F493616

General Info

Members Datasets Scaffolds Average Seq Length
1394 546 1394 107

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10159148|Ga0265342_101591483
Length 112
Sequence MTYVVTEACIKCKFMDCVEVCPVDCFYEGDNMLVIHPDECIDCGVCEPECPPEAIKADTEPGLEKWLTLNADYAKKWPNITQHGTAPADAKEWEGVPDKFEKYFSDKPGSGS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
220 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
221 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
227 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
232 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
235 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
236 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
242 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
243 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
244 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
245 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
246 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
252 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
253 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
254 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
257 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
258 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
259 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
262 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
263 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
267 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
268 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
269 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
270 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
271 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
272 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
273 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
274 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
275 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
278 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
279 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
280 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
281 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
282 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
283 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
284 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
285 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
286 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
287 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
288 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
289 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
290 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
296 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
297 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
298 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
299 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
300 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
302 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
303 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
304 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
305 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
306 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
307 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
308 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
311 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
312 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
313 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
314 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
315 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
316 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
317 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
318 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
319 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
321 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
322 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
323 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
324 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
325 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
326 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
327 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
328 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
329 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
330 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
331 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
332 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
333 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
334 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
335 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
336 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
337 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
338 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
339 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
340 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
341 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
342 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
343 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
344 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
345 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
346 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
347 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
348 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
349 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
350 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
351 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
352 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
353 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
354 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
355 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
356 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
357 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
358 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
359 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
360 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
361 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
362 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
363 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
364 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
365 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
366 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
367 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
368 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
369 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
370 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
371 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
372 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
373 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
374 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
375 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
376 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
377 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
378 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
379 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
380 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
381 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
382 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
383 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
384 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
385 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
386 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
387 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
388 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
389 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
390 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
391 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
392 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
393 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
394 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
395 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
396 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
397 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
398 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
399 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
400 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
401 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
402 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
403 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
404 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
405 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
406 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
407 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
408 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
409 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
410 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
411 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
412 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
413 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
414 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
415 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
416 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
417 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
418 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
419 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
420 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
421 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
422 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
423 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
424 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
425 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
426 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
427 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
428 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
429 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
430 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
431 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
432 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
435 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
436 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
437 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
438 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
439 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
440 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
441 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
442 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
443 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
444 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
445 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
446 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
447 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
448 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
449 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
450 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
451 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
452 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
453 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
454 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
455 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
456 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
457 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
458 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
459 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
460 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
461 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
462 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
463 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
464 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
465 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
466 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
467 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
468 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
469 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
470 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
471 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
472 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
473 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
474 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
475 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
476 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
477 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
493 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
494 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
495 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
496 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
497 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
498 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
499 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
500 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
501 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
502 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
503 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
504 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
