_100000434 | 3300006048 | Bacteria | 13047 |
| 319 | Ga0075363_100007657 | 3300006048 | Bacteria | 4981 |
| 320 | Ga0075364_10154814 | 3300006051 | Bacteria | 1546 |
| 321 | Ga0075364_10389625 | 3300006051 | Bacteria | 951 |
| 322 | Ga0070712_100734954 | 3300006175 | Bacteria | 844 |
| 323 | Ga0075362_10001156 | 3300006177 | Bacteria | 8246 |
| 324 | Ga0075362_10143859 | 3300006177 | Bacteria | 1141 |
| 325 | Ga0075367_10151422 | 3300006178 | Bacteria | 1439 |
| 326 | Ga0075369_10017872 | 3300006186 | Bacteria | 2881 |
| 327 | Ga0075366_10043854 | 3300006195 | Bacteria | 2650 |
| 328 | Ga0075366_10688912 | 3300006195 | Bacteria | 634 |
| 329 | Ga0075366_10702613 | 3300006195 | Bacteria | 628 |
| 330 | Ga0097621_100162823 | 3300006237 | Bacteria | 1918 |
| 331 | Ga0097621_100458747 | 3300006237 | Bacteria | 1149 |
| 332 | Ga0097621_101459311 | 3300006237 | Bacteria | 648 |
| 333 | Ga0075370_10000004 | 3300006353 | Bacteria | 121166 |
| 334 | Ga0075370_10183052 | 3300006353 | Bacteria | 1233 |
| 335 | Ga0075370_10228277 | 3300006353 | Bacteria | 1101 |
| 336 | Ga0075370_10231904 | 3300006353 | Bacteria | 1092 |
| 337 | Ga0075370_10938159 | 3300006353 | Bacteria | 529 |
| 338 | Ga0068871_101309670 | 3300006358 | Bacteria | 681 |
| 339 | Ga0075428_102319728 | 3300006844 | Bacteria | 552 |
| 340 | Ga0075430_100459554 | 3300006846 | Bacteria | 1050 |
| 341 | Ga0075433_10164065 | 3300006852 | Bacteria | 1977 |
| 342 | Ga0075434_102439173 | 3300006871 | Bacteria | 525 |
| 343 | Ga0068865_100063284 | 3300006881 | Bacteria | 2600 |
| 344 | Ga0068865_100124512 | 3300006881 | Bacteria | 1922 |
| 345 | Ga0068865_100619565 | 3300006881 | Bacteria | 917 |
| 346 | Ga0068865_101114496 | 3300006881 | Bacteria | 696 |
| 347 | Ga0068865_101138857 | 3300006881 | Bacteria | 688 |
| 348 | Ga0068865_101149388 | 3300006881 | Bacteria | 686 |
| 349 | Ga0097620_100006388 | 3300006931 | Bacteria | 11959 |
| 350 | Ga0097620_100030651 | 3300006931 | Bacteria | 5398 |
| 351 | Ga0097620_100323639 | 3300006931 | Bacteria | 1636 |
| 352 | Ga0097620_100440841 | 3300006931 | Bacteria | 1399 |
| 353 | Ga0097620_101116306 | 3300006931 | Bacteria | 867 |
| 354 | Ga0097620_101612395 | 3300006931 | Bacteria | 717 |
| 355 | Ga0097620_101774423 | 3300006931 | Bacteria | 681 |
| 356 | Ga0097620_101995678 | 3300006931 | Bacteria | 641 |
| 357 | Ga0105251_10003119 | 3300009011 | Bacteria | 12305 |
| 358 | Ga0105251_10033975 | 3300009011 | Bacteria | 2527 |
| 359 | Ga0105250_10001130 | 3300009092 | Bacteria | 15032 |
| 360 | Ga0105240_10183284 | 3300009093 | Bacteria | 2469 |
| 361 | Ga0105240_10928947 | 3300009093 | Bacteria | 934 |
| 362 | Ga0105240_12215374 | 3300009093 | Bacteria | 570 |
| 363 | Ga0111539_10637376 | 3300009094 | Bacteria | 1241 |
| 364 | Ga0111539_11626981 | 3300009094 | Bacteria | 749 |
| 365 | Ga0105247_10005639 | 3300009101 | Bacteria | 7852 |
| 366 | Ga0105247_10139623 | 3300009101 | Bacteria | 1586 |
| 367 | Ga0105247_10230726 | 3300009101 | Bacteria | 1257 |
| 368 | Ga0105247_10348022 | 3300009101 | Bacteria | 1041 |
| 369 | Ga0114129_10043173 | 3300009147 | Bacteria | 6344 |
| 370 | Ga0105243_10020823 | 3300009148 | Bacteria | 4976 |
| 371 | Ga0105243_10589560 | 3300009148 | Bacteria | 1068 |
| 372 | Ga0105243_12097989 | 3300009148 | Bacteria | 601 |
| 373 | Ga0105243_12203750 | 3300009148 | Bacteria | 588 |
| 374 | Ga0105243_12262099 | 3300009148 | Bacteria | 581 |
| 375 | Ga0105241_10438812 | 3300009174 | Bacteria | 1153 |
| 376 | Ga0105241_10532747 | 3300009174 | Bacteria | 1052 |
| 377 | Ga0105241_10598323 | 3300009174 | Bacteria | 996 |
| 378 | Ga0105241_10858706 | 3300009174 | Bacteria | 840 |
| 379 | Ga0105241_10936905 | 3300009174 | Bacteria | 806 |
| 380 | Ga0105241_11041831 | 3300009174 | Bacteria | 767 |
| 381 | Ga0105242_10527942 | 3300009176 | Bacteria | 1127 |
| 382 | Ga0105242_11662544 | 3300009176 | Bacteria | 674 |
| 383 | Ga0105248_10000021 | 3300009177 | Bacteria | 276159 |
| 384 | Ga0105248_10003987 | 3300009177 | Bacteria | 16323 |
| 385 | Ga0105248_10021485 | 3300009177 | Bacteria | 7149 |
| 386 | Ga0105248_10022907 | 3300009177 | Bacteria | 6935 |
| 387 | Ga0105248_10100231 | 3300009177 | Bacteria | 3264 |
| 388 | Ga0105248_10106162 | 3300009177 | Bacteria | 3167 |
| 389 | Ga0105248_10341020 | 3300009177 | Bacteria | 1687 |
| 390 | Ga0105248_10424396 | 3300009177 | Bacteria | 1498 |
| 391 | Ga0105248_10736984 | 3300009177 | Bacteria | 1112 |
| 392 | Ga0105248_10976747 | 3300009177 | Bacteria | 957 |
| 393 | Ga0105248_11707590 | 3300009177 | Bacteria | 714 |
| 394 | Ga0105248_12990958 | 3300009177 | Bacteria | 538 |
| 395 | Ga0105237_10002858 | 3300009545 | Bacteria | 20999 |
| 396 | Ga0105237_10186090 | 3300009545 | Bacteria | 2077 |
| 397 | Ga0105237_10449722 | 3300009545 | Bacteria | 1294 |
| 398 | Ga0105237_10604010 | 3300009545 | Bacteria | 1104 |
| 399 | Ga0105237_11513256 | 3300009545 | Bacteria | 678 |
| 400 | Ga0105238_10428911 | 3300009551 | Bacteria | 1317 |
| 401 | Ga0105238_11230877 | 3300009551 | Bacteria | 773 |
| 402 | Ga0105249_10001881 | 3300009553 | Bacteria | 18180 |
| 403 | Ga0105249_10002122 | 3300009553 | Bacteria | 17209 |
| 404 | Ga0105249_10134716 | 3300009553 | Bacteria | 2362 |
| 405 | Ga0105249_11020091 | 3300009553 | Bacteria | 896 |
| 406 | Ga0105249_11228458 | 3300009553 | Bacteria | 821 |
| 407 | Ga0105249_11600721 | 3300009553 | Bacteria | 724 |
| 408 | Ga0105239_10457367 | 3300010375 | Bacteria | 1449 |
| 409 | Ga0105239_10945649 | 3300010375 | Bacteria | 990 |
| 410 | Ga0105239_11059697 | 3300010375 | Bacteria | 933 |
| 411 | Ga0105239_11679028 | 3300010375 | Bacteria | 735 |
| 412 | Ga0105246_10736332 | 3300011119 | Bacteria | 868 |
| 413 | Ga0105246_11372844 | 3300011119 | Bacteria | 658 |
| 414 | Ga0157323_1030989 | 3300012495 | Bacteria | 568 |
| 415 | Ga0157339_1045827 | 3300012505 | Bacteria | 563 |
| 416 | Ga0157315_1005960 | 3300012508 | Bacteria | 935 |
| 417 | Ga0157327_1020413 | 3300012512 | Bacteria | 742 |
| 418 | Ga0157338_1000992 | 3300012515 | Bacteria | 1913 |
| 419 | Ga0157373_10050689 | 3300013100 | Bacteria | 2956 |
| 420 | Ga0157373_10172671 | 3300013100 | Bacteria | 1521 |
| 421 | Ga0157373_10419244 | 3300013100 | Bacteria | 961 |
| 422 | Ga0157373_10973344 | 3300013100 | Bacteria | 632 |
| 423 | Ga0157371_10152944 | 3300013102 | Bacteria | 1646 |
| 424 | Ga0157371_11457855 | 3300013102 | Bacteria | 533 |
| 425 | Ga0157370_10029812 | 3300013104 | Bacteria | 5349 |
| 426 | Ga0157370_10102037 | 3300013104 | Bacteria | 2687 |
| 427 | Ga0157369_10034063 | 3300013105 | Bacteria | 5592 |
| 428 | Ga0157369_10070636 | 3300013105 | Bacteria | 3751 |
| 429 | Ga0157369_10153589 | 3300013105 | Bacteria | 2433 |
| 430 | Ga0157369_10574155 | 3300013105 | Bacteria | 1165 |
| 431 | Ga0157369_10778307 | 3300013105 | Bacteria | 984 |
| 432 | Ga0157369_11859513 | 3300013105 | Bacteria | 611 |
| 433 | Ga0157369_12320254 | 3300013105 | Bacteria | 544 |
| 434 | Ga0157374_10414302 | 3300013296 | Bacteria | 1345 |
| 435 | Ga0157374_10881780 | 3300013296 | Bacteria | 912 |
| 436 | Ga0157374_12289027 | 3300013296 | Bacteria | 567 |
| 437 | Ga0157378_10114310 | 3300013297 | Bacteria | 2479 |
| 438 | Ga0163162_10025756 | 3300013306 | Bacteria | 5815 |
| 439 | Ga0163162_10404008 | 3300013306 | Bacteria | 1499 |
| 440 | Ga0163162_10562907 | 3300013306 | Bacteria | 1267 |
| 441 | Ga0163162_10951462 | 3300013306 | Bacteria | 970 |
| 442 | Ga0163162_12300679 | 3300013306 | Bacteria | 619 |
| 443 | Ga0157372_10078683 | 3300013307 | Bacteria | 3726 |
| 444 | Ga0157372_10427160 | 3300013307 | Bacteria | 1544 |
| 445 | Ga0157372_11844695 | 3300013307 | Bacteria | 695 |
| 446 | Ga0157372_12902238 | 3300013307 | Bacteria | 549 |
| 447 | Ga0157372_13029957 | 3300013307 | Bacteria | 537 |
| 448 | Ga0157375_10007439 | 3300013308 | Bacteria | 9585 |
| 449 | Ga0157375_10105208 | 3300013308 | Bacteria | 2912 |
| 450 | Ga0163163_10020116 | 3300014325 | Bacteria | 6282 |
| 451 | Ga0163163_10313059 | 3300014325 | Bacteria | 1623 |
| 452 | Ga0163163_10314201 | 3300014325 | Bacteria | 1620 |
| 453 | Ga0163163_10360924 | 3300014325 | Bacteria | 1509 |
| 454 | Ga0163163_10584351 | 3300014325 | Bacteria | 1180 |
| 455 | Ga0163163_10591250 | 3300014325 | Bacteria | 1173 |
| 456 | Ga0163163_10861498 | 3300014325 | Bacteria | 969 |
| 457 | Ga0163163_11538253 | 3300014325 | Bacteria | 726 |
| 458 | Ga0157380_10000157 | 3300014326 | Bacteria | 39384 |
| 459 | Ga0157380_10015607 | 3300014326 | Bacteria | 5584 |
| 460 | Ga0157380_10435926 | 3300014326 | Bacteria | 1254 |
| 461 | Ga0157380_10630398 | 3300014326 | Bacteria | 1066 |
| 462 | Ga0157380_10677954 | 3300014326 | Bacteria | 1032 |
| 463 | Ga0157380_11422723 | 3300014326 | Bacteria | 744 |
| 464 | Ga0157380_11475188 | 3300014326 | Bacteria | 733 |
| 465 | Ga0182008_10184377 | 3300014497 | Bacteria | 1057 |
| 466 | Ga0157377_10460577 | 3300014745 | Bacteria | 880 |
| 467 | Ga0157379_10223199 | 3300014968 | Bacteria | 1707 |
| 468 | Ga0157379_10665090 | 3300014968 | Bacteria | 976 |
| 469 | Ga0157379_10766984 | 3300014968 | Bacteria | 909 |
| 470 | Ga0157379_11103336 | 3300014968 | Bacteria | 760 |
| 471 | Ga0157376_10019101 | 3300014969 | Bacteria | 5273 |
| 472 | Ga0157376_10363485 | 3300014969 | Bacteria | 1389 |
| 473 | Ga0163161_10160074 | 3300017792 | Bacteria | 1716 |
| 474 | Ga0163161_10359501 | 3300017792 | Bacteria | 1159 |
| 475 | Ga0163161_10417686 | 3300017792 | Bacteria | 1079 |
| 476 | Ga0163161_10667267 | 3300017792 | Bacteria | 863 |
| 477 | Ga0197907_10673139 | 3300020069 | Bacteria | 1094 |
| 478 | Ga0206356_10532533 | 3300020070 | Bacteria | 806 |
| 479 | Ga0213875_10001626 | 3300021388 | Bacteria | 14182 |
| 480 | Ga0207425_1000049 | 3300025245 | Bacteria | 180735 |
| 481 | Ga0209646_1018464 | 3300025246 | Bacteria | 1020 |
| 482 | Ga0209026_1006530 | 3300025250 | Bacteria | 2830 |
| 483 | Ga0209148_1006654 | 3300025254 | Bacteria | 2481 |
| 484 | Ga0209129_1000471 | 3300025258 | Bacteria | 29587 |
| 485 | Ga0209565_1000985 | 3300025263 | Bacteria | 14637 |
| 486 | Ga0209676_1007313 | 3300025292 | Bacteria | 5224 |
| 487 | Ga0209676_1013004 | 3300025292 | Bacteria | 3228 |
| 488 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 489 | Ga0209564_1000335 | 3300025295 | Bacteria | 91079 |
| 490 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 491 | Ga0209758_1002168 | 3300025297 | Bacteria | 20636 |
| 492 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 493 | Ga0209050_1000161 | 3300025298 | Bacteria | 155713 |
| 494 | Ga0209050_1001064 | 3300025298 | Bacteria | 33727 |
| 495 | Ga0209050_1011548 | 3300025298 | Bacteria | 4167 |
| 496 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 497 | Ga0209051_1000877 | 3300025303 | Bacteria | 30359 |
| 498 | Ga0209257_1000252 | 3300025304 | Bacteria | 123718 |
| 499 | Ga0209257_1004959 | 3300025304 | Bacteria | 9760 |
| 500 | Ga0209257_1008377 | 3300025304 | Bacteria | 5898 |
| 501 | Ga0207697_10001580 | 3300025315 | Bacteria | 12319 |
| 502 | Ga0207656_10218634 | 3300025321 | Bacteria | 925 |
| 503 | Ga0207696_1000878 | 3300025711 | Bacteria | 18741 |
| 504 | Ga0207713_1000752 | 3300025735 | Bacteria | 30172 |
| 505 | Ga0207682_10006590 | 3300025893 | Bacteria | 4672 |
| 506 | Ga0207682_10286164 | 3300025893 | Bacteria | 771 |
| 507 | Ga0207682_10408647 | 3300025893 | Bacteria | 642 |
| 508 | Ga0207642_10099534 | 3300025899 | Bacteria | 1456 |
| 509 | Ga0207642_10321425 | 3300025899 | Bacteria | 904 |
| 510 | Ga0207642_10435527 | 3300025899 | Bacteria | 791 |
| 511 | Ga0207642_11027184 | 3300025899 | Bacteria | 531 |
| 512 | Ga0207710_10035506 | 3300025900 | Bacteria | 2194 |
| 513 | Ga0207710_10036482 | 3300025900 | Bacteria | 2167 |
| 514 | Ga0207710_10063379 | 3300025900 | Bacteria | 1681 |
| 515 | Ga0207710_10243846 | 3300025900 | Bacteria | 897 |
| 516 | Ga0207688_10113160 | 3300025901 | Bacteria | 1577 |
| 517 | Ga0207688_10225106 | 3300025901 | Bacteria | 1131 |
| 518 | Ga0207688_10433251 | 3300025901 | Bacteria | 818 |
| 519 | Ga0207680_10013949 | 3300025903 | Bacteria | 4143 |
| 520 | Ga0207680_10040390 | 3300025903 | Bacteria | 2714 |
| 521 | Ga0207680_10134575 | 3300025903 | Bacteria | 1632 |
| 522 | Ga0207680_10201861 | 3300025903 | Bacteria | 1355 |
| 523 | Ga0207680_10299365 | 3300025903 | Bacteria | 1121 |
| 524 | Ga0207680_10712458 | 3300025903 | Bacteria | 719 |
| 525 | Ga0207647_10008472 | 3300025904 | Bacteria | 7370 |
| 526 | Ga0207647_10151764 | 3300025904 | Bacteria | 1354 |
| 527 | Ga0207647_10205617 | 3300025904 | Bacteria | 1138 |
| 528 | Ga0207647_10356562 | 3300025904 | Bacteria | 828 |
| 529 | Ga0207645_10014351 | 3300025907 | Bacteria | 5302 |
| 530 | Ga0207645_10329078 | 3300025907 | Bacteria | 1020 |
| 531 | Ga0207645_10372627 | 3300025907 | Bacteria | 957 |
| 532 | Ga0207645_10486385 | 3300025907 | Bacteria | 835 |
| 533 | Ga0207645_10613201 | 3300025907 | Bacteria | 739 |
| 534 | Ga0207645_11106532 | 3300025907 | Bacteria | 534 |
| 535 | Ga0207643_10262364 | 3300025908 | Bacteria | 1067 |
| 536 | Ga0207643_10512962 | 3300025908 | Bacteria | 767 |
| 537 | Ga0207705_10000243 | 3300025909 | Bacteria | 53479 |
| 538 | Ga0207705_10018065 | 3300025909 | Bacteria | 5043 |
| 539 | Ga0207705_10170172 | 3300025909 | Bacteria | 1640 |
| 540 | Ga0207705_10298895 | 3300025909 | Bacteria | 1234 |
| 541 | Ga0207705_10476427 | 3300025909 | Bacteria | 969 |
| 542 | Ga0207705_10678009 | 3300025909 | Bacteria | 801 |
| 543 | Ga0207705_11372488 | 3300025909 | Bacteria | 538 |
| 544 | Ga0207654_10000796 | 3300025911 | Bacteria | 17350 |
| 545 | Ga0207654_10272601 | 3300025911 | Bacteria | 1142 |
| 546 | Ga0207654_10291692 | 3300025911 | Bacteria | 1106 |
| 547 | Ga0207654_10389537 | 3300025911 | Bacteria | 967 |
| 548 | Ga0207654_10679072 | 3300025911 | Bacteria | 739 |
| 549 | Ga0207707_11574258 | 3300025912 | Bacteria | 518 |
| 550 | Ga0207695_10006167 | 3300025913 | Bacteria | 15631 |
| 551 | Ga0207695_10006293 | 3300025913 | Bacteria | 15449 |
| 552 | Ga0207695_10941004 | 3300025913 | Bacteria | 744 |
| 553 | Ga0207671_10003173 | 3300025914 | Bacteria | 16603 |
| 554 | Ga0207671_10043377 | 3300025914 | Bacteria | 3326 |
| 555 | Ga0207671_10403494 | 3300025914 | Bacteria | 1087 |
| 556 | Ga0207671_10540879 | 3300025914 | Bacteria | 929 |
| 557 | Ga0207660_10044818 | 3300025917 | Bacteria | 3113 |
| 558 | Ga0207660_10738150 | 3300025917 | Bacteria | 803 |
| 559 | Ga0207660_11259222 | 3300025917 | Bacteria | 601 |
| 560 | Ga0207662_10447502 | 3300025918 | Bacteria | 883 |
| 561 | Ga0207662_11345789 | 3300025918 | Bacteria | 507 |
| 562 | Ga0207657_10172620 | 3300025919 | Bacteria | 1751 |
| 563 | Ga0207657_10287802 | 3300025919 | Bacteria | 1303 |
| 564 | Ga0207657_10459521 | 3300025919 | Bacteria | 999 |
| 565 | Ga0207657_10622911 | 3300025919 | Bacteria | 841 |
| 566 | Ga0207657_10823517 | 3300025919 | Bacteria | 717 |
| 567 | Ga0207657_10931409 | 3300025919 | Bacteria | 668 |
| 568 | Ga0207657_11142957 | 3300025919 | Bacteria | 594 |
| 569 | Ga0207649_10155614 | 3300025920 | Bacteria | 1579 |
| 570 | Ga0207649_10805784 | 3300025920 | Bacteria | 733 |
| 571 | Ga0207649_11171159 | 3300025920 | Bacteria | 607 |
| 572 | Ga0207652_10843960 | 3300025921 | Bacteria | 811 |
| 573 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 574 | Ga0207681_10000109 | 3300025923 | Bacteria | 71373 |
| 575 | Ga0207681_10064025 | 3300025923 | Bacteria | 2537 |
| 576 | Ga0207681_10107677 | 3300025923 | Bacteria | 2022 |
| 577 | Ga0207681_10135208 | 3300025923 | Bacteria | 1828 |
| 578 | Ga0207681_10135695 | 3300025923 | Bacteria | 1825 |
| 579 | Ga0207681_10136951 | 3300025923 | Bacteria | 1818 |
| 580 | Ga0207681_10322916 | 3300025923 | Bacteria | 1228 |
| 581 | Ga0207681_10686576 | 3300025923 | Bacteria | 850 |
| 582 | Ga0207681_10743248 | 3300025923 | Bacteria | 817 |
| 583 | Ga0207694_10002782 | 3300025924 | Bacteria | 14124 |
| 584 | Ga0207694_11268795 | 3300025924 | Bacteria | 623 |
| 585 | Ga0207694_11295342 | 3300025924 | Bacteria | 616 |
| 586 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 587 | Ga0207650_10010619 | 3300025925 | Bacteria | 6323 |
| 588 | Ga0207650_10012172 | 3300025925 | Bacteria | 5931 |
| 589 | Ga0207650_10117282 | 3300025925 | Bacteria | 2068 |
| 590 | Ga0207650_10149651 | 3300025925 | Bacteria | 1841 |
| 591 | Ga0207650_10203478 | 3300025925 | Bacteria | 1587 |
| 592 | Ga0207650_10329309 | 3300025925 | Bacteria | 1252 |
| 593 | Ga0207650_10482537 | 3300025925 | Bacteria | 1034 |
| 594 | Ga0207650_11599005 | 3300025925 | Bacteria | 553 |
| 595 | Ga0207659_10001819 | 3300025926 | Bacteria | 12629 |
| 596 | Ga0207659_11189377 | 3300025926 | Bacteria | 655 |
| 597 | Ga0207659_11863388 | 3300025926 | Bacteria | 510 |
| 598 | Ga0207687_11656320 | 3300025927 | Bacteria | 549 |
| 599 | Ga0207700_10348620 | 3300025928 | Bacteria | 1289 |
| 600 | Ga0207664_10033807 | 3300025929 | Bacteria | 3933 |
| 601 | Ga0207664_10407847 | 3300025929 | Bacteria | 1209 |
| 602 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 603 | Ga0207644_10002343 | 3300025931 | Bacteria | 12231 |
| 604 | Ga0207644_10013980 | 3300025931 | Bacteria | 5364 |
| 605 | Ga0207644_10015604 | 3300025931 | Bacteria | 5101 |
| 606 | Ga0207644_10265646 | 3300025931 | Bacteria | 1373 |
| 607 | Ga0207644_10536901 | 3300025931 | Bacteria | 967 |
| 608 | Ga0207644_10873001 | 3300025931 | Bacteria | 753 |
| 609 | Ga0207690_10000234 | 3300025932 | Bacteria | 41241 |
| 610 | Ga0207690_10064522 | 3300025932 | Bacteria | 2501 |
| 611 | Ga0207690_10233117 | 3300025932 | Bacteria | 1414 |
| 612 | Ga0207690_10244551 | 3300025932 | Bacteria | 1383 |
| 613 | Ga0207690_10799856 | 3300025932 | Bacteria | 779 |
| 614 | Ga0207690_11074208 | 3300025932 | Bacteria | 671 |
| 615 | Ga0207690_11385288 | 3300025932 | Bacteria | 588 |
| 616 | Ga0207706_10018915 | 3300025933 | Bacteria | 6194 |
| 617 | Ga0207706_10104516 | 3300025933 | Bacteria | 2492 |
| 618 | Ga0207706_10215402 | 3300025933 | Bacteria | 1682 |
| 619 | Ga0207706_10695595 | 3300025933 | Bacteria | 869 |
| 620 | Ga0207706_10788478 | 3300025933 | Bacteria | 808 |
| 621 | Ga0207706_10966870 | 3300025933 | Bacteria | 717 |
| 622 | Ga0207706_11278411 | 3300025933 | Bacteria | 607 |
| 623 | Ga0207686_11238963 | 3300025934 | Bacteria | 611 |
| 624 | Ga0207686_11632044 | 3300025934 | Bacteria | 533 |
| 625 | Ga0207709_10294414 | 3300025935 | Bacteria | 1204 |
| 626 | Ga0207709_10305309 | 3300025935 | Bacteria | 1185 |
| 627 | Ga0207709_10425941 | 3300025935 | Bacteria | 1020 |
| 628 | Ga0207709_11136648 | 3300025935 | Bacteria | 642 |
| 629 | Ga0207709_11393360 | 3300025935 | Bacteria | 580 |
| 630 | Ga0207670_10140665 | 3300025936 | Bacteria | 1780 |
| 631 | Ga0207670_10157716 | 3300025936 | Bacteria | 1691 |
| 632 | Ga0207670_11494504 | 3300025936 | Bacteria | 574 |
| 633 | Ga0207670_11686067 | 3300025936 | Bacteria | 539 |
| 634 | Ga0207669_10012728 | 3300025937 | Bacteria | 4147 |
| 635 | Ga0207669_10172189 | 3300025937 | Bacteria | 1542 |
| 636 | Ga0207669_10188591 | 3300025937 | Bacteria | 1485 |
| 637 | Ga0207669_10793102 | 3300025937 | Bacteria | 785 |
| 638 | Ga0207704_10188806 | 3300025938 | Bacteria | 1497 |
| 639 | Ga0207704_10403625 | 3300025938 | Bacteria | 1079 |
| 640 | Ga0207704_10425485 | 3300025938 | Bacteria | 1054 |
| 641 | Ga0207704_11083677 | 3300025938 | Bacteria | 680 |
| 642 | Ga0207665_10728840 | 3300025939 | Bacteria | 780 |
| 643 | Ga0207691_10017921 | 3300025940 | Bacteria | 6710 |
| 644 | Ga0207691_10443159 | 3300025940 | Bacteria | 1105 |
| 645 | Ga0207691_10565637 | 3300025940 | Bacteria | 963 |
| 646 | Ga0207691_10826742 | 3300025940 | Bacteria | 777 |
| 647 | Ga0207691_10921219 | 3300025940 | Bacteria | 731 |
| 648 | Ga0207691_11405573 | 3300025940 | Bacteria | 573 |
| 649 | Ga0207691_11670538 | 3300025940 | Bacteria | 516 |
| 650 | Ga0207711_10000025 | 3300025941 | Bacteria | 289972 |
| 651 | Ga0207711_10001472 | 3300025941 | Bacteria | 21955 |
| 652 | Ga0207711_10004929 | 3300025941 | Bacteria | 11336 |
| 653 | Ga0207711_10007295 | 3300025941 | Bacteria | 9260 |
| 654 | Ga0207711_10018353 | 3300025941 | Bacteria | 5814 |
| 655 | Ga0207711_10198760 | 3300025941 | Bacteria | 1829 |
| 656 | Ga0207711_10293709 | 3300025941 | Bacteria | 1498 |
| 657 | Ga0207711_10689339 | 3300025941 | Bacteria | 953 |
| 658 | Ga0207711_11171456 | 3300025941 | Bacteria | 710 |
| 659 | Ga0207661_11692701 | 3300025944 | Bacteria | 578 |
| 660 | Ga0207661_12027118 | 3300025944 | Bacteria | 521 |
| 661 | Ga0207679_10000847 | 3300025945 | Bacteria | 19669 |
| 662 | Ga0207679_10024678 | 3300025945 | Bacteria | 4124 |
| 663 | Ga0207679_10169733 | 3300025945 | Bacteria | 1795 |