505 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
506 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
507 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
511 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
512 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
513 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
514 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
515 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
516 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
517 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
518 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
519 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
520 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
521 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
522 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
523 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
524 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
525 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
526 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
527 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
528 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
529 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
530 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
531 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
532 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
533 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
534 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
535 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
536 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
537 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
538 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
539 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
540 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
541 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
542 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
545 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
546 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 1.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 0.65
Rhizoplane 5.09
Rhizosphere 82.28
Stem 0
Stem Tuber 0
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000614 3300001979 Bacteria 15414
2 JGI24737J22298_10189215 3300001990 Bacteria 608
3 JGI24750J21931_1095797 3300002070 Bacteria 506
4 JGI25164J39214_1000233 3300002772 Bacteria 42959
5 JGI25159J45721_1041751 3300002987 Bacteria 666
6 JGI25165J46597_1000429 3300003214 Bacteria 42959
7 rootH2_10087634 3300003320 Bacteria 3176
8 rootH1_10043132 3300003323 Bacteria 15980
9 Ga0055536_1003442 3300003781 Bacteria 8490
10 Ga0055530_10008951 3300003791 Bacteria 3919
11 Ga0058692_1000002 3300003856 Bacteria 508401
12 Ga0058692_1023840 3300003856 Bacteria 1236
13 Ga0058861_10025803 3300004800 Bacteria 1435
14 Ga0058861_11712684 3300004800 Bacteria 1582
15 Ga0058862_10005162 3300004803 Bacteria 1313
16 Ga0058862_12825507 3300004803 Bacteria 1206
17 Ga0065714_10308955 3300005288 Bacteria 684
18 Ga0065704_10071016 3300005289 Bacteria 13755
19 Ga0065704_10071509 3300005289 Bacteria 10859
20 Ga0065704_10140192 3300005289 Bacteria 1525
21 Ga0065712_10068274 3300005290 Bacteria 12260
22 Ga0065712_10765609 3300005290 Bacteria 523
23 Ga0065715_10180944 3300005293 Bacteria 1477
24 Ga0070658_11157558 3300005327 Bacteria 673
25 Ga0070676_10056207 3300005328 Bacteria 2325
26 Ga0070676_10165226 3300005328 Bacteria 1428
27 Ga0070676_10827543 3300005328 Bacteria 685
28 Ga0070683_100023117 3300005329 Bacteria 5558
29 Ga0070683_100252598 3300005329 Bacteria 1677
30 Ga0070683_101273836 3300005329 Bacteria 707
31 Ga0070690_100001135 3300005330 Bacteria 13691
32 Ga0070690_100234733 3300005330 Bacteria 1291
33 Ga0070690_101101741 3300005330 Bacteria 630
34 Ga0070670_100013647 3300005331 Bacteria 6963
35 Ga0070670_100020260 3300005331 Bacteria 5714
36 Ga0070677_10063923 3300005333 Bacteria 1527
37 Ga0070677_10109587 3300005333 Bacteria 1230
38 Ga0068869_100004548 3300005334 Bacteria 8636
39 Ga0068869_100025083 3300005334 Bacteria 4136
40 Ga0068869_100102931 3300005334 Bacteria 2163
41 Ga0068869_100263008 3300005334 Bacteria 1382
42 Ga0070666_10039031 3300005335 Bacteria 3162
43 Ga0070666_10093981 3300005335 Bacteria 2062
44 Ga0070666_10236255 3300005335 Bacteria 1292
45 Ga0070680_100005582 3300005336 Bacteria 9528
46 Ga0070680_100028070 3300005336 Bacteria 4512
47 Ga0070680_100433747 3300005336 Bacteria 1122
48 Ga0068868_101101109 3300005338 Bacteria 731
49 Ga0070660_100220930 3300005339 Bacteria 1540
50 Ga0070660_100240216 3300005339 Bacteria 1475
51 Ga0070689_100005128 3300005340 Bacteria 8907
52 Ga0070689_100222109 3300005340 Bacteria 1550
53 Ga0070689_101220077 3300005340 Bacteria 675
54 Ga0070687_100148833 3300005343 Bacteria 1372
55 Ga0070687_101286316 3300005343 Bacteria 543
56 Ga0070661_100006281 3300005344 Bacteria 8197
57 Ga0070661_100072694 3300005344 Bacteria 2531
58 Ga0070661_100460410 3300005344 Bacteria 1013
59 Ga0070661_100916223 3300005344 Bacteria 724
60 Ga0070692_10041291 3300005345 Bacteria 2362
61 Ga0070668_100032136 3300005347 Bacteria 3994
62 Ga0070668_100199395 3300005347 Bacteria 1643
63 Ga0070669_100006519 3300005353 Bacteria 8406
64 Ga0070669_100025413 3300005353 Bacteria 4253
65 Ga0070669_100641708 3300005353 Bacteria 893
66 Ga0070669_100880817 3300005353 Bacteria 764
67 Ga0070675_100000783 3300005354 Bacteria 22262
68 Ga0070675_100720782 3300005354 Bacteria 909
69 Ga0070671_100000128 3300005355 Bacteria 48658
70 Ga0070671_100011096 3300005355 Bacteria 7235
71 Ga0070671_100030200 3300005355 Bacteria 4472
72 Ga0070671_100575964 3300005355 Bacteria 972
73 Ga0070674_100113366 3300005356 Bacteria 1994
74 Ga0070674_100994786 3300005356 Bacteria 736
75 Ga0070673_100000798 3300005364 Bacteria 17558
76 Ga0070673_100028839 3300005364 Bacteria 4133
77 Ga0070673_100399339 3300005364 Bacteria 1229
78 Ga0070667_100004527 3300005367 Bacteria 11706
79 Ga0070667_100011814 3300005367 Bacteria 7219
80 Ga0070667_100067453 3300005367 Bacteria 3042
81 Ga0070667_100120972 3300005367 Bacteria 2277
82 Ga0070667_100207680 3300005367 Bacteria 1740
83 Ga0070667_100730775 3300005367 Bacteria 917
84 Ga0070667_100764918 3300005367 Bacteria 896
85 Ga0070703_10571961 3300005406 Bacteria 518
86 Ga0070709_10011768 3300005434 Bacteria 4885
87 Ga0070709_11487438 3300005434 Bacteria 550
88 Ga0070714_100011747 3300005435 Bacteria 6958
89 Ga0070714_100665812 3300005435 Bacteria 1003
90 Ga0070713_100020371 3300005436 Bacteria 5084
91 Ga0070713_100751983 3300005436 Bacteria 933
92 Ga0070710_10096327 3300005437 Bacteria 1754
93 Ga0070701_10030430 3300005438 Bacteria 2671
94 Ga0070701_10146729 3300005438 Bacteria 1355
95 Ga0070701_10397767 3300005438 Bacteria 872
96 Ga0070711_100008522 3300005439 Bacteria 6285
97 Ga0070711_100093293 3300005439 Bacteria 2173
98 Ga0070705_100380600 3300005440 Bacteria 1038
99 Ga0070700_100017048 3300005441 Bacteria 4148
100 Ga0070700_100374019 3300005441 Bacteria 1063
101 Ga0070700_100511093 3300005441 Bacteria 926
102 Ga0070694_100422181 3300005444 Bacteria 1048
103 Ga0070663_100159520 3300005455 Bacteria 1735
104 Ga0070663_100254999 3300005455 Bacteria 1389
105 Ga0070678_100314308 3300005456 Bacteria 1336
106 Ga0070678_100526193 3300005456 Bacteria 1047
107 Ga0070662_100004248 3300005457 Bacteria 9031
108 Ga0070662_100058751 3300005457 Bacteria 2800
109 Ga0070681_10004251 3300005458 Bacteria 13576
110 Ga0070681_10013207 3300005458 Bacteria 8206
111 Ga0070681_11449828 3300005458 Bacteria 611
112 Ga0068867_100018889 3300005459 Bacteria 4905
113 Ga0068867_100101694 3300005459 Bacteria 2196
114 Ga0068867_101196437 3300005459 Bacteria 698
115 Ga0068867_102111177 3300005459 Bacteria 534
116 Ga0068867_102412295 3300005459 Bacteria 501
117 Ga0070685_10016903 3300005466 Bacteria 3894
118 Ga0070685_11404084 3300005466 Bacteria 536
119 Ga0070679_100005951 3300005530 Bacteria 11343
120 Ga0070679_100010434 3300005530 Bacteria 8812
121 Ga0070679_100235067 3300005530 Bacteria 1792
122 Ga0070679_101869794 3300005530 Bacteria 549
123 Ga0070684_100000603 3300005535 Bacteria 24797
124 Ga0070684_100015751 3300005535 Bacteria 6170
125 Ga0070684_100870083 3300005535 Bacteria 844
126 Ga0070684_101487875 3300005535 Bacteria 638
127 Ga0068853_100049140 3300005539 Bacteria 3624
128 Ga0068853_100418357 3300005539 Bacteria 1256
129 Ga0070672_100007042 3300005543 Bacteria 7603
130 Ga0070672_100297638 3300005543 Bacteria 1367
131 Ga0070672_100428930 3300005543 Bacteria 1136
132 Ga0070695_100818713 3300005545 Bacteria 747
133 Ga0070696_100000044 3300005546 Bacteria 57075
134 Ga0070696_100838276 3300005546 Bacteria 759
135 Ga0070693_100057425 3300005547 Bacteria 2250
136 Ga0070693_100638643 3300005547 Bacteria 773
137 Ga0070665_100007432 3300005548 Bacteria 11140
138 Ga0070665_100015200 3300005548 Bacteria 7729
139 Ga0070665_100027147 3300005548 Bacteria 5766
140 Ga0070665_100029015 3300005548 Bacteria 5569
141 Ga0070665_100031259 3300005548 Bacteria 5358
142 Ga0070665_100059767 3300005548 Bacteria 3821
143 Ga0070665_100080808 3300005548 Bacteria 3256
144 Ga0070665_100191491 3300005548 Bacteria 2046
145 Ga0070665_100212550 3300005548 Bacteria 1935
146 Ga0070665_101204961 3300005548 Bacteria 768
147 Ga0068855_100000552 3300005563 Bacteria 45993
148 Ga0068855_100001462 3300005563 Bacteria 29490
149 Ga0068855_100001706 3300005563 Bacteria 27486
150 Ga0068855_100354907 3300005563 Bacteria 1614
151 Ga0068855_101286227 3300005563 Bacteria 757
152 Ga0070664_100000712 3300005564 Bacteria 25469
153 Ga0070664_100017162 3300005564 Bacteria 5943
154 Ga0070664_100174452 3300005564 Bacteria 1908
155 Ga0070664_100388368 3300005564 Bacteria 1275
156 Ga0070664_101760174 3300005564 Bacteria 588
157 Ga0068857_100006602 3300005577 Bacteria 9963
158 Ga0068857_100294934 3300005577 Bacteria 1494
159 Ga0068857_100323023 3300005577 Bacteria 1426
160 Ga0068854_100132014 3300005578 Bacteria 1908
161 Ga0068854_100476074 3300005578 Bacteria 1048
162 Ga0068856_100004553 3300005614 Bacteria 13778
163 Ga0068856_100264908 3300005614 Bacteria 1734
164 Ga0070702_100007773 3300005615 Bacteria 5154
165 Ga0068852_100213110 3300005616 Bacteria 1833
166 Ga0068852_100350248 3300005616 Bacteria 1442
167 Ga0068859_100000674 3300005617 Bacteria 34219
168 Ga0068859_100003776 3300005617 Bacteria 15454
169 Ga0068859_100089202 3300005617 Bacteria 3133
170 Ga0068859_100270710 3300005617 Bacteria 1791
171 Ga0068859_100655524 3300005617 Bacteria 1142
172 Ga0068859_100703088 3300005617 Bacteria 1101
173 Ga0068864_100023356 3300005618 Bacteria 5192
174 Ga0068864_100043830 3300005618 Bacteria 3832
175 Ga0068864_100394852 3300005618 Bacteria 1313
176 Ga0068864_100494343 3300005618 Bacteria 1176
177 Ga0068864_102382068 3300005618 Bacteria 536
178 Ga0068866_10111171 3300005718 Bacteria 1529
179 Ga0068866_10455160 3300005718 Bacteria 838
180 Ga0068861_100001382 3300005719 Bacteria 15229
181 Ga0068861_100016209 3300005719 Bacteria 5268
182 Ga0068861_100271776 3300005719 Bacteria 1456
183 Ga0068861_100697963 3300005719 Bacteria 943
184 Ga0068861_101842669 3300005719 Bacteria 601
185 Ga0068851_10106749 3300005834 Bacteria 1491
186 Ga0068851_10824442 3300005834 Bacteria 577
187 Ga0068870_10022377 3300005840 Bacteria 3105
188 Ga0068870_10022596 3300005840 Bacteria 3092
189 Ga0068870_10119722 3300005840 Bacteria 1515
190 Ga0068863_100002456 3300005841 Bacteria 18419
191 Ga0068863_100007485 3300005841 Bacteria 10683
192 Ga0068863_100009083 3300005841 Bacteria 9705
193 Ga0068863_100077118 3300005841 Bacteria 3154
194 Ga0068858_100000838 3300005842 Bacteria 31992
195 Ga0068858_100003187 3300005842 Bacteria 16393
196 Ga0068858_100022237 3300005842 Bacteria 5921
197 Ga0068858_100056706 3300005842 Bacteria 3620
198 Ga0068858_100170456 3300005842 Bacteria 2052
199 Ga0068860_100000941 3300005843 Bacteria 32265
200 Ga0068860_100008051 3300005843 Bacteria 10509
201 Ga0068860_100135634 3300005843 Bacteria 2363
202 Ga0068860_100576966 3300005843 Bacteria 1129
203 Ga0068860_100884921 3300005843 Bacteria 909
204 Ga0068860_101112107 3300005843 Bacteria 810
205 Ga0068862_100000627 3300005844 Bacteria 36553
206 Ga0068862_100107977 3300005844 Bacteria 2440
207 Ga0068862_100405857 3300005844 Bacteria 1276
208 Ga0068862_100469794 3300005844 Bacteria 1189
209 Ga0068862_101645249 3300005844 Bacteria 650
210 Ga0081538_10382639 3300005981 Bacteria 507
211 Ga0070717_10035050 3300006028 Bacteria 4059
212 Ga0075432_10009154 3300006058 Bacteria 3374
213 Ga0075432_10581581 3300006058 Bacteria 510
214 Ga0070715_10148461 3300006163 Bacteria 1146
215 Ga0070715_10434922 3300006163 Bacteria 737
216 Ga0070716_100005257 3300006173 Bacteria 6257
217 Ga0070716_100138150 3300006173 Bacteria 1550
218 Ga0070712_100143198 3300006175 Bacteria 1827
219 Ga0075427_10004374 3300006194 Bacteria 1979
220 Ga0075366_10316459 3300006195 Bacteria 956
221 Ga0075366_10443038 3300006195 Bacteria 801
222 Ga0097621_100062806 3300006237 Bacteria 3050
223 Ga0097621_100166940 3300006237 Bacteria 1895
224 Ga0097621_100301150 3300006237 Bacteria 1416
225 Ga0097621_100514362 3300006237 Bacteria 1086
226 Ga0097621_100549346 3300006237 Bacteria 1051
227 Ga0097621_100674803 3300006237 Bacteria 950
228 Ga0068871_100029047 3300006358 Bacteria 4341
229 Ga0068871_100038270 3300006358 Bacteria 3829
230 Ga0068871_100173839 3300006358 Bacteria 1848
231 Ga0068871_100318102 3300006358 Bacteria 1370
232 Ga0068871_101605762 3300006358 Bacteria 616
233 Ga0075428_100001820 3300006844 Bacteria 22828
234 Ga0075428_100012398 3300006844 Bacteria 9482