| 664 | Ga0207679_10523914 | 3300025945 | Bacteria | 1060 |
| 665 | Ga0207679_10976302 | 3300025945 | Bacteria | 776 |
| 666 | Ga0207679_11842983 | 3300025945 | Bacteria | 552 |
| 667 | Ga0207667_10004183 | 3300025949 | Bacteria | 17730 |
| 668 | Ga0207667_10009439 | 3300025949 | Bacteria | 11487 |
| 669 | Ga0207667_10021256 | 3300025949 | Bacteria | 7193 |
| 670 | Ga0207667_10033512 | 3300025949 | Bacteria | 5521 |
| 671 | Ga0207667_10113219 | 3300025949 | Bacteria | 2798 |
| 672 | Ga0207667_10758480 | 3300025949 | Bacteria | 969 |
| 673 | Ga0207667_12045683 | 3300025949 | Bacteria | 532 |
| 674 | Ga0207651_10073408 | 3300025960 | Bacteria | 2433 |
| 675 | Ga0207651_10120124 | 3300025960 | Bacteria | 1991 |
| 676 | Ga0207651_11294335 | 3300025960 | Bacteria | 655 |
| 677 | Ga0207712_10006239 | 3300025961 | Bacteria | 7512 |
| 678 | Ga0207712_10037061 | 3300025961 | Bacteria | 3325 |
| 679 | Ga0207712_10112962 | 3300025961 | Bacteria | 2041 |
| 680 | Ga0207712_10124942 | 3300025961 | Bacteria | 1952 |
| 681 | Ga0207712_10405567 | 3300025961 | Bacteria | 1147 |
| 682 | Ga0207712_10515107 | 3300025961 | Bacteria | 1024 |
| 683 | Ga0207668_10032300 | 3300025972 | Bacteria | 3457 |
| 684 | Ga0207668_10098711 | 3300025972 | Bacteria | 2164 |
| 685 | Ga0207668_10125743 | 3300025972 | Bacteria | 1949 |
| 686 | Ga0207668_10142601 | 3300025972 | Bacteria | 1844 |
| 687 | Ga0207668_10520698 | 3300025972 | Bacteria | 1026 |
| 688 | Ga0207668_10896992 | 3300025972 | Bacteria | 789 |
| 689 | Ga0207668_11544709 | 3300025972 | Bacteria | 599 |
| 690 | Ga0207640_10007440 | 3300025981 | Bacteria | 6044 |
| 691 | Ga0207640_10019616 | 3300025981 | Bacteria | 3999 |
| 692 | Ga0207640_10023695 | 3300025981 | Bacteria | 3693 |
| 693 | Ga0207640_10075290 | 3300025981 | Bacteria | 2287 |
| 694 | Ga0207640_10310522 | 3300025981 | Bacteria | 1251 |
| 695 | Ga0207640_10564709 | 3300025981 | Bacteria | 958 |
| 696 | Ga0207640_11117636 | 3300025981 | Bacteria | 698 |
| 697 | Ga0207658_10000064 | 3300025986 | Bacteria | 117779 |
| 698 | Ga0207658_10004938 | 3300025986 | Bacteria | 9199 |
| 699 | Ga0207658_10005381 | 3300025986 | Bacteria | 8790 |
| 700 | Ga0207658_10245342 | 3300025986 | Bacteria | 1519 |
| 701 | Ga0207658_10289784 | 3300025986 | Bacteria | 1406 |
| 702 | Ga0207658_10310759 | 3300025986 | Bacteria | 1361 |
| 703 | Ga0207658_10336283 | 3300025986 | Bacteria | 1311 |
| 704 | Ga0207677_10456903 | 3300026023 | Bacteria | 1095 |
| 705 | Ga0207703_10187314 | 3300026035 | Bacteria | 1830 |
| 706 | Ga0207703_10465468 | 3300026035 | Bacteria | 1183 |
| 707 | Ga0207703_11092724 | 3300026035 | Bacteria | 766 |
| 708 | Ga0207703_11468793 | 3300026035 | Bacteria | 656 |
| 709 | Ga0207703_11497294 | 3300026035 | Bacteria | 649 |
| 710 | Ga0207639_10019581 | 3300026041 | Bacteria | 4829 |
| 711 | Ga0207639_10250926 | 3300026041 | Bacteria | 1543 |
| 712 | Ga0207639_10341890 | 3300026041 | Bacteria | 1334 |
| 713 | Ga0207639_10371280 | 3300026041 | Bacteria | 1282 |
| 714 | Ga0207639_10467754 | 3300026041 | Bacteria | 1147 |
| 715 | Ga0207639_10749209 | 3300026041 | Bacteria | 908 |
| 716 | Ga0207678_10014182 | 3300026067 | Bacteria | 7006 |
| 717 | Ga0207678_10110312 | 3300026067 | Bacteria | 2347 |
| 718 | Ga0207678_10166893 | 3300026067 | Bacteria | 1880 |
| 719 | Ga0207678_11238296 | 3300026067 | Bacteria | 661 |
| 720 | Ga0207678_11399066 | 3300026067 | Bacteria | 618 |
| 721 | Ga0207678_11670553 | 3300026067 | Bacteria | 560 |
| 722 | Ga0207708_10016146 | 3300026075 | Bacteria | 5609 |
| 723 | Ga0207708_10344216 | 3300026075 | Bacteria | 1222 |
| 724 | Ga0207708_11082489 | 3300026075 | Bacteria | 698 |
| 725 | Ga0207708_11246471 | 3300026075 | Bacteria | 651 |
| 726 | Ga0207702_10003021 | 3300026078 | Bacteria | 15630 |
| 727 | Ga0207702_10005908 | 3300026078 | Bacteria | 10645 |
| 728 | Ga0207702_10613417 | 3300026078 | Bacteria | 1068 |
| 729 | Ga0207641_10003244 | 3300026088 | Bacteria | 14521 |
| 730 | Ga0207641_10101679 | 3300026088 | Bacteria | 2533 |
| 731 | Ga0207641_10127150 | 3300026088 | Bacteria | 2283 |
| 732 | Ga0207641_10150340 | 3300026088 | Bacteria | 2108 |
| 733 | Ga0207641_10323913 | 3300026088 | Bacteria | 1462 |
| 734 | Ga0207641_11820018 | 3300026088 | Bacteria | 611 |
| 735 | Ga0207648_10240702 | 3300026089 | Bacteria | 1611 |
| 736 | Ga0207648_10459080 | 3300026089 | Bacteria | 1161 |
| 737 | Ga0207648_11292458 | 3300026089 | Bacteria | 685 |
| 738 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 739 | Ga0207676_10014415 | 3300026095 | Bacteria | 5688 |
| 740 | Ga0207676_10136112 | 3300026095 | Bacteria | 2096 |
| 741 | Ga0207676_10250941 | 3300026095 | Bacteria | 1593 |
| 742 | Ga0207676_10278645 | 3300026095 | Bacteria | 1517 |
| 743 | Ga0207676_10972285 | 3300026095 | Bacteria | 835 |
| 744 | Ga0207676_11582155 | 3300026095 | Bacteria | 653 |
| 745 | Ga0207674_10062161 | 3300026116 | Bacteria | 3772 |
| 746 | Ga0207674_10062748 | 3300026116 | Bacteria | 3753 |
| 747 | Ga0207674_10141809 | 3300026116 | Bacteria | 2362 |
| 748 | Ga0207674_10242234 | 3300026116 | Bacteria | 1750 |
| 749 | Ga0207674_10648444 | 3300026116 | Bacteria | 1020 |
| 750 | Ga0207674_10939193 | 3300026116 | Bacteria | 833 |
| 751 | Ga0207674_11092817 | 3300026116 | Bacteria | 767 |
| 752 | Ga0207675_100001117 | 3300026118 | Bacteria | 26571 |
| 753 | Ga0207675_100022526 | 3300026118 | Bacteria | 5865 |
| 754 | Ga0207675_100155097 | 3300026118 | Bacteria | 2182 |
| 755 | Ga0207675_100877104 | 3300026118 | Bacteria | 913 |
| 756 | Ga0207675_101019576 | 3300026118 | Bacteria | 846 |
| 757 | Ga0207683_10000681 | 3300026121 | Bacteria | 31192 |
| 758 | Ga0207683_10382507 | 3300026121 | Bacteria | 1294 |
| 759 | Ga0207683_10777255 | 3300026121 | Bacteria | 889 |
| 760 | Ga0207683_11466886 | 3300026121 | Bacteria | 630 |
| 761 | Ga0207698_10016673 | 3300026142 | Bacteria | 4962 |
| 762 | Ga0207698_10195073 | 3300026142 | Bacteria | 1808 |
| 763 | Ga0207698_10281969 | 3300026142 | Bacteria | 1537 |
| 764 | Ga0207698_10577682 | 3300026142 | Bacteria | 1105 |
| 765 | Ga0207698_10713984 | 3300026142 | Bacteria | 998 |
| 766 | Ga0207698_11103613 | 3300026142 | Bacteria | 806 |
| 767 | Ga0207698_11288864 | 3300026142 | Bacteria | 745 |
| 768 | Ga0209371_1030624 | 3300027312 | Bacteria | 1176 |
| 769 | Ga0209984_1008264 | 3300027424 | Bacteria | 1307 |
| 770 | Ga0209968_1021665 | 3300027526 | Bacteria | 1044 |
| 771 | Ga0209968_1039141 | 3300027526 | Bacteria | 808 |
| 772 | Ga0209999_1045243 | 3300027543 | Bacteria | 828 |
| 773 | Ga0209982_1015255 | 3300027552 | Bacteria | 1165 |
| 774 | Ga0209970_1056825 | 3300027614 | Bacteria | 714 |
| 775 | Ga0209983_1010835 | 3300027665 | Bacteria | 1863 |
| 776 | Ga0209983_1054690 | 3300027665 | Bacteria | 876 |
| 777 | Ga0209983_1082206 | 3300027665 | Bacteria | 722 |
| 778 | Ga0209998_10099554 | 3300027717 | Bacteria | 719 |
| 779 | Ga0209974_10082069 | 3300027876 | Bacteria | 1111 |
| 780 | Ga0209974_10086086 | 3300027876 | Bacteria | 1086 |
| 781 | Ga0207428_10197963 | 3300027907 | Bacteria | 1512 |
| 782 | Ga0207428_11065529 | 3300027907 | Bacteria | 566 |
| 783 | Ga0268266_10012801 | 3300028379 | Bacteria | 7246 |
| 784 | Ga0268266_10022523 | 3300028379 | Bacteria | 5368 |
| 785 | Ga0268266_10511648 | 3300028379 | Bacteria | 1147 |
| 786 | Ga0268266_10785691 | 3300028379 | Bacteria | 919 |
| 787 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 788 | Ga0268265_10001591 | 3300028380 | Bacteria | 18782 |
| 789 | Ga0268265_10168803 | 3300028380 | Bacteria | 1867 |
| 790 | Ga0268265_10342767 | 3300028380 | Bacteria | 1361 |
| 791 | Ga0268265_10356224 | 3300028380 | Bacteria | 1338 |
| 792 | Ga0268265_10622760 | 3300028380 | Bacteria | 1034 |
| 793 | Ga0268265_12008182 | 3300028380 | Bacteria | 585 |
| 794 | Ga0268264_10000277 | 3300028381 | Bacteria | 86740 |
| 795 | Ga0268264_10015144 | 3300028381 | Bacteria | 6326 |
| 796 | Ga0268264_10058700 | 3300028381 | Bacteria | 3223 |
| 797 | Ga0268264_10102800 | 3300028381 | Bacteria | 2487 |
| 798 | Ga0268264_10177216 | 3300028381 | Bacteria | 1933 |
| 799 | Ga0268264_10505030 | 3300028381 | Bacteria | 1180 |
| 800 | Ga0307511_10006537 | 3300030521 | Bacteria | 11736 |
| 801 | Ga0316177_1214891 | 3300030731 | Bacteria | 663 |
| 802 | Ga0314311_1010360 | 3300030733 | Bacteria | 1203 |
| 803 | Ga0316178_1068395 | 3300030735 | Bacteria | 841 |
| 804 | Ga0307513_10000162 | 3300031456 | Bacteria | 96000 |
| 805 | Ga0307513_10010515 | 3300031456 | Bacteria | 11583 |
| 806 | Ga0307408_100006443 | 3300031548 | Bacteria | 7780 |
| 807 | Ga0307408_100023913 | 3300031548 | Bacteria | 4166 |
| 808 | Ga0307408_100094952 | 3300031548 | Bacteria | 2259 |
| 809 | Ga0307408_100395292 | 3300031548 | Bacteria | 1186 |
| 810 | Ga0307408_100491550 | 3300031548 | Bacteria | 1072 |
| 811 | Ga0307408_100666816 | 3300031548 | Bacteria | 931 |
| 812 | Ga0307408_101072415 | 3300031548 | Bacteria | 746 |
| 813 | Ga0265314_10149514 | 3300031711 | Bacteria | 1434 |
| 814 | Ga0316576_10543318 | 3300031727 | Bacteria | 852 |
| 815 | Ga0307405_10019698 | 3300031731 | Bacteria | 3754 |
| 816 | Ga0307405_10057515 | 3300031731 | Bacteria | 2443 |
| 817 | Ga0307405_10144798 | 3300031731 | Bacteria | 1662 |
| 818 | Ga0307405_10171397 | 3300031731 | Bacteria | 1548 |
| 819 | Ga0307405_10340784 | 3300031731 | Bacteria | 1152 |
| 820 | Ga0307405_10871404 | 3300031731 | Bacteria | 759 |
| 821 | Ga0307405_11653421 | 3300031731 | Bacteria | 566 |
| 822 | Ga0307413_10074509 | 3300031824 | Bacteria | 2150 |
| 823 | Ga0307413_10086312 | 3300031824 | Bacteria | 2029 |
| 824 | Ga0307413_10113610 | 3300031824 | Bacteria | 1818 |
| 825 | Ga0307413_10567311 | 3300031824 | Bacteria | 923 |
| 826 | Ga0307413_10602167 | 3300031824 | Bacteria | 899 |
| 827 | Ga0307413_10699901 | 3300031824 | Bacteria | 841 |
| 828 | Ga0307413_10779755 | 3300031824 | Bacteria | 801 |
| 829 | Ga0307410_10012286 | 3300031852 | Bacteria | 4944 |
| 830 | Ga0307410_10099934 | 3300031852 | Bacteria | 2077 |
| 831 | Ga0307410_10120091 | 3300031852 | Bacteria | 1915 |
| 832 | Ga0307410_10306713 | 3300031852 | Bacteria | 1254 |
| 833 | Ga0307410_10360926 | 3300031852 | Bacteria | 1163 |
| 834 | Ga0307410_10407171 | 3300031852 | Bacteria | 1100 |
| 835 | Ga0307410_10522766 | 3300031852 | Bacteria | 979 |
| 836 | Ga0307410_10606437 | 3300031852 | Bacteria | 914 |
| 837 | Ga0307410_10862790 | 3300031852 | Bacteria | 774 |
| 838 | Ga0307410_10885716 | 3300031852 | Bacteria | 764 |
| 839 | Ga0307410_11274668 | 3300031852 | Bacteria | 642 |
| 840 | Ga0307406_10008913 | 3300031901 | Bacteria | 5608 |
| 841 | Ga0307406_10046990 | 3300031901 | Bacteria | 2718 |
| 842 | Ga0307406_10053412 | 3300031901 | Bacteria | 2573 |
| 843 | Ga0307406_10912592 | 3300031901 | Bacteria | 748 |
| 844 | Ga0307406_11311714 | 3300031901 | Bacteria | 632 |
| 845 | Ga0307407_10002227 | 3300031903 | Bacteria | 7491 |
| 846 | Ga0307407_10070319 | 3300031903 | Bacteria | 2080 |
| 847 | Ga0307407_10315871 | 3300031903 | Bacteria | 1094 |
| 848 | Ga0307407_10520755 | 3300031903 | Bacteria | 874 |
| 849 | Ga0307407_10569608 | 3300031903 | Bacteria | 839 |
| 850 | Ga0307407_10706773 | 3300031903 | Bacteria | 760 |
| 851 | Ga0307407_10788895 | 3300031903 | Bacteria | 722 |
| 852 | Ga0307412_10000330 | 3300031911 | Bacteria | 30088 |
| 853 | Ga0307412_10001378 | 3300031911 | Bacteria | 13503 |
| 854 | Ga0307412_10005349 | 3300031911 | Bacteria | 7203 |
| 855 | Ga0307412_10088494 | 3300031911 | Bacteria | 2160 |
| 856 | Ga0307412_10143230 | 3300031911 | Bacteria | 1753 |
| 857 | Ga0307412_10149070 | 3300031911 | Bacteria | 1723 |
| 858 | Ga0307412_10897320 | 3300031911 | Bacteria | 776 |
| 859 | Ga0307412_10998701 | 3300031911 | Bacteria | 739 |
| 860 | Ga0307409_100054731 | 3300031995 | Bacteria | 3075 |
| 861 | Ga0307409_100120541 | 3300031995 | Bacteria | 2220 |
| 862 | Ga0307409_100468498 | 3300031995 | Bacteria | 1219 |
| 863 | Ga0307409_100499224 | 3300031995 | Bacteria | 1184 |
| 864 | Ga0307409_101199490 | 3300031995 | Bacteria | 782 |
| 865 | Ga0307409_101523219 | 3300031995 | Bacteria | 696 |
| 866 | Ga0307409_101984172 | 3300031995 | Bacteria | 611 |
| 867 | Ga0307416_100005600 | 3300032002 | Bacteria | 7741 |
| 868 | Ga0307416_100007111 | 3300032002 | Bacteria | 7076 |
| 869 | Ga0307416_100015206 | 3300032002 | Bacteria | 5305 |
| 870 | Ga0307416_100343007 | 3300032002 | Bacteria | 1508 |
| 871 | Ga0307416_100420483 | 3300032002 | Bacteria | 1380 |
| 872 | Ga0307416_100716940 | 3300032002 | Bacteria | 1090 |
| 873 | Ga0307416_100904952 | 3300032002 | Bacteria | 982 |
| 874 | Ga0307416_101291913 | 3300032002 | Bacteria | 835 |
| 875 | Ga0307414_10000117 | 3300032004 | Bacteria | 56697 |
| 876 | Ga0307414_10013980 | 3300032004 | Bacteria | 4795 |
| 877 | Ga0307414_10017211 | 3300032004 | Bacteria | 4416 |
| 878 | Ga0307414_10313918 | 3300032004 | Bacteria | 1331 |
| 879 | Ga0307414_10667321 | 3300032004 | Bacteria | 938 |
| 880 | Ga0307414_10708957 | 3300032004 | Bacteria | 911 |
| 881 | Ga0307414_11089132 | 3300032004 | Bacteria | 737 |
| 882 | Ga0307411_10016991 | 3300032005 | Bacteria | 4132 |
| 883 | Ga0307411_10118140 | 3300032005 | Bacteria | 1912 |
| 884 | Ga0307411_10191187 | 3300032005 | Bacteria | 1563 |
| 885 | Ga0307411_10202406 | 3300032005 | Bacteria | 1526 |
| 886 | Ga0307411_10279700 | 3300032005 | Bacteria | 1327 |
| 887 | Ga0307411_10319906 | 3300032005 | Bacteria | 1252 |
| 888 | Ga0307411_10469979 | 3300032005 | Bacteria | 1056 |
| 889 | Ga0307411_10831451 | 3300032005 | Bacteria | 815 |
| 890 | Ga0307411_10911586 | 3300032005 | Bacteria | 781 |
| 891 | Ga0307411_11536867 | 3300032005 | Bacteria | 612 |
| 892 | Ga0307411_11542581 | 3300032005 | Bacteria | 611 |
| 893 | Ga0307415_100006247 | 3300032126 | Bacteria | 6400 |
| 894 | Ga0307415_100011564 | 3300032126 | Bacteria | 5056 |
| 895 | Ga0307415_100013332 | 3300032126 | Bacteria | 4795 |
| 896 | Ga0307415_100169143 | 3300032126 | Bacteria | 1702 |
| 897 | Ga0307415_100188481 | 3300032126 | Bacteria | 1625 |
| 898 | Ga0307415_101289550 | 3300032126 | Bacteria | 691 |
| 899 | Ga0307415_101311329 | 3300032126 | Bacteria | 686 |
| 900 | Ga0307415_101478990 | 3300032126 | Bacteria | 649 |
| 901 | Ga0307415_101868588 | 3300032126 | Bacteria | 582 |
| 902 | Ga0316593_10137165 | 3300032168 | Bacteria | 885 |
| 903 | Ga0307510_10013278 | 3300033180 | Bacteria | 9767 |
| 904 | Ga0307510_10212732 | 3300033180 | Bacteria | 1454 |
| 905 | Ga0373950_0157713 | 3300034818 | Bacteria | 523 |
| 906 | Ga0373949_0162496 | 3300035090 | Bacteria | 652 |
| 907 | Ga0373949_0282794 | 3300035090 | Bacteria | 522 |
| 908 | Ga0373939_0036939 | 3300035114 | Bacteria | 1448 |
| 909 | Ga0373943_0861582 | 3300035170 | Bacteria | 540 |
| 910 | Ga0373955_0225626 | 3300035172 | Bacteria | 1120 |
| 911 | Ga0373962_0088605 | 3300035242 | Bacteria | 950 |
| 912 | Ga0373931_0034960 | 3300035691 | Bacteria | 2610 |
| 913 | Ga0316584_0035209 | 3300036712 | Bacteria | 3715 |
| 914 | Ga0373925_1046502 | 3300037068 | Bacteria | 672 |
| 915 | Ga0395899_0007143 | 3300037312 | Bacteria | 8642 |
| 916 | Ga0395899_0029552 | 3300037312 | Bacteria | 4122 |
| 917 | Ga0395900_0022460 | 3300037418 | Bacteria | 6452 |
| 918 | Ga0395900_0031276 | 3300037418 | Bacteria | 5467 |
| 919 | Ga0395900_0050225 | 3300037418 | Bacteria | 4296 |
| 920 | Ga0395900_0401581 | 3300037418 | Bacteria | 1334 |
| 921 | Ga0395900_0735156 | 3300037418 | Bacteria | 918 |
| 922 | Ga0395898_0017917 | 3300037466 | Bacteria | 7225 |
| 923 | Ga0395898_0381662 | 3300037466 | Bacteria | 1344 |
| 924 | Ga0395898_0522393 | 3300037466 | Bacteria | 1128 |
| 925 | Ga0395898_0653944 | 3300037466 | Bacteria | 993 |
| 926 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 927 | Ga0395905_0035925 | 3300037471 | Bacteria | 4653 |
| 928 | Ga0395905_0173828 | 3300037471 | Bacteria | 2023 |
| 929 | Ga0395905_0194372 | 3300037471 | Bacteria | 1903 |
| 930 | Ga0395905_0274258 | 3300037471 | Bacteria | 1573 |
| 931 | Ga0395905_0328510 | 3300037471 | Bacteria | 1419 |
| 932 | Ga0395905_0362780 | 3300037471 | Bacteria | 1341 |
| 933 | Ga0395905_0478760 | 3300037471 | Bacteria | 1144 |
| 934 | Ga0395905_0507598 | 3300037471 | Bacteria | 1106 |
| 935 | Ga0395905_0632069 | 3300037471 | Bacteria | 972 |
| 936 | Ga0395905_0958577 | 3300037471 | Bacteria | 758 |
| 937 | Ga0436364_1065372 | 3300037853 | Bacteria | 196587 |
| 938 | Ga0395901_0029243 | 3300038443 | Bacteria | 5670 |
| 939 | Ga0395901_0052641 | 3300038443 | Bacteria | 4231 |
| 940 | Ga0395901_0053759 | 3300038443 | Bacteria | 4184 |
| 941 | Ga0395901_0263263 | 3300038443 | Bacteria | 1794 |
| 942 | Ga0395901_0598300 | 3300038443 | Bacteria | 1112 |
| 943 | Ga0395901_1159643 | 3300038443 | Bacteria | 740 |
| 944 | Ga0395901_2044905 | 3300038443 | Bacteria | 518 |
| 945 | Ga0400486_32139 | 3300038742 | Bacteria | 2745 |
| 946 | Ga0436365_1297965 | 3300039437 | Bacteria | 1126 |
| 947 | Ga0436365_1769134 | 3300039437 | Bacteria | 517 |
| 948 | Ga0436363_1100502 | 3300039450 | Bacteria | 846 |
| 949 | Ga0436362_0798514 | 3300039453 | Bacteria | 3452 |
| 950 | Ga0439453_0061634 | 3300041408 | Bacteria | 778 |
| 951 | Ga0439465_0070568 | 3300041413 | Bacteria | 1170 |
| 952 | Ga0439465_0156571 | 3300041413 | Bacteria | 816 |
| 953 | Ga0451787_390226 | 3300041441 | Bacteria | 553 |
| 954 | Ga0451790_00316 | 3300041444 | Bacteria | 630 |
| 955 | Ga0451791_0503248 | 3300041451 | Bacteria | 653 |
| 956 | Ga0451791_1104984 | 3300041451 | Bacteria | 563 |
| 957 | Ga0451793_0741227 | 3300041452 | Bacteria | 883 |
| 958 | Ga0451793_1374280 | 3300041452 | Bacteria | 577 |
| 959 | Ga0451798_0619513 | 3300041458 | Bacteria | 687 |
| 960 | Ga0451802_2082364 | 3300041460 | Bacteria | 1377 |
| 961 | Ga0451806_470971 | 3300041462 | Bacteria | 943 |
| 962 | Ga0451806_566321 | 3300041462 | Bacteria | 790 |
| 963 | Ga0451807_0886460 | 3300041486 | Bacteria | 770 |
| 964 | Ga0451833_0002658 | 3300041491 | Bacteria | 864 |
| 965 | Ga0451833_1375293 | 3300041491 | Bacteria | 558 |
| 966 | Ga0451835_0084593 | 3300041492 | Bacteria | 687 |
| 967 | Ga0451835_0542372 | 3300041492 | Bacteria | 634 |
| 968 | Ga0451837_0693834 | 3300041494 | Bacteria | 519 |
| 969 | Ga0451845_0970488 | 3300041501 | Bacteria | 525 |
| 970 | Ga0451851_0815981 | 3300041507 | Bacteria | 638 |
| 971 | Ga0451855_1317451 | 3300041511 | Bacteria | 570 |
| 972 | Ga0451855_1380188 | 3300041511 | Bacteria | 995 |
| 973 | Ga0451853_3932357 | 3300041512 | Bacteria | 751 |
| 974 | Ga0439433_0025105 | 3300041999 | Bacteria | 1345 |
| 975 | Ga0439441_020693 | 3300042001 | Bacteria | 1208 |
| 976 | Ga0439445_0002249 | 3300042004 | Bacteria | 4286 |
| 977 | Ga0439448_0055818 | 3300042005 | Bacteria | 1299 |
| 978 | Ga0439432_106712 | 3300042006 | Bacteria | 835 |
| 979 | Ga0439449_0044016 | 3300042007 | Bacteria | 1656 |
| 980 | Ga0439450_019689 | 3300042008 | Bacteria | 1433 |
| 981 | Ga0439454_067357 | 3300042011 | Bacteria | 630 |
| 982 | Ga0439455_0078878 | 3300042012 | Bacteria | 893 |
| 983 | Ga0450912_000406 | 3300042116 | Bacteria | 2080 |
| 984 | Ga0450917_002616 | 3300042120 | Bacteria | 1290 |
| 985 | Ga0450920_018839 | 3300042122 | Bacteria | 1323 |
| 986 | Ga0450923_015818 | 3300042125 | Bacteria | 1415 |
| 987 | Ga0450894_042600 | 3300042131 | Bacteria | 655 |
| 988 | Ga0450902_055233 | 3300042137 | Bacteria | 684 |
| 989 | Ga0450906_019463 | 3300042145 | Bacteria | 1217 |
| 990 | Ga0439446_0145971 | 3300042156 | Bacteria | 775 |
| 991 | Ga0450918_033244 | 3300042531 | Bacteria | 914 |
| 992 | Ga0451577_0708206 | 3300042876 | Bacteria | 912 |
| 993 | Ga0451577_0940419 | 3300042876 | Bacteria | 777 |
| 994 | Ga0439440_0221149 | 3300042993 | Bacteria | 568 |
| 995 | Ga0466969_0076277 | 3300044656 | Bacteria | 1606 |
| 996 | Ga0466972_0196342 | 3300044658 | Bacteria | 946 |
| 997 | Ga0466972_0209711 | 3300044658 | Bacteria | 912 |
| 998 | Ga0466966_0213565 | 3300044684 | Bacteria | 1165 |
| 999 | Ga0466961_0562513 | 3300044693 | Bacteria | 686 |
| 1000 | Ga0453684_0153114 | 3300044712 | Bacteria | 2737 |
| 1001 | Ga0453684_0589010 | 3300044712 | Bacteria | 1220 |
| 1002 | Ga0466971_0372534 | 3300044719 | Bacteria | 693 |
| 1003 | Ga0466968_0010999 | 3300044735 | Bacteria | 3517 |
| 1004 | Ga0466968_0250288 | 3300044735 | Bacteria | 841 |
| 1005 | Ga0466957_0077343 | 3300044842 | Bacteria | 2067 |
| 1006 | Ga0466957_0553996 | 3300044842 | Bacteria | 801 |
| 1007 | Ga0466957_1061208 | 3300044842 | Bacteria | 583 |
| 1008 | Ga0466960_0738413 | 3300044901 | Bacteria | 593 |
| 1009 | Ga0466959_0263063 | 3300045049 | Bacteria | 1187 |
| 1010 | Ga0466959_0289265 | 3300045049 | Bacteria | 1123 |
| 1011 | Ga0451576_2139109 | 3300045051 | Bacteria | 575 |