235 Ga0075428_100247340 3300006844 Bacteria 1922
236 Ga0075430_100012275 3300006846 Bacteria 7290
237 Ga0075430_100021289 3300006846 Bacteria 5512
238 Ga0075430_100107235 3300006846 Bacteria 2330
239 Ga0075430_100309251 3300006846 Bacteria 1307
240 Ga0075430_100647363 3300006846 Bacteria 871
241 Ga0075430_100826221 3300006846 Bacteria 764
242 Ga0075430_100887335 3300006846 Bacteria 735
243 Ga0075431_100000992 3300006847 Bacteria 25307
244 Ga0075431_100027329 3300006847 Bacteria 5853
245 Ga0075431_100032100 3300006847 Bacteria 5411
246 Ga0075431_100253474 3300006847 Bacteria 1788
247 Ga0075433_11465690 3300006852 Bacteria 590
248 Ga0075434_100149115 3300006871 Bacteria 2359
249 Ga0075429_100004428 3300006880 Bacteria 12070
250 Ga0075429_100007829 3300006880 Bacteria 9283
251 Ga0075429_100823479 3300006880 Bacteria 813
252 Ga0068865_100056496 3300006881 Bacteria 2735
253 Ga0068865_100327331 3300006881 Bacteria 1234
254 Ga0068865_100558094 3300006881 Bacteria 963
255 Ga0097620_100000674 3300006931 Bacteria 34219
256 Ga0097620_100003775 3300006931 Bacteria 15454
257 Ga0097620_100089201 3300006931 Bacteria 3133
258 Ga0097620_100270721 3300006931 Bacteria 1791
259 Ga0097620_100655519 3300006931 Bacteria 1142
260 Ga0097620_100703119 3300006931 Bacteria 1101
261 Ga0099823_1000119 3300006944 Bacteria 39691
262 Ga0079104_1001155 3300006946 Bacteria 19100
263 Ga0079104_1005472 3300006946 Bacteria 5063
264 Ga0099826_10000860 3300006948 Bacteria 16486
265 Ga0075435_100030312 3300007076 Bacteria 4251
266 Ga0099794_10689273 3300007265 Bacteria 544
267 Ga0099794_10723176 3300007265 Bacteria 531
268 Ga0099795_10000001 3300007788 Bacteria 179944
269 Ga0099795_10000342 3300007788 Bacteria 8410
270 Ga0105251_10000396 3300009011 Bacteria 42564
271 Ga0105251_10036856 3300009011 Bacteria 2403
272 Ga0105251_10055931 3300009011 Bacteria 1869
273 Ga0105244_10005072 3300009036 Bacteria 8854
274 Ga0105244_10026994 3300009036 Bacteria 3100
275 Ga0105244_10083463 3300009036 Bacteria 1579
276 Ga0105250_10068877 3300009092 Bacteria 1429
277 Ga0105250_10235653 3300009092 Bacteria 779
278 Ga0105240_10001990 3300009093 Bacteria 33763
279 Ga0105240_10010840 3300009093 Bacteria 12767
280 Ga0105240_10056435 3300009093 Bacteria 4914
281 Ga0105240_10059022 3300009093 Bacteria 4789
282 Ga0105240_10076281 3300009093 Bacteria 4133
283 Ga0105240_10157500 3300009093 Bacteria 2700
284 Ga0105240_10185125 3300009093 Bacteria 2454
285 Ga0105240_10613628 3300009093 Bacteria 1196
286 Ga0105240_11349660 3300009093 Bacteria 751
287 Ga0111539_10002602 3300009094 Bacteria 23907
288 Ga0111539_10012428 3300009094 Bacteria 10676
289 Ga0111539_10043347 3300009094 Bacteria 5394
290 Ga0111539_10056415 3300009094 Bacteria 4668
291 Ga0111539_10059404 3300009094 Bacteria 4534
292 Ga0111539_10560381 3300009094 Bacteria 1331
293 Ga0111539_12194479 3300009094 Bacteria 641
294 Ga0111539_12253282 3300009094 Bacteria 632
295 Ga0105245_10001367 3300009098 Bacteria 22086
296 Ga0105245_10422613 3300009098 Bacteria 1336
297 Ga0105245_10583726 3300009098 Bacteria 1142
298 Ga0105245_11856605 3300009098 Bacteria 656
299 Ga0105245_12079471 3300009098 Bacteria 621
300 Ga0105247_10000613 3300009101 Bacteria 28740
301 Ga0105247_10150643 3300009101 Bacteria 1532
302 Ga0105247_10382570 3300009101 Bacteria 998
303 Ga0105247_10491414 3300009101 Bacteria 892
304 Ga0105247_10893756 3300009101 Bacteria 685
305 Ga0114129_10000246 3300009147 Bacteria 60999
306 Ga0114129_10457595 3300009147 Bacteria 1673
307 Ga0105243_10025874 3300009148 Bacteria 4488
308 Ga0105243_10290588 3300009148 Bacteria 1476
309 Ga0105243_13035728 3300009148 Bacteria 509
310 Ga0105241_10365215 3300009174 Bacteria 1257
311 Ga0105242_10001178 3300009176 Bacteria 20602
312 Ga0105242_10893583 3300009176 Bacteria 888
313 Ga0105242_11786562 3300009176 Bacteria 653
314 Ga0105242_13104048 3300009176 Bacteria 515
315 Ga0105248_10003210 3300009177 Bacteria 18126
316 Ga0105248_10264408 3300009177 Bacteria 1936
317 Ga0105248_10272462 3300009177 Bacteria 1906
318 Ga0105248_10445085 3300009177 Bacteria 1460
319 Ga0105248_11882587 3300009177 Bacteria 679
320 Ga0105237_10000196 3300009545 Bacteria 85826
321 Ga0105237_10027955 3300009545 Bacteria 5748
322 Ga0105237_10031421 3300009545 Bacteria 5385
323 Ga0105237_10120319 3300009545 Bacteria 2620
324 Ga0105237_10254718 3300009545 Bacteria 1757
325 Ga0105237_12156801 3300009545 Bacteria 566
326 Ga0105237_12549370 3300009545 Bacteria 522
327 Ga0105238_10114535 3300009551 Bacteria 2675
328 Ga0105238_10115060 3300009551 Bacteria 2669
329 Ga0105238_10412878 3300009551 Bacteria 1344
330 Ga0105249_10002480 3300009553 Bacteria 15981
331 Ga0105249_10008927 3300009553 Bacteria 8756
332 Ga0105249_10009607 3300009553 Bacteria 8476
333 Ga0105249_10106962 3300009553 Bacteria 2639
334 Ga0105249_10739412 3300009553 Bacteria 1045
335 Ga0099796_10000001 3300010159 Bacteria 107173
336 Ga0099796_10020675 3300010159 Bacteria 2015
337 Ga0105239_10165064 3300010375 Bacteria 2476
338 Ga0105239_10371947 3300010375 Bacteria 1615
339 Ga0105239_10428079 3300010375 Bacteria 1500
340 Ga0105239_10450017 3300010375 Bacteria 1461
341 Ga0105239_10831763 3300010375 Bacteria 1058
342 Ga0105239_11538340 3300010375 Bacteria 769
343 Ga0105246_10124844 3300011119 Bacteria 1913
344 Ga0105246_11056942 3300011119 Bacteria 739
345 Ga0157373_10011711 3300013100 Bacteria 6441
346 Ga0157373_10110281 3300013100 Bacteria 1935
347 Ga0157371_10006276 3300013102 Bacteria 9843
348 Ga0157371_10012444 3300013102 Bacteria 6503
349 Ga0157371_10334666 3300013102 Bacteria 1100
350 Ga0157370_10088182 3300013104 Bacteria 2914
351 Ga0157370_10347025 3300013104 Bacteria 1368
352 Ga0157370_10364787 3300013104 Bacteria 1331
353 Ga0157370_10799407 3300013104 Bacteria 858
354 Ga0157369_10017050 3300013105 Bacteria 8161
355 Ga0157369_10046803 3300013105 Bacteria 4700
356 Ga0157369_10408369 3300013105 Bacteria 1408
357 Ga0157369_12272771 3300013105 Bacteria 550
358 Ga0157374_10006088 3300013296 Bacteria 10210
359 Ga0157374_10219317 3300013296 Bacteria 1866
360 Ga0157374_10415131 3300013296 Bacteria 1344
361 Ga0157378_10007969 3300013297 Bacteria 9247
362 Ga0157378_10107804 3300013297 Bacteria 2549
363 Ga0157378_10332769 3300013297 Bacteria 1478
364 Ga0163162_10003168 3300013306 Bacteria 15723
365 Ga0163162_10401294 3300013306 Bacteria 1504
366 Ga0163162_10662766 3300013306 Bacteria 1167
367 Ga0163162_13131330 3300013306 Bacteria 531
368 Ga0163162_13405246 3300013306 Bacteria 507
369 Ga0157372_10000663 3300013307 Bacteria 37808
370 Ga0157372_10033882 3300013307 Bacteria 5613
371 Ga0157372_10140143 3300013307 Bacteria 2785
372 Ga0157372_10304057 3300013307 Bacteria 1855
373 Ga0157372_10497786 3300013307 Bacteria 1421
374 Ga0157375_10004983 3300013308 Bacteria 11549
375 Ga0157375_10010994 3300013308 Bacteria 7982
376 Ga0157375_10011199 3300013308 Bacteria 7913
377 Ga0157375_10013691 3300013308 Bacteria 7230
378 Ga0163163_10003368 3300014325 Bacteria 13566
379 Ga0163163_10015469 3300014325 Bacteria 7053
380 Ga0163163_10425437 3300014325 Bacteria 1387
381 Ga0163163_10582710 3300014325 Bacteria 1182
382 Ga0157380_10000523 3300014326 Bacteria 23586
383 Ga0157380_10001490 3300014326 Bacteria 15328
384 Ga0157380_10497037 3300014326 Bacteria 1184
385 Ga0157380_10579256 3300014326 Bacteria 1106
386 Ga0157380_10957487 3300014326 Bacteria 886
387 Ga0157379_10000786 3300014968 Bacteria 25770
388 Ga0157379_10020413 3300014968 Bacteria 5857
389 Ga0157379_10023113 3300014968 Bacteria 5513
390 Ga0157379_10225379 3300014968 Bacteria 1699
391 Ga0157379_11152174 3300014968 Bacteria 744
392 Ga0157376_10010282 3300014969 Bacteria 6834
393 Ga0157376_12384523 3300014969 Bacteria 569
394 Ga0182006_1007768 3300015261 Bacteria 4891
395 Ga0182006_1099210 3300015261 Bacteria 1036
396 Ga0182005_1067608 3300015265 Bacteria 979
397 Ga0163161_10038675 3300017792 Bacteria 3422
398 Ga0163161_10141983 3300017792 Bacteria 1819
399 Ga0163161_10260362 3300017792 Bacteria 1355
400 Ga0163161_10288360 3300017792 Bacteria 1289
401 Ga0163161_10604366 3300017792 Bacteria 904
402 Ga0206355_1034253 3300020076 Bacteria 951
403 Ga0154015_1305603 3300020610 Bacteria 516
404 Ga0213874_10038162 3300021377 Bacteria 1425
405 Ga0213874_10249862 3300021377 Bacteria 653
406 Ga0213876_10034937 3300021384 Bacteria 2652
407 Ga0213876_10714319 3300021384 Bacteria 533
408 Ga0224712_10322525 3300022467 Bacteria 726
409 Ga0209760_100046 3300025207 Bacteria 107840
410 Ga0207427_100029 3300025231 Bacteria 376678
411 Ga0209437_100009 3300025233 Bacteria 915954
412 Ga0207425_1026619 3300025245 Bacteria 1185
413 Ga0209233_1000032 3300025261 Bacteria 623596
414 Ga0209676_1000047 3300025292 Bacteria 408645
415 Ga0209676_1000079 3300025292 Bacteria 290447
416 Ga0209676_1002594 3300025292 Bacteria 12405
417 Ga0209050_1000329 3300025298 Bacteria 94932
418 Ga0209256_1007584 3300025299 Bacteria 5300
419 Ga0209051_1000879 3300025303 Bacteria 30297
420 Ga0209051_1001951 3300025303 Bacteria 15859
421 Ga0209257_1000081 3300025304 Bacteria 306577
422 Ga0209257_1000231 3300025304 Bacteria 131226
423 Ga0209257_1005149 3300025304 Bacteria 9435
424 Ga0209257_1008743 3300025304 Bacteria 5638
425 Ga0207656_10076352 3300025321 Bacteria 1498
426 Ga0207696_1000164 3300025711 Bacteria 106057
427 Ga0207696_1015856 3300025711 Bacteria 2539
428 Ga0207696_1055096 3300025711 Bacteria 1129
429 Ga0207655_1001023 3300025728 Bacteria 28252
430 Ga0207655_1001119 3300025728 Bacteria 26209
431 Ga0207655_1001253 3300025728 Bacteria 24224
432 Ga0207655_1009566 3300025728 Bacteria 6005
433 Ga0207655_1029036 3300025728 Bacteria 2597
434 Ga0207655_1052855 3300025728 Bacteria 1630
435 Ga0207713_1002179 3300025735 Bacteria 14516
436 Ga0207713_1003704 3300025735 Bacteria 10275
437 Ga0207713_1006408 3300025735 Bacteria 7174
438 Ga0207713_1012464 3300025735 Bacteria 4541
439 Ga0207713_1025353 3300025735 Bacteria 2741
440 Ga0207713_1026428 3300025735 Bacteria 2660
441 Ga0207713_1037828 3300025735 Bacteria 2053
442 Ga0207713_1047478 3300025735 Bacteria 1737
443 Ga0207682_10111450 3300025893 Bacteria 1205
444 Ga0207692_10349269 3300025898 Bacteria 911
445 Ga0207692_10918993 3300025898 Bacteria 576
446 Ga0207642_10216896 3300025899 Bacteria 1067
447 Ga0207642_10544291 3300025899 Bacteria 716
448 Ga0207642_10582826 3300025899 Bacteria 694
449 Ga0207710_10000345 3300025900 Bacteria 33870
450 Ga0207710_10006077 3300025900 Bacteria 5174
451 Ga0207710_10183081 3300025900 Bacteria 1028
452 Ga0207710_10225776 3300025900 Bacteria 931
453 Ga0207710_10411046 3300025900 Bacteria 695
454 Ga0207688_10132352 3300025901 Bacteria 1463
455 Ga0207680_10014536 3300025903 Bacteria 4078
456 Ga0207680_10117095 3300025903 Bacteria 1737
457 Ga0207647_10003570 3300025904 Bacteria 11674
458 Ga0207647_10261820 3300025904 Bacteria 990
459 Ga0207685_10079600 3300025905 Bacteria 1352
460 Ga0207685_10186387 3300025905 Bacteria 965
461 Ga0207699_10167599 3300025906 Bacteria 1467
462 Ga0207699_10281999 3300025906 Bacteria 1155
463 Ga0207645_10437530 3300025907 Bacteria 882
464 Ga0207645_10669493 3300025907 Bacteria 705
465 Ga0207645_10773504 3300025907 Bacteria 653
466 Ga0207643_10017683 3300025908 Bacteria 3901
467 Ga0207643_10035559 3300025908 Bacteria 2793
468 Ga0207643_10054619 3300025908 Bacteria 2270
469 Ga0207705_10508878 3300025909 Bacteria 935
470 Ga0207707_10002386 3300025912 Bacteria 16904
471 Ga0207707_10958240 3300025912 Bacteria 704
472 Ga0207695_10022267 3300025913 Bacteria 7203
473 Ga0207695_10027680 3300025913 Bacteria 6308
474 Ga0207695_10034230 3300025913 Bacteria 5529
475 Ga0207695_10044843 3300025913 Bacteria 4699
476 Ga0207695_10045412 3300025913 Bacteria 4664
477 Ga0207695_10048616 3300025913 Bacteria 4478
478 Ga0207695_10069991 3300025913 Bacteria 3589
479 Ga0207695_10186801 3300025913 Bacteria 1991
480 Ga0207695_10434890 3300025913 Bacteria 1196
481 Ga0207695_10874344 3300025913 Bacteria 779
482 Ga0207671_10000019 3300025914 Bacteria 317781
483 Ga0207671_10035517 3300025914 Bacteria 3698
484 Ga0207671_10228557 3300025914 Bacteria 1459
485 Ga0207671_10287531 3300025914 Bacteria 1298
486 Ga0207693_10095446 3300025915 Bacteria 2331
487 Ga0207663_10003510 3300025916 Bacteria 7687
488 Ga0207663_10020460 3300025916 Bacteria 3747
489 Ga0207663_10894535 3300025916 Bacteria 710
490 Ga0207660_10018244 3300025917 Bacteria 4675
491 Ga0207660_10030100 3300025917 Bacteria 3729
492 Ga0207660_10620298 3300025917 Bacteria 881
493 Ga0207662_10077415 3300025918 Bacteria 2023
494 Ga0207657_10015296 3300025919 Bacteria 7437
495 Ga0207657_10870238 3300025919 Bacteria 695
496 Ga0207649_10000004 3300025920 Bacteria 360726
497 Ga0207649_10021407 3300025920 Bacteria 3722
498 Ga0207649_10031365 3300025920 Bacteria 3158
499 Ga0207652_10006955 3300025921 Bacteria 9114
500 Ga0207652_10118222 3300025921 Bacteria 2356
501 Ga0207652_10550082 3300025921 Bacteria 1037
502 Ga0207681_10118210 3300025923 Bacteria 1940
503 Ga0207681_10322039 3300025923 Bacteria 1230
504 Ga0207681_10547352 3300025923 Bacteria 952
505 Ga0207681_10802387 3300025923 Bacteria 786
506 Ga0207694_10116328 3300025924 Bacteria 2131
507 Ga0207694_10285747 3300025924 Bacteria 1356
508 Ga0207694_10339982 3300025924 Bacteria 1241
509 Ga0207694_10372263 3300025924 Bacteria 1185
510 Ga0207694_11815677 3300025924 Bacteria 512
511 Ga0207650_10005141 3300025925 Bacteria 8932
512 Ga0207650_10131542 3300025925 Bacteria 1958
513 Ga0207659_10010565 3300025926 Bacteria 5805
514 Ga0207659_10295262 3300025926 Bacteria 1329
515 Ga0207687_10135083 3300025927 Bacteria 1865
516 Ga0207687_11163306 3300025927 Bacteria 663
517 Ga0207700_10031633 3300025928 Bacteria 3762
518 Ga0207700_10108684 3300025928 Bacteria 2227