| 1012 | Ga0466958_0451214 | 3300045836 | Bacteria | 832 |
| 1013 | Ga0466958_0765460 | 3300045836 | Bacteria | 629 |
| 1014 | Ga0466967_0407001 | 3300045976 | Bacteria | 1324 |
| 1015 | Ga0466967_2488322 | 3300045976 | Bacteria | 513 |
| 1016 | Ga0495590_0158635 | 3300046457 | Bacteria | 822 |
| 1017 | Ga0495590_0241931 | 3300046457 | Bacteria | 670 |
| 1018 | Ga0495638_0115483 | 3300046460 | Bacteria | 1591 |
| 1019 | Ga0495638_0593218 | 3300046460 | Bacteria | 545 |
| 1020 | Ga0495638_0606663 | 3300046460 | Bacteria | 537 |
| 1021 | Ga0495650_0143718 | 3300046471 | Bacteria | 861 |
| 1022 | Ga0495584_0131949 | 3300046491 | Bacteria | 1267 |
| 1023 | Ga0495596_0112786 | 3300046500 | Bacteria | 1056 |
| 1024 | Ga0495632_0246087 | 3300046519 | Bacteria | 803 |
| 1025 | Ga0495632_0312770 | 3300046519 | Bacteria | 695 |
| 1026 | Ga0495663_0078113 | 3300046525 | Bacteria | 1062 |
| 1027 | Ga0495642_0576188 | 3300046528 | Bacteria | 500 |
| 1028 | Ga0495598_0403631 | 3300046537 | Bacteria | 534 |
| 1029 | Ga0495621_0277072 | 3300046539 | Bacteria | 690 |
| 1030 | Ga0495597_0229089 | 3300046542 | Bacteria | 736 |
| 1031 | Ga0495622_0322808 | 3300046557 | Bacteria | 671 |
| 1032 | Ga0495668_0150942 | 3300046616 | Bacteria | 1272 |
| 1033 | Ga0495668_0166107 | 3300046616 | Bacteria | 1209 |
| 1034 | Ga0495668_0280848 | 3300046616 | Bacteria | 912 |
| 1035 | Ga0495668_0416197 | 3300046616 | Bacteria | 739 |
| 1036 | Ga0495669_0116862 | 3300046684 | Bacteria | 1248 |
| 1037 | Ga0495669_0410406 | 3300046684 | Bacteria | 657 |
| 1038 | Ga0495670_0015418 | 3300046691 | Bacteria | 3755 |
| 1039 | Ga0495670_0357840 | 3300046691 | Bacteria | 786 |
| 1040 | Ga0495649_0097490 | 3300046694 | Bacteria | 1564 |
| 1041 | Ga0495589_0122273 | 3300046794 | Bacteria | 1253 |
| 1042 | Ga0495589_0293318 | 3300046794 | Bacteria | 755 |
| 1043 | Ga0495672_0380130 | 3300047320 | Bacteria | 650 |
| 1044 | Ga0495683_0246985 | 3300047323 | Bacteria | 785 |
| 1045 | Ga0495677_0218494 | 3300047445 | Bacteria | 742 |
| 1046 | Ga0495685_217507 | 3300047447 | Bacteria | 610 |
| 1047 | Ga0495673_0098949 | 3300047469 | Bacteria | 1182 |
| 1048 | Ga0495681_0063192 | 3300047470 | Bacteria | 1700 |
| 1049 | Ga0495686_0214876 | 3300047472 | Bacteria | 1097 |
| 1050 | Ga0496100_0017887 | 3300048903 | Bacteria | 4193 |
| 1051 | Ga0496100_0042948 | 3300048903 | Bacteria | 2889 |
| 1052 | Ga0496100_0065395 | 3300048903 | Bacteria | 2409 |
| 1053 | Ga0496100_0072649 | 3300048903 | Bacteria | 2300 |
| 1054 | Ga0496100_0100037 | 3300048903 | Bacteria | 1996 |
| 1055 | Ga0496100_0401531 | 3300048903 | Bacteria | 1044 |
| 1056 | Ga0496101_0007782 | 3300048904 | Bacteria | 6963 |
| 1057 | Ga0496101_0013181 | 3300048904 | Bacteria | 5533 |
| 1058 | Ga0496101_0046999 | 3300048904 | Bacteria | 3097 |
| 1059 | Ga0496101_0060073 | 3300048904 | Bacteria | 2757 |
| 1060 | Ga0496101_0105123 | 3300048904 | Bacteria | 2118 |
| 1061 | Ga0496101_0476988 | 3300048904 | Bacteria | 985 |
| 1062 | Ga0496101_0499073 | 3300048904 | Bacteria | 961 |
| 1063 | Ga0496101_0983045 | 3300048904 | Bacteria | 664 |
| 1064 | Ga0496102_0000345 | 3300048905 | Bacteria | 56618 |
| 1065 | Ga0496102_0001880 | 3300048905 | Bacteria | 18093 |
| 1066 | Ga0496102_0038393 | 3300048905 | Bacteria | 4321 |
| 1067 | Ga0496102_0321597 | 3300048905 | Bacteria | 1457 |
| 1068 | Ga0496102_0362700 | 3300048905 | Bacteria | 1364 |
| 1069 | Ga0496103_0000110 | 3300048906 | Bacteria | 90202 |
| 1070 | Ga0496103_0000276 | 3300048906 | Bacteria | 48842 |
| 1071 | Ga0496103_0010156 | 3300048906 | Bacteria | 5567 |
| 1072 | Ga0496103_0030798 | 3300048906 | Bacteria | 3266 |
| 1073 | Ga0496103_0064863 | 3300048906 | Bacteria | 2277 |
| 1074 | Ga0496103_0193874 | 3300048906 | Bacteria | 1306 |
| 1075 | Ga0496103_0211450 | 3300048906 | Bacteria | 1247 |
| 1076 | Ga0496104_0000047 | 3300048907 | Bacteria | 148896 |
| 1077 | Ga0496104_0015109 | 3300048907 | Bacteria | 6988 |
| 1078 | Ga0496104_0045259 | 3300048907 | Bacteria | 4138 |
| 1079 | Ga0496104_0171951 | 3300048907 | Bacteria | 2077 |
| 1080 | Ga0496104_0471527 | 3300048907 | Bacteria | 1167 |
| 1081 | Ga0496104_1079821 | 3300048907 | Bacteria | 706 |
| 1082 | Ga0496105_0000034 | 3300048908 | Bacteria | 127505 |
| 1083 | Ga0496105_0013990 | 3300048908 | Bacteria | 6382 |
| 1084 | Ga0496105_0071727 | 3300048908 | Bacteria | 2862 |
| 1085 | Ga0496105_0074994 | 3300048908 | Bacteria | 2794 |
| 1086 | Ga0496106_0004127 | 3300048909 | Bacteria | 10825 |
| 1087 | Ga0496106_0087648 | 3300048909 | Bacteria | 2398 |
| 1088 | Ga0496106_0192678 | 3300048909 | Bacteria | 1621 |
| 1089 | Ga0496106_0538407 | 3300048909 | Bacteria | 937 |
| 1090 | Ga0496106_0600882 | 3300048909 | Bacteria | 881 |
| 1091 | Ga0496106_0831324 | 3300048909 | Bacteria | 732 |
| 1092 | Ga0496107_0002978 | 3300048910 | Bacteria | 11215 |
| 1093 | Ga0496107_0065334 | 3300048910 | Bacteria | 2637 |
| 1094 | Ga0496107_0075313 | 3300048910 | Bacteria | 2456 |
| 1095 | Ga0496107_0092297 | 3300048910 | Bacteria | 2213 |
| 1096 | Ga0496107_0114521 | 3300048910 | Bacteria | 1984 |
| 1097 | Ga0496107_0574145 | 3300048910 | Bacteria | 834 |
| 1098 | Ga0496108_0017449 | 3300048911 | Bacteria | 5873 |
| 1099 | Ga0496108_0247391 | 3300048911 | Bacteria | 1551 |
| 1100 | Ga0496109_0006427 | 3300048912 | Bacteria | 9898 |
| 1101 | Ga0496109_0012139 | 3300048912 | Bacteria | 7430 |
| 1102 | Ga0496109_0017285 | 3300048912 | Bacteria | 6317 |
| 1103 | Ga0496109_0347268 | 3300048912 | Bacteria | 1401 |
| 1104 | Ga0496109_0444060 | 3300048912 | Bacteria | 1225 |
| 1105 | Ga0496109_0451919 | 3300048912 | Bacteria | 1213 |
| 1106 | Ga0496110_0032770 | 3300048913 | Bacteria | 4491 |
| 1107 | Ga0496110_0310814 | 3300048913 | Bacteria | 1435 |
| 1108 | Ga0496110_0516261 | 3300048913 | Bacteria | 1087 |
| 1109 | Ga0496110_0712834 | 3300048913 | Bacteria | 905 |
| 1110 | Ga0496110_0958406 | 3300048913 | Bacteria | 762 |
| 1111 | Ga0496111_0056586 | 3300048914 | Bacteria | 2837 |
| 1112 | Ga0496111_0515411 | 3300048914 | Bacteria | 880 |
| 1113 | Ga0496111_0535498 | 3300048914 | Bacteria | 860 |
| 1114 | Ga0496111_1019852 | 3300048914 | Bacteria | 592 |
| 1115 | Ga0496112_0030279 | 3300048915 | Bacteria | 5236 |
| 1116 | Ga0496112_0038752 | 3300048915 | Bacteria | 4655 |
| 1117 | Ga0496112_0046698 | 3300048915 | Bacteria | 4248 |
| 1118 | Ga0496112_0094664 | 3300048915 | Bacteria | 2957 |
| 1119 | Ga0496113_0011540 | 3300048916 | Bacteria | 5901 |
| 1120 | Ga0496113_0011673 | 3300048916 | Bacteria | 5875 |
| 1121 | Ga0496113_0014734 | 3300048916 | Bacteria | 5347 |
| 1122 | Ga0496113_0086466 | 3300048916 | Bacteria | 2409 |
| 1123 | Ga0496113_1320023 | 3300048916 | Bacteria | 561 |
| 1124 | Ga0496114_0029773 | 3300048917 | Bacteria | 4488 |
| 1125 | Ga0496114_0062704 | 3300048917 | Bacteria | 3111 |
| 1126 | Ga0496114_0104199 | 3300048917 | Bacteria | 2425 |
| 1127 | Ga0496114_0267595 | 3300048917 | Bacteria | 1506 |
| 1128 | Ga0496114_0475808 | 3300048917 | Bacteria | 1105 |
| 1129 | Ga0496115_0007121 | 3300048918 | Bacteria | 8213 |
| 1130 | Ga0496115_0030807 | 3300048918 | Bacteria | 4223 |
| 1131 | Ga0496115_0179827 | 3300048918 | Bacteria | 1749 |
| 1132 | Ga0496115_0563570 | 3300048918 | Bacteria | 909 |
| 1133 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 1134 | Ga0496116_0006727 | 3300048919 | Bacteria | 10350 |
| 1135 | Ga0496116_0162835 | 3300048919 | Bacteria | 1221 |
| 1136 | Ga0496116_0478282 | 3300048919 | Bacteria | 525 |
| 1137 | Ga0496117_0000146 | 3300048920 | Bacteria | 152244 |
| 1138 | Ga0496117_0000633 | 3300048920 | Bacteria | 56618 |
| 1139 | Ga0496117_0056690 | 3300048920 | Bacteria | 2727 |
| 1140 | Ga0496117_0104942 | 3300048920 | Bacteria | 1777 |
| 1141 | Ga0496117_0198027 | 3300048920 | Bacteria | 1137 |
| 1142 | Ga0496118_0000654 | 3300048921 | Bacteria | 56618 |
| 1143 | Ga0496118_0001846 | 3300048921 | Bacteria | 30336 |
| 1144 | Ga0496118_0083807 | 3300048921 | Bacteria | 2227 |
| 1145 | Ga0496119_0000057 | 3300048922 | Bacteria | 173746 |
| 1146 | Ga0496119_0107924 | 3300048922 | Bacteria | 1551 |
| 1147 | Ga0496120_0000686 | 3300048923 | Bacteria | 49719 |
| 1148 | Ga0496121_0002302 | 3300048924 | Bacteria | 29625 |
| 1149 | Ga0496121_0004567 | 3300048924 | Bacteria | 18461 |
| 1150 | Ga0496121_0127343 | 3300048924 | Bacteria | 1912 |
| 1151 | Ga0496122_0000723 | 3300048925 | Bacteria | 64694 |
| 1152 | Ga0496122_0009631 | 3300048925 | Bacteria | 10115 |
| 1153 | Ga0496122_0115844 | 3300048925 | Bacteria | 1744 |
| 1154 | Ga0496123_0003623 | 3300048926 | Bacteria | 17095 |
| 1155 | Ga0496123_0005637 | 3300048926 | Bacteria | 12503 |
| 1156 | Ga0496123_0072757 | 3300048926 | Bacteria | 2137 |
| 1157 | Ga0496124_0000664 | 3300048927 | Bacteria | 56618 |
| 1158 | Ga0496124_0005247 | 3300048927 | Bacteria | 14676 |
| 1159 | Ga0496124_0005829 | 3300048927 | Bacteria | 13673 |
| 1160 | Ga0496124_0008523 | 3300048927 | Bacteria | 10701 |
| 1161 | Ga0496124_0061846 | 3300048927 | Bacteria | 3136 |
| 1162 | Ga0496124_0299375 | 3300048927 | Bacteria | 1163 |
| 1163 | Ga0496125_0003283 | 3300048928 | Bacteria | 19867 |
| 1164 | Ga0496125_0018829 | 3300048928 | Bacteria | 6538 |
| 1165 | Ga0496125_0035566 | 3300048928 | Bacteria | 4365 |
| 1166 | Ga0496125_0038992 | 3300048928 | Bacteria | 4100 |
| 1167 | Ga0496125_0152988 | 3300048928 | Bacteria | 1581 |
| 1168 | Ga0496125_0377163 | 3300048928 | Bacteria | 837 |
| 1169 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 1170 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 1171 | Ga0496126_0049088 | 3300048929 | Bacteria | 3854 |
| 1172 | Ga0496126_0396529 | 3300048929 | Bacteria | 1120 |
| 1173 | Ga0501306_028173 | 3300049127 | Bacteria | 821 |
| 1174 | Ga0501306_048947 | 3300049127 | Bacteria | 674 |
| 1175 | Ga0501306_051230 | 3300049127 | Bacteria | 662 |
| 1176 | Ga0501305_057482 | 3300049161 | Bacteria | 664 |
| 1177 | Ga0501305_116221 | 3300049161 | Bacteria | 510 |
| 1178 | Ga0501307_077067 | 3300049162 | Bacteria | 539 |
| 1179 | Ga0501312_018590 | 3300049528 | Bacteria | 1013 |
| 1180 | Ga0501312_074784 | 3300049528 | Bacteria | 605 |
| 1181 | Ga0501314_000002 | 3300049530 | Bacteria | 13192 |
| 1182 | Ga0501315_017306 | 3300049531 | Bacteria | 941 |
| 1183 | Ga0501317_019109 | 3300049533 | Bacteria | 912 |
| 1184 | Ga0501317_055003 | 3300049533 | Bacteria | 641 |
| 1185 | Ga0501323_031592 | 3300049539 | Bacteria | 746 |
| 1186 | Ga0501323_088693 | 3300049539 | Bacteria | 513 |
| 1187 | Ga0501335_007167 | 3300049551 | Bacteria | 1026 |
| 1188 | Ga0501335_014667 | 3300049551 | Bacteria | 793 |
| 1189 | Ga0501031_0126555 | 3300049568 | Bacteria | 1669 |
| 1190 | Ga0501031_0241885 | 3300049568 | Bacteria | 1173 |
| 1191 | Ga0501031_0765269 | 3300049568 | Bacteria | 619 |
| 1192 | Ga0501032_0208418 | 3300049569 | Bacteria | 1275 |
| 1193 | Ga0501032_0415952 | 3300049569 | Bacteria | 863 |
| 1194 | Ga0501032_0508991 | 3300049569 | Bacteria | 769 |
| 1195 | Ga0501033_0172227 | 3300049570 | Bacteria | 1554 |
| 1196 | Ga0501033_0270797 | 3300049570 | Bacteria | 1200 |
| 1197 | Ga0501033_0281342 | 3300049570 | Bacteria | 1174 |
| 1198 | Ga0501033_0838230 | 3300049570 | Bacteria | 620 |
| 1199 | Ga0501034_0025412 | 3300049571 | Bacteria | 6029 |
| 1200 | Ga0501034_0247035 | 3300049571 | Bacteria | 1729 |
| 1201 | Ga0501034_0478339 | 3300049571 | Bacteria | 1161 |
| 1202 | Ga0501034_0729840 | 3300049571 | Bacteria | 887 |
| 1203 | Ga0501036_0018306 | 3300049572 | Bacteria | 5865 |
| 1204 | Ga0501036_0042635 | 3300049572 | Bacteria | 3841 |
| 1205 | Ga0501036_0165512 | 3300049572 | Bacteria | 1864 |
| 1206 | Ga0501036_0813227 | 3300049572 | Bacteria | 769 |
| 1207 | Ga0501037_0138294 | 3300049573 | Bacteria | 1744 |
| 1208 | Ga0501037_0194822 | 3300049573 | Bacteria | 1434 |
| 1209 | Ga0501037_0268954 | 3300049573 | Bacteria | 1190 |
| 1210 | Ga0501037_0668128 | 3300049573 | Bacteria | 693 |
| 1211 | Ga0501037_0848222 | 3300049573 | Bacteria | 601 |
| 1212 | Ga0501038_0078858 | 3300049574 | Bacteria | 2778 |
| 1213 | Ga0501038_0099119 | 3300049574 | Bacteria | 2429 |
| 1214 | Ga0501038_0460347 | 3300049574 | Bacteria | 977 |
| 1215 | Ga0501038_0708435 | 3300049574 | Bacteria | 754 |
| 1216 | Ga0501039_0099065 | 3300049575 | Bacteria | 2274 |
| 1217 | Ga0501039_1017715 | 3300049575 | Bacteria | 643 |
| 1218 | Ga0501040_0092275 | 3300049576 | Bacteria | 2105 |
| 1219 | Ga0501040_0099905 | 3300049576 | Bacteria | 2022 |
| 1220 | Ga0501041_0030131 | 3300049577 | Bacteria | 3275 |
| 1221 | Ga0501041_0078054 | 3300049577 | Bacteria | 2037 |
| 1222 | Ga0501042_0049150 | 3300049578 | Bacteria | 3008 |
| 1223 | Ga0501042_0217545 | 3300049578 | Bacteria | 1378 |
| 1224 | Ga0501042_1082022 | 3300049578 | Bacteria | 584 |
| 1225 | Ga0501042_1145601 | 3300049578 | Bacteria | 567 |
| 1226 | Ga0501043_0303623 | 3300049579 | Bacteria | 1219 |
| 1227 | Ga0501043_0449366 | 3300049579 | Bacteria | 968 |
| 1228 | Ga0501043_0454212 | 3300049579 | Bacteria | 962 |
| 1229 | Ga0501046_0013319 | 3300049580 | Bacteria | 6966 |
| 1230 | Ga0501046_0084789 | 3300049580 | Bacteria | 2443 |
| 1231 | Ga0501046_0661801 | 3300049580 | Bacteria | 738 |
| 1232 | Ga0501047_0343378 | 3300049581 | Bacteria | 1330 |
| 1233 | Ga0501047_0514337 | 3300049581 | Bacteria | 1023 |
| 1234 | Ga0501047_0960007 | 3300049581 | Bacteria | 668 |
| 1235 | Ga0501048_0229422 | 3300049582 | Bacteria | 1317 |
| 1236 | Ga0501048_0253661 | 3300049582 | Bacteria | 1249 |
| 1237 | Ga0501048_0686070 | 3300049582 | Bacteria | 735 |
| 1238 | Ga0501048_1305937 | 3300049582 | Bacteria | 522 |
| 1239 | Ga0501067_0019787 | 3300049583 | Bacteria | 3726 |
| 1240 | Ga0501067_0207443 | 3300049583 | Bacteria | 1091 |
| 1241 | Ga0501068_0030631 | 3300049584 | Bacteria | 3193 |
| 1242 | Ga0501068_0122438 | 3300049584 | Bacteria | 1623 |
| 1243 | Ga0501068_0582926 | 3300049584 | Bacteria | 728 |
| 1244 | Ga0501069_0010393 | 3300049585 | Bacteria | 4925 |
| 1245 | Ga0501069_0488905 | 3300049585 | Bacteria | 734 |
| 1246 | Ga0501069_0776948 | 3300049585 | Bacteria | 580 |
| 1247 | Ga0501070_0014243 | 3300049586 | Bacteria | 6692 |
| 1248 | Ga0501070_0371806 | 3300049586 | Bacteria | 1159 |
| 1249 | Ga0501070_0587267 | 3300049586 | Bacteria | 889 |
| 1250 | Ga0501070_0911750 | 3300049586 | Bacteria | 685 |
| 1251 | Ga0501070_1180823 | 3300049586 | Bacteria | 588 |
| 1252 | Ga0501071_0017063 | 3300049587 | Bacteria | 5001 |
| 1253 | Ga0501071_0330706 | 3300049587 | Bacteria | 1158 |
| 1254 | Ga0501072_0025429 | 3300049588 | Bacteria | 4612 |
| 1255 | Ga0501072_0242569 | 3300049588 | Bacteria | 1435 |
| 1256 | Ga0501072_0245070 | 3300049588 | Bacteria | 1427 |
| 1257 | Ga0501072_0900024 | 3300049588 | Bacteria | 691 |
| 1258 | Ga0501074_0110230 | 3300049590 | Bacteria | 1969 |
| 1259 | Ga0501074_0610191 | 3300049590 | Bacteria | 771 |
| 1260 | Ga0501074_0887198 | 3300049590 | Bacteria | 628 |
| 1261 | Ga0501075_0013808 | 3300049591 | Bacteria | 5774 |
| 1262 | Ga0501075_0224856 | 3300049591 | Bacteria | 1431 |
| 1263 | Ga0501076_0000421 | 3300049592 | Bacteria | 26662 |
| 1264 | Ga0501076_0094632 | 3300049592 | Bacteria | 2405 |
| 1265 | Ga0501076_0733278 | 3300049592 | Bacteria | 816 |
| 1266 | Ga0501076_0965506 | 3300049592 | Bacteria | 702 |
| 1267 | Ga0501077_0022721 | 3300049593 | Bacteria | 3974 |
| 1268 | Ga0501077_0067033 | 3300049593 | Bacteria | 2276 |
| 1269 | Ga0501223_000394 | 3300049663 | Bacteria | 10743 |
| 1270 | Ga0501224_000009 | 3300049664 | Bacteria | 107191 |
| 1271 | Ga0501233_000604 | 3300049668 | Bacteria | 5865 |
| 1272 | Ga0501235_004379 | 3300049669 | Bacteria | 3054 |
| 1273 | Ga0501239_007192 | 3300049672 | Bacteria | 1161 |
| 1274 | Ga0501252_066287 | 3300049682 | Bacteria | 574 |
| 1275 | Ga0501257_074213 | 3300049686 | Bacteria | 872 |
| 1276 | Ga0501259_155413 | 3300049688 | Bacteria | 569 |
| 1277 | Ga0501225_0000094 | 3300049705 | Bacteria | 28402 |
| 1278 | Ga0501079_0013561 | 3300049741 | Bacteria | 6216 |
| 1279 | Ga0501079_0166268 | 3300049741 | Bacteria | 1720 |
| 1280 | Ga0501079_0439844 | 3300049741 | Bacteria | 1024 |
| 1281 | Ga0501079_1267185 | 3300049741 | Bacteria | 580 |
| 1282 | Ga0501080_0027711 | 3300049742 | Bacteria | 5268 |
| 1283 | Ga0501080_0306890 | 3300049742 | Bacteria | 1439 |
| 1284 | Ga0501081_0063944 | 3300049743 | Bacteria | 2554 |
| 1285 | Ga0501081_0207993 | 3300049743 | Bacteria | 1420 |
| 1286 | Ga0501083_0027038 | 3300049744 | Bacteria | 3961 |
| 1287 | Ga0501083_0121106 | 3300049744 | Bacteria | 1716 |
| 1288 | Ga0501083_0122165 | 3300049744 | Bacteria | 1708 |
| 1289 | Ga0501268_060531 | 3300049765 | Bacteria | 749 |
| 1290 | Ga0501270_042241 | 3300049767 | Bacteria | 798 |
| 1291 | Ga0501035_0331354 | 3300049822 | Bacteria | 1277 |
| 1292 | Ga0501035_0571172 | 3300049822 | Bacteria | 924 |
| 1293 | Ga0501044_0032239 | 3300049823 | Bacteria | 5509 |
| 1294 | Ga0501044_0791978 | 3300049823 | Bacteria | 828 |
| 1295 | Ga0501044_0937891 | 3300049823 | Bacteria | 739 |
| 1296 | Ga0501045_0139388 | 3300049824 | Bacteria | 1803 |
| 1297 | Ga0501045_0323542 | 3300049824 | Bacteria | 1147 |
| 1298 | Ga0501045_0873588 | 3300049824 | Bacteria | 661 |
| 1299 | Ga0501226_000076 | 3300049853 | Bacteria | 29950 |
| 1300 | nmdc:mga03683_31_c1 | 3300050489 | Bacteria | 69502 |
| 1301 | nmdc:mga03683_47433_c1 | 3300050489 | Bacteria | 1783 |
| 1302 | nmdc:mga03n38_4566_c1 | 3300050490 | Bacteria | 4608 |
| 1303 | nmdc:mga00v17_110640_c1 | 3300050491 | Bacteria | 1742 |
| 1304 | nmdc:mga0yw44_461045_c2 | 3300050492 | Bacteria | 500 |
| 1305 | nmdc:mga0yw44_767745_c1 | 3300050492 | Bacteria | 655 |
| 1306 | nmdc:mga0k408_125335_c2 | 3300050493 | Bacteria | 734 |
| 1307 | nmdc:mga0k408_538_c1 | 3300050493 | Bacteria | 20859 |
| 1308 | nmdc:mga06z11_260048_c1 | 3300050494 | Bacteria | 1024 |
| 1309 | nmdc:mga07m45_176045_c1 | 3300050496 | Bacteria | 1244 |
| 1310 | nmdc:mga07m45_19_c1 | 3300050496 | Bacteria | 133476 |
| 1311 | nmdc:mga07m45_406701_c1 | 3300050496 | Bacteria | 790 |
| 1312 | nmdc:mga07m45_745415_c1 | 3300050496 | Bacteria | 562 |
| 1313 | nmdc:mga05p37_49513_c1 | 3300050507 | Bacteria | 5168 |
| 1314 | nmdc:mga06r32_274856_c1 | 3300050510 | Bacteria | 1672 |
| 1315 | nmdc:mga06r32_328722_c1 | 3300050510 | Bacteria | 1514 |
| 1316 | nmdc:mga08y16_1330190_c1 | 3300050511 | Bacteria | 684 |
| 1317 | nmdc:mga08y16_343991_c1 | 3300050511 | Bacteria | 1533 |
| 1318 | nmdc:mga08y16_531895_c1 | 3300050511 | Bacteria | 1191 |
| 1319 | nmdc:mga0n895_2125338_c1 | 3300050512 | Bacteria | 518 |
| 1320 | nmdc:mga0sz30_17138_c1 | 3300050516 | Bacteria | 2887 |
| 1321 | Ga0500643_013492 | 3300053087 | Bacteria | 2882 |
| 1322 | Ga0500641_0426902 | 3300053096 | Bacteria | 516 |
| 1323 | Ga0500621_165805 | 3300053126 | Bacteria | 815 |
| 1324 | Ga0500588_0155506 | 3300053146 | Bacteria | 829 |
| 1325 | Ga0500616_0047381 | 3300053153 | Bacteria | 2282 |
| 1326 | Ga0500616_0154340 | 3300053153 | Bacteria | 1059 |
| 1327 | Ga0500616_0220183 | 3300053153 | Bacteria | 828 |
| 1328 | Ga0500619_258443 | 3300053154 | Bacteria | 572 |
| 1329 | Ga0500624_000023 | 3300053157 | Bacteria | 114997 |
| 1330 | Ga0500637_0000611 | 3300053178 | Bacteria | 14096 |
| 1331 | Ga0501084_0010490 | 3300054114 | Bacteria | 7658 |
| 1332 | Ga0501084_0098690 | 3300054114 | Bacteria | 2452 |
| 1333 | Ga0501084_0161123 | 3300054114 | Bacteria | 1892 |
| 1334 | Ga0501084_1325812 | 3300054114 | Bacteria | 603 |
| 1335 | Ga0590075_187193 | 3300059424 | Bacteria | 548 |
| 1336 | Ga0587070_038788 | 3300059491 | Bacteria | 901 |
| 1337 | Ga0587070_111858 | 3300059491 | Bacteria | 642 |
| 1338 | Ga0587073_0091319 | 3300059492 | Bacteria | 775 |
| 1339 | Ga0587077_059136 | 3300059493 | Bacteria | 825 |
| 1340 | Ga0587077_081924 | 3300059493 | Bacteria | 742 |
| 1341 | Ga0587077_131644 | 3300059493 | Bacteria | 635 |
| 1342 | Ga0587080_142361 | 3300059503 | Bacteria | 549 |
| 1343 | Ga0587083_0053536 | 3300059505 | Bacteria | 888 |
| 1344 | Ga0587085_149409 | 3300059506 | Bacteria | 537 |
| 1345 | Ga0587109_056339 | 3300059624 | Bacteria | 818 |
| 1346 | Ga0587128_135039 | 3300059630 | Bacteria | 549 |
| 1347 | Ga0587068_017978 | 3300059641 | Bacteria | 1135 |
| 1348 | Ga0587068_065334 | 3300059641 | Bacteria | 708 |
| 1349 | Ga0587072_057219 | 3300059643 | Bacteria | 795 |
| 1350 | Ga0587076_007008 | 3300059645 | Bacteria | 1525 |
| 1351 | Ga0587105_001817 | 3300059651 | Bacteria | 1154 |
| 1352 | Ga0587108_006900 | 3300059653 | Bacteria | 889 |
| 1353 | Ga0587110_030666 | 3300059654 | Bacteria | 654 |
| 1354 | Ga0587071_036914 | 3300060344 | Bacteria | 965 |
| 1355 | Ga0587071_123092 | 3300060344 | Bacteria | 622 |
| 1356 | Ga0587111_0038388 | 3300060346 | Bacteria | 1010 |