519 Ga0207700_10422269 3300025928 Bacteria 1171
520 Ga0207700_10443536 3300025928 Bacteria 1143
521 Ga0207700_10521674 3300025928 Bacteria 1053
522 Ga0207664_10046657 3300025929 Bacteria 3402
523 Ga0207664_11055684 3300025929 Bacteria 727
524 Ga0207664_11296888 3300025929 Bacteria 648
525 Ga0207644_10000403 3300025931 Bacteria 28161
526 Ga0207644_10056591 3300025931 Bacteria 2830
527 Ga0207644_10281555 3300025931 Bacteria 1335
528 Ga0207644_10847696 3300025931 Bacteria 765
529 Ga0207644_10901383 3300025931 Bacteria 741
530 Ga0207690_10055807 3300025932 Bacteria 2662
531 Ga0207706_10003395 3300025933 Bacteria 15225
532 Ga0207706_10088968 3300025933 Bacteria 2714
533 Ga0207706_10341660 3300025933 Bacteria 1302
534 Ga0207686_10015382 3300025934 Bacteria 4278
535 Ga0207686_11724266 3300025934 Bacteria 518
536 Ga0207709_10034056 3300025935 Bacteria 2998
537 Ga0207709_10062436 3300025935 Bacteria 2332
538 Ga0207709_11141119 3300025935 Bacteria 641
539 Ga0207670_10004796 3300025936 Bacteria 7339
540 Ga0207669_10089723 3300025937 Bacteria 1997
541 Ga0207669_10107077 3300025937 Bacteria 1864
542 Ga0207669_10733665 3300025937 Bacteria 814
543 Ga0207704_10119037 3300025938 Bacteria 1803
544 Ga0207704_10145815 3300025938 Bacteria 1663
545 Ga0207704_10216599 3300025938 Bacteria 1413
546 Ga0207665_10011416 3300025939 Bacteria 5835
547 Ga0207665_10020217 3300025939 Bacteria 4374
548 Ga0207691_10002537 3300025940 Bacteria 17844
549 Ga0207691_10008772 3300025940 Bacteria 9701
550 Ga0207691_10009236 3300025940 Bacteria 9461
551 Ga0207711_10002599 3300025941 Bacteria 16038
552 Ga0207711_10021913 3300025941 Bacteria 5338
553 Ga0207711_10041758 3300025941 Bacteria 3907
554 Ga0207711_10056871 3300025941 Bacteria 3362
555 Ga0207711_10552991 3300025941 Bacteria 1073
556 Ga0207689_10041539 3300025942 Bacteria 3806
557 Ga0207689_10094365 3300025942 Bacteria 2457
558 Ga0207689_10146715 3300025942 Bacteria 1944
559 Ga0207689_10404796 3300025942 Bacteria 1138
560 Ga0207661_10109844 3300025944 Bacteria 2330
561 Ga0207661_10543209 3300025944 Bacteria 1064
562 Ga0207679_10000019 3300025945 Bacteria 230270
563 Ga0207679_10002358 3300025945 Bacteria 11620
564 Ga0207679_10294768 3300025945 Bacteria 1396
565 Ga0207679_11335189 3300025945 Bacteria 658
566 Ga0207667_10000618 3300025949 Bacteria 45953
567 Ga0207667_10004938 3300025949 Bacteria 16285
568 Ga0207667_10014059 3300025949 Bacteria 9137
569 Ga0207667_10890576 3300025949 Bacteria 882
570 Ga0207667_10929776 3300025949 Bacteria 860
571 Ga0207667_12057893 3300025949 Bacteria 530
572 Ga0207651_10496598 3300025960 Bacteria 1054
573 Ga0207651_11196138 3300025960 Bacteria 682
574 Ga0207651_11872218 3300025960 Bacteria 540
575 Ga0207712_10062143 3300025961 Bacteria 2653
576 Ga0207712_10313931 3300025961 Bacteria 1291
577 Ga0207668_10003932 3300025972 Bacteria 8760
578 Ga0207668_11184130 3300025972 Bacteria 686
579 Ga0207640_10001795 3300025981 Bacteria 11532
580 Ga0207640_10128235 3300025981 Bacteria 1829
581 Ga0207640_10141671 3300025981 Bacteria 1753
582 Ga0207640_10195006 3300025981 Bacteria 1530
583 Ga0207658_10061497 3300025986 Bacteria 2806
584 Ga0207658_10162868 3300025986 Bacteria 1829
585 Ga0207658_10743435 3300025986 Bacteria 888
586 Ga0207658_10786380 3300025986 Bacteria 863
587 Ga0207658_10876426 3300025986 Bacteria 817
588 Ga0207658_10926464 3300025986 Bacteria 794
589 Ga0207703_10000527 3300026035 Bacteria 39354
590 Ga0207703_10000649 3300026035 Bacteria 34880
591 Ga0207703_10011508 3300026035 Bacteria 6883
592 Ga0207703_10062891 3300026035 Bacteria 3041
593 Ga0207703_10073316 3300026035 Bacteria 2832
594 Ga0207703_10084825 3300026035 Bacteria 2649
595 Ga0207639_10165808 3300026041 Bacteria 1866
596 Ga0207678_10033565 3300026067 Bacteria 4470
597 Ga0207678_10053737 3300026067 Bacteria 3470
598 Ga0207708_10027051 3300026075 Bacteria 4342
599 Ga0207708_10151184 3300026075 Bacteria 1828
600 Ga0207708_10221566 3300026075 Bacteria 1516
601 Ga0207708_10716228 3300026075 Bacteria 856
602 Ga0207708_10760680 3300026075 Bacteria 832
603 Ga0207702_10327990 3300026078 Bacteria 1459
604 Ga0207702_10331481 3300026078 Bacteria 1452
605 Ga0207702_10519742 3300026078 Bacteria 1162
606 Ga0207641_10000604 3300026088 Bacteria 39468
607 Ga0207641_10006006 3300026088 Bacteria 10290
608 Ga0207641_10256130 3300026088 Bacteria 1636
609 Ga0207641_11587977 3300026088 Bacteria 656
610 Ga0207648_10004465 3300026089 Bacteria 14352
611 Ga0207676_10279624 3300026095 Bacteria 1515
612 Ga0207676_10402730 3300026095 Bacteria 1279
613 Ga0207676_10578803 3300026095 Bacteria 1076
614 Ga0207676_11155158 3300026095 Bacteria 766
615 Ga0207674_10006753 3300026116 Bacteria 13469
616 Ga0207674_10131659 3300026116 Bacteria 2464
617 Ga0207674_10252436 3300026116 Bacteria 1711
618 Ga0207674_10414235 3300026116 Bacteria 1302
619 Ga0207674_11778706 3300026116 Bacteria 584
620 Ga0207675_100030104 3300026118 Bacteria 5055
621 Ga0207675_100037357 3300026118 Bacteria 4530
622 Ga0207675_100207390 3300026118 Bacteria 1884
623 Ga0207675_100252538 3300026118 Bacteria 1707
624 Ga0207675_100335285 3300026118 Bacteria 1479
625 Ga0207675_100691444 3300026118 Bacteria 1028
626 Ga0207675_101036536 3300026118 Bacteria 839
627 Ga0207683_10889411 3300026121 Bacteria 827
628 Ga0207698_10554213 3300026142 Bacteria 1127
629 Ga0207698_10593692 3300026142 Bacteria 1091
630 Ga0207698_11063807 3300026142 Bacteria 821
631 Ga0209281_1000013 3300027111 Bacteria 653449
632 Ga0209281_1000015 3300027111 Bacteria 590084
633 Ga0209281_1003287 3300027111 Bacteria 5470
634 Ga0209389_1000205 3300027296 Bacteria 42388
635 Ga0209371_1000004 3300027312 Bacteria 1098197
636 Ga0209371_1000016 3300027312 Bacteria 646301
637 Ga0209371_1000142 3300027312 Bacteria 118726
638 Ga0209371_1000584 3300027312 Bacteria 32775
639 Ga0209371_1027632 3300027312 Bacteria 1274
640 Ga0209371_1040604 3300027312 Bacteria 946
641 Ga0209179_1000006 3300027512 Bacteria 101289
642 Ga0209179_1007486 3300027512 Bacteria 1805
643 Ga0209282_1305181 3300027666 Bacteria 674
644 Ga0209588_1092973 3300027671 Bacteria 972
645 Ga0207428_10004796 3300027907 Bacteria 12774
646 Ga0207428_10014528 3300027907 Bacteria 6832
647 Ga0207428_10028912 3300027907 Bacteria 4600
648 Ga0207428_10718917 3300027907 Bacteria 713
649 Ga0265356_1001503 3300028017 Bacteria 3414
650 Ga0265357_1000734 3300028023 Bacteria 2109
651 Ga0268266_10005233 3300028379 Bacteria 12193
652 Ga0268266_10038457 3300028379 Bacteria 4073
653 Ga0268266_10086540 3300028379 Bacteria 2740
654 Ga0268266_10175598 3300028379 Bacteria 1947
655 Ga0268266_10194966 3300028379 Bacteria 1851
656 Ga0268266_10247583 3300028379 Bacteria 1647
657 Ga0268266_10285925 3300028379 Bacteria 1534
658 Ga0268266_10964159 3300028379 Bacteria 825
659 Ga0268266_11978083 3300028379 Bacteria 556
660 Ga0268265_10000932 3300028380 Bacteria 27011
661 Ga0268265_10002340 3300028380 Bacteria 14383
662 Ga0268265_10358027 3300028380 Bacteria 1335
663 Ga0268265_11672093 3300028380 Bacteria 642
664 Ga0268265_11891787 3300028380 Bacteria 603
665 Ga0268264_10000176 3300028381 Bacteria 136166
666 Ga0268264_10003702 3300028381 Bacteria 13128
667 Ga0268264_10005113 3300028381 Bacteria 11118
668 Ga0268264_10152827 3300028381 Bacteria 2071
669 Ga0265326_10017083 3300028558 Bacteria 2095
670 Ga0265319_1010114 3300028563 Bacteria 3955
671 Ga0265334_10000669 3300028573 Bacteria 17205
672 Ga0265334_10026076 3300028573 Bacteria 2362
673 Ga0265318_10019707 3300028577 Bacteria 2732
674 Ga0265322_10214651 3300028654 Bacteria 551
675 Ga0307517_10226615 3300028786 Bacteria 1128
676 Ga0307515_10001184 3300028794 Bacteria 59700
677 Ga0307515_10371965 3300028794 Bacteria 1065
678 Ga0265338_10010356 3300028800 Bacteria 10949
679 Ga0265338_10116545 3300028800 Bacteria 2139
680 Ga0265338_10209784 3300028800 Bacteria 1463
681 Ga0268256_1000005 3300030500 Bacteria 1082342
682 Ga0268256_1000015 3300030500 Bacteria 646300
683 Ga0268256_1000111 3300030500 Bacteria 118726
684 Ga0268256_1000436 3300030500 Bacteria 37153
685 Ga0268256_1031434 3300030500 Bacteria 1274
686 Ga0268256_1038012 3300030500 Bacteria 1098
687 Ga0307511_10029804 3300030521 Bacteria 4916
688 Ga0316177_1095471 3300030731 Bacteria 1938
689 Ga0314311_1137878 3300030733 Bacteria 4792
690 Ga0316178_1009525 3300030735 Bacteria 55280
691 Ga0316183_1002629 3300030742 Bacteria 2535
692 Ga0316181_1261844 3300030744 Bacteria 1414
693 Ga0265763_1006747 3300030763 Bacteria 994
694 Ga0265767_106400 3300030836 Bacteria 733
695 Ga0265765_1029494 3300030879 Bacteria 694
696 Ga0265773_1047532 3300031018 Bacteria 507
697 Ga0265760_10010613 3300031090 Bacteria 2632
698 Ga0265760_10184949 3300031090 Bacteria 697
699 Ga0265330_10352430 3300031235 Bacteria 622
700 Ga0265332_10034344 3300031238 Bacteria 2204
701 Ga0265328_10004103 3300031239 Bacteria 6358
702 Ga0265328_10143135 3300031239 Bacteria 897
703 Ga0265320_10022318 3300031240 Bacteria 3387
704 Ga0265325_10013274 3300031241 Bacteria 4694
705 Ga0265329_10008091 3300031242 Bacteria 4017
706 Ga0265340_10034386 3300031247 Bacteria 2521
707 Ga0265340_10186057 3300031247 Bacteria 938
708 Ga0265339_10017954 3300031249 Bacteria 4181
709 Ga0265331_10005302 3300031250 Bacteria 7801
710 Ga0265327_10001379 3300031251 Bacteria 31081
711 Ga0265327_10003741 3300031251 Bacteria 14146
712 Ga0265327_10010879 3300031251 Bacteria 6336
713 Ga0265327_10045765 3300031251 Bacteria 2323
714 Ga0265316_10000783 3300031344 Bacteria 35073
715 Ga0265316_10012865 3300031344 Bacteria 7473
716 Ga0265316_10020230 3300031344 Bacteria 5670
717 Ga0307513_10042643 3300031456 Bacteria 4993
718 Ga0307513_10179846 3300031456 Bacteria 1979
719 Ga0307513_10640543 3300031456 Bacteria 770
720 Ga0307509_10000021 3300031507 Bacteria 250589
721 Ga0307509_10105278 3300031507 Bacteria 2843
722 Ga0307509_10419708 3300031507 Bacteria 1039
723 Ga0307408_100045527 3300031548 Bacteria 3134
724 Ga0307408_100088657 3300031548 Bacteria 2330
725 Ga0307408_100339274 3300031548 Bacteria 1271
726 Ga0307408_100594254 3300031548 Bacteria 982
727 Ga0265313_10005492 3300031595 Bacteria 9302
728 Ga0265313_10058875 3300031595 Bacteria 1809
729 Ga0307514_10498177 3300031649 Bacteria 580
730 Ga0316575_10250229 3300031665 Bacteria 743
731 Ga0316579_10089972 3300031691 Bacteria 1465
732 Ga0316579_10149269 3300031691 Bacteria 1127
733 Ga0316579_10299821 3300031691 Bacteria 777
734 Ga0265314_10012315 3300031711 Bacteria 6988
735 Ga0265314_10022458 3300031711 Bacteria 4832
736 Ga0265314_10279726 3300031711 Bacteria 944
737 Ga0265314_10715672 3300031711 Bacteria 505
738 Ga0265342_10047521 3300031712 Bacteria 2575
739 Ga0265342_10159148 3300031712 Bacteria 1249
740 Ga0316576_10002013 3300031727 Bacteria 11385
741 Ga0316576_10005102 3300031727 Bacteria 7967
742 Ga0316576_10197015 3300031727 Bacteria 1518
743 Ga0316576_10258572 3300031727 Bacteria 1306
744 Ga0316576_10381748 3300031727 Bacteria 1046
745 Ga0316578_10023579 3300031728 Bacteria 3444
746 Ga0316578_10132478 3300031728 Bacteria 1500
747 Ga0316578_10144519 3300031728 Bacteria 1432
748 Ga0316578_10145739 3300031728 Bacteria 1426
749 Ga0316578_10386358 3300031728 Bacteria 830
750 Ga0316578_10451027 3300031728 Bacteria 760
751 Ga0316578_10559007 3300031728 Bacteria 672
752 Ga0307516_10000050 3300031730 Bacteria 129848
753 Ga0307516_10284338 3300031730 Bacteria 1335
754 Ga0307405_10433782 3300031731 Bacteria 1037
755 Ga0307405_11166368 3300031731 Bacteria 665
756 Ga0307405_11175368 3300031731 Bacteria 662
757 Ga0316577_10013474 3300031733 Bacteria 4471
758 Ga0316577_10043323 3300031733 Bacteria 2518
759 Ga0316577_10232132 3300031733 Bacteria 1043
760 Ga0316577_10421347 3300031733 Bacteria 758
761 Ga0316577_10544324 3300031733 Bacteria 660
762 Ga0307413_10010454 3300031824 Bacteria 4502
763 Ga0307413_10163301 3300031824 Bacteria 1567
764 Ga0307413_10942534 3300031824 Bacteria 736
765 Ga0307413_11749383 3300031824 Bacteria 555
766 Ga0307518_10482099 3300031838 Bacteria 648
767 Ga0307410_10023462 3300031852 Bacteria 3835
768 Ga0307410_10513296 3300031852 Bacteria 988
769 Ga0307410_12036100 3300031852 Bacteria 513
770 Ga0307406_10064136 3300031901 Bacteria 2383
771 Ga0307406_10273777 3300031901 Bacteria 1284
772 Ga0307406_10368777 3300031901 Bacteria 1128
773 Ga0307406_11263546 3300031901 Bacteria 643
774 Ga0307407_10002190 3300031903 Bacteria 7531
775 Ga0307412_10590216 3300031911 Bacteria 939
776 Ga0307412_10860810 3300031911 Bacteria 791
777 Ga0307409_100028163 3300031995 Bacteria 3997
778 Ga0307409_100297603 3300031995 Bacteria 1499
779 Ga0307409_100423553 3300031995 Bacteria 1278
780 Ga0307409_101241970 3300031995 Bacteria 769
781 Ga0307416_100008099 3300032002 Bacteria 6745
782 Ga0307416_100053714 3300032002 Bacteria 3234
783 Ga0307416_100263336 3300032002 Bacteria 1687
784 Ga0307416_100300364 3300032002 Bacteria 1595
785 Ga0307416_101194651 3300032002 Bacteria 866
786 Ga0307414_10108541 3300032004 Bacteria 2106
787 Ga0307414_10182901 3300032004 Bacteria 1687
788 Ga0307414_10249447 3300032004 Bacteria 1474
789 Ga0307414_11135916 3300032004 Bacteria 722
790 Ga0307411_10191085 3300032005 Bacteria 1563
791 Ga0307411_10833575 3300032005 Bacteria 815
792 Ga0307411_10935178 3300032005 Bacteria 772
793 Ga0307415_100539626 3300032126 Bacteria 1027
794 Ga0307415_100653888 3300032126 Bacteria 943
795 Ga0307415_100750955 3300032126 Bacteria 886
796 Ga0307415_101254395 3300032126 Bacteria 700
797 Ga0307415_102498791 3300032126 Bacteria 509
798 Ga0316583_10019225 3300032133 Bacteria 2452
799 Ga0316583_10037476 3300032133 Bacteria 1719
800 Ga0316583_10060858 3300032133 Bacteria 1323
801 Ga0316585_10098244 3300032137 Bacteria 959
802 Ga0316585_10219646 3300032137 Bacteria 629