| 1357 | Ga0587111_0215808 | 3300060346 | Bacteria | 551 |
| 1358 | Ga0501082_0015085 | 3300060353 | Bacteria | 6656 |
| 1359 | Ga0501082_0016074 | 3300060353 | Bacteria | 6437 |
| 1360 | Ga0501082_0173837 | 3300060353 | Bacteria | 1873 |
| 1361 | Ga0501082_0282211 | 3300060353 | Bacteria | 1445 |
| 1362 | Ga0501082_1793504 | 3300060353 | Bacteria | 535 |
| 1363 | Ga0530510_0006306 | 3300061734 | Bacteria | 8251 |
| 1364 | Ga0530510_0041695 | 3300061734 | Bacteria | 3314 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050489 | nmdc:mga03683_47433_c1 | nmdc:mga03683_47433_c1_1455_1772 | 103 |
| 2 | 3300035090 | Ga0373949_0282794 | Ga0373949_0282794_56_373 | 104 |
| 3 | 3300042993 | Ga0439440_0221149 | Ga0439440_0221149_220_537 | 104 |
| 4 | 3300046519 | Ga0495632_0312770 | Ga0495632_0312770_270_605 | 104 |
| 5 | 3300046616 | Ga0495668_0280848 | Ga0495668_0280848_25_360 | 104 |
| 6 | 3300049578 | Ga0501042_1082022 | Ga0501042_1082022_254_571 | 104 |
| 7 | 3300050510 | nmdc:mga06r32_328722_c1 | nmdc:mga06r32_328722_c1_33_350 | 104 |
| 8 | 3300037466 | Ga0395898_0381662 | Ga0395898_0381662_13_330 | 105 |
| 9 | 3300046537 | Ga0495598_0403631 | Ga0495598_0403631_199_516 | 105 |
| 10 | 3300048916 | Ga0496113_1320023 | Ga0496113_1320023_11_337 | 105 |
| 11 | 3300049533 | Ga0501317_019109 | Ga0501317_019109_581_901 | 105 |
| 12 | 3300049578 | Ga0501042_0217545 | Ga0501042_0217545_48_374 | 105 |
| 13 | 3300049586 | Ga0501070_1180823 | Ga0501070_1180823_36_362 | 105 |
| 14 | 3300050492 | nmdc:mga0yw44_461045_c2 | nmdc:mga0yw44_461045_c2_158_481 | 105 |
| 15 | 3300050496 | nmdc:mga07m45_745415_c1 | nmdc:mga07m45_745415_c1_33_356 | 105 |
| 16 | 3300002067 | JGI24735J21928_10001020 | JGI24735J21928_100010201 | 108 |
| 17 | 3300048904 | Ga0496101_0499073 | Ga0496101_0499073_610_939 | 108 |
| 18 | 3300049822 | Ga0501035_0571172 | Ga0501035_0571172_14_343 | 108 |
| 19 | 3300053126 | Ga0500621_165805 | Ga0500621_165805_11_340 | 108 |
| 20 | 3300027543 | Ga0209999_1045243 | Ga0209999_10452432 | 113 |
| 21 | 3300003781 | Ga0055536_1012782 | Ga0055536_10127823 | 116 |
| 22 | 3300037312 | Ga0395899_0007143 | Ga0395899_0007143_4932_5282 | 116 |
| 23 | 3300037418 | Ga0395900_0050225 | Ga0395900_0050225_1566_1916 | 116 |
| 24 | 3300037466 | Ga0395898_0017917 | Ga0395898_0017917_1401_1751 | 116 |
| 25 | 3300037471 | Ga0395905_0000031 | Ga0395905_0000031_3526_3876 | 116 |
| 26 | 3300038443 | Ga0395901_0053759 | Ga0395901_0053759_1401_1751 | 116 |
| 27 | 3300049161 | Ga0501305_116221 | Ga0501305_116221_14_364 | 116 |
| 28 | 3300049570 | Ga0501033_0838230 | Ga0501033_0838230_10_360 | 116 |
| 29 | 3300049590 | Ga0501074_0887198 | Ga0501074_0887198_14_364 | 116 |
| 30 | 3300048906 | Ga0496103_0211450 | Ga0496103_0211450_558_914 | 118 |
| 31 | 3300038742 | Ga0400486_32139 | Ga0400486_32139_945_1325 | 120 |
| 32 | iso_pu_bacteria | 2510917021 | 2511127733 | 121 |
| 33 | iso_pu_bacteria | 2523231067 | 2523469237 | 121 |
| 34 | iso_pu_bacteria | 2599185359 | 2600225728 | 121 |
| 35 | iso_pu_bacteria | 2643221622 | 2644125945 | 121 |
| 36 | iso_pu_bacteria | 2738541275 | 2738709641 | 121 |
| 37 | iso_pu_bacteria | 2738541301 | 2738848066 | 121 |
| 38 | iso_pu_bacteria | 2738541304 | 2738863795 | 121 |
| 39 | iso_pu_bacteria | 2738543022 | 2739296313 | 121 |
| 40 | iso_pu_bacteria | 2738543031 | 2739347264 | 121 |
| 41 | iso_pu_bacteria | 2738543033 | 2739357991 | 121 |
| 42 | iso_pu_bacteria | 2739367664 | 2739651893 | 121 |
| 43 | iso_pu_bacteria | 2739367865 | 2740030367 | 121 |
| 44 | iso_pu_bacteria | 2818991438 | 2819552567 | 121 |
| 45 | iso_pu_bacteria | 2818991466 | 2819716470 | 121 |
| 46 | iso_pu_bacteria | 2830075706 | 2830079056 | 121 |
| 47 | iso_pu_bacteria | 2848297114 | 2848298233 | 121 |
| 48 | iso_pu_bacteria | 2879163058 | 2879165245 | 121 |
| 49 | iso_pu_bacteria | 2885427238 | 2885427575 | 121 |
| 50 | iso_pu_bacteria | 2896253425 | 2896255631 | 121 |
| 51 | iso_pu_bacteria | 2917554339 | 2917555104 | 121 |
| 52 | iso_pu_bacteria | 2919138771 | 2919141408 | 121 |
| 53 | iso_pu_bacteria | 2928027323 | 2928028508 | 121 |
| 54 | iso_pu_bacteria | 2928100450 | 2928101197 | 121 |
| 55 | iso_pu_bacteria | 2928526807 | 2928528721 | 121 |
| 56 | iso_pu_bacteria | 2928959182 | 2928960393 | 121 |
| 57 | iso_pu_bacteria | 2928968154 | 2928970273 | 121 |
| 58 | iso_pu_bacteria | 2946787523 | 2946787681 | 121 |
| 59 | iso_pu_bacteria | 2984555340 | 2984555916 | 121 |
| 60 | iso_pu_bacteria | 2984564862 | 2984565978 | 121 |
| 61 | iso_pu_bacteria | 2993356040 | 2993356987 | 121 |
| 62 | iso_pu_bacteria | 8054302542 | 8054304444 | 121 |
| 63 | 3300047472 | Ga0495686_0214876 | Ga0495686_0214876_110_484 | 122 |
| 64 | 3300049744 | Ga0501083_0121106 | Ga0501083_0121106_128_517 | 123 |
| 65 | 3300053153 | Ga0500616_0220183 | Ga0500616_0220183_45_431 | 123 |
| 66 | 3300003775 | Ga0055524_1041467 | Ga0055524_10414673 | 124 |
| 67 | 3300003781 | Ga0055536_1040482 | Ga0055536_10404822 | 124 |
| 68 | 3300003791 | Ga0055530_10004523 | Ga0055530_100045239 | 124 |
| 69 | 3300003791 | Ga0055530_10053671 | Ga0055530_100536712 | 124 |
| 70 | 3300003792 | Ga0055540_1050858 | Ga0055540_10508583 | 124 |
| 71 | 3300003794 | Ga0055531_10011237 | Ga0055531_100112373 | 124 |
| 72 | 3300003794 | Ga0055531_10018292 | Ga0055531_100182924 | 124 |
| 73 | 3300005262 | Ga0065165_1007044 | Ga0065165_10070441 | 124 |
| 74 | 3300005328 | Ga0070676_10852711 | Ga0070676_108527112 | 124 |
| 75 | 3300005338 | Ga0068868_101966217 | Ga0068868_1019662171 | 124 |
| 76 | 3300005340 | Ga0070689_100764544 | Ga0070689_1007645442 | 124 |
| 77 | 3300005340 | Ga0070689_101589165 | Ga0070689_1015891652 | 124 |
| 78 | 3300005354 | Ga0070675_100282639 | Ga0070675_1002826392 | 124 |
| 79 | 3300005356 | Ga0070674_101294936 | Ga0070674_1012949362 | 124 |
| 80 | 3300005367 | Ga0070667_100692723 | Ga0070667_1006927232 | 124 |
| 81 | 3300005456 | Ga0070678_100926518 | Ga0070678_1009265182 | 124 |
| 82 | 3300005539 | Ga0068853_100134014 | Ga0068853_1001340144 | 124 |
| 83 | 3300005548 | Ga0070665_100107634 | Ga0070665_1001076345 | 124 |
| 84 | 3300005577 | Ga0068857_101288741 | Ga0068857_1012887411 | 124 |
| 85 | 3300005616 | Ga0068852_101918233 | Ga0068852_1019182331 | 124 |
| 86 | 3300005617 | Ga0068859_101774425 | Ga0068859_1017744252 | 124 |
| 87 | 3300005618 | Ga0068864_101664716 | Ga0068864_1016647161 | 124 |
| 88 | 3300005719 | Ga0068861_101079403 | Ga0068861_1010794032 | 124 |
| 89 | 3300005844 | Ga0068862_101527106 | Ga0068862_1015271061 | 124 |
| 90 | 3300006038 | Ga0075365_11071766 | Ga0075365_110717661 | 124 |
| 91 | 3300006048 | Ga0075363_100007657 | Ga0075363_10000765711 | 124 |
| 92 | 3300006178 | Ga0075367_10151422 | Ga0075367_101514222 | 124 |
| 93 | 3300006186 | Ga0075369_10017872 | Ga0075369_100178726 | 124 |
| 94 | 3300006195 | Ga0075366_10688912 | Ga0075366_106889121 | 124 |
| 95 | 3300006353 | Ga0075370_10228277 | Ga0075370_102282772 | 124 |
| 96 | 3300006353 | Ga0075370_10231904 | Ga0075370_102319042 | 124 |
| 97 | 3300006353 | Ga0075370_10938159 | Ga0075370_109381592 | 124 |
| 98 | 3300006881 | Ga0068865_100619565 | Ga0068865_1006195651 | 124 |
| 99 | 3300006881 | Ga0068865_101149388 | Ga0068865_1011493882 | 124 |
| 100 | 3300006931 | Ga0097620_101774423 | Ga0097620_1017744232 | 124 |
| 101 | 3300009093 | Ga0105240_10928947 | Ga0105240_109289472 | 124 |
| 102 | 3300009094 | Ga0111539_11626981 | Ga0111539_116269812 | 124 |
| 103 | 3300009176 | Ga0105242_11662544 | Ga0105242_116625442 | 124 |
| 104 | 3300009177 | Ga0105248_12990958 | Ga0105248_129909582 | 124 |
| 105 | 3300009551 | Ga0105238_10428911 | Ga0105238_104289112 | 124 |
| 106 | 3300013105 | Ga0157369_11859513 | Ga0157369_118595131 | 124 |
| 107 | 3300014325 | Ga0163163_10861498 | Ga0163163_108614982 | 124 |
| 108 | 3300020070 | Ga0206356_10532533 | Ga0206356_105325331 | 124 |
| 109 | 3300025246 | Ga0209646_1018464 | Ga0209646_10184641 | 124 |
| 110 | 3300025250 | Ga0209026_1006530 | Ga0209026_10065304 | 124 |
| 111 | 3300025292 | Ga0209676_1013004 | Ga0209676_10130047 | 124 |
| 112 | 3300025297 | Ga0209758_1002168 | Ga0209758_100216810 | 124 |
| 113 | 3300025298 | Ga0209050_1000161 | Ga0209050_100016192 | 124 |
| 114 | 3300025298 | Ga0209050_1011548 | Ga0209050_10115489 | 124 |
| 115 | 3300025303 | Ga0209051_1000877 | Ga0209051_100087720 | 124 |
| 116 | 3300025304 | Ga0209257_1000252 | Ga0209257_100025284 | 124 |
| 117 | 3300025304 | Ga0209257_1008377 | Ga0209257_10083777 | 124 |
| 118 | 3300025899 | Ga0207642_10435527 | Ga0207642_104355272 | 124 |
| 119 | 3300025909 | Ga0207705_10678009 | Ga0207705_106780092 | 124 |
| 120 | 3300025913 | Ga0207695_10941004 | Ga0207695_109410042 | 124 |
| 121 | 3300025924 | Ga0207694_11268795 | Ga0207694_112687951 | 124 |
| 122 | 3300025927 | Ga0207687_11656320 | Ga0207687_116563201 | 124 |
| 123 | 3300025931 | Ga0207644_10536901 | Ga0207644_105369012 | 124 |
| 124 | 3300025936 | Ga0207670_11494504 | Ga0207670_114945042 | 124 |
| 125 | 3300025936 | Ga0207670_11686067 | Ga0207670_116860672 | 124 |
| 126 | 3300025944 | Ga0207661_11692701 | Ga0207661_116927011 | 124 |
| 127 | 3300025986 | Ga0207658_10310759 | Ga0207658_103107592 | 124 |
| 128 | 3300026041 | Ga0207639_10749209 | Ga0207639_107492092 | 124 |
| 129 | 3300026095 | Ga0207676_11582155 | Ga0207676_115821551 | 124 |
| 130 | 3300026116 | Ga0207674_10242234 | Ga0207674_102422342 | 124 |
| 131 | 3300030521 | Ga0307511_10006537 | Ga0307511_100065379 | 124 |
| 132 | 3300031456 | Ga0307513_10000162 | Ga0307513_100001629 | 124 |
| 133 | 3300031456 | Ga0307513_10010515 | Ga0307513_100105158 | 124 |
| 134 | 3300031548 | Ga0307408_100395292 | Ga0307408_1003952923 | 124 |
| 135 | 3300031548 | Ga0307408_101072415 | Ga0307408_1010724152 | 124 |
| 136 | 3300031852 | Ga0307410_10606437 | Ga0307410_106064372 | 124 |
| 137 | 3300031901 | Ga0307406_11311714 | Ga0307406_113117142 | 124 |
| 138 | 3300031903 | Ga0307407_10706773 | Ga0307407_107067732 | 124 |
| 139 | 3300033180 | Ga0307510_10212732 | Ga0307510_102127322 | 124 |
| 140 | 3300037471 | Ga0395905_0632069 | Ga0395905_0632069_396_776 | 124 |
| 141 | 3300039437 | Ga0436365_1769134 | Ga0436365_1769134_112_492 | 124 |
| 142 | 3300041441 | Ga0451787_390226 | Ga0451787_390226_154_534 | 124 |
| 143 | 3300041451 | Ga0451791_1104984 | Ga0451791_1104984_109_489 | 124 |
| 144 | 3300041491 | Ga0451833_1375293 | Ga0451833_1375293_160_540 | 124 |
| 145 | 3300041492 | Ga0451835_0084593 | Ga0451835_0084593_218_598 | 124 |
| 146 | 3300041494 | Ga0451837_0693834 | Ga0451837_0693834_21_401 | 124 |
| 147 | 3300041501 | Ga0451845_0970488 | Ga0451845_0970488_135_515 | 124 |
| 148 | 3300042131 | Ga0450894_042600 | Ga0450894_042600_23_403 | 124 |
| 149 | 3300042876 | Ga0451577_0708206 | Ga0451577_0708206_327_707 | 124 |
| 150 | 3300044658 | Ga0466972_0196342 | Ga0466972_0196342_301_681 | 124 |
| 151 | 3300044693 | Ga0466961_0562513 | Ga0466961_0562513_204_584 | 124 |
| 152 | 3300044735 | Ga0466968_0250288 | Ga0466968_0250288_174_554 | 124 |
| 153 | 3300044842 | Ga0466957_0077343 | Ga0466957_0077343_885_1265 | 124 |
| 154 | 3300044901 | Ga0466960_0738413 | Ga0466960_0738413_44_424 | 124 |
| 155 | 3300045976 | Ga0466967_2488322 | Ga0466967_2488322_25_405 | 124 |
| 156 | 3300046457 | Ga0495590_0158635 | Ga0495590_0158635_419_799 | 124 |
| 157 | 3300046460 | Ga0495638_0593218 | Ga0495638_0593218_150_530 | 124 |
| 158 | 3300046471 | Ga0495650_0143718 | Ga0495650_0143718_412_792 | 124 |
| 159 | 3300046500 | Ga0495596_0112786 | Ga0495596_0112786_460_840 | 124 |
| 160 | 3300046539 | Ga0495621_0277072 | Ga0495621_0277072_68_448 | 124 |
| 161 | 3300046616 | Ga0495668_0150942 | Ga0495668_0150942_353_733 | 124 |
| 162 | 3300047320 | Ga0495672_0380130 | Ga0495672_0380130_210_605 | 124 |
| 163 | 3300048927 | Ga0496124_0061846 | Ga0496124_0061846_1908_2288 | 124 |
| 164 | 3300048928 | Ga0496125_0035566 | Ga0496125_0035566_104_484 | 124 |
| 165 | 3300048929 | Ga0496126_0049088 | Ga0496126_0049088_1973_2353 | 124 |
| 166 | 3300049528 | Ga0501312_018590 | Ga0501312_018590_115_495 | 124 |
| 167 | 3300049569 | Ga0501032_0508991 | Ga0501032_0508991_30_410 | 124 |
| 168 | 3300049570 | Ga0501033_0281342 | Ga0501033_0281342_337_717 | 124 |
| 169 | 3300049571 | Ga0501034_0478339 | Ga0501034_0478339_654_1034 | 124 |
| 170 | 3300049571 | Ga0501034_0729840 | Ga0501034_0729840_102_482 | 124 |
| 171 | 3300049573 | Ga0501037_0268954 | Ga0501037_0268954_618_998 | 124 |
| 172 | 3300049575 | Ga0501039_1017715 | Ga0501039_1017715_131_511 | 124 |
| 173 | 3300049578 | Ga0501042_1145601 | Ga0501042_1145601_144_524 | 124 |
| 174 | 3300049579 | Ga0501043_0303623 | Ga0501043_0303623_296_676 | 124 |
| 175 | 3300049581 | Ga0501047_0514337 | Ga0501047_0514337_399_779 | 124 |
| 176 | 3300049583 | Ga0501067_0019787 | Ga0501067_0019787_1514_1909 | 124 |
| 177 | 3300049588 | Ga0501072_0025429 | Ga0501072_0025429_1238_1633 | 124 |
| 178 | 3300049590 | Ga0501074_0610191 | Ga0501074_0610191_114_509 | 124 |
| 179 | 3300049742 | Ga0501080_0027711 | Ga0501080_0027711_1394_1789 | 124 |
| 180 | 3300049744 | Ga0501083_0027038 | Ga0501083_0027038_673_1068 | 124 |
| 181 | 3300049823 | Ga0501044_0032239 | Ga0501044_0032239_822_1202 | 124 |
| 182 | 3300050492 | nmdc:mga0yw44_767745_c1 | nmdc:mga0yw44_767745_c1_246_626 | 124 |
| 183 | 3300050496 | nmdc:mga07m45_176045_c1 | nmdc:mga07m45_176045_c1_310_690 | 124 |
| 184 | 3300050496 | nmdc:mga07m45_406701_c1 | nmdc:mga07m45_406701_c1_25_405 | 124 |
| 185 | 3300050511 | nmdc:mga08y16_1330190_c1 | nmdc:mga08y16_1330190_c1_68_448 | 124 |
| 186 | 3300050516 | nmdc:mga0sz30_17138_c1 | nmdc:mga0sz30_17138_c1_534_914 | 124 |
| 187 | 3300053153 | Ga0500616_0154340 | Ga0500616_0154340_232_612 | 124 |
| 188 | 3300053154 | Ga0500619_258443 | Ga0500619_258443_102_482 | 124 |
| 189 | 3300054114 | Ga0501084_0098690 | Ga0501084_0098690_1559_1954 | 124 |
| 190 | 3300059491 | Ga0587070_038788 | Ga0587070_038788_247_627 | 124 |
| 191 | 3300059491 | Ga0587070_111858 | Ga0587070_111858_218_598 | 124 |
| 192 | 3300059492 | Ga0587073_0091319 | Ga0587073_0091319_29_409 | 124 |
| 193 | 3300059493 | Ga0587077_081924 | Ga0587077_081924_32_412 | 124 |
| 194 | 3300059503 | Ga0587080_142361 | Ga0587080_142361_106_486 | 124 |
| 195 | 3300059505 | Ga0587083_0053536 | Ga0587083_0053536_218_598 | 124 |
| 196 | 3300059506 | Ga0587085_149409 | Ga0587085_149409_27_407 | 124 |
| 197 | 3300059624 | Ga0587109_056339 | Ga0587109_056339_172_552 | 124 |
| 198 | 3300059641 | Ga0587068_065334 | Ga0587068_065334_29_409 | 124 |
| 199 | 3300059643 | Ga0587072_057219 | Ga0587072_057219_326_706 | 124 |
| 200 | 3300059645 | Ga0587076_007008 | Ga0587076_007008_1102_1482 | 124 |
| 201 | 3300059651 | Ga0587105_001817 | Ga0587105_001817_232_612 | 124 |
| 202 | 3300059653 | Ga0587108_006900 | Ga0587108_006900_278_658 | 124 |
| 203 | 3300059654 | Ga0587110_030666 | Ga0587110_030666_229_609 | 124 |
| 204 | 3300060346 | Ga0587111_0038388 | Ga0587111_0038388_336_716 | 124 |
| 205 | 3300060346 | Ga0587111_0215808 | Ga0587111_0215808_117_497 | 124 |
| 206 | 3300060353 | Ga0501082_0016074 | Ga0501082_0016074_1360_1755 | 124 |
| 207 | 2162886007 | SwRhRL2b_contig_1902450 | SwRhRL2b_0970.00001750 | 125 |
| 208 | 2162886007 | SwRhRL2b_contig_219213 | SwRhRL2b_0257.00001430 | 125 |
| 209 | 2162886007 | SwRhRL2b_contig_90406 | SwRhRL2b_0963.00000460 | 125 |
| 210 | 3300000043 | ARcpr5yngRDRAFT_c009192 | ARcpr5yngRDRAFT_0091922 | 125 |
| 211 | 3300000652 | ARCol0yngRDRAFT_1010664 | ARCol0yngRDRAFT_10106642 | 125 |
| 212 | 3300001904 | JGI24736J21556_1000017 | JGI24736J21556_10000173 | 125 |
| 213 | 3300001915 | JGI24741J21665_1001831 | JGI24741J21665_10018316 | 125 |
| 214 | 3300001915 | JGI24741J21665_1004669 | JGI24741J21665_10046697 | 125 |
| 215 | 3300001979 | JGI24740J21852_10023038 | JGI24740J21852_100230384 | 125 |
| 216 | 3300001979 | JGI24740J21852_10073730 | JGI24740J21852_100737302 | 125 |
| 217 | 3300001979 | JGI24740J21852_10098157 | JGI24740J21852_100981571 | 125 |
| 218 | 3300001989 | JGI24739J22299_10070471 | JGI24739J22299_100704712 | 125 |
| 219 | 3300001989 | JGI24739J22299_10119248 | JGI24739J22299_101192482 | 125 |
| 220 | 3300001990 | JGI24737J22298_10010075 | JGI24737J22298_100100754 | 125 |
| 221 | 3300001990 | JGI24737J22298_10022076 | JGI24737J22298_100220764 | 125 |
| 222 | 3300001990 | JGI24737J22298_10076884 | JGI24737J22298_100768842 | 125 |
| 223 | 3300001990 | JGI24737J22298_10197514 | JGI24737J22298_101975141 | 125 |
| 224 | 3300002067 | JGI24735J21928_10003396 | JGI24735J21928_100033965 | 125 |
| 225 | 3300002067 | JGI24735J21928_10052944 | JGI24735J21928_100529442 | 125 |
| 226 | 3300002067 | JGI24735J21928_10083171 | JGI24735J21928_100831712 | 125 |
| 227 | 3300002074 | JGI24748J21848_1022174 | JGI24748J21848_10221742 | 125 |
| 228 | 3300002075 | JGI24738J21930_10002167 | JGI24738J21930_100021676 | 125 |
| 229 | 3300002075 | JGI24738J21930_10015293 | JGI24738J21930_100152932 | 125 |
| 230 | 3300002075 | JGI24738J21930_10055219 | JGI24738J21930_100552192 | 125 |
| 231 | 3300002076 | JGI24749J21850_1001152 | JGI24749J21850_10011525 | 125 |
| 232 | 3300002155 | JGI24033J26618_1006238 | JGI24033J26618_10062383 | 125 |
| 233 | 3300002155 | JGI24033J26618_1032954 | JGI24033J26618_10329542 | 125 |
| 234 | 3300002239 | JGI24034J26672_10001857 | JGI24034J26672_100018576 | 125 |
| 235 | 3300002239 | JGI24034J26672_10004339 | JGI24034J26672_100043392 | 125 |
| 236 | 3300002239 | JGI24034J26672_10014590 | JGI24034J26672_100145902 | 125 |
| 237 | 3300002239 | JGI24034J26672_10030081 | JGI24034J26672_100300811 | 125 |
| 238 | 3300002239 | JGI24034J26672_10051630 | JGI24034J26672_100516301 | 125 |
| 239 | 3300002459 | JGI24751J29686_10000133 | JGI24751J29686_1000013312 | 125 |
| 240 | 3300002459 | JGI24751J29686_10000325 | JGI24751J29686_100003255 | 125 |
| 241 | 3300002459 | JGI24751J29686_10109440 | JGI24751J29686_101094402 | 125 |
| 242 | 3300002773 | JGI25152J39213_1019543 | JGI25152J39213_10195432 | 125 |
| 243 | 3300002774 | JGI25150J39212_1000365 | JGI25150J39212_100036520 | 125 |
| 244 | 3300003187 | JGI25151J46595_10034781 | JGI25151J46595_100347813 | 125 |
| 245 | 3300003371 | JGI26145J50221_1019280 | JGI26145J50221_10192801 | 125 |
| 246 | 3300003771 | Ga0055526_1001689 | Ga0055526_100168910 | 125 |
| 247 | 3300003781 | Ga0055536_1004136 | Ga0055536_10041363 | 125 |
| 248 | 3300003791 | Ga0055530_10006129 | Ga0055530_1000612913 | 125 |
| 249 | 3300003792 | Ga0055540_1000723 | Ga0055540_10007236 | 125 |
| 250 | 3300005288 | Ga0065714_10439110 | Ga0065714_104391101 | 125 |
| 251 | 3300005289 | Ga0065704_10070214 | Ga0065704_1007021435 | 125 |
| 252 | 3300005289 | Ga0065704_10070777 | Ga0065704_1007077713 | 125 |
| 253 | 3300005289 | Ga0065704_10101429 | Ga0065704_101014293 | 125 |
| 254 | 3300005289 | Ga0065704_10335587 | Ga0065704_103355872 | 125 |
| 255 | 3300005290 | Ga0065712_10044945 | Ga0065712_100449452 | 125 |
| 256 | 3300005290 | Ga0065712_10154061 | Ga0065712_101540612 | 125 |
| 257 | 3300005295 | Ga0065707_10007537 | Ga0065707_100075371 | 125 |
| 258 | 3300005295 | Ga0065707_10051097 | Ga0065707_100510972 | 125 |
| 259 | 3300005295 | Ga0065707_10374061 | Ga0065707_103740611 | 125 |
| 260 | 3300005295 | Ga0065707_10492149 | Ga0065707_104921492 | 125 |
| 261 | 3300005327 | Ga0070658_10104595 | Ga0070658_101045952 | 125 |
| 262 | 3300005327 | Ga0070658_10217697 | Ga0070658_102176973 | 125 |
| 263 | 3300005327 | Ga0070658_10855387 | Ga0070658_108553872 | 125 |
| 264 | 3300005327 | Ga0070658_11285588 | Ga0070658_112855882 | 125 |
| 265 | 3300005328 | Ga0070676_10010202 | Ga0070676_1001020211 | 125 |
| 266 | 3300005328 | Ga0070676_10114853 | Ga0070676_101148532 | 125 |
| 267 | 3300005328 | Ga0070676_10396009 | Ga0070676_103960092 | 125 |
| 268 | 3300005328 | Ga0070676_10618497 | Ga0070676_106184972 | 125 |
| 269 | 3300005329 | Ga0070683_100888866 | Ga0070683_1008888662 | 125 |
| 270 | 3300005330 | Ga0070690_100018053 | Ga0070690_1000180539 | 125 |
| 271 | 3300005331 | Ga0070670_100024275 | Ga0070670_1000242755 | 125 |
| 272 | 3300005331 | Ga0070670_100044177 | Ga0070670_1000441778 | 125 |
| 273 | 3300005331 | Ga0070670_100047139 | Ga0070670_1000471398 | 125 |
| 274 | 3300005331 | Ga0070670_100065360 | Ga0070670_1000653607 | 125 |
| 275 | 3300005331 | Ga0070670_100100471 | Ga0070670_1001004712 | 125 |
| 276 | 3300005331 | Ga0070670_100148526 | Ga0070670_1001485264 | 125 |
| 277 | 3300005331 | Ga0070670_100240682 | Ga0070670_1002406822 | 125 |
| 278 | 3300005331 | Ga0070670_100548160 | Ga0070670_1005481601 | 125 |
| 279 | 3300005331 | Ga0070670_100628039 | Ga0070670_1006280392 | 125 |
| 280 | 3300005331 | Ga0070670_100738370 | Ga0070670_1007383701 | 125 |
| 281 | 3300005331 | Ga0070670_101368932 | Ga0070670_1013689322 | 125 |
| 282 | 3300005333 | Ga0070677_10018552 | Ga0070677_100185522 | 125 |
| 283 | 3300005333 | Ga0070677_10365215 | Ga0070677_103652151 | 125 |
| 284 | 3300005334 | Ga0068869_100349580 | Ga0068869_1003495802 | 125 |
| 285 | 3300005334 | Ga0068869_100922701 | Ga0068869_1009227012 | 125 |
| 286 | 3300005335 | Ga0070666_10007165 | Ga0070666_1000716515 | 125 |
| 287 | 3300005335 | Ga0070666_10054950 | Ga0070666_100549503 | 125 |
| 288 | 3300005335 | Ga0070666_10179942 | Ga0070666_101799422 | 125 |
| 289 | 3300005335 | Ga0070666_10271508 | Ga0070666_102715082 | 125 |
| 290 | 3300005335 | Ga0070666_10525631 | Ga0070666_105256312 | 125 |
| 291 | 3300005335 | Ga0070666_10890077 | Ga0070666_108900772 | 125 |
| 292 | 3300005335 | Ga0070666_11149184 | Ga0070666_111491841 | 125 |
| 293 | 3300005335 | Ga0070666_11161595 | Ga0070666_111615952 | 125 |
| 294 | 3300005336 | Ga0070680_100162100 | Ga0070680_1001621003 | 125 |
| 295 | 3300005336 | Ga0070680_100413449 | Ga0070680_1004134492 | 125 |
| 296 | 3300005337 | Ga0070682_100167589 | Ga0070682_1001675893 | 125 |
| 297 | 3300005338 | Ga0068868_100569237 | Ga0068868_1005692372 | 125 |
| 298 | 3300005339 | Ga0070660_100018108 | Ga0070660_1000181082 | 125 |
| 299 | 3300005339 | Ga0070660_100095636 | Ga0070660_1000956365 | 125 |
| 300 | 3300005339 | Ga0070660_100676942 | Ga0070660_1006769422 | 125 |
| 301 | 3300005339 | Ga0070660_101411668 | Ga0070660_1014116681 | 125 |
| 302 | 3300005339 | Ga0070660_101834420 | Ga0070660_1018344201 | 125 |
| 303 | 3300005340 | Ga0070689_100665543 | Ga0070689_1006655432 | 125 |
| 304 | 3300005341 | Ga0070691_10023128 | Ga0070691_100231282 | 125 |
| 305 | 3300005341 | Ga0070691_10093826 | Ga0070691_100938263 | 125 |
| 306 | 3300005344 | Ga0070661_100241777 | Ga0070661_1002417771 | 125 |
| 307 | 3300005344 | Ga0070661_100577775 | Ga0070661_1005777752 | 125 |
| 308 | 3300005344 | Ga0070661_100614891 | Ga0070661_1006148912 | 125 |
| 309 | 3300005344 | Ga0070661_101625825 | Ga0070661_1016258251 | 125 |
| 310 | 3300005345 | Ga0070692_10354552 | Ga0070692_103545522 | 125 |
| 311 | 3300005345 | Ga0070692_11190734 | Ga0070692_111907341 | 125 |
| 312 | 3300005347 | Ga0070668_100017451 | Ga0070668_10001745112 | 125 |
| 313 | 3300005347 | Ga0070668_100396570 | Ga0070668_1003965701 | 125 |
| 314 | 3300005347 | Ga0070668_100478984 | Ga0070668_1004789842 | 125 |
| 315 | 3300005347 | Ga0070668_101335208 | Ga0070668_1013352081 | 125 |
| 316 | 3300005347 | Ga0070668_101983076 | Ga0070668_1019830762 | 125 |
| 317 | 3300005347 | Ga0070668_102028746 | Ga0070668_1020287461 | 125 |
| 318 | 3300005353 | Ga0070669_100004937 | Ga0070669_1000049376 | 125 |
| 319 | 3300005353 | Ga0070669_100005654 | Ga0070669_1000056545 | 125 |
| 320 | 3300005353 | Ga0070669_100014400 | Ga0070669_1000144003 | 125 |
| 321 | 3300005353 | Ga0070669_100033975 | Ga0070669_1000339755 | 125 |
| 322 | 3300005353 | Ga0070669_100264859 | Ga0070669_1002648593 | 125 |
| 323 | 3300005353 | Ga0070669_100334722 | Ga0070669_1003347223 | 125 |
| 324 | 3300005353 | Ga0070669_100380842 | Ga0070669_1003808422 | 125 |
| 325 | 3300005353 | Ga0070669_100492436 | Ga0070669_1004924363 | 125 |
| 326 | 3300005353 | Ga0070669_100527333 | Ga0070669_1005273332 | 125 |
| 327 | 3300005353 | Ga0070669_100557818 | Ga0070669_1005578182 | 125 |
| 328 | 3300005354 | Ga0070675_100021317 | Ga0070675_1000213178 | 125 |
| 329 | 3300005354 | Ga0070675_100660469 | Ga0070675_1006604692 | 125 |
| 330 | 3300005354 | Ga0070675_101392207 | Ga0070675_1013922071 | 125 |
| 331 | 3300005354 | Ga0070675_101761456 | Ga0070675_1017614562 | 125 |
| 332 | 3300005354 | Ga0070675_101826824 | Ga0070675_1018268241 | 125 |
| 333 | 3300005355 | Ga0070671_100001718 | Ga0070671_1000017188 | 125 |
| 334 | 3300005355 | Ga0070671_100052885 | Ga0070671_1000528858 | 125 |
| 335 | 3300005355 | Ga0070671_100071036 | Ga0070671_1000710366 | 125 |
| 336 | 3300005355 | Ga0070671_100075094 | Ga0070671_1000750945 | 125 |
| 337 | 3300005355 | Ga0070671_100149996 | Ga0070671_1001499962 | 125 |
| 338 | 3300005355 | Ga0070671_100230557 | Ga0070671_1002305572 | 125 |
| 339 | 3300005355 | Ga0070671_100243374 | Ga0070671_1002433743 | 125 |
| 340 | 3300005355 | Ga0070671_101271800 | Ga0070671_1012718002 | 125 |
| 341 | 3300005355 | Ga0070671_102056963 | Ga0070671_1020569631 | 125 |
| 342 | 3300005356 | Ga0070674_100065137 | Ga0070674_1000651374 | 125 |
| 343 | 3300005356 | Ga0070674_100101471 | Ga0070674_1001014712 | 125 |
| 344 | 3300005356 | Ga0070674_101384186 | Ga0070674_1013841861 | 125 |
| 345 | 3300005364 | Ga0070673_100034662 | Ga0070673_1000346626 | 125 |
| 346 | 3300005364 | Ga0070673_101239019 | Ga0070673_1012390191 | 125 |
| 347 | 3300005365 | Ga0070688_100364027 | Ga0070688_1003640273 | 125 |
| 348 | 3300005366 | Ga0070659_100052713 | Ga0070659_1000527137 | 125 |
| 349 | 3300005366 | Ga0070659_100180084 | Ga0070659_1001800843 | 125 |
| 350 | 3300005366 | Ga0070659_100310110 | Ga0070659_1003101102 | 125 |
| 351 | 3300005366 | Ga0070659_100368816 | Ga0070659_1003688163 | 125 |
| 352 | 3300005366 | Ga0070659_100902102 | Ga0070659_1009021022 | 125 |
| 353 | 3300005366 | Ga0070659_101601104 | Ga0070659_1016011041 | 125 |
| 354 | 3300005367 | Ga0070667_100000088 | Ga0070667_10000008861 | 125 |
| 355 | 3300005367 | Ga0070667_100001059 | Ga0070667_1000010596 | 125 |
| 356 | 3300005367 | Ga0070667_100141917 | Ga0070667_1001419174 | 125 |
| 357 | 3300005367 | Ga0070667_100508657 | Ga0070667_1005086571 | 125 |
| 358 | 3300005435 | Ga0070714_100056706 | Ga0070714_1000567065 | 125 |
| 359 | 3300005435 | Ga0070714_100446850 | Ga0070714_1004468503 | 125 |
| 360 | 3300005436 | Ga0070713_100050613 | Ga0070713_1000506133 | 125 |
| 361 | 3300005438 | Ga0070701_10543196 | Ga0070701_105431961 | 125 |
| 362 | 3300005440 | Ga0070705_100529297 | Ga0070705_1005292972 | 125 |
| 363 | 3300005441 | Ga0070700_100044432 | Ga0070700_1000444323 | 125 |
| 364 | 3300005441 | Ga0070700_100904716 | Ga0070700_1009047161 | 125 |
| 365 | 3300005444 | Ga0070694_100564632 | Ga0070694_1005646322 | 125 |
| 366 | 3300005455 | Ga0070663_100082480 | Ga0070663_1000824803 | 125 |
| 367 | 3300005455 | Ga0070663_100155543 | Ga0070663_1001555432 | 125 |
| 368 | 3300005455 | Ga0070663_100388956 | Ga0070663_1003889562 | 125 |
| 369 | 3300005455 | Ga0070663_100439922 | Ga0070663_1004399222 | 125 |
| 370 | 3300005455 | Ga0070663_100738153 | Ga0070663_1007381532 | 125 |
| 371 | 3300005455 | Ga0070663_100820918 | Ga0070663_1008209182 | 125 |
| 372 | 3300005455 | Ga0070663_101654665 | Ga0070663_1016546652 | 125 |
| 373 | 3300005456 | Ga0070678_100020582 | Ga0070678_1000205823 | 125 |
| 374 | 3300005456 | Ga0070678_100204291 | Ga0070678_1002042911 | 125 |
| 375 | 3300005456 | Ga0070678_100228696 | Ga0070678_1002286963 | 125 |
| 376 | 3300005456 | Ga0070678_100446078 | Ga0070678_1004460781 | 125 |
| 377 | 3300005456 | Ga0070678_101187273 | Ga0070678_1011872731 | 125 |
| 378 | 3300005457 | Ga0070662_100249078 | Ga0070662_1002490783 | 125 |
| 379 | 3300005457 | Ga0070662_100329829 | Ga0070662_1003298291 | 125 |
| 380 | 3300005457 | Ga0070662_100343467 | Ga0070662_1003434672 | 125 |
| 381 | 3300005457 | Ga0070662_100834265 | Ga0070662_1008342651 | 125 |
| 382 | 3300005457 | Ga0070662_101608754 | Ga0070662_1016087541 | 125 |
| 383 | 3300005457 | Ga0070662_101683119 | Ga0070662_1016831192 | 125 |
| 384 | 3300005457 | Ga0070662_101745263 | Ga0070662_1017452631 | 125 |
| 385 | 3300005458 | Ga0070681_10842690 | Ga0070681_108426902 | 125 |
| 386 | 3300005458 | Ga0070681_11187871 | Ga0070681_111878712 | 125 |
| 387 | 3300005458 | Ga0070681_11666624 | Ga0070681_116666242 | 125 |
| 388 | 3300005459 | Ga0068867_100167090 | Ga0068867_1001670903 | 125 |
| 389 | 3300005459 | Ga0068867_100239469 | Ga0068867_1002394693 | 125 |
| 390 | 3300005459 | Ga0068867_100339305 | Ga0068867_1003393052 | 125 |
| 391 | 3300005459 | Ga0068867_100608690 | Ga0068867_1006086901 | 125 |
| 392 | 3300005459 | Ga0068867_100858773 | Ga0068867_1008587732 | 125 |
| 393 | 3300005518 | Ga0070699_101902222 | Ga0070699_1019022221 | 125 |
| 394 | 3300005530 | Ga0070679_101027471 | Ga0070679_1010274711 | 125 |
| 395 | 3300005530 | Ga0070679_102141505 | Ga0070679_1021415051 | 125 |
| 396 | 3300005535 | Ga0070684_100038268 | Ga0070684_1000382688 | 125 |
| 397 | 3300005536 | Ga0070697_100271153 | Ga0070697_1002711532 | 125 |
| 398 | 3300005539 | Ga0068853_100100537 | Ga0068853_1001005372 | 125 |
| 399 | 3300005539 | Ga0068853_100413468 | Ga0068853_1004134683 | 125 |
| 400 | 3300005539 | Ga0068853_100965538 | Ga0068853_1009655381 | 125 |
| 401 | 3300005539 | Ga0068853_101107283 | Ga0068853_1011072832 | 125 |
| 402 | 3300005539 | Ga0068853_101923504 | Ga0068853_1019235042 | 125 |
| 403 | 3300005543 | Ga0070672_100034217 | Ga0070672_1000342175 | 125 |
| 404 | 3300005543 | Ga0070672_100627533 | Ga0070672_1006275332 | 125 |
| 405 | 3300005543 | Ga0070672_100817407 | Ga0070672_1008174073 | 125 |
| 406 | 3300005543 | Ga0070672_100841589 | Ga0070672_1008415892 | 125 |
| 407 | 3300005543 | Ga0070672_101407993 | Ga0070672_1014079931 | 125 |
| 408 | 3300005543 | Ga0070672_102153785 | Ga0070672_1021537852 | 125 |
| 409 | 3300005544 | Ga0070686_100162697 | Ga0070686_1001626973 | 125 |
| 410 | 3300005544 | Ga0070686_100312950 | Ga0070686_1003129502 | 125 |
| 411 | 3300005546 | Ga0070696_100274635 | Ga0070696_1002746353 | 125 |
| 412 | 3300005547 | Ga0070693_100090075 | Ga0070693_1000900753 | 125 |
| 413 | 3300005547 | Ga0070693_100280396 | Ga0070693_1002803961 | 125 |
| 414 | 3300005547 | Ga0070693_101054800 | Ga0070693_1010548002 | 125 |
| 415 | 3300005548 | Ga0070665_100017754 | Ga0070665_1000177547 | 125 |
| 416 | 3300005548 | Ga0070665_100043393 | Ga0070665_1000433932 | 125 |
| 417 | 3300005548 | Ga0070665_100080805 | Ga0070665_1000808056 | 125 |
| 418 | 3300005548 | Ga0070665_101362015 | Ga0070665_1013620152 | 125 |
| 419 | 3300005548 | Ga0070665_101775586 | Ga0070665_1017755862 | 125 |
| 420 | 3300005549 | Ga0070704_100284431 | Ga0070704_1002844313 | 125 |
| 421 | 3300005549 | Ga0070704_101993804 | Ga0070704_1019938041 | 125 |
| 422 | 3300005563 | Ga0068855_100042514 | Ga0068855_1000425144 | 125 |
| 423 | 3300005563 | Ga0068855_100080645 | Ga0068855_1000806452 | 125 |
| 424 | 3300005563 | Ga0068855_100269053 | Ga0068855_1002690532 | 125 |
| 425 | 3300005563 | Ga0068855_100820305 | Ga0068855_1008203052 | 125 |
| 426 | 3300005563 | Ga0068855_100932750 | Ga0068855_1009327503 | 125 |
| 427 | 3300005563 | Ga0068855_100998628 | Ga0068855_1009986282 | 125 |
| 428 | 3300005564 | Ga0070664_100036985 | Ga0070664_1000369859 | 125 |
| 429 | 3300005564 | Ga0070664_100070110 | Ga0070664_1000701103 | 125 |
| 430 | 3300005564 | Ga0070664_100253451 | Ga0070664_1002534512 | 125 |
| 431 | 3300005564 | Ga0070664_100464231 | Ga0070664_1004642312 | 125 |
| 432 | 3300005564 | Ga0070664_100976480 | Ga0070664_1009764802 | 125 |
| 433 | 3300005564 | Ga0070664_101382016 | Ga0070664_1013820162 | 125 |
| 434 | 3300005564 | Ga0070664_101968684 | Ga0070664_1019686842 | 125 |
| 435 | 3300005564 | Ga0070664_102158471 | Ga0070664_1021584712 | 125 |
| 436 | 3300005577 | Ga0068857_100026049 | Ga0068857_1000260496 | 125 |
| 437 | 3300005577 | Ga0068857_100359493 | Ga0068857_1003594933 | 125 |
| 438 | 3300005577 | Ga0068857_100764880 | Ga0068857_1007648802 | 125 |
| 439 | 3300005577 | Ga0068857_101691162 | Ga0068857_1016911622 | 125 |
| 440 | 3300005578 | Ga0068854_100097571 | Ga0068854_1000975715 | 125 |
| 441 | 3300005578 | Ga0068854_100175422 | Ga0068854_1001754223 | 125 |
| 442 | 3300005578 | Ga0068854_101151278 | Ga0068854_1011512781 | 125 |
| 443 | 3300005578 | Ga0068854_102143988 | Ga0068854_1021439881 | 125 |
| 444 | 3300005614 | Ga0068856_100058104 | Ga0068856_1000581042 | 125 |
| 445 | 3300005614 | Ga0068856_100364986 | Ga0068856_1003649862 | 125 |
| 446 | 3300005614 | Ga0068856_101251499 | Ga0068856_1012514992 | 125 |
| 447 | 3300005615 | Ga0070702_100090393 | Ga0070702_1000903932 | 125 |
| 448 | 3300005615 | Ga0070702_100379736 | Ga0070702_1003797362 | 125 |
| 449 | 3300005616 | Ga0068852_100343494 | Ga0068852_1003434942 | 125 |
| 450 | 3300005616 | Ga0068852_100448060 | Ga0068852_1004480601 | 125 |
| 451 | 3300005616 | Ga0068852_101538415 | Ga0068852_1015384152 | 125 |
| 452 | 3300005616 | Ga0068852_102079416 | Ga0068852_1020794161 | 125 |
| 453 | 3300005617 | Ga0068859_100006387 | Ga0068859_10000638713 | 125 |
| 454 | 3300005617 | Ga0068859_100030651 | Ga0068859_1000306516 | 125 |
| 455 | 3300005617 | Ga0068859_100323648 | Ga0068859_1003236483 | 125 |
| 456 | 3300005617 | Ga0068859_100440837 | Ga0068859_1004408373 | 125 |
| 457 | 3300005617 | Ga0068859_101116349 | Ga0068859_1011163493 | 125 |
| 458 | 3300005617 | Ga0068859_101612409 | Ga0068859_1016124092 | 125 |
| 459 | 3300005618 | Ga0068864_100014199 | Ga0068864_1000141998 | 125 |
| 460 | 3300005618 | Ga0068864_100081298 | Ga0068864_1000812983 | 125 |
| 461 | 3300005618 | Ga0068864_100599726 | Ga0068864_1005997262 | 125 |
| 462 | 3300005618 | Ga0068864_100649123 | Ga0068864_1006491232 | 125 |
| 463 | 3300005618 | Ga0068864_100832313 | Ga0068864_1008323133 | 125 |
| 464 | 3300005718 | Ga0068866_10028552 | Ga0068866_100285523 | 125 |
| 465 | 3300005718 | Ga0068866_11315034 | Ga0068866_113150341 | 125 |
| 466 | 3300005719 | Ga0068861_100002700 | Ga0068861_1000027002 | 125 |
| 467 | 3300005719 | Ga0068861_100039077 | Ga0068861_1000390773 | 125 |
| 468 | 3300005719 | Ga0068861_100134622 | Ga0068861_1001346223 | 125 |
| 469 | 3300005719 | Ga0068861_101285918 | Ga0068861_1012859182 | 125 |
| 470 | 3300005834 | Ga0068851_10039033 | Ga0068851_100390332 | 125 |
| 471 | 3300005834 | Ga0068851_10109610 | Ga0068851_101096102 | 125 |
| 472 | 3300005840 | Ga0068870_10196609 | Ga0068870_101966091 | 125 |
| 473 | 3300005840 | Ga0068870_10230894 | Ga0068870_102308942 | 125 |
| 474 | 3300005840 | Ga0068870_10594405 | Ga0068870_105944052 | 125 |
| 475 | 3300005840 | Ga0068870_10676704 | Ga0068870_106767042 | 125 |
| 476 | 3300005841 | Ga0068863_100007187 | Ga0068863_10000718711 | 125 |
| 477 | 3300005841 | Ga0068863_100008669 | Ga0068863_1000086696 | 125 |
| 478 | 3300005841 | Ga0068863_100080807 | Ga0068863_1000808076 | 125 |
| 479 | 3300005841 | Ga0068863_100388526 | Ga0068863_1003885263 | 125 |
| 480 | 3300005841 | Ga0068863_101323670 | Ga0068863_1013236702 | 125 |
| 481 | 3300005842 | Ga0068858_100141594 | Ga0068858_1001415943 | 125 |
| 482 | 3300005842 | Ga0068858_100305438 | Ga0068858_1003054381 | 125 |
| 483 | 3300005842 | Ga0068858_101424513 | Ga0068858_1014245132 | 125 |
| 484 | 3300005843 | Ga0068860_100000220 | Ga0068860_10000022033 | 125 |
| 485 | 3300005843 | Ga0068860_100009418 | Ga0068860_1000094188 | 125 |
| 486 | 3300005843 | Ga0068860_100290484 | Ga0068860_1002904842 | 125 |
| 487 | 3300005843 | Ga0068860_100365743 | Ga0068860_1003657432 | 125 |
| 488 | 3300005843 | Ga0068860_100683453 | Ga0068860_1006834533 | 125 |
| 489 | 3300005844 | Ga0068862_100000126 | Ga0068862_1000001266 | 125 |
| 490 | 3300005844 | Ga0068862_100002931 | Ga0068862_10000293115 | 125 |
| 491 | 3300005844 | Ga0068862_100136266 | Ga0068862_1001362663 | 125 |
| 492 | 3300005844 | Ga0068862_100188127 | Ga0068862_1001881272 | 125 |
| 493 | 3300005844 | Ga0068862_100355311 | Ga0068862_1003553112 | 125 |
| 494 | 3300005844 | Ga0068862_100383926 | Ga0068862_1003839263 | 125 |
| 495 | 3300005844 | Ga0068862_100849430 | Ga0068862_1008494302 | 125 |
| 496 | 3300006028 | Ga0070717_10009669 | Ga0070717_100096692 | 125 |
| 497 | 3300006048 | Ga0075363_100000434 | Ga0075363_10000043412 | 125 |
| 498 | 3300006051 | Ga0075364_10154814 | Ga0075364_101548142 | 125 |
| 499 | 3300006051 | Ga0075364_10389625 | Ga0075364_103896252 | 125 |
| 500 | 3300006175 | Ga0070712_100734954 | Ga0070712_1007349542 | 125 |
| 501 | 3300006177 | Ga0075362_10001156 | Ga0075362_1000115610 | 125 |
| 502 | 3300006177 | Ga0075362_10143859 | Ga0075362_101438593 | 125 |
| 503 | 3300006195 | Ga0075366_10043854 | Ga0075366_100438543 | 125 |
| 504 | 3300006195 | Ga0075366_10702613 | Ga0075366_107026131 | 125 |
| 505 | 3300006237 | Ga0097621_100162823 | Ga0097621_1001628232 | 125 |
| 506 | 3300006237 | Ga0097621_100458747 | Ga0097621_1004587472 | 125 |
| 507 | 3300006237 | Ga0097621_101459311 | Ga0097621_1014593112 | 125 |
| 508 | 3300006353 | Ga0075370_10000004 | Ga0075370_10000004105 | 125 |
| 509 | 3300006353 | Ga0075370_10183052 | Ga0075370_101830522 | 125 |
| 510 | 3300006358 | Ga0068871_101309670 | Ga0068871_1013096702 | 125 |
| 511 | 3300006844 | Ga0075428_102319728 | Ga0075428_1023197282 | 125 |
| 512 | 3300006846 | Ga0075430_100459554 | Ga0075430_1004595541 | 125 |
| 513 | 3300006852 | Ga0075433_10164065 | Ga0075433_101640654 | 125 |
| 514 | 3300006871 | Ga0075434_102439173 | Ga0075434_1024391731 | 125 |
| 515 | 3300006881 | Ga0068865_100063284 | Ga0068865_1000632842 | 125 |
| 516 | 3300006881 | Ga0068865_100124512 | Ga0068865_1001245123 | 125 |
| 517 | 3300006881 | Ga0068865_101114496 | Ga0068865_1011144962 | 125 |
| 518 | 3300006881 | Ga0068865_101138857 | Ga0068865_1011388572 | 125 |
| 519 | 3300006931 | Ga0097620_100006388 | Ga0097620_10000638813 | 125 |
| 520 | 3300006931 | Ga0097620_100030651 | Ga0097620_1000306518 | 125 |
| 521 | 3300006931 | Ga0097620_100323639 | Ga0097620_1003236393 | 125 |
| 522 | 3300006931 | Ga0097620_100440841 | Ga0097620_1004408411 | 125 |
| 523 | 3300006931 | Ga0097620_101116306 | Ga0097620_1011163062 | 125 |
| 524 | 3300006931 | Ga0097620_101612395 | Ga0097620_1016123952 | 125 |
| 525 | 3300006931 | Ga0097620_101995678 | Ga0097620_1019956782 | 125 |
| 526 | 3300009011 | Ga0105251_10003119 | Ga0105251_1000311914 | 125 |
| 527 | 3300009011 | Ga0105251_10033975 | Ga0105251_100339752 | 125 |
| 528 | 3300009092 | Ga0105250_10001130 | Ga0105250_1000113014 | 125 |
| 529 | 3300009093 | Ga0105240_10183284 | Ga0105240_101832841 | 125 |
| 530 | 3300009093 | Ga0105240_12215374 | Ga0105240_122153741 | 125 |
| 531 | 3300009094 | Ga0111539_10637376 | Ga0111539_106373762 | 125 |
| 532 | 3300009101 | Ga0105247_10005639 | Ga0105247_1000563913 | 125 |
| 533 | 3300009101 | Ga0105247_10139623 | Ga0105247_101396233 | 125 |
| 534 | 3300009101 | Ga0105247_10230726 | Ga0105247_102307263 | 125 |
| 535 | 3300009101 | Ga0105247_10348022 | Ga0105247_103480222 | 125 |
| 536 | 3300009147 | Ga0114129_10043173 | Ga0114129_100431737 | 125 |
| 537 | 3300009148 | Ga0105243_10020823 | Ga0105243_100208236 | 125 |
| 538 | 3300009148 | Ga0105243_10589560 | Ga0105243_105895602 | 125 |
| 539 | 3300009148 | Ga0105243_12097989 | Ga0105243_120979892 | 125 |
| 540 | 3300009148 | Ga0105243_12203750 | Ga0105243_122037502 | 125 |
| 541 | 3300009148 | Ga0105243_12262099 | Ga0105243_122620992 | 125 |
| 542 | 3300009174 | Ga0105241_10438812 | Ga0105241_104388121 | 125 |
| 543 | 3300009174 | Ga0105241_10532747 | Ga0105241_105327471 | 125 |
| 544 | 3300009174 | Ga0105241_10598323 | Ga0105241_105983232 | 125 |
| 545 | 3300009174 | Ga0105241_10858706 | Ga0105241_108587062 | 125 |
| 546 | 3300009174 | Ga0105241_10936905 | Ga0105241_109369052 | 125 |
| 547 | 3300009174 | Ga0105241_11041831 | Ga0105241_110418311 | 125 |
| 548 | 3300009176 | Ga0105242_10527942 | Ga0105242_105279423 | 125 |
| 549 | 3300009177 | Ga0105248_10000021 | Ga0105248_10000021128 | 125 |
| 550 | 3300009177 | Ga0105248_10003987 | Ga0105248_100039872 | 125 |
| 551 | 3300009177 | Ga0105248_10021485 | Ga0105248_100214855 | 125 |
| 552 | 3300009177 | Ga0105248_10022907 | Ga0105248_1002290712 | 125 |
| 553 | 3300009177 | Ga0105248_10100231 | Ga0105248_101002312 | 125 |
| 554 | 3300009177 | Ga0105248_10106162 | Ga0105248_101061623 | 125 |
| 555 | 3300009177 | Ga0105248_10341020 | Ga0105248_103410202 | 125 |
| 556 | 3300009177 | Ga0105248_10424396 | Ga0105248_104243963 | 125 |
| 557 | 3300009177 | Ga0105248_10736984 | Ga0105248_107369843 | 125 |
| 558 | 3300009177 | Ga0105248_10976747 | Ga0105248_109767472 | 125 |
| 559 | 3300009177 | Ga0105248_11707590 | Ga0105248_117075902 | 125 |
| 560 | 3300009545 | Ga0105237_10002858 | Ga0105237_1000285820 | 125 |
| 561 | 3300009545 | Ga0105237_10186090 | Ga0105237_101860903 | 125 |
| 562 | 3300009545 | Ga0105237_10449722 | Ga0105237_104497223 | 125 |
| 563 | 3300009545 | Ga0105237_10604010 | Ga0105237_106040102 | 125 |
| 564 | 3300009545 | Ga0105237_11513256 | Ga0105237_115132562 | 125 |
| 565 | 3300009551 | Ga0105238_11230877 | Ga0105238_112308773 | 125 |
| 566 | 3300009553 | Ga0105249_10001881 | Ga0105249_1000188125 | 125 |
| 567 | 3300009553 | Ga0105249_10002122 | Ga0105249_1000212224 | 125 |
| 568 | 3300009553 | Ga0105249_10134716 | Ga0105249_101347162 | 125 |
| 569 | 3300009553 | Ga0105249_11020091 | Ga0105249_110200912 | 125 |
| 570 | 3300009553 | Ga0105249_11228458 | Ga0105249_112284582 | 125 |