803 Ga0316585_10238511 3300032137 Bacteria 602
804 Ga0316580_10191924 3300032139 Bacteria 629
805 Ga0316593_10002261 3300032168 Bacteria 4516
806 Ga0316593_10008887 3300032168 Bacteria 2820
807 Ga0316593_10009046 3300032168 Bacteria 2799
808 Ga0316593_10071900 3300032168 Bacteria 1197
809 Ga0316593_10132724 3300032168 Bacteria 899
810 Ga0316593_10177769 3300032168 Bacteria 782
811 Ga0307510_10000002 3300033180 Bacteria 801565
812 Ga0307510_10038803 3300033180 Bacteria 5259
813 Ga0316592_1112428 3300033524 Bacteria 630
814 Ga0316587_1110358 3300033529 Bacteria 534
815 Ga0316596_1040230 3300033541 Bacteria 1227
816 Ga0316596_1101239 3300033541 Bacteria 779
817 Ga0316596_1201300 3300033541 Bacteria 554
818 Ga0373948_0117083 3300034817 Bacteria 641
819 Ga0373934_0172633 3300035086 Bacteria 888
820 Ga0373940_0219738 3300035088 Bacteria 631
821 Ga0373951_0045728 3300035091 Bacteria 1066
822 Ga0373952_0086760 3300035092 Bacteria 807
823 Ga0373923_0248228 3300035111 Bacteria 833
824 Ga0373923_0426648 3300035111 Bacteria 641
825 Ga0373936_0022331 3300035113 Bacteria 2464
826 Ga0373936_0049230 3300035113 Bacteria 1702
827 Ga0373936_0500272 3300035113 Bacteria 565
828 Ga0373953_0134980 3300035117 Bacteria 1054
829 Ga0373954_0581950 3300035118 Bacteria 555
830 Ga0373956_0129592 3300035119 Bacteria 1181
831 Ga0373957_0208156 3300035120 Bacteria 817
832 Ga0373946_0409211 3300035171 Bacteria 686
833 Ga0373955_0314504 3300035172 Bacteria 946
834 Ga0373961_0192657 3300035241 Bacteria 716
835 Ga0373962_0076741 3300035242 Bacteria 1008
836 Ga0316574_0017689 3300035398 Bacteria 4177
837 Ga0316574_0030031 3300035398 Bacteria 3288
838 Ga0316574_0120412 3300035398 Bacteria 1685
839 Ga0316574_0520826 3300035398 Bacteria 740
840 Ga0316574_0674841 3300035398 Bacteria 635
841 Ga0316574_0878369 3300035398 Bacteria 543
842 Ga0316574_0944990 3300035398 Bacteria 520
843 Ga0373924_0400309 3300035410 Bacteria 614
844 Ga0373931_0074168 3300035691 Bacteria 1864
845 Ga0373935_0098770 3300035692 Bacteria 1922
846 Ga0373935_0649283 3300035692 Bacteria 774
847 Ga0373927_0686543 3300035695 Bacteria 676
848 Ga0373933_0726994 3300035724 Bacteria 653
849 Ga0373937_0230073 3300036401 Bacteria 1746
850 Ga0373937_0352801 3300036401 Bacteria 1393
851 Ga0373937_1810936 3300036401 Bacteria 557
852 Ga0316582_0013733 3300036647 Bacteria 4568
853 Ga0316582_0031308 3300036647 Bacteria 3250
854 Ga0316582_0036762 3300036647 Bacteria 3032
855 Ga0316582_0036824 3300036647 Bacteria 3030
856 Ga0316582_0037163 3300036647 Bacteria 3017
857 Ga0316582_0102210 3300036647 Bacteria 1899
858 Ga0316584_0006541 3300036712 Bacteria 7895
859 Ga0316584_0013058 3300036712 Bacteria 5870
860 Ga0316584_0020240 3300036712 Bacteria 4821
861 Ga0316584_0098654 3300036712 Bacteria 2187
862 Ga0316584_0147131 3300036712 Bacteria 1755
863 Ga0316584_0623978 3300036712 Bacteria 745
864 Ga0316584_0857075 3300036712 Bacteria 614
865 Ga0373925_0280903 3300037068 Bacteria 1341
866 Ga0373925_0412262 3300037068 Bacteria 1103
867 Ga0373925_1367703 3300037068 Bacteria 580
868 Ga0316581_0000292 3300037588 Bacteria 8862
869 Ga0316581_0209325 3300037588 Bacteria 600
870 Ga0316581_0224402 3300037588 Bacteria 578
871 Ga0395901_0749020 3300038443 Bacteria 970
872 Ga0436365_0844919 3300039437 Bacteria 890
873 Ga0436365_1214120 3300039437 Bacteria 1114
874 Ga0436365_1360668 3300039437 Bacteria 4000
875 Ga0436360_0380318 3300039438 Bacteria 2167
876 Ga0436360_0515949 3300039438 Bacteria 1384
877 Ga0436360_0593715 3300039438 Bacteria 2864
878 Ga0436360_0826695 3300039438 Bacteria 563
879 Ga0436360_0942877 3300039438 Bacteria 594
880 Ga0436360_1010070 3300039438 Bacteria 762
881 Ga0436361_0136079 3300039447 Bacteria 521
882 Ga0436361_0201071 3300039447 Bacteria 2590
883 Ga0436361_0567398 3300039447 Bacteria 751
884 Ga0436363_0164591 3300039450 Bacteria 1696
885 Ga0436363_0952595 3300039450 Bacteria 5360
886 Ga0436363_1169546 3300039450 Bacteria 735
887 Ga0436363_1439963 3300039450 Bacteria 804
888 Ga0436363_1687372 3300039450 Bacteria 829
889 Ga0436362_0097055 3300039453 Bacteria 596
890 Ga0436362_0352054 3300039453 Bacteria 703
891 Ga0436362_0519667 3300039453 Bacteria 1850
892 Ga0436362_0645059 3300039453 Bacteria 706
893 Ga0439436_0063145 3300041404 Bacteria 1035
894 Ga0439438_002379 3300041405 Bacteria 8020
895 Ga0439439_0264001 3300041406 Bacteria 513
896 Ga0439461_0002118 3300041410 Bacteria 3139
897 Ga0439466_0173061 3300041411 Bacteria 659
898 Ga0439465_0018419 3300041413 Bacteria 2181
899 Ga0439465_0131668 3300041413 Bacteria 883
900 Ga0451787_099410 3300041441 Bacteria 1049
901 Ga0451787_760742 3300041441 Bacteria 603
902 Ga0451789_0137202 3300041443 Bacteria 1121
903 Ga0451791_0494916 3300041451 Bacteria 692
904 Ga0451791_0961898 3300041451 Bacteria 1079
905 Ga0451791_1050206 3300041451 Bacteria 1190
906 Ga0451791_1425262 3300041451 Bacteria 757
907 Ga0451793_0269673 3300041452 Bacteria 2306
908 Ga0451793_0577701 3300041452 Bacteria 1267
909 Ga0451793_0762201 3300041452 Bacteria 1445
910 Ga0451793_1116150 3300041452 Bacteria 1913
911 Ga0451797_0401209 3300041453 Bacteria 680
912 Ga0451795_0635588 3300041456 Bacteria 515
913 Ga0451798_0142136 3300041458 Bacteria 814
914 Ga0451800_0048791 3300041459 Bacteria 1945
915 Ga0451802_0129455 3300041460 Bacteria 1291
916 Ga0451802_1404507 3300041460 Bacteria 760
917 Ga0451802_2055396 3300041460 Bacteria 4211
918 Ga0451806_211117 3300041462 Bacteria 1721
919 Ga0451804_0417164 3300041463 Bacteria 748
920 Ga0451807_0396063 3300041486 Bacteria 2401
921 Ga0451807_1278800 3300041486 Bacteria 2893
922 Ga0451807_1451139 3300041486 Bacteria 682
923 Ga0451807_2648389 3300041486 Bacteria 2287
924 Ga0451833_0022883 3300041491 Bacteria 1744
925 Ga0451837_1238615 3300041494 Bacteria 963
926 Ga0451841_0161635 3300041498 Bacteria 840
927 Ga0451849_0503352 3300041505 Bacteria 1015
928 Ga0451851_1375299 3300041507 Bacteria 671
929 Ga0451843_0723165 3300041509 Bacteria 1300
930 Ga0451843_1159197 3300041509 Bacteria 2324
931 Ga0451843_1698381 3300041509 Bacteria 646
932 Ga0451853_3357331 3300041512 Bacteria 633
933 Ga0439431_0008517 3300041997 Bacteria 2309
934 Ga0439433_0110391 3300041999 Bacteria 688
935 Ga0439437_009360 3300042000 Bacteria 1108
936 Ga0439442_008746 3300042002 Bacteria 2044
937 Ga0439443_006790 3300042003 Bacteria 1575
938 Ga0439448_0102766 3300042005 Bacteria 972
939 Ga0439432_013881 3300042006 Bacteria 2731
940 Ga0439432_040586 3300042006 Bacteria 1476
941 Ga0439449_0005200 3300042007 Bacteria 4994
942 Ga0439450_064872 3300042008 Bacteria 888
943 Ga0439452_037451 3300042010 Bacteria 1156
944 Ga0439454_035191 3300042011 Bacteria 801
945 Ga0439455_0022714 3300042012 Bacteria 1506
946 Ga0439455_0140419 3300042012 Bacteria 684
947 Ga0439456_000224 3300042013 Bacteria 15438
948 Ga0439456_014967 3300042013 Bacteria 1618
949 Ga0439457_046307 3300042014 Bacteria 973
950 Ga0450911_000005 3300042115 Bacteria 233469
951 Ga0450917_008885 3300042120 Bacteria 781
952 Ga0450892_020384 3300042130 Bacteria 648
953 Ga0450898_151929 3300042134 Bacteria 507
954 Ga0450900_005178 3300042136 Bacteria 1531
955 Ga0450900_025628 3300042136 Bacteria 840
956 Ga0450903_060560 3300042138 Bacteria 549
957 Ga0450903_061596 3300042138 Bacteria 544
958 Ga0450904_000002 3300042139 Bacteria 82376
959 Ga0450905_002387 3300042142 Bacteria 2410
960 Ga0450905_008100 3300042142 Bacteria 1436
961 Ga0450905_099360 3300042142 Bacteria 521
962 Ga0450889_023204 3300042144 Bacteria 699
963 Ga0439446_0375064 3300042156 Bacteria 510
964 Ga0439444_0125881 3300042437 Bacteria 602
965 Ga0439459_0007151 3300042438 Bacteria 1878
966 Ga0439464_0178424 3300042439 Bacteria 672
967 Ga0439464_0238835 3300042439 Bacteria 585
968 Ga0450916_008977 3300042530 Bacteria 1227
969 Ga0450916_009543 3300042530 Bacteria 1201
970 Ga0450901_000683 3300042533 Bacteria 4010
971 Ga0451577_0000105 3300042876 Bacteria 184360
972 Ga0451577_0128767 3300042876 Bacteria 2270
973 Ga0451577_0568651 3300042876 Bacteria 1029
974 Ga0451577_0641866 3300042876 Bacteria 963
975 Ga0439440_0053011 3300042993 Bacteria 1018
976 Ga0439440_0229706 3300042993 Bacteria 559
977 Ga0466969_0014574 3300044656 Bacteria 4132
978 Ga0466969_0088720 3300044656 Bacteria 1468
979 Ga0466972_0143428 3300044658 Bacteria 1124
980 Ga0466972_0283035 3300044658 Bacteria 775
981 Ga0466965_0211482 3300044683 Bacteria 1031
982 Ga0466966_0004186 3300044684 Bacteria 9527
983 Ga0466966_0395644 3300044684 Bacteria 830
984 Ga0466961_0020090 3300044693 Bacteria 4298
985 Ga0466964_0004197 3300044706 Bacteria 5301
986 Ga0453684_0003537 3300044712 Bacteria 34947
987 Ga0453684_0034985 3300044712 Bacteria 6955
988 Ga0453684_0220280 3300044712 Bacteria 2199
989 Ga0466971_0002218 3300044719 Bacteria 8217
990 Ga0466971_0380102 3300044719 Bacteria 686
991 Ga0466968_0218920 3300044735 Bacteria 896
992 Ga0466970_0015790 3300044765 Bacteria 3887
993 Ga0466970_0161945 3300044765 Bacteria 1238
994 Ga0466970_0276325 3300044765 Bacteria 944
995 Ga0466957_0018370 3300044842 Bacteria 4106
996 Ga0466957_0572185 3300044842 Bacteria 789
997 Ga0466959_0022009 3300045049 Bacteria 4709
998 Ga0466959_0048755 3300045049 Bacteria 3112
999 Ga0466959_0072728 3300045049 Bacteria 2488
1000 Ga0466959_0081512 3300045049 Bacteria 2331
1001 Ga0466959_0958262 3300045049 Bacteria 570
1002 Ga0451576_0000741 3300045051 Bacteria 65303
1003 Ga0451576_0014390 3300045051 Bacteria 8809
1004 Ga0451576_0359358 3300045051 Bacteria 1525
1005 Ga0451576_0758278 3300045051 Bacteria 1019
1006 Ga0466958_0114325 3300045836 Bacteria 1686
1007 Ga0495617_024700 3300046452 Bacteria 2027
1008 Ga0495627_000424 3300046453 Bacteria 36677
1009 Ga0495627_000496 3300046453 Bacteria 33018
1010 Ga0495627_001316 3300046453 Bacteria 15137
1011 Ga0495627_008095 3300046453 Bacteria 3963
1012 Ga0495627_079133 3300046453 Bacteria 954
1013 Ga0495591_000849 3300046458 Bacteria 21493
1014 Ga0495591_009341 3300046458 Bacteria 3906
1015 Ga0495591_040223 3300046458 Bacteria 1334
1016 Ga0495629_0299467 3300046459 Bacteria 1101
1017 Ga0495629_0648537 3300046459 Bacteria 704
1018 Ga0495641_0390721 3300046461 Bacteria 631
1019 Ga0495651_0963061 3300046462 Bacteria 519
1020 Ga0495653_0005238 3300046463 Bacteria 10546
1021 Ga0495650_0008755 3300046471 Bacteria 5856
1022 Ga0495650_0018342 3300046471 Bacteria 3478
1023 Ga0495650_0021605 3300046471 Bacteria 3105
1024 Ga0495650_0035382 3300046471 Bacteria 2199
1025 Ga0495580_0107838 3300046472 Bacteria 1934
1026 Ga0495582_0603442 3300046473 Bacteria 635
1027 Ga0495605_0000449 3300046474 Bacteria 36901
1028 Ga0495605_0000461 3300046474 Bacteria 36449
1029 Ga0495664_0740603 3300046477 Bacteria 580
1030 Ga0495584_0052116 3300046491 Bacteria 2059
1031 Ga0495584_0108849 3300046491 Bacteria 1401
1032 Ga0495585_0003113 3300046492 Bacteria 11385
1033 Ga0495607_0000490 3300046501 Bacteria 39577
1034 Ga0495607_0000544 3300046501 Bacteria 36921
1035 Ga0495607_0000841 3300046501 Bacteria 29029
1036 Ga0495607_0063674 3300046501 Bacteria 2085
1037 Ga0495607_0099414 3300046501 Bacteria 1560
1038 Ga0495607_0122780 3300046501 Bacteria 1361
1039 Ga0495607_0184100 3300046501 Bacteria 1045
1040 Ga0495607_0226057 3300046501 Bacteria 912
1041 Ga0495583_0000861 3300046506 Bacteria 36885
1042 Ga0495583_0004417 3300046506 Bacteria 10076
1043 Ga0495583_0032928 3300046506 Bacteria 2497
1044 Ga0495583_0371704 3300046506 Bacteria 563
1045 Ga0495606_0001804 3300046507 Bacteria 27243
1046 Ga0495606_0006268 3300046507 Bacteria 11034
1047 Ga0495606_0168322 3300046507 Bacteria 1273
1048 Ga0495606_0515192 3300046507 Bacteria 601
1049 Ga0495610_0003557 3300046512 Bacteria 12062
1050 Ga0495620_0000003 3300046515 Bacteria 345923
1051 Ga0495620_0001260 3300046515 Bacteria 15445
1052 Ga0495620_0003107 3300046515 Bacteria 9537
1053 Ga0495631_0004082 3300046518 Bacteria 7841
1054 Ga0495631_0023789 3300046518 Bacteria 2835
1055 Ga0495631_0049517 3300046518 Bacteria 1839
1056 Ga0495632_0003927 3300046519 Bacteria 10327
1057 Ga0495632_0005427 3300046519 Bacteria 8431
1058 Ga0495632_0048630 3300046519 Bacteria 2099
1059 Ga0495632_0125156 3300046519 Bacteria 1198
1060 Ga0495632_0336259 3300046519 Bacteria 665
1061 Ga0495637_0002014 3300046520 Bacteria 11466
1062 Ga0495643_0000917 3300046522 Bacteria 30970
1063 Ga0495643_0003034 3300046522 Bacteria 12623
1064 Ga0495643_0006177 3300046522 Bacteria 7950
1065 Ga0495648_0003639 3300046524 Bacteria 13473
1066 Ga0495648_0003944 3300046524 Bacteria 12851
1067 Ga0495648_0010333 3300046524 Bacteria 7119
1068 Ga0495648_0017142 3300046524 Bacteria 5189
1069 Ga0495648_0312114 3300046524 Bacteria 732
1070 Ga0495642_0521381 3300046528 Bacteria 527
1071 Ga0495654_0020728 3300046530 Bacteria 3424
1072 Ga0495654_0076246 3300046530 Bacteria 1580
1073 Ga0495654_0140619 3300046530 Bacteria 1076
1074 Ga0495654_0254239 3300046530 Bacteria 730
1075 Ga0495587_0018441 3300046536 Bacteria 4327
1076 Ga0495609_0000153 3300046538 Bacteria 71744
1077 Ga0495622_0437774 3300046557 Bacteria 561
1078 Ga0495633_0000300 3300046558 Bacteria 56356
1079 Ga0495633_0016022 3300046558 Bacteria 3877
1080 Ga0495633_0034834 3300046558 Bacteria 2419
1081 Ga0495668_0049124 3300046616 Bacteria 2339
1082 Ga0495668_0215387 3300046616 Bacteria 1051
1083 Ga0495611_0003885 3300046648 Bacteria 6509
1084 Ga0495611_0227622 3300046648 Bacteria 867
1085 Ga0495625_0051346 3300046660 Bacteria 2956
1086 Ga0495625_0116455 3300046660 Bacteria 1823
1087 Ga0495625_0126691 3300046660 Bacteria 1733
1088 Ga0495625_0156283 3300046660 Bacteria 1530
1089 Ga0495661_0000538 3300046665 Bacteria 39127
1090 Ga0495661_0001311 3300046665 Bacteria 21132
1091 Ga0495661_0045241 3300046665 Bacteria 2693
1092 Ga0495661_0225039 3300046665 Bacteria 970