| 571 | 3300009553 | Ga0105249_11600721 | Ga0105249_116007212 | 125 |
| 572 | 3300010375 | Ga0105239_10457367 | Ga0105239_104573672 | 125 |
| 573 | 3300010375 | Ga0105239_10945649 | Ga0105239_109456492 | 125 |
| 574 | 3300010375 | Ga0105239_11059697 | Ga0105239_110596973 | 125 |
| 575 | 3300010375 | Ga0105239_11679028 | Ga0105239_116790282 | 125 |
| 576 | 3300011119 | Ga0105246_10736332 | Ga0105246_107363322 | 125 |
| 577 | 3300011119 | Ga0105246_11372844 | Ga0105246_113728442 | 125 |
| 578 | 3300012495 | Ga0157323_1030989 | Ga0157323_10309892 | 125 |
| 579 | 3300012505 | Ga0157339_1045827 | Ga0157339_10458272 | 125 |
| 580 | 3300012508 | Ga0157315_1005960 | Ga0157315_10059602 | 125 |
| 581 | 3300012512 | Ga0157327_1020413 | Ga0157327_10204132 | 125 |
| 582 | 3300012515 | Ga0157338_1000992 | Ga0157338_10009924 | 125 |
| 583 | 3300013100 | Ga0157373_10050689 | Ga0157373_100506892 | 125 |
| 584 | 3300013100 | Ga0157373_10172671 | Ga0157373_101726712 | 125 |
| 585 | 3300013100 | Ga0157373_10419244 | Ga0157373_104192443 | 125 |
| 586 | 3300013100 | Ga0157373_10973344 | Ga0157373_109733442 | 125 |
| 587 | 3300013102 | Ga0157371_10152944 | Ga0157371_101529442 | 125 |
| 588 | 3300013102 | Ga0157371_11457855 | Ga0157371_114578552 | 125 |
| 589 | 3300013104 | Ga0157370_10029812 | Ga0157370_100298128 | 125 |
| 590 | 3300013104 | Ga0157370_10102037 | Ga0157370_101020372 | 125 |
| 591 | 3300013105 | Ga0157369_10034063 | Ga0157369_100340638 | 125 |
| 592 | 3300013105 | Ga0157369_10070636 | Ga0157369_100706363 | 125 |
| 593 | 3300013105 | Ga0157369_10153589 | Ga0157369_101535895 | 125 |
| 594 | 3300013105 | Ga0157369_10574155 | Ga0157369_105741552 | 125 |
| 595 | 3300013105 | Ga0157369_10778307 | Ga0157369_107783073 | 125 |
| 596 | 3300013105 | Ga0157369_12320254 | Ga0157369_123202542 | 125 |
| 597 | 3300013296 | Ga0157374_10414302 | Ga0157374_104143022 | 125 |
| 598 | 3300013296 | Ga0157374_10881780 | Ga0157374_108817803 | 125 |
| 599 | 3300013296 | Ga0157374_12289027 | Ga0157374_122890272 | 125 |
| 600 | 3300013297 | Ga0157378_10114310 | Ga0157378_101143102 | 125 |
| 601 | 3300013306 | Ga0163162_10025756 | Ga0163162_100257565 | 125 |
| 602 | 3300013306 | Ga0163162_10404008 | Ga0163162_104040083 | 125 |
| 603 | 3300013306 | Ga0163162_10562907 | Ga0163162_105629072 | 125 |
| 604 | 3300013306 | Ga0163162_10951462 | Ga0163162_109514622 | 125 |
| 605 | 3300013306 | Ga0163162_12300679 | Ga0163162_123006791 | 125 |
| 606 | 3300013307 | Ga0157372_10078683 | Ga0157372_100786832 | 125 |
| 607 | 3300013307 | Ga0157372_10427160 | Ga0157372_104271602 | 125 |
| 608 | 3300013307 | Ga0157372_11844695 | Ga0157372_118446952 | 125 |
| 609 | 3300013307 | Ga0157372_12902238 | Ga0157372_129022382 | 125 |
| 610 | 3300013307 | Ga0157372_13029957 | Ga0157372_130299572 | 125 |
| 611 | 3300013308 | Ga0157375_10007439 | Ga0157375_100074395 | 125 |
| 612 | 3300013308 | Ga0157375_10105208 | Ga0157375_101052082 | 125 |
| 613 | 3300014325 | Ga0163163_10020116 | Ga0163163_1002011613 | 125 |
| 614 | 3300014325 | Ga0163163_10313059 | Ga0163163_103130592 | 125 |
| 615 | 3300014325 | Ga0163163_10314201 | Ga0163163_103142013 | 125 |
| 616 | 3300014325 | Ga0163163_10360924 | Ga0163163_103609242 | 125 |
| 617 | 3300014325 | Ga0163163_10584351 | Ga0163163_105843512 | 125 |
| 618 | 3300014325 | Ga0163163_10591250 | Ga0163163_105912503 | 125 |
| 619 | 3300014325 | Ga0163163_11538253 | Ga0163163_115382532 | 125 |
| 620 | 3300014326 | Ga0157380_10000157 | Ga0157380_100001572 | 125 |
| 621 | 3300014326 | Ga0157380_10015607 | Ga0157380_100156076 | 125 |
| 622 | 3300014326 | Ga0157380_10435926 | Ga0157380_104359262 | 125 |
| 623 | 3300014326 | Ga0157380_10630398 | Ga0157380_106303983 | 125 |
| 624 | 3300014326 | Ga0157380_10677954 | Ga0157380_106779541 | 125 |
| 625 | 3300014326 | Ga0157380_11422723 | Ga0157380_114227232 | 125 |
| 626 | 3300014326 | Ga0157380_11475188 | Ga0157380_114751882 | 125 |
| 627 | 3300014497 | Ga0182008_10184377 | Ga0182008_101843772 | 125 |
| 628 | 3300014745 | Ga0157377_10460577 | Ga0157377_104605772 | 125 |
| 629 | 3300014968 | Ga0157379_10223199 | Ga0157379_102231994 | 125 |
| 630 | 3300014968 | Ga0157379_10665090 | Ga0157379_106650902 | 125 |
| 631 | 3300014968 | Ga0157379_10766984 | Ga0157379_107669841 | 125 |
| 632 | 3300014968 | Ga0157379_11103336 | Ga0157379_111033362 | 125 |
| 633 | 3300014969 | Ga0157376_10019101 | Ga0157376_100191018 | 125 |
| 634 | 3300014969 | Ga0157376_10363485 | Ga0157376_103634852 | 125 |
| 635 | 3300017792 | Ga0163161_10160074 | Ga0163161_101600743 | 125 |
| 636 | 3300017792 | Ga0163161_10359501 | Ga0163161_103595012 | 125 |
| 637 | 3300017792 | Ga0163161_10417686 | Ga0163161_104176862 | 125 |
| 638 | 3300017792 | Ga0163161_10667267 | Ga0163161_106672672 | 125 |
| 639 | 3300020069 | Ga0197907_10673139 | Ga0197907_106731392 | 125 |
| 640 | 3300021388 | Ga0213875_10001626 | Ga0213875_100016268 | 125 |
| 641 | 3300025245 | Ga0207425_1000049 | Ga0207425_1000049172 | 125 |
| 642 | 3300025254 | Ga0209148_1006654 | Ga0209148_10066543 | 125 |
| 643 | 3300025258 | Ga0209129_1000471 | Ga0209129_100047121 | 125 |
| 644 | 3300025263 | Ga0209565_1000985 | Ga0209565_10009853 | 125 |
| 645 | 3300025292 | Ga0209676_1007313 | Ga0209676_10073136 | 125 |
| 646 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068144 | 125 |
| 647 | 3300025295 | Ga0209564_1000335 | Ga0209564_100033587 | 125 |
| 648 | 3300025297 | Ga0209758_1000004 | Ga0209758_100000443 | 125 |
| 649 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011974 | 125 |
| 650 | 3300025298 | Ga0209050_1001064 | Ga0209050_100106414 | 125 |
| 651 | 3300025303 | Ga0209051_1000191 | Ga0209051_100019195 | 125 |
| 652 | 3300025304 | Ga0209257_1004959 | Ga0209257_10049596 | 125 |
| 653 | 3300025315 | Ga0207697_10001580 | Ga0207697_100015803 | 125 |
| 654 | 3300025321 | Ga0207656_10218634 | Ga0207656_102186342 | 125 |
| 655 | 3300025711 | Ga0207696_1000878 | Ga0207696_100087812 | 125 |
| 656 | 3300025735 | Ga0207713_1000752 | Ga0207713_100075223 | 125 |
| 657 | 3300025893 | Ga0207682_10006590 | Ga0207682_100065901 | 125 |
| 658 | 3300025893 | Ga0207682_10286164 | Ga0207682_102861642 | 125 |
| 659 | 3300025893 | Ga0207682_10408647 | Ga0207682_104086472 | 125 |
| 660 | 3300025899 | Ga0207642_10099534 | Ga0207642_100995342 | 125 |
| 661 | 3300025899 | Ga0207642_10321425 | Ga0207642_103214252 | 125 |
| 662 | 3300025899 | Ga0207642_11027184 | Ga0207642_110271841 | 125 |
| 663 | 3300025900 | Ga0207710_10035506 | Ga0207710_100355065 | 125 |
| 664 | 3300025900 | Ga0207710_10036482 | Ga0207710_100364824 | 125 |
| 665 | 3300025900 | Ga0207710_10063379 | Ga0207710_100633792 | 125 |
| 666 | 3300025900 | Ga0207710_10243846 | Ga0207710_102438462 | 125 |
| 667 | 3300025901 | Ga0207688_10113160 | Ga0207688_101131603 | 125 |
| 668 | 3300025901 | Ga0207688_10225106 | Ga0207688_102251062 | 125 |
| 669 | 3300025901 | Ga0207688_10433251 | Ga0207688_104332512 | 125 |
| 670 | 3300025903 | Ga0207680_10013949 | Ga0207680_100139492 | 125 |
| 671 | 3300025903 | Ga0207680_10040390 | Ga0207680_100403902 | 125 |
| 672 | 3300025903 | Ga0207680_10134575 | Ga0207680_101345751 | 125 |
| 673 | 3300025903 | Ga0207680_10201861 | Ga0207680_102018612 | 125 |
| 674 | 3300025903 | Ga0207680_10299365 | Ga0207680_102993652 | 125 |
| 675 | 3300025903 | Ga0207680_10712458 | Ga0207680_107124582 | 125 |
| 676 | 3300025904 | Ga0207647_10008472 | Ga0207647_100084729 | 125 |
| 677 | 3300025904 | Ga0207647_10151764 | Ga0207647_101517643 | 125 |
| 678 | 3300025904 | Ga0207647_10205617 | Ga0207647_102056173 | 125 |
| 679 | 3300025904 | Ga0207647_10356562 | Ga0207647_103565622 | 125 |
| 680 | 3300025907 | Ga0207645_10014351 | Ga0207645_1001435111 | 125 |
| 681 | 3300025907 | Ga0207645_10329078 | Ga0207645_103290783 | 125 |
| 682 | 3300025907 | Ga0207645_10372627 | Ga0207645_103726272 | 125 |
| 683 | 3300025907 | Ga0207645_10486385 | Ga0207645_104863852 | 125 |
| 684 | 3300025907 | Ga0207645_10613201 | Ga0207645_106132012 | 125 |
| 685 | 3300025907 | Ga0207645_11106532 | Ga0207645_111065321 | 125 |
| 686 | 3300025908 | Ga0207643_10262364 | Ga0207643_102623643 | 125 |
| 687 | 3300025908 | Ga0207643_10512962 | Ga0207643_105129622 | 125 |
| 688 | 3300025909 | Ga0207705_10000243 | Ga0207705_1000024330 | 125 |
| 689 | 3300025909 | Ga0207705_10018065 | Ga0207705_1001806510 | 125 |
| 690 | 3300025909 | Ga0207705_10170172 | Ga0207705_101701722 | 125 |
| 691 | 3300025909 | Ga0207705_10298895 | Ga0207705_102988953 | 125 |
| 692 | 3300025909 | Ga0207705_10476427 | Ga0207705_104764272 | 125 |
| 693 | 3300025909 | Ga0207705_11372488 | Ga0207705_113724881 | 125 |
| 694 | 3300025911 | Ga0207654_10000796 | Ga0207654_1000079623 | 125 |
| 695 | 3300025911 | Ga0207654_10272601 | Ga0207654_102726012 | 125 |
| 696 | 3300025911 | Ga0207654_10291692 | Ga0207654_102916922 | 125 |
| 697 | 3300025911 | Ga0207654_10389537 | Ga0207654_103895372 | 125 |
| 698 | 3300025911 | Ga0207654_10679072 | Ga0207654_106790722 | 125 |
| 699 | 3300025912 | Ga0207707_11574258 | Ga0207707_115742581 | 125 |
| 700 | 3300025913 | Ga0207695_10006167 | Ga0207695_1000616718 | 125 |
| 701 | 3300025913 | Ga0207695_10006293 | Ga0207695_1000629311 | 125 |
| 702 | 3300025914 | Ga0207671_10003173 | Ga0207671_100031739 | 125 |
| 703 | 3300025914 | Ga0207671_10043377 | Ga0207671_100433776 | 125 |
| 704 | 3300025914 | Ga0207671_10403494 | Ga0207671_104034943 | 125 |
| 705 | 3300025914 | Ga0207671_10540879 | Ga0207671_105408791 | 125 |
| 706 | 3300025917 | Ga0207660_10044818 | Ga0207660_100448187 | 125 |
| 707 | 3300025917 | Ga0207660_10738150 | Ga0207660_107381502 | 125 |
| 708 | 3300025917 | Ga0207660_11259222 | Ga0207660_112592222 | 125 |
| 709 | 3300025918 | Ga0207662_10447502 | Ga0207662_104475022 | 125 |
| 710 | 3300025918 | Ga0207662_11345789 | Ga0207662_113457892 | 125 |
| 711 | 3300025919 | Ga0207657_10172620 | Ga0207657_101726201 | 125 |
| 712 | 3300025919 | Ga0207657_10287802 | Ga0207657_102878022 | 125 |
| 713 | 3300025919 | Ga0207657_10459521 | Ga0207657_104595212 | 125 |
| 714 | 3300025919 | Ga0207657_10622911 | Ga0207657_106229112 | 125 |
| 715 | 3300025919 | Ga0207657_10823517 | Ga0207657_108235172 | 125 |
| 716 | 3300025919 | Ga0207657_10931409 | Ga0207657_109314092 | 125 |
| 717 | 3300025919 | Ga0207657_11142957 | Ga0207657_111429571 | 125 |
| 718 | 3300025920 | Ga0207649_10155614 | Ga0207649_101556143 | 125 |
| 719 | 3300025920 | Ga0207649_10805784 | Ga0207649_108057842 | 125 |
| 720 | 3300025920 | Ga0207649_11171159 | Ga0207649_111711592 | 125 |
| 721 | 3300025921 | Ga0207652_10843960 | Ga0207652_108439603 | 125 |
| 722 | 3300025923 | Ga0207681_10000005 | Ga0207681_1000000567 | 125 |
| 723 | 3300025923 | Ga0207681_10000109 | Ga0207681_1000010954 | 125 |
| 724 | 3300025923 | Ga0207681_10064025 | Ga0207681_100640253 | 125 |
| 725 | 3300025923 | Ga0207681_10107677 | Ga0207681_101076771 | 125 |
| 726 | 3300025923 | Ga0207681_10135208 | Ga0207681_101352083 | 125 |
| 727 | 3300025923 | Ga0207681_10135695 | Ga0207681_101356954 | 125 |
| 728 | 3300025923 | Ga0207681_10136951 | Ga0207681_101369513 | 125 |
| 729 | 3300025923 | Ga0207681_10322916 | Ga0207681_103229162 | 125 |
| 730 | 3300025923 | Ga0207681_10686576 | Ga0207681_106865762 | 125 |
| 731 | 3300025923 | Ga0207681_10743248 | Ga0207681_107432482 | 125 |
| 732 | 3300025924 | Ga0207694_10002782 | Ga0207694_100027829 | 125 |
| 733 | 3300025924 | Ga0207694_11295342 | Ga0207694_112953421 | 125 |
| 734 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004654 | 125 |
| 735 | 3300025925 | Ga0207650_10010619 | Ga0207650_100106193 | 125 |
| 736 | 3300025925 | Ga0207650_10012172 | Ga0207650_100121722 | 125 |
| 737 | 3300025925 | Ga0207650_10117282 | Ga0207650_101172823 | 125 |
| 738 | 3300025925 | Ga0207650_10149651 | Ga0207650_101496514 | 125 |
| 739 | 3300025925 | Ga0207650_10203478 | Ga0207650_102034782 | 125 |
| 740 | 3300025925 | Ga0207650_10329309 | Ga0207650_103293092 | 125 |
| 741 | 3300025925 | Ga0207650_10482537 | Ga0207650_104825372 | 125 |
| 742 | 3300025925 | Ga0207650_11599005 | Ga0207650_115990051 | 125 |
| 743 | 3300025926 | Ga0207659_10001819 | Ga0207659_100018194 | 125 |
| 744 | 3300025926 | Ga0207659_11189377 | Ga0207659_111893772 | 125 |
| 745 | 3300025926 | Ga0207659_11863388 | Ga0207659_118633881 | 125 |
| 746 | 3300025928 | Ga0207700_10348620 | Ga0207700_103486202 | 125 |
| 747 | 3300025929 | Ga0207664_10033807 | Ga0207664_100338076 | 125 |
| 748 | 3300025929 | Ga0207664_10407847 | Ga0207664_104078472 | 125 |
| 749 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005326 | 125 |
| 750 | 3300025931 | Ga0207644_10002343 | Ga0207644_1000234320 | 125 |
| 751 | 3300025931 | Ga0207644_10013980 | Ga0207644_1001398011 | 125 |
| 752 | 3300025931 | Ga0207644_10015604 | Ga0207644_100156046 | 125 |
| 753 | 3300025931 | Ga0207644_10265646 | Ga0207644_102656463 | 125 |
| 754 | 3300025931 | Ga0207644_10873001 | Ga0207644_108730012 | 125 |
| 755 | 3300025932 | Ga0207690_10000234 | Ga0207690_100002343 | 125 |
| 756 | 3300025932 | Ga0207690_10064522 | Ga0207690_100645222 | 125 |
| 757 | 3300025932 | Ga0207690_10233117 | Ga0207690_102331172 | 125 |
| 758 | 3300025932 | Ga0207690_10244551 | Ga0207690_102445512 | 125 |
| 759 | 3300025932 | Ga0207690_10799856 | Ga0207690_107998561 | 125 |
| 760 | 3300025932 | Ga0207690_11074208 | Ga0207690_110742081 | 125 |
| 761 | 3300025932 | Ga0207690_11385288 | Ga0207690_113852882 | 125 |
| 762 | 3300025933 | Ga0207706_10018915 | Ga0207706_100189156 | 125 |
| 763 | 3300025933 | Ga0207706_10104516 | Ga0207706_101045162 | 125 |
| 764 | 3300025933 | Ga0207706_10215402 | Ga0207706_102154023 | 125 |
| 765 | 3300025933 | Ga0207706_10695595 | Ga0207706_106955952 | 125 |
| 766 | 3300025933 | Ga0207706_10788478 | Ga0207706_107884782 | 125 |
| 767 | 3300025933 | Ga0207706_10966870 | Ga0207706_109668701 | 125 |
| 768 | 3300025933 | Ga0207706_11278411 | Ga0207706_112784112 | 125 |
| 769 | 3300025934 | Ga0207686_11238963 | Ga0207686_112389632 | 125 |
| 770 | 3300025934 | Ga0207686_11632044 | Ga0207686_116320441 | 125 |
| 771 | 3300025935 | Ga0207709_10294414 | Ga0207709_102944142 | 125 |
| 772 | 3300025935 | Ga0207709_10305309 | Ga0207709_103053092 | 125 |
| 773 | 3300025935 | Ga0207709_10425941 | Ga0207709_104259412 | 125 |
| 774 | 3300025935 | Ga0207709_11136648 | Ga0207709_111366482 | 125 |
| 775 | 3300025935 | Ga0207709_11393360 | Ga0207709_113933602 | 125 |
| 776 | 3300025936 | Ga0207670_10140665 | Ga0207670_101406653 | 125 |
| 777 | 3300025936 | Ga0207670_10157716 | Ga0207670_101577163 | 125 |
| 778 | 3300025937 | Ga0207669_10012728 | Ga0207669_100127286 | 125 |
| 779 | 3300025937 | Ga0207669_10172189 | Ga0207669_101721893 | 125 |
| 780 | 3300025937 | Ga0207669_10188591 | Ga0207669_101885913 | 125 |
| 781 | 3300025937 | Ga0207669_10793102 | Ga0207669_107931021 | 125 |
| 782 | 3300025938 | Ga0207704_10188806 | Ga0207704_101888063 | 125 |
| 783 | 3300025938 | Ga0207704_10403625 | Ga0207704_104036252 | 125 |
| 784 | 3300025938 | Ga0207704_10425485 | Ga0207704_104254852 | 125 |
| 785 | 3300025938 | Ga0207704_11083677 | Ga0207704_110836772 | 125 |
| 786 | 3300025939 | Ga0207665_10728840 | Ga0207665_107288402 | 125 |
| 787 | 3300025940 | Ga0207691_10017921 | Ga0207691_1001792110 | 125 |
| 788 | 3300025940 | Ga0207691_10443159 | Ga0207691_104431592 | 125 |
| 789 | 3300025940 | Ga0207691_10565637 | Ga0207691_105656373 | 125 |
| 790 | 3300025940 | Ga0207691_10826742 | Ga0207691_108267422 | 125 |
| 791 | 3300025940 | Ga0207691_10921219 | Ga0207691_109212191 | 125 |
| 792 | 3300025940 | Ga0207691_11405573 | Ga0207691_114055731 | 125 |
| 793 | 3300025940 | Ga0207691_11670538 | Ga0207691_116705381 | 125 |
| 794 | 3300025941 | Ga0207711_10000025 | Ga0207711_10000025168 | 125 |
| 795 | 3300025941 | Ga0207711_10001472 | Ga0207711_100014725 | 125 |
| 796 | 3300025941 | Ga0207711_10004929 | Ga0207711_100049293 | 125 |
| 797 | 3300025941 | Ga0207711_10007295 | Ga0207711_100072958 | 125 |
| 798 | 3300025941 | Ga0207711_10018353 | Ga0207711_100183537 | 125 |
| 799 | 3300025941 | Ga0207711_10198760 | Ga0207711_101987602 | 125 |
| 800 | 3300025941 | Ga0207711_10293709 | Ga0207711_102937092 | 125 |
| 801 | 3300025941 | Ga0207711_10689339 | Ga0207711_106893392 | 125 |
| 802 | 3300025941 | Ga0207711_11171456 | Ga0207711_111714562 | 125 |
| 803 | 3300025944 | Ga0207661_12027118 | Ga0207661_120271181 | 125 |
| 804 | 3300025945 | Ga0207679_10000847 | Ga0207679_1000084721 | 125 |
| 805 | 3300025945 | Ga0207679_10024678 | Ga0207679_100246786 | 125 |
| 806 | 3300025945 | Ga0207679_10169733 | Ga0207679_101697333 | 125 |
| 807 | 3300025945 | Ga0207679_10523914 | Ga0207679_105239142 | 125 |
| 808 | 3300025945 | Ga0207679_10976302 | Ga0207679_109763022 | 125 |
| 809 | 3300025945 | Ga0207679_11842983 | Ga0207679_118429831 | 125 |
| 810 | 3300025949 | Ga0207667_10004183 | Ga0207667_100041839 | 125 |
| 811 | 3300025949 | Ga0207667_10009439 | Ga0207667_1000943916 | 125 |
| 812 | 3300025949 | Ga0207667_10021256 | Ga0207667_100212568 | 125 |
| 813 | 3300025949 | Ga0207667_10033512 | Ga0207667_1003351213 | 125 |
| 814 | 3300025949 | Ga0207667_10113219 | Ga0207667_101132195 | 125 |
| 815 | 3300025949 | Ga0207667_10758480 | Ga0207667_107584802 | 125 |
| 816 | 3300025949 | Ga0207667_12045683 | Ga0207667_120456832 | 125 |
| 817 | 3300025960 | Ga0207651_10073408 | Ga0207651_100734082 | 125 |
| 818 | 3300025960 | Ga0207651_10120124 | Ga0207651_101201241 | 125 |
| 819 | 3300025960 | Ga0207651_11294335 | Ga0207651_112943352 | 125 |
| 820 | 3300025961 | Ga0207712_10006239 | Ga0207712_100062396 | 125 |
| 821 | 3300025961 | Ga0207712_10037061 | Ga0207712_100370613 | 125 |
| 822 | 3300025961 | Ga0207712_10112962 | Ga0207712_101129622 | 125 |
| 823 | 3300025961 | Ga0207712_10124942 | Ga0207712_101249422 | 125 |
| 824 | 3300025961 | Ga0207712_10405567 | Ga0207712_104055671 | 125 |
| 825 | 3300025961 | Ga0207712_10515107 | Ga0207712_105151072 | 125 |
| 826 | 3300025972 | Ga0207668_10032300 | Ga0207668_100323008 | 125 |
| 827 | 3300025972 | Ga0207668_10098711 | Ga0207668_100987112 | 125 |
| 828 | 3300025972 | Ga0207668_10125743 | Ga0207668_101257432 | 125 |
| 829 | 3300025972 | Ga0207668_10142601 | Ga0207668_101426013 | 125 |
| 830 | 3300025972 | Ga0207668_10520698 | Ga0207668_105206983 | 125 |
| 831 | 3300025972 | Ga0207668_10896992 | Ga0207668_108969921 | 125 |
| 832 | 3300025972 | Ga0207668_11544709 | Ga0207668_115447092 | 125 |
| 833 | 3300025981 | Ga0207640_10007440 | Ga0207640_100074406 | 125 |
| 834 | 3300025981 | Ga0207640_10019616 | Ga0207640_100196166 | 125 |
| 835 | 3300025981 | Ga0207640_10023695 | Ga0207640_100236956 | 125 |
| 836 | 3300025981 | Ga0207640_10075290 | Ga0207640_100752902 | 125 |
| 837 | 3300025981 | Ga0207640_10310522 | Ga0207640_103105221 | 125 |
| 838 | 3300025981 | Ga0207640_10564709 | Ga0207640_105647092 | 125 |
| 839 | 3300025981 | Ga0207640_11117636 | Ga0207640_111176361 | 125 |
| 840 | 3300025986 | Ga0207658_10000064 | Ga0207658_1000006456 | 125 |
| 841 | 3300025986 | Ga0207658_10004938 | Ga0207658_100049389 | 125 |
| 842 | 3300025986 | Ga0207658_10005381 | Ga0207658_100053812 | 125 |
| 843 | 3300025986 | Ga0207658_10245342 | Ga0207658_102453423 | 125 |
| 844 | 3300025986 | Ga0207658_10289784 | Ga0207658_102897842 | 125 |
| 845 | 3300025986 | Ga0207658_10336283 | Ga0207658_103362833 | 125 |
| 846 | 3300026023 | Ga0207677_10456903 | Ga0207677_104569032 | 125 |
| 847 | 3300026035 | Ga0207703_10187314 | Ga0207703_101873142 | 125 |
| 848 | 3300026035 | Ga0207703_10465468 | Ga0207703_104654682 | 125 |
| 849 | 3300026035 | Ga0207703_11092724 | Ga0207703_110927241 | 125 |
| 850 | 3300026035 | Ga0207703_11468793 | Ga0207703_114687932 | 125 |
| 851 | 3300026035 | Ga0207703_11497294 | Ga0207703_114972942 | 125 |
| 852 | 3300026041 | Ga0207639_10019581 | Ga0207639_100195813 | 125 |
| 853 | 3300026041 | Ga0207639_10250926 | Ga0207639_102509263 | 125 |
| 854 | 3300026041 | Ga0207639_10341890 | Ga0207639_103418901 | 125 |
| 855 | 3300026041 | Ga0207639_10371280 | Ga0207639_103712803 | 125 |
| 856 | 3300026041 | Ga0207639_10467754 | Ga0207639_104677541 | 125 |
| 857 | 3300026067 | Ga0207678_10014182 | Ga0207678_100141826 | 125 |
| 858 | 3300026067 | Ga0207678_10110312 | Ga0207678_101103122 | 125 |
| 859 | 3300026067 | Ga0207678_10166893 | Ga0207678_101668933 | 125 |
| 860 | 3300026067 | Ga0207678_11238296 | Ga0207678_112382962 | 125 |
| 861 | 3300026067 | Ga0207678_11399066 | Ga0207678_113990662 | 125 |
| 862 | 3300026067 | Ga0207678_11670553 | Ga0207678_116705532 | 125 |
| 863 | 3300026075 | Ga0207708_10016146 | Ga0207708_1001614611 | 125 |
| 864 | 3300026075 | Ga0207708_10344216 | Ga0207708_103442162 | 125 |
| 865 | 3300026075 | Ga0207708_11082489 | Ga0207708_110824892 | 125 |