1093 Ga0495599_0886783 3300046678 Bacteria 506
1094 Ga0495646_0231982 3300046680 Bacteria 994
1095 Ga0495613_0097182 3300046689 Bacteria 2129
1096 Ga0495670_0003681 3300046691 Bacteria 7537
1097 Ga0495670_0560107 3300046691 Bacteria 622
1098 Ga0495671_0002986 3300046692 Bacteria 10508
1099 Ga0495671_0003782 3300046692 Bacteria 9199
1100 Ga0495671_0004634 3300046692 Bacteria 8152
1101 Ga0495671_0035909 3300046692 Bacteria 2514
1102 Ga0495649_0177366 3300046694 Bacteria 1113
1103 Ga0495649_0518270 3300046694 Bacteria 592
1104 Ga0495589_0003579 3300046794 Bacteria 8398
1105 Ga0495589_0085799 3300046794 Bacteria 1529
1106 Ga0495589_0527828 3300046794 Bacteria 538
1107 Ga0495600_0048423 3300046809 Bacteria 2772
1108 Ga0495660_0000879 3300046810 Bacteria 22220
1109 Ga0495660_0059143 3300046810 Bacteria 2062
1110 Ga0495672_0004648 3300047320 Bacteria 11142
1111 Ga0495672_0009343 3300047320 Bacteria 7117
1112 Ga0495672_0045928 3300047320 Bacteria 2609
1113 Ga0495672_0073906 3300047320 Bacteria 1921
1114 Ga0495672_0258781 3300047320 Bacteria 841
1115 Ga0495680_0019915 3300047322 Bacteria 5655
1116 Ga0495680_0592466 3300047322 Bacteria 743
1117 Ga0495683_0000371 3300047323 Bacteria 36984
1118 Ga0495683_0020063 3300047323 Bacteria 3448
1119 Ga0495687_011253 3300047443 Bacteria 4823
1120 Ga0495675_0126005 3300047444 Bacteria 1593
1121 Ga0495679_001695 3300047446 Bacteria 12223
1122 Ga0495673_0000441 3300047469 Bacteria 45987
1123 Ga0495673_0005418 3300047469 Bacteria 7714
1124 Ga0495673_0014278 3300047469 Bacteria 4134
1125 Ga0495673_0077839 3300047469 Bacteria 1380
1126 Ga0495673_0316127 3300047469 Bacteria 557
1127 Ga0495681_0010196 3300047470 Bacteria 5706
1128 Ga0495681_0012745 3300047470 Bacteria 4922
1129 Ga0495686_0215600 3300047472 Bacteria 1094
1130 Ga0495615_0157045 3300048090 Bacteria 681
1131 Ga0496100_0171274 3300048903 Bacteria 1564
1132 Ga0496100_0193835 3300048903 Bacteria 1477
1133 Ga0496100_0668261 3300048903 Bacteria 810
1134 Ga0496100_1073885 3300048903 Bacteria 634
1135 Ga0496101_0062886 3300048904 Bacteria 2700
1136 Ga0496101_0256566 3300048904 Bacteria 1363
1137 Ga0496101_0794622 3300048904 Bacteria 746
1138 Ga0496101_0839608 3300048904 Bacteria 724
1139 Ga0496102_0018568 3300048905 Bacteria 6114
1140 Ga0496102_0018878 3300048905 Bacteria 6066
1141 Ga0496102_0664196 3300048905 Bacteria 965
1142 Ga0496103_0145762 3300048906 Bacteria 1515
1143 Ga0496104_0007534 3300048907 Bacteria 9624
1144 Ga0496104_0025932 3300048907 Bacteria 5405
1145 Ga0496104_0291973 3300048907 Bacteria 1543
1146 Ga0496104_0558271 3300048907 Bacteria 1056
1147 Ga0496105_0002244 3300048908 Bacteria 13996
1148 Ga0496105_0003869 3300048908 Bacteria 11191
1149 Ga0496105_1083126 3300048908 Bacteria 596
1150 Ga0496106_0034846 3300048909 Bacteria 3762
1151 Ga0496106_0238810 3300048909 Bacteria 1452
1152 Ga0496106_0956057 3300048909 Bacteria 675
1153 Ga0496108_0011729 3300048911 Bacteria 7127
1154 Ga0496108_0099406 3300048911 Bacteria 2480
1155 Ga0496108_0183338 3300048911 Bacteria 1813
1156 Ga0496108_0521059 3300048911 Bacteria 1038
1157 Ga0496109_0019965 3300048912 Bacteria 5915
1158 Ga0496110_0009253 3300048913 Bacteria 7962
1159 Ga0496110_0013330 3300048913 Bacteria 6792
1160 Ga0496110_0186911 3300048913 Bacteria 1881
1161 Ga0496110_0247943 3300048913 Bacteria 1621
1162 Ga0496110_0258743 3300048913 Bacteria 1584
1163 Ga0496111_0004803 3300048914 Bacteria 8572
1164 Ga0496111_0287462 3300048914 Bacteria 1219
1165 Ga0496111_0297142 3300048914 Bacteria 1197
1166 Ga0496111_0321330 3300048914 Bacteria 1146
1167 Ga0496112_0139570 3300048915 Bacteria 2393
1168 Ga0496112_0236066 3300048915 Bacteria 1782
1169 Ga0496112_0408518 3300048915 Bacteria 1297
1170 Ga0496112_1754343 3300048915 Bacteria 533
1171 Ga0496114_0028572 3300048917 Bacteria 4577
1172 Ga0496114_0040475 3300048917 Bacteria 3859
1173 Ga0496114_0084456 3300048917 Bacteria 2688
1174 Ga0496114_0489139 3300048917 Bacteria 1088
1175 Ga0496115_0082741 3300048918 Bacteria 2616
1176 Ga0496115_0127308 3300048918 Bacteria 2098
1177 Ga0496115_1300079 3300048918 Bacteria 542
1178 Ga0496116_0008971 3300048919 Bacteria 8599
1179 Ga0496116_0016264 3300048919 Bacteria 5831
1180 Ga0496116_0020453 3300048919 Bacteria 5026
1181 Ga0496117_0000054 3300048920 Bacteria 278013
1182 Ga0496117_0000334 3300048920 Bacteria 83273
1183 Ga0496117_0000798 3300048920 Bacteria 49089
1184 Ga0496117_0006004 3300048920 Bacteria 12502
1185 Ga0496117_0017273 3300048920 Bacteria 6034
1186 Ga0496117_0057179 3300048920 Bacteria 2711
1187 Ga0496117_0096534 3300048920 Bacteria 1885
1188 Ga0496118_0000045 3300048921 Bacteria 275165
1189 Ga0496118_0003619 3300048921 Bacteria 19184
1190 Ga0496118_0006724 3300048921 Bacteria 12529
1191 Ga0496118_0013622 3300048921 Bacteria 7677
1192 Ga0496118_0028632 3300048921 Bacteria 4687
1193 Ga0496118_0057707 3300048921 Bacteria 2907
1194 Ga0496118_0063473 3300048921 Bacteria 2717
1195 Ga0496118_0168475 3300048921 Bacteria 1342
1196 Ga0496118_0464672 3300048921 Bacteria 639
1197 Ga0496119_0000380 3300048922 Bacteria 61208
1198 Ga0496119_0007592 3300048922 Bacteria 9729
1199 Ga0496119_0015657 3300048922 Bacteria 5819
1200 Ga0496119_0145844 3300048922 Bacteria 1273
1201 Ga0496119_0264672 3300048922 Bacteria 861
1202 Ga0496120_0000570 3300048923 Bacteria 56326
1203 Ga0496120_0002710 3300048923 Bacteria 17352
1204 Ga0496120_0113063 3300048923 Bacteria 1415
1205 Ga0496120_0190249 3300048923 Bacteria 1001
1206 Ga0496120_0294816 3300048923 Bacteria 745
1207 Ga0496121_0002897 3300048924 Bacteria 25213
1208 Ga0496121_0004919 3300048924 Bacteria 17531
1209 Ga0496121_0015841 3300048924 Bacteria 7841
1210 Ga0496121_0020386 3300048924 Bacteria 6568
1211 Ga0496121_0064016 3300048924 Bacteria 3000
1212 Ga0496121_0072566 3300048924 Bacteria 2763
1213 Ga0496121_0125269 3300048924 Bacteria 1932
1214 Ga0496121_0161763 3300048924 Bacteria 1636
1215 Ga0496121_0200859 3300048924 Bacteria 1421
1216 Ga0496122_0002009 3300048925 Bacteria 30251
1217 Ga0496122_0002614 3300048925 Bacteria 25219
1218 Ga0496122_0027322 3300048925 Bacteria 4883
1219 Ga0496122_0028114 3300048925 Bacteria 4784
1220 Ga0496122_0164164 3300048925 Bacteria 1349
1221 Ga0496122_0293928 3300048925 Bacteria 880
1222 Ga0496123_0000706 3300048926 Bacteria 54610
1223 Ga0496123_0001758 3300048926 Bacteria 28593
1224 Ga0496123_0029385 3300048926 Bacteria 4047
1225 Ga0496123_0063671 3300048926 Bacteria 2354
1226 Ga0496123_0069050 3300048926 Bacteria 2221
1227 Ga0496123_0240888 3300048926 Bacteria 898
1228 Ga0496124_0000132 3300048927 Bacteria 155405
1229 Ga0496124_0001105 3300048927 Bacteria 42427
1230 Ga0496124_0013196 3300048927 Bacteria 8080
1231 Ga0496124_0015927 3300048927 Bacteria 7178
1232 Ga0496124_0017522 3300048927 Bacteria 6746
1233 Ga0496124_0030811 3300048927 Bacteria 4753
1234 Ga0496124_0031893 3300048927 Bacteria 4660
1235 Ga0496124_0152550 3300048927 Bacteria 1810
1236 Ga0496124_0220087 3300048927 Bacteria 1428
1237 Ga0496124_0275591 3300048927 Bacteria 1229
1238 Ga0496124_0491235 3300048927 Bacteria 826
1239 Ga0496124_0519930 3300048927 Bacteria 793
1240 Ga0496125_0001279 3300048928 Bacteria 37354
1241 Ga0496125_0006982 3300048928 Bacteria 12084
1242 Ga0496125_0007611 3300048928 Bacteria 11497
1243 Ga0496125_0019903 3300048928 Bacteria 6311
1244 Ga0496125_0038453 3300048928 Bacteria 4141
1245 Ga0496125_0190724 3300048928 Bacteria 1353
1246 Ga0496125_0378962 3300048928 Bacteria 834
1247 Ga0496125_0512480 3300048928 Bacteria 672
1248 Ga0496126_0025805 3300048929 Bacteria 5646
1249 Ga0496126_0051230 3300048929 Bacteria 3759
1250 Ga0496126_0081305 3300048929 Bacteria 2864
1251 Ga0496126_0085051 3300048929 Bacteria 2789
1252 Ga0496126_0202568 3300048929 Bacteria 1675
1253 Ga0496126_0298740 3300048929 Bacteria 1329
1254 Ga0495678_000536 3300049459 Bacteria 36666
1255 Ga0495678_001447 3300049459 Bacteria 18697
1256 Ga0495678_024441 3300049459 Bacteria 2609
1257 Ga0495682_0000613 3300049460 Bacteria 24066
1258 Ga0495682_0000919 3300049460 Bacteria 17922
1259 Ga0501031_0203939 3300049568 Bacteria 1290
1260 Ga0501032_0202959 3300049569 Bacteria 1294
1261 Ga0501033_0029032 3300049570 Bacteria 4155
1262 Ga0501033_0169901 3300049570 Bacteria 1566
1263 Ga0501034_0000692 3300049571 Bacteria 51206
1264 Ga0501034_0535090 3300049571 Bacteria 1082
1265 Ga0501036_0074554 3300049572 Bacteria 2870
1266 Ga0501036_0738013 3300049572 Bacteria 813
1267 Ga0501036_1348958 3300049572 Bacteria 579
1268 Ga0501037_0899304 3300049573 Bacteria 580
1269 Ga0501038_0151006 3300049574 Bacteria 1894
1270 Ga0501039_1245585 3300049575 Bacteria 575
1271 Ga0501040_0017931 3300049576 Bacteria 4699
1272 Ga0501040_0239186 3300049576 Bacteria 1294
1273 Ga0501041_0062832 3300049577 Bacteria 2274
1274 Ga0501041_0186805 3300049577 Bacteria 1298
1275 Ga0501042_0011940 3300049578 Bacteria 5870
1276 Ga0501042_0153347 3300049578 Bacteria 1661
1277 Ga0501042_1122685 3300049578 Bacteria 573
1278 Ga0501043_0331124 3300049579 Bacteria 1160
1279 Ga0501043_0578753 3300049579 Bacteria 831
1280 Ga0501043_0945438 3300049579 Bacteria 616
1281 Ga0501046_0105464 3300049580 Bacteria 2158
1282 Ga0501046_0155892 3300049580 Bacteria 1720
1283 Ga0501047_0050139 3300049581 Bacteria 4031
1284 Ga0501047_0165008 3300049581 Bacteria 2086
1285 Ga0501047_0340257 3300049581 Bacteria 1338
1286 Ga0501047_0459646 3300049581 Bacteria 1102
1287 Ga0501047_0654394 3300049581 Bacteria 870
1288 Ga0501047_1239098 3300049581 Bacteria 560
1289 Ga0501048_0023751 3300049582 Bacteria 4477
1290 Ga0501048_0865272 3300049582 Bacteria 650
1291 Ga0501067_0006809 3300049583 Bacteria 6339
1292 Ga0501068_0002793 3300049584 Bacteria 9287
1293 Ga0501068_0608237 3300049584 Bacteria 712
1294 Ga0501069_0867641 3300049585 Bacteria 548
1295 Ga0501070_0007573 3300049586 Bacteria 9227
1296 Ga0501070_0063793 3300049586 Bacteria 3052
1297 Ga0501071_0001833 3300049587 Bacteria 12604
1298 Ga0501071_0009669 3300049587 Bacteria 6436
1299 Ga0501072_0035416 3300049588 Bacteria 3910
1300 Ga0501072_0049556 3300049588 Bacteria 3306
1301 Ga0501072_0433281 3300049588 Bacteria 1042
1302 Ga0501073_0000472 3300049589 Bacteria 27853
1303 Ga0501073_0433941 3300049589 Bacteria 908
1304 Ga0501074_0002836 3300049590 Bacteria 12136
1305 Ga0501074_0036301 3300049590 Bacteria 3571
1306 Ga0501075_0000792 3300049591 Bacteria 19767
1307 Ga0501075_0014752 3300049591 Bacteria 5600
1308 Ga0501076_0007783 3300049592 Bacteria 7809
1309 Ga0501076_0035980 3300049592 Bacteria 3877
1310 Ga0501076_0384431 3300049592 Bacteria 1154
1311 Ga0501077_0000280 3300049593 Bacteria 30354
1312 Ga0501077_0171032 3300049593 Bacteria 1380
1313 Ga0501230_040204 3300049667 Bacteria 904
1314 Ga0501079_0001080 3300049741 Bacteria 18962
1315 Ga0501079_0021711 3300049741 Bacteria 4913
1316 Ga0501080_0013669 3300049742 Bacteria 7474
1317 Ga0501080_0072108 3300049742 Bacteria 3213
1318 Ga0501083_0014663 3300049744 Bacteria 5479
1319 Ga0501083_0048506 3300049744 Bacteria 2866
1320 Ga0501083_0491604 3300049744 Bacteria 799
1321 Ga0501035_0675812 3300049822 Bacteria 835
1322 Ga0501044_0000745 3300049823 Bacteria 39309
1323 Ga0501044_1081409 3300049823 Bacteria 672
1324 Ga0501045_0013215 3300049824 Bacteria 5824
1325 Ga0501226_000010 3300049853 Bacteria 180094
1326 nmdc:mga00v17_6749_c1 3300050491 Bacteria 6099
1327 nmdc:mga0k408_321371_c1 3300050493 Bacteria 923
1328 nmdc:mga0k408_653060_c1 3300050493 Bacteria 618
1329 nmdc:mga05p37_22213_c1 3300050507 Bacteria 7692
1330 nmdc:mga05p37_37857_c1 3300050507 Bacteria 5916
1331 nmdc:mga09592_199515_c1 3300050508 Bacteria 1733
1332 nmdc:mga09592_6806_c1 3300050508 Bacteria 9303
1333 nmdc:mga09592_777742_c1 3300050508 Bacteria 811
1334 nmdc:mga09592_895930_c1 3300050508 Bacteria 746
1335 nmdc:mga0qj67_100942_c1 3300050509 Bacteria 2326
1336 nmdc:mga0qj67_187552_c1 3300050509 Bacteria 1680
1337 nmdc:mga0qj67_188850_c1 3300050509 Bacteria 1674
1338 nmdc:mga0qj67_201016_c1 3300050509 Bacteria 1619
1339 nmdc:mga06r32_22391_c1 3300050510 Bacteria 5842
1340 nmdc:mga06r32_328139_c1 3300050510 Bacteria 1515
1341 nmdc:mga06r32_747_c1 3300050510 Bacteria 28538
1342 nmdc:mga06r32_7750_c2 3300050510 Bacteria 7874
1343 nmdc:mga08y16_104026_c1 3300050511 Bacteria 2956
1344 nmdc:mga08y16_1066236_c1 3300050511 Bacteria 785
1345 nmdc:mga08y16_1255_c1 3300050511 Bacteria 25165
1346 nmdc:mga08y16_1641422_c1 3300050511 Bacteria 600
1347 nmdc:mga08y16_211735_c1 3300050511 Bacteria 2007
1348 nmdc:mga08y16_71923_c1 3300050511 Bacteria 3604
1349 nmdc:mga08y16_7261_c1 3300050511 Bacteria 11631
1350 nmdc:mga08y16_899876_c1 3300050511 Bacteria 871
1351 nmdc:mga0n895_565258_c1 3300050512 Bacteria 1142
1352 nmdc:mga0rr50_1357398_c1 3300050513 Bacteria 602
1353 nmdc:mga0rr50_32375_c1 3300050513 Bacteria 3724
1354 nmdc:mga08x19_217959_c1 3300050514 Bacteria 1311
1355 nmdc:mga0a205_557015_c1 3300050515 Bacteria 1001
1356 nmdc:mga0a205_88566_c1 3300050515 Bacteria 2991
1357 Ga0495601_0312189 3300053077 Bacteria 1024
1358 Ga0500644_0062975 3300053088 Bacteria 1313
1359 Ga0500644_0100029 3300053088 Bacteria 1100
1360 Ga0500583_0058297 3300053092 Bacteria 1816
1361 Ga0500583_0073042 3300053092 Bacteria 1644
1362 Ga0500583_0301270 3300053092 Bacteria 784
1363 Ga0500583_0396594 3300053092 Bacteria 662
1364 Ga0500650_0058300 3300053098 Bacteria 1801
1365 Ga0500556_0000442 3300053104 Bacteria 29531
1366 Ga0500572_065710 3300053111 Bacteria 1111
1367 Ga0500591_030876 3300053115 Bacteria 2585
1368 Ga0500595_027112 3300053119 Bacteria 1966
1369 Ga0500658_0080346 3300053134 Bacteria 1393
1370 Ga0500658_0114697 3300053134 Bacteria 1189
1371 Ga0500659_0001435 3300053135 Bacteria 15111
1372 Ga0500559_0252268 3300053136 Bacteria 831
1373 Ga0500588_0005174 3300053146 Bacteria 2878
1374 Ga0500590_239218 3300053148 Bacteria 732
1375 Ga0500616_0000018 3300053153 Bacteria 610976
1376 Ga0500616_0132122 3300053153 Bacteria 1178
1377 Ga0500622_0004527 3300053156 Bacteria 8682
1378 Ga0500622_0420657 3300053156 Bacteria 538
1379 Ga0500627_0191709 3300053158 Bacteria 918
1380 Ga0500627_0293718 3300053158 Bacteria 711
1381 Ga0500634_0000047 3300053161 Bacteria 55541
1382 Ga0500637_0100378 3300053178 Bacteria 1679
1383 Ga0500637_0100441 3300053178 Bacteria 1678
1384 Ga0501084_0001292 3300054114 Bacteria 19723
1385 Ga0501084_0093387 3300054114 Bacteria 2526
1386 Ga0590075_136468 3300059424 Bacteria 645
1387 Ga0587090_120295 3300059510 Bacteria 569
1388 Ga0587071_165880 3300060344 Bacteria 558
1389 Ga0501082_0025328 3300060353 Bacteria 5112
1390 Ga0501082_0314316 3300060353 Bacteria 1364
1391 Ga0501082_0456958 3300060353 Bacteria 1116
1392 Ga0466962_0001556 3300061719 Bacteria 10706
1393 Ga0466962_0386845 3300061719 Bacteria 699
1394 Ga0530510_0142376 3300061734 Bacteria 1767

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10331481 Ga0207702_103314812 101
2 3300031711 Ga0265314_10012315 Ga0265314_100123156 102
3 3300031712 Ga0265342_10159148 Ga0265342_101591483 102
4 3300001979 JGI24740J21852_10000614 JGI24740J21852_1000061413 107
5 3300001990 JGI24737J22298_10189215 JGI24737J22298_101892151 107
6 3300002070 JGI24750J21931_1095797 JGI24750J21931_10957972 107
7 3300002772 JGI25164J39214_1000233 JGI25164J39214_100023340 107
8 3300002987 JGI25159J45721_1041751 JGI25159J45721_10417511 107
9 3300003214 JGI25165J46597_1000429 JGI25165J46597_100042911 107
10 3300003320 rootH2_10087634 rootH2_100876342 107
11 3300003323 rootH1_10043132 rootH1_100431322 107
12 3300003781 Ga0055536_1003442 Ga0055536_10034428 107
13 3300003791 Ga0055530_10008951 Ga0055530_100089513 107
14 3300003856 Ga0058692_1000002 Ga0058692_1000002127 107
15 3300003856 Ga0058692_1023840 Ga0058692_10238401 107
16 3300004800 Ga0058861_10025803 Ga0058861_100258031 107
17 3300004800 Ga0058861_11712684 Ga0058861_117126842 107
18 3300004803 Ga0058862_10005162 Ga0058862_100051622 107
19 3300004803 Ga0058862_12825507 Ga0058862_128255071 107
20 3300005288 Ga0065714_10308955 Ga0065714_103089551 107
21 3300005289 Ga0065704_10071016 Ga0065704_1007101610 107
22 3300005289 Ga0065704_10071509 Ga0065704_100715092 107
23 3300005289 Ga0065704_10140192 Ga0065704_101401921 107
24 3300005290 Ga0065712_10068274 Ga0065712_100682742 107
25 3300005290 Ga0065712_10765609 Ga0065712_107656091 107
26 3300005293 Ga0065715_10180944 Ga0065715_101809443 107
27 3300005327 Ga0070658_11157558 Ga0070658_111575581 107
28 3300005328 Ga0070676_10056207 Ga0070676_100562071 107
29 3300005328 Ga0070676_10165226 Ga0070676_101652262 107
30 3300005328 Ga0070676_10827543 Ga0070676_108275431 107
31 3300005329 Ga0070683_100023117 Ga0070683_1000231177 107
32 3300005329 Ga0070683_100252598 Ga0070683_1002525982 107
33 3300005329 Ga0070683_101273836 Ga0070683_1012738362 107
34 3300005330 Ga0070690_100001135 Ga0070690_10000113512 107
35 3300005330 Ga0070690_100234733 Ga0070690_1002347331 107
36 3300005330 Ga0070690_101101741 Ga0070690_1011017412 107
37 3300005331 Ga0070670_100013647 Ga0070670_1000136474 107
38 3300005331 Ga0070670_100020260 Ga0070670_1000202602 107
39 3300005333 Ga0070677_10063923 Ga0070677_100639231 107
40 3300005333 Ga0070677_10109587 Ga0070677_101095872 107
41 3300005334 Ga0068869_100004548 Ga0068869_1000045483 107
42 3300005334 Ga0068869_100025083 Ga0068869_1000250832 107
43 3300005334 Ga0068869_100102931 Ga0068869_1001029312 107
44 3300005334 Ga0068869_100263008 Ga0068869_1002630082 107
45 3300005335 Ga0070666_10039031 Ga0070666_100390312 107
46 3300005335 Ga0070666_10093981 Ga0070666_100939811 107
47 3300005335 Ga0070666_10236255 Ga0070666_102362552 107
48 3300005336 Ga0070680_100005582 Ga0070680_1000055827 107
49 3300005336 Ga0070680_100028070 Ga0070680_1000280703 107
50 3300005336 Ga0070680_100433747 Ga0070680_1004337472 107
51 3300005338 Ga0068868_101101109 Ga0068868_1011011092 107
52 3300005339 Ga0070660_100220930 Ga0070660_1002209302 107
53 3300005339 Ga0070660_100240216 Ga0070660_1002402162 107
54 3300005340 Ga0070689_100005128 Ga0070689_1000051285 107
55 3300005340 Ga0070689_100222109 Ga0070689_1002221092 107
56 3300005340 Ga0070689_101220077 Ga0070689_1012200772 107
57 3300005343 Ga0070687_100148833 Ga0070687_1001488331 107
58 3300005343 Ga0070687_101286316 Ga0070687_1012863161 107
59 3300005344 Ga0070661_100006281 Ga0070661_1000062818 107
60 3300005344 Ga0070661_100072694 Ga0070661_1000726942 107
61 3300005344 Ga0070661_100460410 Ga0070661_1004604102 107
62 3300005344 Ga0070661_100916223 Ga0070661_1009162232 107
63 3300005345 Ga0070692_10041291 Ga0070692_100412913 107
64 3300005347 Ga0070668_100032136 Ga0070668_1000321363 107
65 3300005347 Ga0070668_100199395 Ga0070668_1001993953 107
66 3300005353 Ga0070669_100006519 Ga0070669_1000065198 107
67 3300005353 Ga0070669_100025413 Ga0070669_1000254131 107
68 3300005353 Ga0070669_100641708 Ga0070669_1006417081 107
69 3300005353 Ga0070669_100880817 Ga0070669_1008808171 107
70 3300005354 Ga0070675_100000783 Ga0070675_10000078312 107
71 3300005354 Ga0070675_100720782 Ga0070675_1007207822 107
72 3300005355 Ga0070671_100000128 Ga0070671_10000012821 107
73 3300005355 Ga0070671_100011096 Ga0070671_1000110966 107
74 3300005355 Ga0070671_100030200 Ga0070671_1000302004 107
75 3300005355 Ga0070671_100575964 Ga0070671_1005759642 107
76 3300005356 Ga0070674_100113366 Ga0070674_1001133662 107
77 3300005356 Ga0070674_100994786 Ga0070674_1009947861 107
78 3300005364 Ga0070673_100000798 Ga0070673_10000079817 107
79 3300005364 Ga0070673_100028839 Ga0070673_1000288392 107
80 3300005364 Ga0070673_100399339 Ga0070673_1003993392 107
81 3300005367 Ga0070667_100004527 Ga0070667_1000045278 107
82 3300005367 Ga0070667_100011814 Ga0070667_1000118142 107
83 3300005367 Ga0070667_100067453 Ga0070667_1000674532 107
84 3300005367 Ga0070667_100120972 Ga0070667_1001209723 107
85 3300005367 Ga0070667_100207680 Ga0070667_1002076803 107
86 3300005367 Ga0070667_100730775 Ga0070667_1007307751 107
87 3300005367 Ga0070667_100764918 Ga0070667_1007649182 107
88 3300005406 Ga0070703_10571961 Ga0070703_105719611 107
89 3300005434 Ga0070709_10011768 Ga0070709_100117684 107
90 3300005434 Ga0070709_11487438 Ga0070709_114874381 107
91 3300005435 Ga0070714_100011747 Ga0070714_1000117471 107
92 3300005435 Ga0070714_100665812 Ga0070714_1006658121 107
93 3300005436 Ga0070713_100020371 Ga0070713_1000203716 107
94 3300005436 Ga0070713_100751983 Ga0070713_1007519832 107
95 3300005437 Ga0070710_10096327 Ga0070710_100963271 107
96 3300005438 Ga0070701_10030430 Ga0070701_100304302 107
97 3300005438 Ga0070701_10146729 Ga0070701_101467292 107
98 3300005438 Ga0070701_10397767 Ga0070701_103977672 107
99 3300005439 Ga0070711_100008522 Ga0070711_1000085224 107
100 3300005439 Ga0070711_100093293 Ga0070711_1000932933 107
101 3300005440 Ga0070705_100380600 Ga0070705_1003806002 107
102 3300005441 Ga0070700_100017048 Ga0070700_1000170485 107
103 3300005441 Ga0070700_100374019 Ga0070700_1003740192 107
104 3300005441 Ga0070700_100511093 Ga0070700_1005110931 107
105 3300005444 Ga0070694_100422181 Ga0070694_1004221812 107
106 3300005455 Ga0070663_100159520 Ga0070663_1001595202 107
107 3300005455 Ga0070663_100254999 Ga0070663_1002549992 107
108 3300005456 Ga0070678_100314308 Ga0070678_1003143082 107
109 3300005456 Ga0070678_100526193 Ga0070678_1005261932 107
110 3300005457 Ga0070662_100004248 Ga0070662_1000042481 107
111 3300005457 Ga0070662_100058751 Ga0070662_1000587513 107
112 3300005458 Ga0070681_10004251 Ga0070681_100042517 107
113 3300005458 Ga0070681_10013207 Ga0070681_100132077 107
114 3300005458 Ga0070681_11449828 Ga0070681_114498282 107
115 3300005459 Ga0068867_100018889 Ga0068867_1000188893 107
116 3300005459 Ga0068867_100101694 Ga0068867_1001016942 107
117 3300005459 Ga0068867_101196437 Ga0068867_1011964372 107
118 3300005459 Ga0068867_102111177 Ga0068867_1021111771 107
119 3300005459 Ga0068867_102412295 Ga0068867_1024122951 107
120 3300005466 Ga0070685_10016903 Ga0070685_100169033 107
121 3300005466 Ga0070685_11404084 Ga0070685_114040841 107
122 3300005530 Ga0070679_100005951 Ga0070679_1000059514 107
123 3300005530 Ga0070679_100010434 Ga0070679_1000104347 107
124 3300005530 Ga0070679_100235067 Ga0070679_1002350672 107
125 3300005530 Ga0070679_101869794 Ga0070679_1018697941 107
126 3300005535 Ga0070684_100000603 Ga0070684_1000006032 107
127 3300005535 Ga0070684_100015751 Ga0070684_1000157516 107
128 3300005535 Ga0070684_100870083 Ga0070684_1008700832 107
129 3300005535 Ga0070684_101487875 Ga0070684_1014878751 107
130 3300005539 Ga0068853_100049140 Ga0068853_1000491405 107
131 3300005539 Ga0068853_100418357 Ga0068853_1004183572 107
132 3300005543 Ga0070672_100007042 Ga0070672_1000070423 107
133 3300005543 Ga0070672_100297638 Ga0070672_1002976382 107
134 3300005543 Ga0070672_100428930 Ga0070672_1004289303 107
135 3300005545 Ga0070695_100818713 Ga0070695_1008187132 107
136 3300005546 Ga0070696_100000044 Ga0070696_10000004443 107
137 3300005546 Ga0070696_100838276 Ga0070696_1008382762 107
138 3300005547 Ga0070693_100057425 Ga0070693_1000574252 107
139 3300005547 Ga0070693_100638643 Ga0070693_1006386431 107
140 3300005548 Ga0070665_100007432 Ga0070665_10000743211 107
141 3300005548 Ga0070665_100015200 Ga0070665_1000152006 107
142 3300005548 Ga0070665_100027147 Ga0070665_1000271475 107
143 3300005548 Ga0070665_100029015 Ga0070665_1000290155 107
144 3300005548 Ga0070665_100031259 Ga0070665_1000312595 107
145 3300005548 Ga0070665_100059767 Ga0070665_1000597674 107
146 3300005548 Ga0070665_100080808 Ga0070665_1000808082 107
147 3300005548 Ga0070665_100191491 Ga0070665_1001914912 107
148 3300005548 Ga0070665_100212550 Ga0070665_1002125502 107
149 3300005548 Ga0070665_101204961 Ga0070665_1012049612 107
150 3300005563 Ga0068855_100000552 Ga0068855_10000055232 107
151 3300005563 Ga0068855_100001462 Ga0068855_1000014623 107
152 3300005563 Ga0068855_100001706 Ga0068855_10000170612 107
153 3300005563 Ga0068855_100354907 Ga0068855_1003549072 107
154 3300005563 Ga0068855_101286227 Ga0068855_1012862272 107
155 3300005564 Ga0070664_100000712 Ga0070664_1000007129 107
156 3300005564 Ga0070664_100017162 Ga0070664_1000171623 107
157 3300005564 Ga0070664_100174452 Ga0070664_1001744522 107
158 3300005564 Ga0070664_100388368 Ga0070664_1003883681 107
159 3300005564 Ga0070664_101760174 Ga0070664_1017601742 107
160 3300005577 Ga0068857_100006602 Ga0068857_1000066023 107
161 3300005577 Ga0068857_100294934 Ga0068857_1002949342 107
162 3300005577 Ga0068857_100323023 Ga0068857_1003230233 107
163 3300005578 Ga0068854_100132014 Ga0068854_1001320142 107
164 3300005578 Ga0068854_100476074 Ga0068854_1004760742 107
165 3300005614 Ga0068856_100004553 Ga0068856_10000455311 107
166 3300005614 Ga0068856_100264908 Ga0068856_1002649083 107
167 3300005615 Ga0070702_100007773 Ga0070702_1000077735 107
168 3300005616 Ga0068852_100213110 Ga0068852_1002131102 107
169 3300005616 Ga0068852_100350248 Ga0068852_1003502482 107
170 3300005617 Ga0068859_100000674 Ga0068859_10000067411 107
171 3300005617 Ga0068859_100003776 Ga0068859_1000037766 107
172 3300005617 Ga0068859_100089202 Ga0068859_1000892022 107
173 3300005617 Ga0068859_100270710 Ga0068859_1002707103 107
174 3300005617 Ga0068859_100655524 Ga0068859_1006555242 107
175 3300005617 Ga0068859_100703088 Ga0068859_1007030882 107
176 3300005618 Ga0068864_100023356 Ga0068864_1000233564 107
177 3300005618 Ga0068864_100043830 Ga0068864_1000438302 107
178 3300005618 Ga0068864_100394852 Ga0068864_1003948522 107
179 3300005618 Ga0068864_100494343 Ga0068864_1004943432 107
180 3300005618 Ga0068864_102382068 Ga0068864_1023820681 107
181 3300005718 Ga0068866_10111171 Ga0068866_101111712 107
182 3300005718 Ga0068866_10455160 Ga0068866_104551602 107
183 3300005719 Ga0068861_100001382 Ga0068861_10000138213 107
184 3300005719 Ga0068861_100016209 Ga0068861_1000162095 107
185 3300005719 Ga0068861_100271776 Ga0068861_1002717762 107
186 3300005719 Ga0068861_100697963 Ga0068861_1006979631 107
187 3300005719 Ga0068861_101842669 Ga0068861_1018426691 107
188 3300005834 Ga0068851_10106749 Ga0068851_101067492 107
189 3300005834 Ga0068851_10824442 Ga0068851_108244421 107
190 3300005840 Ga0068870_10022377 Ga0068870_100223776 107
191 3300005840 Ga0068870_10022596 Ga0068870_100225964 107
192 3300005840 Ga0068870_10119722 Ga0068870_101197223 107
193 3300005841 Ga0068863_100002456 Ga0068863_1000024566 107
194 3300005841 Ga0068863_100007485 Ga0068863_1000074855 107
195 3300005841 Ga0068863_100009083 Ga0068863_1000090838 107
196 3300005841 Ga0068863_100077118 Ga0068863_1000771184 107
197 3300005842 Ga0068858_100000838 Ga0068858_10000083817 107
198 3300005842 Ga0068858_100003187 Ga0068858_1000031873 107
199 3300005842 Ga0068858_100022237 Ga0068858_1000222375 107
200 3300005842 Ga0068858_100056706 Ga0068858_1000567063 107
201 3300005842 Ga0068858_100170456 Ga0068858_1001704562 107
202 3300005843 Ga0068860_100000941 Ga0068860_10000094113 107
203 3300005843 Ga0068860_100008051 Ga0068860_1000080515 107
204 3300005843 Ga0068860_100135634 Ga0068860_1001356341 107
205 3300005843 Ga0068860_100576966 Ga0068860_1005769661 107
206 3300005843 Ga0068860_100884921 Ga0068860_1008849212 107
207 3300005843 Ga0068860_101112107 Ga0068860_1011121071 107
208 3300005844 Ga0068862_100000627 Ga0068862_10000062717 107
209 3300005844 Ga0068862_100107977 Ga0068862_1001079772 107
210 3300005844 Ga0068862_100405857 Ga0068862_1004058571 107
211 3300005844 Ga0068862_100469794 Ga0068862_1004697942 107
212 3300005844 Ga0068862_101645249 Ga0068862_1016452491 107