| 866 | 3300026075 | Ga0207708_11246471 | Ga0207708_112464711 | 125 |
| 867 | 3300026078 | Ga0207702_10003021 | Ga0207702_100030219 | 125 |
| 868 | 3300026078 | Ga0207702_10005908 | Ga0207702_100059088 | 125 |
| 869 | 3300026078 | Ga0207702_10613417 | Ga0207702_106134172 | 125 |
| 870 | 3300026088 | Ga0207641_10003244 | Ga0207641_100032443 | 125 |
| 871 | 3300026088 | Ga0207641_10101679 | Ga0207641_101016792 | 125 |
| 872 | 3300026088 | Ga0207641_10127150 | Ga0207641_101271504 | 125 |
| 873 | 3300026088 | Ga0207641_10150340 | Ga0207641_101503403 | 125 |
| 874 | 3300026088 | Ga0207641_10323913 | Ga0207641_103239132 | 125 |
| 875 | 3300026088 | Ga0207641_11820018 | Ga0207641_118200182 | 125 |
| 876 | 3300026089 | Ga0207648_10240702 | Ga0207648_102407023 | 125 |
| 877 | 3300026089 | Ga0207648_10459080 | Ga0207648_104590803 | 125 |
| 878 | 3300026089 | Ga0207648_11292458 | Ga0207648_112924582 | 125 |
| 879 | 3300026095 | Ga0207676_10000006 | Ga0207676_1000000658 | 125 |
| 880 | 3300026095 | Ga0207676_10014415 | Ga0207676_100144158 | 125 |
| 881 | 3300026095 | Ga0207676_10136112 | Ga0207676_101361125 | 125 |
| 882 | 3300026095 | Ga0207676_10250941 | Ga0207676_102509413 | 125 |
| 883 | 3300026095 | Ga0207676_10278645 | Ga0207676_102786452 | 125 |
| 884 | 3300026095 | Ga0207676_10972285 | Ga0207676_109722851 | 125 |
| 885 | 3300026116 | Ga0207674_10062161 | Ga0207674_100621614 | 125 |
| 886 | 3300026116 | Ga0207674_10062748 | Ga0207674_100627488 | 125 |
| 887 | 3300026116 | Ga0207674_10141809 | Ga0207674_101418095 | 125 |
| 888 | 3300026116 | Ga0207674_10648444 | Ga0207674_106484443 | 125 |
| 889 | 3300026116 | Ga0207674_10939193 | Ga0207674_109391932 | 125 |
| 890 | 3300026116 | Ga0207674_11092817 | Ga0207674_110928172 | 125 |
| 891 | 3300026118 | Ga0207675_100001117 | Ga0207675_10000111728 | 125 |
| 892 | 3300026118 | Ga0207675_100022526 | Ga0207675_10002252611 | 125 |
| 893 | 3300026118 | Ga0207675_100155097 | Ga0207675_1001550975 | 125 |
| 894 | 3300026118 | Ga0207675_100877104 | Ga0207675_1008771042 | 125 |
| 895 | 3300026118 | Ga0207675_101019576 | Ga0207675_1010195762 | 125 |
| 896 | 3300026121 | Ga0207683_10000681 | Ga0207683_100006813 | 125 |
| 897 | 3300026121 | Ga0207683_10382507 | Ga0207683_103825072 | 125 |
| 898 | 3300026121 | Ga0207683_10777255 | Ga0207683_107772552 | 125 |
| 899 | 3300026121 | Ga0207683_11466886 | Ga0207683_114668862 | 125 |
| 900 | 3300026142 | Ga0207698_10016673 | Ga0207698_100166736 | 125 |
| 901 | 3300026142 | Ga0207698_10195073 | Ga0207698_101950732 | 125 |
| 902 | 3300026142 | Ga0207698_10281969 | Ga0207698_102819692 | 125 |
| 903 | 3300026142 | Ga0207698_10577682 | Ga0207698_105776823 | 125 |
| 904 | 3300026142 | Ga0207698_10713984 | Ga0207698_107139842 | 125 |
| 905 | 3300026142 | Ga0207698_11103613 | Ga0207698_111036131 | 125 |
| 906 | 3300026142 | Ga0207698_11288864 | Ga0207698_112888642 | 125 |
| 907 | 3300027312 | Ga0209371_1030624 | Ga0209371_10306243 | 125 |
| 908 | 3300027424 | Ga0209984_1008264 | Ga0209984_10082643 | 125 |
| 909 | 3300027526 | Ga0209968_1021665 | Ga0209968_10216653 | 125 |
| 910 | 3300027526 | Ga0209968_1039141 | Ga0209968_10391412 | 125 |
| 911 | 3300027552 | Ga0209982_1015255 | Ga0209982_10152552 | 125 |
| 912 | 3300027614 | Ga0209970_1056825 | Ga0209970_10568252 | 125 |
| 913 | 3300027665 | Ga0209983_1010835 | Ga0209983_10108352 | 125 |
| 914 | 3300027665 | Ga0209983_1054690 | Ga0209983_10546902 | 125 |
| 915 | 3300027665 | Ga0209983_1082206 | Ga0209983_10822061 | 125 |
| 916 | 3300027717 | Ga0209998_10099554 | Ga0209998_100995542 | 125 |
| 917 | 3300027876 | Ga0209974_10082069 | Ga0209974_100820692 | 125 |
| 918 | 3300027876 | Ga0209974_10086086 | Ga0209974_100860863 | 125 |
| 919 | 3300027907 | Ga0207428_10197963 | Ga0207428_101979631 | 125 |
| 920 | 3300027907 | Ga0207428_11065529 | Ga0207428_110655292 | 125 |
| 921 | 3300028379 | Ga0268266_10012801 | Ga0268266_100128017 | 125 |
| 922 | 3300028379 | Ga0268266_10022523 | Ga0268266_100225237 | 125 |
| 923 | 3300028379 | Ga0268266_10511648 | Ga0268266_105116483 | 125 |
| 924 | 3300028379 | Ga0268266_10785691 | Ga0268266_107856912 | 125 |
| 925 | 3300028380 | Ga0268265_10000001 | Ga0268265_100000011120 | 125 |
| 926 | 3300028380 | Ga0268265_10001591 | Ga0268265_1000159114 | 125 |
| 927 | 3300028380 | Ga0268265_10168803 | Ga0268265_101688033 | 125 |
| 928 | 3300028380 | Ga0268265_10342767 | Ga0268265_103427672 | 125 |
| 929 | 3300028380 | Ga0268265_10356224 | Ga0268265_103562243 | 125 |
| 930 | 3300028380 | Ga0268265_10622760 | Ga0268265_106227602 | 125 |
| 931 | 3300028380 | Ga0268265_12008182 | Ga0268265_120081821 | 125 |
| 932 | 3300028381 | Ga0268264_10000277 | Ga0268264_10000277100 | 125 |
| 933 | 3300028381 | Ga0268264_10015144 | Ga0268264_1001514413 | 125 |
| 934 | 3300028381 | Ga0268264_10058700 | Ga0268264_100587006 | 125 |
| 935 | 3300028381 | Ga0268264_10102800 | Ga0268264_101028002 | 125 |
| 936 | 3300028381 | Ga0268264_10177216 | Ga0268264_101772163 | 125 |
| 937 | 3300028381 | Ga0268264_10505030 | Ga0268264_105050301 | 125 |
| 938 | 3300030731 | Ga0316177_1214891 | Ga0316177_12148912 | 125 |
| 939 | 3300030733 | Ga0314311_1010360 | Ga0314311_10103603 | 125 |
| 940 | 3300030735 | Ga0316178_1068395 | Ga0316178_10683952 | 125 |
| 941 | 3300031548 | Ga0307408_100006443 | Ga0307408_1000064439 | 125 |
| 942 | 3300031548 | Ga0307408_100023913 | Ga0307408_1000239131 | 125 |
| 943 | 3300031548 | Ga0307408_100094952 | Ga0307408_1000949522 | 125 |
| 944 | 3300031548 | Ga0307408_100491550 | Ga0307408_1004915503 | 125 |
| 945 | 3300031548 | Ga0307408_100666816 | Ga0307408_1006668162 | 125 |
| 946 | 3300031711 | Ga0265314_10149514 | Ga0265314_101495141 | 125 |
| 947 | 3300031727 | Ga0316576_10543318 | Ga0316576_105433182 | 125 |
| 948 | 3300031731 | Ga0307405_10019698 | Ga0307405_100196982 | 125 |
| 949 | 3300031731 | Ga0307405_10057515 | Ga0307405_100575152 | 125 |
| 950 | 3300031731 | Ga0307405_10144798 | Ga0307405_101447983 | 125 |
| 951 | 3300031731 | Ga0307405_10171397 | Ga0307405_101713972 | 125 |
| 952 | 3300031731 | Ga0307405_10340784 | Ga0307405_103407842 | 125 |
| 953 | 3300031731 | Ga0307405_10871404 | Ga0307405_108714042 | 125 |
| 954 | 3300031731 | Ga0307405_11653421 | Ga0307405_116534212 | 125 |
| 955 | 3300031824 | Ga0307413_10074509 | Ga0307413_100745095 | 125 |
| 956 | 3300031824 | Ga0307413_10086312 | Ga0307413_100863123 | 125 |
| 957 | 3300031824 | Ga0307413_10113610 | Ga0307413_101136104 | 125 |
| 958 | 3300031824 | Ga0307413_10567311 | Ga0307413_105673113 | 125 |
| 959 | 3300031824 | Ga0307413_10602167 | Ga0307413_106021673 | 125 |
| 960 | 3300031824 | Ga0307413_10699901 | Ga0307413_106999012 | 125 |
| 961 | 3300031824 | Ga0307413_10779755 | Ga0307413_107797552 | 125 |
| 962 | 3300031852 | Ga0307410_10012286 | Ga0307410_100122862 | 125 |
| 963 | 3300031852 | Ga0307410_10099934 | Ga0307410_100999344 | 125 |
| 964 | 3300031852 | Ga0307410_10120091 | Ga0307410_101200912 | 125 |
| 965 | 3300031852 | Ga0307410_10306713 | Ga0307410_103067133 | 125 |
| 966 | 3300031852 | Ga0307410_10360926 | Ga0307410_103609262 | 125 |
| 967 | 3300031852 | Ga0307410_10407171 | Ga0307410_104071713 | 125 |
| 968 | 3300031852 | Ga0307410_10522766 | Ga0307410_105227661 | 125 |
| 969 | 3300031852 | Ga0307410_10862790 | Ga0307410_108627902 | 125 |
| 970 | 3300031852 | Ga0307410_10885716 | Ga0307410_108857162 | 125 |
| 971 | 3300031852 | Ga0307410_11274668 | Ga0307410_112746681 | 125 |
| 972 | 3300031901 | Ga0307406_10008913 | Ga0307406_100089132 | 125 |
| 973 | 3300031901 | Ga0307406_10046990 | Ga0307406_100469905 | 125 |
| 974 | 3300031901 | Ga0307406_10053412 | Ga0307406_100534124 | 125 |
| 975 | 3300031901 | Ga0307406_10912592 | Ga0307406_109125922 | 125 |
| 976 | 3300031903 | Ga0307407_10002227 | Ga0307407_100022273 | 125 |
| 977 | 3300031903 | Ga0307407_10070319 | Ga0307407_100703195 | 125 |
| 978 | 3300031903 | Ga0307407_10315871 | Ga0307407_103158713 | 125 |
| 979 | 3300031903 | Ga0307407_10520755 | Ga0307407_105207552 | 125 |
| 980 | 3300031903 | Ga0307407_10569608 | Ga0307407_105696081 | 125 |
| 981 | 3300031903 | Ga0307407_10788895 | Ga0307407_107888952 | 125 |
| 982 | 3300031911 | Ga0307412_10000330 | Ga0307412_1000033024 | 125 |
| 983 | 3300031911 | Ga0307412_10001378 | Ga0307412_1000137813 | 125 |
| 984 | 3300031911 | Ga0307412_10005349 | Ga0307412_100053498 | 125 |
| 985 | 3300031911 | Ga0307412_10088494 | Ga0307412_100884941 | 125 |
| 986 | 3300031911 | Ga0307412_10143230 | Ga0307412_101432302 | 125 |
| 987 | 3300031911 | Ga0307412_10149070 | Ga0307412_101490703 | 125 |
| 988 | 3300031911 | Ga0307412_10897320 | Ga0307412_108973202 | 125 |
| 989 | 3300031911 | Ga0307412_10998701 | Ga0307412_109987012 | 125 |
| 990 | 3300031995 | Ga0307409_100054731 | Ga0307409_1000547315 | 125 |
| 991 | 3300031995 | Ga0307409_100120541 | Ga0307409_1001205413 | 125 |
| 992 | 3300031995 | Ga0307409_100468498 | Ga0307409_1004684982 | 125 |
| 993 | 3300031995 | Ga0307409_100499224 | Ga0307409_1004992243 | 125 |
| 994 | 3300031995 | Ga0307409_101199490 | Ga0307409_1011994902 | 125 |
| 995 | 3300031995 | Ga0307409_101523219 | Ga0307409_1015232192 | 125 |
| 996 | 3300031995 | Ga0307409_101984172 | Ga0307409_1019841722 | 125 |
| 997 | 3300032002 | Ga0307416_100005600 | Ga0307416_1000056005 | 125 |
| 998 | 3300032002 | Ga0307416_100007111 | Ga0307416_1000071118 | 125 |
| 999 | 3300032002 | Ga0307416_100015206 | Ga0307416_1000152068 | 125 |
| 1000 | 3300032002 | Ga0307416_100343007 | Ga0307416_1003430072 | 125 |
| 1001 | 3300032002 | Ga0307416_100420483 | Ga0307416_1004204833 | 125 |
| 1002 | 3300032002 | Ga0307416_100716940 | Ga0307416_1007169403 | 125 |
| 1003 | 3300032002 | Ga0307416_100904952 | Ga0307416_1009049522 | 125 |
| 1004 | 3300032002 | Ga0307416_101291913 | Ga0307416_1012919132 | 125 |
| 1005 | 3300032004 | Ga0307414_10000117 | Ga0307414_1000011743 | 125 |
| 1006 | 3300032004 | Ga0307414_10013980 | Ga0307414_100139808 | 125 |
| 1007 | 3300032004 | Ga0307414_10017211 | Ga0307414_100172116 | 125 |
| 1008 | 3300032004 | Ga0307414_10313918 | Ga0307414_103139183 | 125 |
| 1009 | 3300032004 | Ga0307414_10667321 | Ga0307414_106673212 | 125 |
| 1010 | 3300032004 | Ga0307414_10708957 | Ga0307414_107089573 | 125 |
| 1011 | 3300032004 | Ga0307414_11089132 | Ga0307414_110891322 | 125 |
| 1012 | 3300032005 | Ga0307411_10016991 | Ga0307411_100169913 | 125 |
| 1013 | 3300032005 | Ga0307411_10118140 | Ga0307411_101181401 | 125 |
| 1014 | 3300032005 | Ga0307411_10191187 | Ga0307411_101911872 | 125 |
| 1015 | 3300032005 | Ga0307411_10202406 | Ga0307411_102024063 | 125 |
| 1016 | 3300032005 | Ga0307411_10279700 | Ga0307411_102797003 | 125 |
| 1017 | 3300032005 | Ga0307411_10319906 | Ga0307411_103199063 | 125 |
| 1018 | 3300032005 | Ga0307411_10469979 | Ga0307411_104699792 | 125 |
| 1019 | 3300032005 | Ga0307411_10831451 | Ga0307411_108314512 | 125 |
| 1020 | 3300032005 | Ga0307411_10911586 | Ga0307411_109115863 | 125 |
| 1021 | 3300032005 | Ga0307411_11536867 | Ga0307411_115368672 | 125 |
| 1022 | 3300032005 | Ga0307411_11542581 | Ga0307411_115425812 | 125 |
| 1023 | 3300032126 | Ga0307415_100006247 | Ga0307415_1000062478 | 125 |
| 1024 | 3300032126 | Ga0307415_100011564 | Ga0307415_1000115643 | 125 |
| 1025 | 3300032126 | Ga0307415_100013332 | Ga0307415_10001333211 | 125 |
| 1026 | 3300032126 | Ga0307415_100169143 | Ga0307415_1001691431 | 125 |
| 1027 | 3300032126 | Ga0307415_100188481 | Ga0307415_1001884812 | 125 |
| 1028 | 3300032126 | Ga0307415_101289550 | Ga0307415_1012895502 | 125 |
| 1029 | 3300032126 | Ga0307415_101311329 | Ga0307415_1013113292 | 125 |
| 1030 | 3300032126 | Ga0307415_101478990 | Ga0307415_1014789901 | 125 |
| 1031 | 3300032126 | Ga0307415_101868588 | Ga0307415_1018685882 | 125 |
| 1032 | 3300032168 | Ga0316593_10137165 | Ga0316593_101371651 | 125 |
| 1033 | 3300033180 | Ga0307510_10013278 | Ga0307510_1001327810 | 125 |
| 1034 | 3300034818 | Ga0373950_0157713 | Ga0373950_0157713_23_400 | 125 |
| 1035 | 3300035090 | Ga0373949_0162496 | Ga0373949_0162496_82_459 | 125 |
| 1036 | 3300035114 | Ga0373939_0036939 | Ga0373939_0036939_945_1322 | 125 |
| 1037 | 3300035170 | Ga0373943_0861582 | Ga0373943_0861582_140_517 | 125 |
| 1038 | 3300035172 | Ga0373955_0225626 | Ga0373955_0225626_50_427 | 125 |
| 1039 | 3300035242 | Ga0373962_0088605 | Ga0373962_0088605_526_903 | 125 |
| 1040 | 3300035691 | Ga0373931_0034960 | Ga0373931_0034960_616_993 | 125 |
| 1041 | 3300036712 | Ga0316584_0035209 | Ga0316584_0035209_2722_3099 | 125 |
| 1042 | 3300037068 | Ga0373925_1046502 | Ga0373925_1046502_149_529 | 125 |
| 1043 | 3300037312 | Ga0395899_0029552 | Ga0395899_0029552_363_740 | 125 |
| 1044 | 3300037418 | Ga0395900_0022460 | Ga0395900_0022460_455_832 | 125 |
| 1045 | 3300037418 | Ga0395900_0031276 | Ga0395900_0031276_4742_5125 | 125 |
| 1046 | 3300037418 | Ga0395900_0401581 | Ga0395900_0401581_559_936 | 125 |
| 1047 | 3300037418 | Ga0395900_0735156 | Ga0395900_0735156_202_579 | 125 |
| 1048 | 3300037466 | Ga0395898_0522393 | Ga0395898_0522393_95_472 | 125 |
| 1049 | 3300037466 | Ga0395898_0653944 | Ga0395898_0653944_161_538 | 125 |
| 1050 | 3300037471 | Ga0395905_0035925 | Ga0395905_0035925_3350_3727 | 125 |
| 1051 | 3300037471 | Ga0395905_0173828 | Ga0395905_0173828_1489_1866 | 125 |
| 1052 | 3300037471 | Ga0395905_0194372 | Ga0395905_0194372_582_959 | 125 |
| 1053 | 3300037471 | Ga0395905_0274258 | Ga0395905_0274258_319_696 | 125 |
| 1054 | 3300037471 | Ga0395905_0328510 | Ga0395905_0328510_586_963 | 125 |
| 1055 | 3300037471 | Ga0395905_0362780 | Ga0395905_0362780_771_1148 | 125 |
| 1056 | 3300037471 | Ga0395905_0478760 | Ga0395905_0478760_697_1074 | 125 |
| 1057 | 3300037471 | Ga0395905_0507598 | Ga0395905_0507598_391_768 | 125 |
| 1058 | 3300037471 | Ga0395905_0958577 | Ga0395905_0958577_30_407 | 125 |
| 1059 | 3300037853 | Ga0436364_1065372 | Ga0436364_1065372_104029_104406 | 125 |
| 1060 | 3300038443 | Ga0395901_0029243 | Ga0395901_0029243_5201_5578 | 125 |
| 1061 | 3300038443 | Ga0395901_0052641 | Ga0395901_0052641_2665_3048 | 125 |
| 1062 | 3300038443 | Ga0395901_0263263 | Ga0395901_0263263_988_1365 | 125 |
| 1063 | 3300038443 | Ga0395901_0598300 | Ga0395901_0598300_725_1102 | 125 |
| 1064 | 3300038443 | Ga0395901_1159643 | Ga0395901_1159643_336_713 | 125 |
| 1065 | 3300038443 | Ga0395901_2044905 | Ga0395901_2044905_81_458 | 125 |
| 1066 | 3300039437 | Ga0436365_1297965 | Ga0436365_1297965_113_490 | 125 |
| 1067 | 3300039450 | Ga0436363_1100502 | Ga0436363_1100502_342_737 | 125 |
| 1068 | 3300039453 | Ga0436362_0798514 | Ga0436362_0798514_1985_2362 | 125 |
| 1069 | 3300041408 | Ga0439453_0061634 | Ga0439453_0061634_198_578 | 125 |
| 1070 | 3300041413 | Ga0439465_0070568 | Ga0439465_0070568_720_1097 | 125 |
| 1071 | 3300041413 | Ga0439465_0156571 | Ga0439465_0156571_65_442 | 125 |
| 1072 | 3300041444 | Ga0451790_00316 | Ga0451790_00316_224_604 | 125 |
| 1073 | 3300041451 | Ga0451791_0503248 | Ga0451791_0503248_196_579 | 125 |
| 1074 | 3300041452 | Ga0451793_0741227 | Ga0451793_0741227_144_521 | 125 |
| 1075 | 3300041452 | Ga0451793_1374280 | Ga0451793_1374280_118_495 | 125 |
| 1076 | 3300041458 | Ga0451798_0619513 | Ga0451798_0619513_90_467 | 125 |
| 1077 | 3300041460 | Ga0451802_2082364 | Ga0451802_2082364_561_938 | 125 |
| 1078 | 3300041462 | Ga0451806_470971 | Ga0451806_470971_411_788 | 125 |
| 1079 | 3300041462 | Ga0451806_566321 | Ga0451806_566321_147_524 | 125 |
| 1080 | 3300041486 | Ga0451807_0886460 | Ga0451807_0886460_90_467 | 125 |
| 1081 | 3300041491 | Ga0451833_0002658 | Ga0451833_0002658_279_656 | 125 |
| 1082 | 3300041492 | Ga0451835_0542372 | Ga0451835_0542372_22_399 | 125 |
| 1083 | 3300041507 | Ga0451851_0815981 | Ga0451851_0815981_91_468 | 125 |
| 1084 | 3300041511 | Ga0451855_1317451 | Ga0451855_1317451_176_559 | 125 |
| 1085 | 3300041511 | Ga0451855_1380188 | Ga0451855_1380188_333_710 | 125 |
| 1086 | 3300041512 | Ga0451853_3932357 | Ga0451853_3932357_298_675 | 125 |
| 1087 | 3300041999 | Ga0439433_0025105 | Ga0439433_0025105_301_678 | 125 |
| 1088 | 3300042001 | Ga0439441_020693 | Ga0439441_020693_522_899 | 125 |
| 1089 | 3300042004 | Ga0439445_0002249 | Ga0439445_0002249_752_1129 | 125 |
| 1090 | 3300042005 | Ga0439448_0055818 | Ga0439448_0055818_332_709 | 125 |
| 1091 | 3300042006 | Ga0439432_106712 | Ga0439432_106712_83_460 | 125 |
| 1092 | 3300042007 | Ga0439449_0044016 | Ga0439449_0044016_575_952 | 125 |
| 1093 | 3300042008 | Ga0439450_019689 | Ga0439450_019689_360_740 | 125 |
| 1094 | 3300042011 | Ga0439454_067357 | Ga0439454_067357_144_521 | 125 |
| 1095 | 3300042012 | Ga0439455_0078878 | Ga0439455_0078878_370_747 | 125 |
| 1096 | 3300042116 | Ga0450912_000406 | Ga0450912_000406_1545_1922 | 125 |
| 1097 | 3300042120 | Ga0450917_002616 | Ga0450917_002616_444_824 | 125 |
| 1098 | 3300042122 | Ga0450920_018839 | Ga0450920_018839_421_798 | 125 |
| 1099 | 3300042125 | Ga0450923_015818 | Ga0450923_015818_853_1230 | 125 |
| 1100 | 3300042137 | Ga0450902_055233 | Ga0450902_055233_167_544 | 125 |
| 1101 | 3300042145 | Ga0450906_019463 | Ga0450906_019463_161_538 | 125 |
| 1102 | 3300042156 | Ga0439446_0145971 | Ga0439446_0145971_177_554 | 125 |
| 1103 | 3300042531 | Ga0450918_033244 | Ga0450918_033244_379_756 | 125 |
| 1104 | 3300042876 | Ga0451577_0940419 | Ga0451577_0940419_244_621 | 125 |
| 1105 | 3300044656 | Ga0466969_0076277 | Ga0466969_0076277_1216_1593 | 125 |
| 1106 | 3300044658 | Ga0466972_0209711 | Ga0466972_0209711_321_698 | 125 |
| 1107 | 3300044684 | Ga0466966_0213565 | Ga0466966_0213565_644_1021 | 125 |
| 1108 | 3300044712 | Ga0453684_0153114 | Ga0453684_0153114_865_1242 | 125 |
| 1109 | 3300044712 | Ga0453684_0589010 | Ga0453684_0589010_544_921 | 125 |
| 1110 | 3300044719 | Ga0466971_0372534 | Ga0466971_0372534_203_580 | 125 |
| 1111 | 3300044735 | Ga0466968_0010999 | Ga0466968_0010999_1387_1764 | 125 |
| 1112 | 3300044842 | Ga0466957_0553996 | Ga0466957_0553996_282_659 | 125 |
| 1113 | 3300044842 | Ga0466957_1061208 | Ga0466957_1061208_164_541 | 125 |
| 1114 | 3300045049 | Ga0466959_0263063 | Ga0466959_0263063_10_387 | 125 |
| 1115 | 3300045049 | Ga0466959_0289265 | Ga0466959_0289265_182_559 | 125 |
| 1116 | 3300045051 | Ga0451576_2139109 | Ga0451576_2139109_144_521 | 125 |
| 1117 | 3300045836 | Ga0466958_0451214 | Ga0466958_0451214_12_389 | 125 |
| 1118 | 3300045836 | Ga0466958_0765460 | Ga0466958_0765460_136_513 | 125 |
| 1119 | 3300045976 | Ga0466967_0407001 | Ga0466967_0407001_808_1185 | 125 |
| 1120 | 3300046457 | Ga0495590_0241931 | Ga0495590_0241931_160_537 | 125 |
| 1121 | 3300046460 | Ga0495638_0115483 | Ga0495638_0115483_859_1236 | 125 |
| 1122 | 3300046460 | Ga0495638_0606663 | Ga0495638_0606663_89_466 | 125 |
| 1123 | 3300046491 | Ga0495584_0131949 | Ga0495584_0131949_27_407 | 125 |
| 1124 | 3300046519 | Ga0495632_0246087 | Ga0495632_0246087_260_637 | 125 |
| 1125 | 3300046525 | Ga0495663_0078113 | Ga0495663_0078113_375_752 | 125 |
| 1126 | 3300046528 | Ga0495642_0576188 | Ga0495642_0576188_66_443 | 125 |
| 1127 | 3300046542 | Ga0495597_0229089 | Ga0495597_0229089_229_606 | 125 |
| 1128 | 3300046557 | Ga0495622_0322808 | Ga0495622_0322808_176_556 | 125 |
| 1129 | 3300046616 | Ga0495668_0166107 | Ga0495668_0166107_64_444 | 125 |
| 1130 | 3300046616 | Ga0495668_0416197 | Ga0495668_0416197_171_548 | 125 |
| 1131 | 3300046684 | Ga0495669_0116862 | Ga0495669_0116862_570_947 | 125 |
| 1132 | 3300046684 | Ga0495669_0410406 | Ga0495669_0410406_138_515 | 125 |
| 1133 | 3300046691 | Ga0495670_0015418 | Ga0495670_0015418_408_788 | 125 |
| 1134 | 3300046691 | Ga0495670_0357840 | Ga0495670_0357840_151_531 | 125 |
| 1135 | 3300046694 | Ga0495649_0097490 | Ga0495649_0097490_536_913 | 125 |
| 1136 | 3300046794 | Ga0495589_0122273 | Ga0495589_0122273_636_1016 | 125 |
| 1137 | 3300046794 | Ga0495589_0293318 | Ga0495589_0293318_331_708 | 125 |
| 1138 | 3300047323 | Ga0495683_0246985 | Ga0495683_0246985_27_404 | 125 |
| 1139 | 3300047445 | Ga0495677_0218494 | Ga0495677_0218494_258_635 | 125 |
| 1140 | 3300047447 | Ga0495685_217507 | Ga0495685_217507_131_508 | 125 |
| 1141 | 3300047469 | Ga0495673_0098949 | Ga0495673_0098949_680_1060 | 125 |
| 1142 | 3300047470 | Ga0495681_0063192 | Ga0495681_0063192_837_1214 | 125 |
| 1143 | 3300048903 | Ga0496100_0017887 | Ga0496100_0017887_511_888 | 125 |
| 1144 | 3300048903 | Ga0496100_0042948 | Ga0496100_0042948_1189_1572 | 125 |
| 1145 | 3300048903 | Ga0496100_0065395 | Ga0496100_0065395_1155_1532 | 125 |
| 1146 | 3300048903 | Ga0496100_0072649 | Ga0496100_0072649_738_1118 | 125 |
| 1147 | 3300048903 | Ga0496100_0100037 | Ga0496100_0100037_1476_1856 | 125 |
| 1148 | 3300048903 | Ga0496100_0401531 | Ga0496100_0401531_431_808 | 125 |
| 1149 | 3300048904 | Ga0496101_0007782 | Ga0496101_0007782_6527_6904 | 125 |