213 3300005981 Ga0081538_10382639 Ga0081538_103826391 107
214 3300006028 Ga0070717_10035050 Ga0070717_100350503 107
215 3300006058 Ga0075432_10009154 Ga0075432_100091542 107
216 3300006058 Ga0075432_10581581 Ga0075432_105815812 107
217 3300006163 Ga0070715_10148461 Ga0070715_101484612 107
218 3300006163 Ga0070715_10434922 Ga0070715_104349221 107
219 3300006173 Ga0070716_100005257 Ga0070716_1000052574 107
220 3300006173 Ga0070716_100138150 Ga0070716_1001381503 107
221 3300006175 Ga0070712_100143198 Ga0070712_1001431982 107
222 3300006194 Ga0075427_10004374 Ga0075427_100043742 107
223 3300006195 Ga0075366_10316459 Ga0075366_103164592 107
224 3300006195 Ga0075366_10443038 Ga0075366_104430381 107
225 3300006237 Ga0097621_100062806 Ga0097621_1000628062 107
226 3300006237 Ga0097621_100166940 Ga0097621_1001669402 107
227 3300006237 Ga0097621_100301150 Ga0097621_1003011502 107
228 3300006237 Ga0097621_100514362 Ga0097621_1005143622 107
229 3300006237 Ga0097621_100549346 Ga0097621_1005493462 107
230 3300006237 Ga0097621_100674803 Ga0097621_1006748032 107
231 3300006358 Ga0068871_100029047 Ga0068871_1000290472 107
232 3300006358 Ga0068871_100038270 Ga0068871_1000382704 107
233 3300006358 Ga0068871_100173839 Ga0068871_1001738392 107
234 3300006358 Ga0068871_100318102 Ga0068871_1003181023 107
235 3300006358 Ga0068871_101605762 Ga0068871_1016057621 107
236 3300006844 Ga0075428_100001820 Ga0075428_10000182014 107
237 3300006844 Ga0075428_100012398 Ga0075428_1000123985 107
238 3300006844 Ga0075428_100247340 Ga0075428_1002473401 107
239 3300006846 Ga0075430_100012275 Ga0075430_1000122755 107
240 3300006846 Ga0075430_100021289 Ga0075430_1000212894 107
241 3300006846 Ga0075430_100107235 Ga0075430_1001072353 107
242 3300006846 Ga0075430_100309251 Ga0075430_1003092512 107
243 3300006846 Ga0075430_100647363 Ga0075430_1006473632 107
244 3300006846 Ga0075430_100826221 Ga0075430_1008262212 107
245 3300006846 Ga0075430_100887335 Ga0075430_1008873352 107
246 3300006847 Ga0075431_100000992 Ga0075431_10000099213 107
247 3300006847 Ga0075431_100027329 Ga0075431_1000273299 107
248 3300006847 Ga0075431_100032100 Ga0075431_1000321004 107
249 3300006847 Ga0075431_100253474 Ga0075431_1002534743 107
250 3300006852 Ga0075433_11465690 Ga0075433_114656902 107
251 3300006871 Ga0075434_100149115 Ga0075434_1001491152 107
252 3300006880 Ga0075429_100004428 Ga0075429_10000442816 107
253 3300006880 Ga0075429_100007829 Ga0075429_1000078292 107
254 3300006880 Ga0075429_100823479 Ga0075429_1008234791 107
255 3300006881 Ga0068865_100056496 Ga0068865_1000564964 107
256 3300006881 Ga0068865_100327331 Ga0068865_1003273313 107
257 3300006881 Ga0068865_100558094 Ga0068865_1005580941 107
258 3300006931 Ga0097620_100000674 Ga0097620_10000067421 107
259 3300006931 Ga0097620_100003775 Ga0097620_1000037756 107
260 3300006931 Ga0097620_100089201 Ga0097620_1000892012 107
261 3300006931 Ga0097620_100270721 Ga0097620_1002707213 107
262 3300006931 Ga0097620_100655519 Ga0097620_1006555192 107
263 3300006931 Ga0097620_100703119 Ga0097620_1007031192 107
264 3300006944 Ga0099823_1000119 Ga0099823_100011919 107
265 3300006946 Ga0079104_1001155 Ga0079104_100115515 107
266 3300006946 Ga0079104_1005472 Ga0079104_10054722 107
267 3300006948 Ga0099826_10000860 Ga0099826_1000086010 107
268 3300007076 Ga0075435_100030312 Ga0075435_1000303124 107
269 3300007265 Ga0099794_10689273 Ga0099794_106892731 107
270 3300007265 Ga0099794_10723176 Ga0099794_107231762 107
271 3300007788 Ga0099795_10000001 Ga0099795_1000000180 107
272 3300007788 Ga0099795_10000342 Ga0099795_100003427 107
273 3300009011 Ga0105251_10000396 Ga0105251_1000039621 107
274 3300009011 Ga0105251_10036856 Ga0105251_100368561 107
275 3300009011 Ga0105251_10055931 Ga0105251_100559312 107
276 3300009036 Ga0105244_10005072 Ga0105244_100050722 107
277 3300009036 Ga0105244_10026994 Ga0105244_100269943 107
278 3300009036 Ga0105244_10083463 Ga0105244_100834632 107
279 3300009092 Ga0105250_10068877 Ga0105250_100688772 107
280 3300009092 Ga0105250_10235653 Ga0105250_102356532 107
281 3300009093 Ga0105240_10001990 Ga0105240_1000199020 107
282 3300009093 Ga0105240_10010840 Ga0105240_100108408 107
283 3300009093 Ga0105240_10056435 Ga0105240_100564353 107
284 3300009093 Ga0105240_10059022 Ga0105240_100590224 107
285 3300009093 Ga0105240_10076281 Ga0105240_100762814 107
286 3300009093 Ga0105240_10157500 Ga0105240_101575002 107
287 3300009093 Ga0105240_10185125 Ga0105240_101851252 107
288 3300009093 Ga0105240_10613628 Ga0105240_106136282 107
289 3300009093 Ga0105240_11349660 Ga0105240_113496602 107
290 3300009094 Ga0111539_10002602 Ga0111539_100026023 107
291 3300009094 Ga0111539_10012428 Ga0111539_100124285 107
292 3300009094 Ga0111539_10043347 Ga0111539_100433475 107
293 3300009094 Ga0111539_10056415 Ga0111539_100564157 107
294 3300009094 Ga0111539_10059404 Ga0111539_100594044 107
295 3300009094 Ga0111539_10560381 Ga0111539_105603811 107
296 3300009094 Ga0111539_12194479 Ga0111539_121944793 107
297 3300009094 Ga0111539_12253282 Ga0111539_122532821 107
298 3300009098 Ga0105245_10001367 Ga0105245_1000136713 107
299 3300009098 Ga0105245_10422613 Ga0105245_104226132 107
300 3300009098 Ga0105245_10583726 Ga0105245_105837263 107
301 3300009098 Ga0105245_11856605 Ga0105245_118566051 107
302 3300009098 Ga0105245_12079471 Ga0105245_120794711 107
303 3300009101 Ga0105247_10000613 Ga0105247_100006139 107
304 3300009101 Ga0105247_10150643 Ga0105247_101506434 107
305 3300009101 Ga0105247_10382570 Ga0105247_103825701 107
306 3300009101 Ga0105247_10491414 Ga0105247_104914142 107
307 3300009101 Ga0105247_10893756 Ga0105247_108937561 107
308 3300009147 Ga0114129_10000246 Ga0114129_1000024615 107
309 3300009147 Ga0114129_10457595 Ga0114129_104575952 107
310 3300009148 Ga0105243_10025874 Ga0105243_100258745 107
311 3300009148 Ga0105243_10290588 Ga0105243_102905882 107
312 3300009148 Ga0105243_13035728 Ga0105243_130357281 107
313 3300009174 Ga0105241_10365215 Ga0105241_103652152 107
314 3300009176 Ga0105242_10001178 Ga0105242_1000117813 107
315 3300009176 Ga0105242_10893583 Ga0105242_108935833 107
316 3300009176 Ga0105242_11786562 Ga0105242_117865622 107
317 3300009176 Ga0105242_13104048 Ga0105242_131040481 107
318 3300009177 Ga0105248_10003210 Ga0105248_100032107 107
319 3300009177 Ga0105248_10264408 Ga0105248_102644083 107
320 3300009177 Ga0105248_10272462 Ga0105248_102724621 107
321 3300009177 Ga0105248_10445085 Ga0105248_104450852 107
322 3300009177 Ga0105248_11882587 Ga0105248_118825871 107
323 3300009545 Ga0105237_10000196 Ga0105237_1000019679 107
324 3300009545 Ga0105237_10027955 Ga0105237_100279553 107
325 3300009545 Ga0105237_10031421 Ga0105237_100314213 107
326 3300009545 Ga0105237_10120319 Ga0105237_101203191 107
327 3300009545 Ga0105237_10254718 Ga0105237_102547183 107
328 3300009545 Ga0105237_12156801 Ga0105237_121568011 107
329 3300009545 Ga0105237_12549370 Ga0105237_125493701 107
330 3300009551 Ga0105238_10114535 Ga0105238_101145353 107
331 3300009551 Ga0105238_10115060 Ga0105238_101150603 107
332 3300009551 Ga0105238_10412878 Ga0105238_104128781 107
333 3300009553 Ga0105249_10002480 Ga0105249_100024809 107
334 3300009553 Ga0105249_10008927 Ga0105249_100089275 107
335 3300009553 Ga0105249_10009607 Ga0105249_100096078 107
336 3300009553 Ga0105249_10106962 Ga0105249_101069622 107
337 3300009553 Ga0105249_10739412 Ga0105249_107394122 107
338 3300010159 Ga0099796_10000001 Ga0099796_1000000165 107
339 3300010159 Ga0099796_10020675 Ga0099796_100206752 107
340 3300010375 Ga0105239_10165064 Ga0105239_101650642 107
341 3300010375 Ga0105239_10371947 Ga0105239_103719473 107
342 3300010375 Ga0105239_10428079 Ga0105239_104280791 107
343 3300010375 Ga0105239_10450017 Ga0105239_104500172 107
344 3300010375 Ga0105239_10831763 Ga0105239_108317632 107
345 3300010375 Ga0105239_11538340 Ga0105239_115383402 107
346 3300011119 Ga0105246_10124844 Ga0105246_101248443 107
347 3300011119 Ga0105246_11056942 Ga0105246_110569421 107
348 3300013100 Ga0157373_10011711 Ga0157373_100117114 107
349 3300013100 Ga0157373_10110281 Ga0157373_101102812 107
350 3300013102 Ga0157371_10006276 Ga0157371_100062768 107
351 3300013102 Ga0157371_10012444 Ga0157371_100124443 107
352 3300013102 Ga0157371_10334666 Ga0157371_103346662 107
353 3300013104 Ga0157370_10088182 Ga0157370_100881822 107
354 3300013104 Ga0157370_10347025 Ga0157370_103470251 107
355 3300013104 Ga0157370_10364787 Ga0157370_103647872 107
356 3300013104 Ga0157370_10799407 Ga0157370_107994072 107
357 3300013105 Ga0157369_10017050 Ga0157369_100170506 107
358 3300013105 Ga0157369_10046803 Ga0157369_100468033 107
359 3300013105 Ga0157369_10408369 Ga0157369_104083692 107
360 3300013105 Ga0157369_12272771 Ga0157369_122727711 107
361 3300013296 Ga0157374_10006088 Ga0157374_100060888 107
362 3300013296 Ga0157374_10219317 Ga0157374_102193172 107
363 3300013296 Ga0157374_10415131 Ga0157374_104151312 107
364 3300013297 Ga0157378_10007969 Ga0157378_100079698 107
365 3300013297 Ga0157378_10107804 Ga0157378_101078043 107
366 3300013297 Ga0157378_10332769 Ga0157378_103327692 107
367 3300013306 Ga0163162_10003168 Ga0163162_100031687 107
368 3300013306 Ga0163162_10401294 Ga0163162_104012943 107
369 3300013306 Ga0163162_10662766 Ga0163162_106627662 107
370 3300013306 Ga0163162_13131330 Ga0163162_131313301 107
371 3300013306 Ga0163162_13405246 Ga0163162_134052461 107
372 3300013307 Ga0157372_10000663 Ga0157372_1000066315 107
373 3300013307 Ga0157372_10033882 Ga0157372_100338824 107
374 3300013307 Ga0157372_10140143 Ga0157372_101401433 107
375 3300013307 Ga0157372_10304057 Ga0157372_103040572 107
376 3300013307 Ga0157372_10497786 Ga0157372_104977862 107
377 3300013308 Ga0157375_10004983 Ga0157375_1000498314 107
378 3300013308 Ga0157375_10010994 Ga0157375_100109942 107
379 3300013308 Ga0157375_10011199 Ga0157375_1001119911 107
380 3300013308 Ga0157375_10013691 Ga0157375_100136914 107
381 3300014325 Ga0163163_10003368 Ga0163163_100033682 107
382 3300014325 Ga0163163_10015469 Ga0163163_100154695 107
383 3300014325 Ga0163163_10425437 Ga0163163_104254372 107
384 3300014325 Ga0163163_10582710 Ga0163163_105827102 107
385 3300014326 Ga0157380_10000523 Ga0157380_1000052312 107
386 3300014326 Ga0157380_10001490 Ga0157380_100014907 107
387 3300014326 Ga0157380_10497037 Ga0157380_104970373 107
388 3300014326 Ga0157380_10579256 Ga0157380_105792562 107
389 3300014326 Ga0157380_10957487 Ga0157380_109574872 107
390 3300014968 Ga0157379_10000786 Ga0157379_1000078614 107
391 3300014968 Ga0157379_10020413 Ga0157379_100204133 107
392 3300014968 Ga0157379_10023113 Ga0157379_100231135 107
393 3300014968 Ga0157379_10225379 Ga0157379_102253792 107
394 3300014968 Ga0157379_11152174 Ga0157379_111521742 107
395 3300014969 Ga0157376_10010282 Ga0157376_100102822 107
396 3300014969 Ga0157376_12384523 Ga0157376_123845231 107
397 3300015261 Ga0182006_1007768 Ga0182006_10077682 107
398 3300015261 Ga0182006_1099210 Ga0182006_10992102 107
399 3300015265 Ga0182005_1067608 Ga0182005_10676081 107
400 3300017792 Ga0163161_10038675 Ga0163161_100386753 107
401 3300017792 Ga0163161_10141983 Ga0163161_101419833 107
402 3300017792 Ga0163161_10260362 Ga0163161_102603622 107
403 3300017792 Ga0163161_10288360 Ga0163161_102883601 107
404 3300017792 Ga0163161_10604366 Ga0163161_106043661 107
405 3300020076 Ga0206355_1034253 Ga0206355_10342532 107
406 3300020610 Ga0154015_1305603 Ga0154015_13056031 107
407 3300021377 Ga0213874_10038162 Ga0213874_100381622 107
408 3300021377 Ga0213874_10249862 Ga0213874_102498622 107
409 3300021384 Ga0213876_10034937 Ga0213876_100349372 107
410 3300021384 Ga0213876_10714319 Ga0213876_107143191 107
411 3300022467 Ga0224712_10322525 Ga0224712_103225252 107
412 3300025207 Ga0209760_100046 Ga0209760_10004661 107
413 3300025231 Ga0207427_100029 Ga0207427_100029324 107
414 3300025233 Ga0209437_100009 Ga0209437_100009579 107
415 3300025245 Ga0207425_1026619 Ga0207425_10266191 107
416 3300025261 Ga0209233_1000032 Ga0209233_1000032579 107
417 3300025292 Ga0209676_1000047 Ga0209676_100004794 107
418 3300025292 Ga0209676_1000079 Ga0209676_1000079176 107
419 3300025292 Ga0209676_1002594 Ga0209676_10025942 107
420 3300025298 Ga0209050_1000329 Ga0209050_100032910 107
421 3300025299 Ga0209256_1007584 Ga0209256_10075845 107
422 3300025303 Ga0209051_1000879 Ga0209051_10008793 107
423 3300025303 Ga0209051_1001951 Ga0209051_10019519 107
424 3300025304 Ga0209257_1000081 Ga0209257_1000081186 107
425 3300025304 Ga0209257_1000231 Ga0209257_100023123 107
426 3300025304 Ga0209257_1005149 Ga0209257_100514912 107
427 3300025304 Ga0209257_1008743 Ga0209257_10087431 107
428 3300025321 Ga0207656_10076352 Ga0207656_100763522 107
429 3300025711 Ga0207696_1000164 Ga0207696_10001647 107
430 3300025711 Ga0207696_1015856 Ga0207696_10158562 107
431 3300025711 Ga0207696_1055096 Ga0207696_10550962 107
432 3300025728 Ga0207655_1001023 Ga0207655_10010231 107
433 3300025728 Ga0207655_1001119 Ga0207655_100111924 107
434 3300025728 Ga0207655_1001253 Ga0207655_100125313 107
435 3300025728 Ga0207655_1009566 Ga0207655_10095663 107
436 3300025728 Ga0207655_1029036 Ga0207655_10290362 107
437 3300025728 Ga0207655_1052855 Ga0207655_10528552 107
438 3300025735 Ga0207713_1002179 Ga0207713_10021798 107
439 3300025735 Ga0207713_1003704 Ga0207713_100370413 107
440 3300025735 Ga0207713_1006408 Ga0207713_10064086 107
441 3300025735 Ga0207713_1012464 Ga0207713_10124642 107
442 3300025735 Ga0207713_1025353 Ga0207713_10253531 107
443 3300025735 Ga0207713_1026428 Ga0207713_10264281 107
444 3300025735 Ga0207713_1037828 Ga0207713_10378281 107
445 3300025735 Ga0207713_1047478 Ga0207713_10474782 107
446 3300025893 Ga0207682_10111450 Ga0207682_101114502