| 1150 | 3300048904 | Ga0496101_0013181 | Ga0496101_0013181_3759_4139 | 125 |
| 1151 | 3300048904 | Ga0496101_0046999 | Ga0496101_0046999_1150_1533 | 125 |
| 1152 | 3300048904 | Ga0496101_0060073 | Ga0496101_0060073_196_576 | 125 |
| 1153 | 3300048904 | Ga0496101_0105123 | Ga0496101_0105123_832_1209 | 125 |
| 1154 | 3300048904 | Ga0496101_0476988 | Ga0496101_0476988_95_478 | 125 |
| 1155 | 3300048904 | Ga0496101_0983045 | Ga0496101_0983045_67_444 | 125 |
| 1156 | 3300048905 | Ga0496102_0000345 | Ga0496102_0000345_36054_36437 | 125 |
| 1157 | 3300048905 | Ga0496102_0001880 | Ga0496102_0001880_5308_5685 | 125 |
| 1158 | 3300048905 | Ga0496102_0038393 | Ga0496102_0038393_1458_1841 | 125 |
| 1159 | 3300048905 | Ga0496102_0321597 | Ga0496102_0321597_1036_1416 | 125 |
| 1160 | 3300048905 | Ga0496102_0362700 | Ga0496102_0362700_710_1087 | 125 |
| 1161 | 3300048906 | Ga0496103_0000110 | Ga0496103_0000110_73908_74285 | 125 |
| 1162 | 3300048906 | Ga0496103_0000276 | Ga0496103_0000276_12425_12808 | 125 |
| 1163 | 3300048906 | Ga0496103_0010156 | Ga0496103_0010156_5150_5533 | 125 |
| 1164 | 3300048906 | Ga0496103_0030798 | Ga0496103_0030798_1819_2199 | 125 |
| 1165 | 3300048906 | Ga0496103_0064863 | Ga0496103_0064863_248_628 | 125 |
| 1166 | 3300048906 | Ga0496103_0193874 | Ga0496103_0193874_675_1055 | 125 |
| 1167 | 3300048907 | Ga0496104_0000047 | Ga0496104_0000047_15829_16206 | 125 |
| 1168 | 3300048907 | Ga0496104_0015109 | Ga0496104_0015109_833_1216 | 125 |
| 1169 | 3300048907 | Ga0496104_0045259 | Ga0496104_0045259_3092_3472 | 125 |
| 1170 | 3300048907 | Ga0496104_0171951 | Ga0496104_0171951_1470_1850 | 125 |
| 1171 | 3300048907 | Ga0496104_0471527 | Ga0496104_0471527_576_956 | 125 |
| 1172 | 3300048907 | Ga0496104_1079821 | Ga0496104_1079821_11_400 | 125 |
| 1173 | 3300048908 | Ga0496105_0000034 | Ga0496105_0000034_123441_123818 | 125 |
| 1174 | 3300048908 | Ga0496105_0013990 | Ga0496105_0013990_2041_2424 | 125 |
| 1175 | 3300048908 | Ga0496105_0071727 | Ga0496105_0071727_306_686 | 125 |
| 1176 | 3300048908 | Ga0496105_0074994 | Ga0496105_0074994_2366_2746 | 125 |
| 1177 | 3300048909 | Ga0496106_0004127 | Ga0496106_0004127_5535_5918 | 125 |
| 1178 | 3300048909 | Ga0496106_0087648 | Ga0496106_0087648_14_394 | 125 |
| 1179 | 3300048909 | Ga0496106_0192678 | Ga0496106_0192678_318_695 | 125 |
| 1180 | 3300048909 | Ga0496106_0538407 | Ga0496106_0538407_462_839 | 125 |
| 1181 | 3300048909 | Ga0496106_0600882 | Ga0496106_0600882_475_852 | 125 |
| 1182 | 3300048909 | Ga0496106_0831324 | Ga0496106_0831324_302_682 | 125 |
| 1183 | 3300048910 | Ga0496107_0002978 | Ga0496107_0002978_9453_9833 | 125 |
| 1184 | 3300048910 | Ga0496107_0065334 | Ga0496107_0065334_2128_2505 | 125 |
| 1185 | 3300048910 | Ga0496107_0075313 | Ga0496107_0075313_1570_1953 | 125 |
| 1186 | 3300048910 | Ga0496107_0092297 | Ga0496107_0092297_1556_1936 | 125 |
| 1187 | 3300048910 | Ga0496107_0114521 | Ga0496107_0114521_879_1256 | 125 |
| 1188 | 3300048910 | Ga0496107_0574145 | Ga0496107_0574145_255_632 | 125 |
| 1189 | 3300048911 | Ga0496108_0017449 | Ga0496108_0017449_270_653 | 125 |
| 1190 | 3300048911 | Ga0496108_0247391 | Ga0496108_0247391_211_591 | 125 |
| 1191 | 3300048912 | Ga0496109_0006427 | Ga0496109_0006427_2321_2698 | 125 |
| 1192 | 3300048912 | Ga0496109_0012139 | Ga0496109_0012139_5164_5544 | 125 |
| 1193 | 3300048912 | Ga0496109_0017285 | Ga0496109_0017285_1576_1956 | 125 |
| 1194 | 3300048912 | Ga0496109_0347268 | Ga0496109_0347268_997_1377 | 125 |
| 1195 | 3300048912 | Ga0496109_0444060 | Ga0496109_0444060_406_783 | 125 |
| 1196 | 3300048912 | Ga0496109_0451919 | Ga0496109_0451919_459_842 | 125 |
| 1197 | 3300048913 | Ga0496110_0032770 | Ga0496110_0032770_330_713 | 125 |
| 1198 | 3300048913 | Ga0496110_0310814 | Ga0496110_0310814_276_653 | 125 |
| 1199 | 3300048913 | Ga0496110_0516261 | Ga0496110_0516261_551_928 | 125 |
| 1200 | 3300048913 | Ga0496110_0712834 | Ga0496110_0712834_358_735 | 125 |
| 1201 | 3300048913 | Ga0496110_0958406 | Ga0496110_0958406_64_441 | 125 |
| 1202 | 3300048914 | Ga0496111_0056586 | Ga0496111_0056586_2149_2532 | 125 |
| 1203 | 3300048914 | Ga0496111_0515411 | Ga0496111_0515411_445_822 | 125 |
| 1204 | 3300048914 | Ga0496111_0535498 | Ga0496111_0535498_460_837 | 125 |
| 1205 | 3300048914 | Ga0496111_1019852 | Ga0496111_1019852_32_409 | 125 |
| 1206 | 3300048915 | Ga0496112_0030279 | Ga0496112_0030279_1499_1876 | 125 |
| 1207 | 3300048915 | Ga0496112_0038752 | Ga0496112_0038752_3295_3678 | 125 |
| 1208 | 3300048915 | Ga0496112_0046698 | Ga0496112_0046698_2511_2888 | 125 |
| 1209 | 3300048915 | Ga0496112_0094664 | Ga0496112_0094664_2029_2409 | 125 |
| 1210 | 3300048916 | Ga0496113_0011540 | Ga0496113_0011540_2396_2779 | 125 |
| 1211 | 3300048916 | Ga0496113_0011673 | Ga0496113_0011673_211_588 | 125 |
| 1212 | 3300048916 | Ga0496113_0014734 | Ga0496113_0014734_3393_3773 | 125 |
| 1213 | 3300048916 | Ga0496113_0086466 | Ga0496113_0086466_1172_1549 | 125 |
| 1214 | 3300048917 | Ga0496114_0029773 | Ga0496114_0029773_2935_3312 | 125 |
| 1215 | 3300048917 | Ga0496114_0062704 | Ga0496114_0062704_2192_2572 | 125 |
| 1216 | 3300048917 | Ga0496114_0104199 | Ga0496114_0104199_1977_2357 | 125 |
| 1217 | 3300048917 | Ga0496114_0267595 | Ga0496114_0267595_833_1213 | 125 |
| 1218 | 3300048917 | Ga0496114_0475808 | Ga0496114_0475808_86_469 | 125 |
| 1219 | 3300048918 | Ga0496115_0007121 | Ga0496115_0007121_5452_5832 | 125 |
| 1220 | 3300048918 | Ga0496115_0030807 | Ga0496115_0030807_454_834 | 125 |
| 1221 | 3300048918 | Ga0496115_0179827 | Ga0496115_0179827_1319_1696 | 125 |
| 1222 | 3300048918 | Ga0496115_0563570 | Ga0496115_0563570_413_793 | 125 |
| 1223 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_160778_161155 | 125 |
| 1224 | 3300048919 | Ga0496116_0006727 | Ga0496116_0006727_5378_5755 | 125 |
| 1225 | 3300048919 | Ga0496116_0162835 | Ga0496116_0162835_203_586 | 125 |
| 1226 | 3300048919 | Ga0496116_0478282 | Ga0496116_0478282_96_473 | 125 |
| 1227 | 3300048920 | Ga0496117_0000146 | Ga0496117_0000146_62358_62735 | 125 |
| 1228 | 3300048920 | Ga0496117_0000633 | Ga0496117_0000633_20182_20565 | 125 |
| 1229 | 3300048920 | Ga0496117_0056690 | Ga0496117_0056690_1653_2030 | 125 |
| 1230 | 3300048920 | Ga0496117_0104942 | Ga0496117_0104942_603_980 | 125 |
| 1231 | 3300048920 | Ga0496117_0198027 | Ga0496117_0198027_28_405 | 125 |
| 1232 | 3300048921 | Ga0496118_0000654 | Ga0496118_0000654_36054_36437 | 125 |
| 1233 | 3300048921 | Ga0496118_0001846 | Ga0496118_0001846_24582_24959 | 125 |
| 1234 | 3300048921 | Ga0496118_0083807 | Ga0496118_0083807_1557_1934 | 125 |
| 1235 | 3300048922 | Ga0496119_0000057 | Ga0496119_0000057_49929_50306 | 125 |
| 1236 | 3300048922 | Ga0496119_0107924 | Ga0496119_0107924_91_468 | 125 |
| 1237 | 3300048923 | Ga0496120_0000686 | Ga0496120_0000686_33528_33905 | 125 |
| 1238 | 3300048924 | Ga0496121_0002302 | Ga0496121_0002302_1078_1455 | 125 |
| 1239 | 3300048924 | Ga0496121_0004567 | Ga0496121_0004567_15494_15871 | 125 |
| 1240 | 3300048924 | Ga0496121_0127343 | Ga0496121_0127343_584_961 | 125 |
| 1241 | 3300048925 | Ga0496122_0000723 | Ga0496122_0000723_9311_9688 | 125 |
| 1242 | 3300048925 | Ga0496122_0009631 | Ga0496122_0009631_1790_2167 | 125 |
| 1243 | 3300048925 | Ga0496122_0115844 | Ga0496122_0115844_546_923 | 125 |
| 1244 | 3300048926 | Ga0496123_0003623 | Ga0496123_0003623_5240_5617 | 125 |
| 1245 | 3300048926 | Ga0496123_0005637 | Ga0496123_0005637_8472_8849 | 125 |
| 1246 | 3300048926 | Ga0496123_0072757 | Ga0496123_0072757_246_623 | 125 |
| 1247 | 3300048927 | Ga0496124_0000664 | Ga0496124_0000664_36054_36437 | 125 |
| 1248 | 3300048927 | Ga0496124_0005247 | Ga0496124_0005247_9360_9737 | 125 |
| 1249 | 3300048927 | Ga0496124_0005829 | Ga0496124_0005829_10638_11015 | 125 |
| 1250 | 3300048927 | Ga0496124_0008523 | Ga0496124_0008523_4375_4752 | 125 |
| 1251 | 3300048927 | Ga0496124_0299375 | Ga0496124_0299375_433_810 | 125 |
| 1252 | 3300048928 | Ga0496125_0003283 | Ga0496125_0003283_3655_4032 | 125 |
| 1253 | 3300048928 | Ga0496125_0018829 | Ga0496125_0018829_1001_1384 | 125 |
| 1254 | 3300048928 | Ga0496125_0038992 | Ga0496125_0038992_475_852 | 125 |
| 1255 | 3300048928 | Ga0496125_0152988 | Ga0496125_0152988_525_902 | 125 |
| 1256 | 3300048928 | Ga0496125_0377163 | Ga0496125_0377163_247_624 | 125 |
| 1257 | 3300048929 | Ga0496126_0000028 | Ga0496126_0000028_68288_68665 | 125 |
| 1258 | 3300048929 | Ga0496126_0000084 | Ga0496126_0000084_72902_73279 | 125 |
| 1259 | 3300048929 | Ga0496126_0396529 | Ga0496126_0396529_170_547 | 125 |
| 1260 | 3300049127 | Ga0501306_028173 | Ga0501306_028173_97_474 | 125 |
| 1261 | 3300049127 | Ga0501306_048947 | Ga0501306_048947_81_458 | 125 |
| 1262 | 3300049127 | Ga0501306_051230 | Ga0501306_051230_65_442 | 125 |
| 1263 | 3300049161 | Ga0501305_057482 | Ga0501305_057482_239_616 | 125 |
| 1264 | 3300049162 | Ga0501307_077067 | Ga0501307_077067_78_455 | 125 |
| 1265 | 3300049528 | Ga0501312_074784 | Ga0501312_074784_53_430 | 125 |
| 1266 | 3300049530 | Ga0501314_000002 | Ga0501314_000002_5749_6132 | 125 |
| 1267 | 3300049531 | Ga0501315_017306 | Ga0501315_017306_69_446 | 125 |
| 1268 | 3300049533 | Ga0501317_055003 | Ga0501317_055003_34_417 | 125 |
| 1269 | 3300049539 | Ga0501323_031592 | Ga0501323_031592_299_676 | 125 |
| 1270 | 3300049539 | Ga0501323_088693 | Ga0501323_088693_116_493 | 125 |
| 1271 | 3300049551 | Ga0501335_007167 | Ga0501335_007167_214_591 | 125 |
| 1272 | 3300049551 | Ga0501335_014667 | Ga0501335_014667_364_741 | 125 |
| 1273 | 3300049568 | Ga0501031_0126555 | Ga0501031_0126555_757_1137 | 125 |
| 1274 | 3300049568 | Ga0501031_0241885 | Ga0501031_0241885_626_1006 | 125 |
| 1275 | 3300049568 | Ga0501031_0765269 | Ga0501031_0765269_104_484 | 125 |
| 1276 | 3300049569 | Ga0501032_0208418 | Ga0501032_0208418_226_603 | 125 |
| 1277 | 3300049569 | Ga0501032_0415952 | Ga0501032_0415952_186_566 | 125 |
| 1278 | 3300049570 | Ga0501033_0172227 | Ga0501033_0172227_1071_1451 | 125 |
| 1279 | 3300049570 | Ga0501033_0270797 | Ga0501033_0270797_161_541 | 125 |
| 1280 | 3300049571 | Ga0501034_0025412 | Ga0501034_0025412_2157_2540 | 125 |
| 1281 | 3300049571 | Ga0501034_0247035 | Ga0501034_0247035_453_830 | 125 |
| 1282 | 3300049572 | Ga0501036_0018306 | Ga0501036_0018306_4245_4625 | 125 |
| 1283 | 3300049572 | Ga0501036_0042635 | Ga0501036_0042635_2751_3131 | 125 |
| 1284 | 3300049572 | Ga0501036_0165512 | Ga0501036_0165512_995_1375 | 125 |
| 1285 | 3300049572 | Ga0501036_0813227 | Ga0501036_0813227_322_702 | 125 |
| 1286 | 3300049573 | Ga0501037_0138294 | Ga0501037_0138294_472_852 | 125 |
| 1287 | 3300049573 | Ga0501037_0194822 | Ga0501037_0194822_588_968 | 125 |
| 1288 | 3300049573 | Ga0501037_0668128 | Ga0501037_0668128_212_589 | 125 |
| 1289 | 3300049573 | Ga0501037_0848222 | Ga0501037_0848222_128_505 | 125 |
| 1290 | 3300049574 | Ga0501038_0078858 | Ga0501038_0078858_209_589 | 125 |
| 1291 | 3300049574 | Ga0501038_0099119 | Ga0501038_0099119_1585_1965 | 125 |
| 1292 | 3300049574 | Ga0501038_0460347 | Ga0501038_0460347_82_459 | 125 |
| 1293 | 3300049574 | Ga0501038_0708435 | Ga0501038_0708435_110_490 | 125 |
| 1294 | 3300049575 | Ga0501039_0099065 | Ga0501039_0099065_212_592 | 125 |
| 1295 | 3300049576 | Ga0501040_0092275 | Ga0501040_0092275_274_654 | 125 |
| 1296 | 3300049576 | Ga0501040_0099905 | Ga0501040_0099905_1470_1850 | 125 |
| 1297 | 3300049577 | Ga0501041_0030131 | Ga0501041_0030131_2469_2849 | 125 |
| 1298 | 3300049577 | Ga0501041_0078054 | Ga0501041_0078054_1397_1777 | 125 |
| 1299 | 3300049578 | Ga0501042_0049150 | Ga0501042_0049150_631_1011 | 125 |
| 1300 | 3300049579 | Ga0501043_0449366 | Ga0501043_0449366_210_590 | 125 |
| 1301 | 3300049579 | Ga0501043_0454212 | Ga0501043_0454212_113_490 | 125 |
| 1302 | 3300049580 | Ga0501046_0013319 | Ga0501046_0013319_345_725 | 125 |
| 1303 | 3300049580 | Ga0501046_0084789 | Ga0501046_0084789_1063_1443 | 125 |
| 1304 | 3300049580 | Ga0501046_0661801 | Ga0501046_0661801_313_690 | 125 |
| 1305 | 3300049581 | Ga0501047_0343378 | Ga0501047_0343378_313_690 | 125 |
| 1306 | 3300049581 | Ga0501047_0960007 | Ga0501047_0960007_250_639 | 125 |
| 1307 | 3300049582 | Ga0501048_0229422 | Ga0501048_0229422_511_891 | 125 |
| 1308 | 3300049582 | Ga0501048_0253661 | Ga0501048_0253661_752_1132 | 125 |
| 1309 | 3300049582 | Ga0501048_0686070 | Ga0501048_0686070_328_708 | 125 |
| 1310 | 3300049582 | Ga0501048_1305937 | Ga0501048_1305937_128_505 | 125 |
| 1311 | 3300049583 | Ga0501067_0207443 | Ga0501067_0207443_64_441 | 125 |
| 1312 | 3300049584 | Ga0501068_0030631 | Ga0501068_0030631_129_509 | 125 |
| 1313 | 3300049584 | Ga0501068_0122438 | Ga0501068_0122438_71_451 | 125 |
| 1314 | 3300049584 | Ga0501068_0582926 | Ga0501068_0582926_220_597 | 125 |
| 1315 | 3300049585 | Ga0501069_0010393 | Ga0501069_0010393_818_1195 | 125 |
| 1316 | 3300049585 | Ga0501069_0488905 | Ga0501069_0488905_164_544 | 125 |
| 1317 | 3300049585 | Ga0501069_0776948 | Ga0501069_0776948_125_502 | 125 |
| 1318 | 3300049586 | Ga0501070_0014243 | Ga0501070_0014243_3678_4055 | 125 |
| 1319 | 3300049586 | Ga0501070_0371806 | Ga0501070_0371806_247_624 | 125 |
| 1320 | 3300049586 | Ga0501070_0587267 | Ga0501070_0587267_166_546 | 125 |
| 1321 | 3300049586 | Ga0501070_0911750 | Ga0501070_0911750_129_509 | 125 |
| 1322 | 3300049587 | Ga0501071_0017063 | Ga0501071_0017063_2338_2718 | 125 |
| 1323 | 3300049587 | Ga0501071_0330706 | Ga0501071_0330706_637_1014 | 125 |
| 1324 | 3300049588 | Ga0501072_0242569 | Ga0501072_0242569_906_1286 | 125 |
| 1325 | 3300049588 | Ga0501072_0245070 | Ga0501072_0245070_998_1378 | 125 |
| 1326 | 3300049588 | Ga0501072_0900024 | Ga0501072_0900024_55_435 | 125 |
| 1327 | 3300049590 | Ga0501074_0110230 | Ga0501074_0110230_23_403 | 125 |
| 1328 | 3300049591 | Ga0501075_0013808 | Ga0501075_0013808_5223_5603 | 125 |
| 1329 | 3300049591 | Ga0501075_0224856 | Ga0501075_0224856_345_725 | 125 |
| 1330 | 3300049592 | Ga0501076_0000421 | Ga0501076_0000421_18582_18962 | 125 |
| 1331 | 3300049592 | Ga0501076_0094632 | Ga0501076_0094632_156_536 | 125 |
| 1332 | 3300049592 | Ga0501076_0733278 | Ga0501076_0733278_198_575 | 125 |
| 1333 | 3300049592 | Ga0501076_0965506 | Ga0501076_0965506_254_634 | 125 |
| 1334 | 3300049593 | Ga0501077_0022721 | Ga0501077_0022721_880_1260 | 125 |
| 1335 | 3300049593 | Ga0501077_0067033 | Ga0501077_0067033_1762_2142 | 125 |
| 1336 | 3300049663 | Ga0501223_000394 | Ga0501223_000394_5471_5854 | 125 |
| 1337 | 3300049664 | Ga0501224_000009 | Ga0501224_000009_5474_5857 | 125 |
| 1338 | 3300049668 | Ga0501233_000604 | Ga0501233_000604_2016_2399 | 125 |
| 1339 | 3300049669 | Ga0501235_004379 | Ga0501235_004379_1013_1396 | 125 |
| 1340 | 3300049672 | Ga0501239_007192 | Ga0501239_007192_148_525 | 125 |
| 1341 | 3300049682 | Ga0501252_066287 | Ga0501252_066287_52_429 | 125 |
| 1342 | 3300049686 | Ga0501257_074213 | Ga0501257_074213_288_665 | 125 |
| 1343 | 3300049688 | Ga0501259_155413 | Ga0501259_155413_17_394 | 125 |
| 1344 | 3300049705 | Ga0501225_0000094 | Ga0501225_0000094_21288_21671 | 125 |
| 1345 | 3300049741 | Ga0501079_0013561 | Ga0501079_0013561_5703_6083 | 125 |
| 1346 | 3300049741 | Ga0501079_0166268 | Ga0501079_0166268_1164_1544 | 125 |
| 1347 | 3300049741 | Ga0501079_0439844 | Ga0501079_0439844_273_653 | 125 |
| 1348 | 3300049741 | Ga0501079_1267185 | Ga0501079_1267185_97_477 | 125 |
| 1349 | 3300049742 | Ga0501080_0306890 | Ga0501080_0306890_1001_1381 | 125 |
| 1350 | 3300049743 | Ga0501081_0063944 | Ga0501081_0063944_1478_1858 | 125 |
| 1351 | 3300049743 | Ga0501081_0207993 | Ga0501081_0207993_614_994 | 125 |
| 1352 | 3300049744 | Ga0501083_0122165 | Ga0501083_0122165_1260_1640 | 125 |
| 1353 | 3300049765 | Ga0501268_060531 | Ga0501268_060531_228_605 | 125 |
| 1354 | 3300049767 | Ga0501270_042241 | Ga0501270_042241_57_434 | 125 |
| 1355 | 3300049822 | Ga0501035_0331354 | Ga0501035_0331354_137_517 | 125 |
| 1356 | 3300049823 | Ga0501044_0791978 | Ga0501044_0791978_153_533 | 125 |
| 1357 | 3300049823 | Ga0501044_0937891 | Ga0501044_0937891_172_552 | 125 |
| 1358 | 3300049824 | Ga0501045_0139388 | Ga0501045_0139388_844_1224 | 125 |
| 1359 | 3300049824 | Ga0501045_0323542 | Ga0501045_0323542_683_1063 | 125 |
| 1360 | 3300049824 | Ga0501045_0873588 | Ga0501045_0873588_143_520 | 125 |
| 1361 | 3300049853 | Ga0501226_000076 | Ga0501226_000076_24403_24786 | 125 |
| 1362 | 3300050489 | nmdc:mga03683_31_c1 | nmdc:mga03683_31_c1_19355_19732 | 125 |
| 1363 | 3300050490 | nmdc:mga03n38_4566_c1 | nmdc:mga03n38_4566_c1_4080_4457 | 125 |
| 1364 | 3300050491 | nmdc:mga00v17_110640_c1 | nmdc:mga00v17_110640_c1_442_819 | 125 |
| 1365 | 3300050493 | nmdc:mga0k408_125335_c2 | nmdc:mga0k408_125335_c2_220_597 | 125 |
| 1366 | 3300050493 | nmdc:mga0k408_538_c1 | nmdc:mga0k408_538_c1_1104_1481 | 125 |
| 1367 | 3300050494 | nmdc:mga06z11_260048_c1 | nmdc:mga06z11_260048_c1_186_563 | 125 |
| 1368 | 3300050496 | nmdc:mga07m45_19_c1 | nmdc:mga07m45_19_c1_19449_19826 | 125 |
| 1369 | 3300050507 | nmdc:mga05p37_49513_c1 | nmdc:mga05p37_49513_c1_2721_3101 | 125 |
| 1370 | 3300050510 | nmdc:mga06r32_274856_c1 | nmdc:mga06r32_274856_c1_358_738 | 125 |
| 1371 | 3300050511 | nmdc:mga08y16_343991_c1 | nmdc:mga08y16_343991_c1_942_1319 | 125 |
| 1372 | 3300050511 | nmdc:mga08y16_531895_c1 | nmdc:mga08y16_531895_c1_49_429 | 125 |
| 1373 | 3300050512 | nmdc:mga0n895_2125338_c1 | nmdc:mga0n895_2125338_c1_83_460 | 125 |
| 1374 | 3300053087 | Ga0500643_013492 | Ga0500643_013492_149_526 | 125 |
| 1375 | 3300053096 | Ga0500641_0426902 | Ga0500641_0426902_60_437 | 125 |
| 1376 | 3300053146 | Ga0500588_0155506 | Ga0500588_0155506_337_714 | 125 |
| 1377 | 3300053153 | Ga0500616_0047381 | Ga0500616_0047381_1227_1604 | 125 |
| 1378 | 3300053157 | Ga0500624_000023 | Ga0500624_000023_9427_9810 | 125 |
| 1379 | 3300053178 | Ga0500637_0000611 | Ga0500637_0000611_4330_4713 | 125 |
| 1380 | 3300054114 | Ga0501084_0010490 | Ga0501084_0010490_1600_1980 | 125 |
| 1381 | 3300054114 | Ga0501084_0161123 | Ga0501084_0161123_134_514 | 125 |
| 1382 | 3300054114 | Ga0501084_1325812 | Ga0501084_1325812_99_479 | 125 |
| 1383 | 3300059424 | Ga0590075_187193 | Ga0590075_187193_63_440 | 125 |
| 1384 | 3300059493 | Ga0587077_059136 | Ga0587077_059136_319_696 | 125 |
| 1385 | 3300059493 | Ga0587077_131644 | Ga0587077_131644_16_393 | 125 |
| 1386 | 3300059630 | Ga0587128_135039 | Ga0587128_135039_95_472 | 125 |
| 1387 | 3300059641 | Ga0587068_017978 | Ga0587068_017978_373_753 | 125 |
| 1388 | 3300060344 | Ga0587071_036914 | Ga0587071_036914_278_658 | 125 |
| 1389 | 3300060344 | Ga0587071_123092 | Ga0587071_123092_204_581 | 125 |
| 1390 | 3300060353 | Ga0501082_0015085 | Ga0501082_0015085_579_959 | 125 |
| 1391 | 3300060353 | Ga0501082_0173837 | Ga0501082_0173837_233_613 | 125 |
| 1392 | 3300060353 | Ga0501082_0282211 | Ga0501082_0282211_824_1204 | 125 |
| 1393 | 3300060353 | Ga0501082_1793504 | Ga0501082_1793504_79_459 | 125 |
| 1394 | 3300061734 | Ga0530510_0006306 | Ga0530510_0006306_5493_5873 | 125 |
| 1395 | 3300061734 | Ga0530510_0041695 | Ga0530510_0041695_432_812 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c93-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9333 | 14 | 119 |
| 8c95-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9236 | 14 | 122 |
| 8c9a-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9234 | 15 | 119 |
| 6pvk-assembly1.cif.gz_S | bacterial 45srbga ribosomal particle class a | 0.9176 | 15 | 122 |
| 8c94-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9087 | 14 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5mmiT00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8717 | 14 | 122 | 3.90.470.10 |
| 4g5uS00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8694 | 14 | 125 | 3.90.470.10 |
| af_O74464_102_233_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8693 | 13 | 121 | 3.90.470.10 |
| af_I1K1P2_86_208_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8675 | 14 | 125 | 3.90.470.10 |
| af_P56795_7_145_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8668 | 9 | 121 | 3.90.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N6AF95-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9006 | 7 | 125 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A3R8A008-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.8941 | 13 | 124 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A1I5NCQ9-F1-model_v4 | 50S ribosomal protein L22 | 0.8917 | 1 | 123 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A1Y1HXX3-F1-model_v4 | Large ribosomal subunit protein uL22c | 0.8884 | 12 | 124 |
GO:0003735
GO:0005762 GO:0006412 |
| AF-A0A424KJ66-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.8863 | 13 | 125 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar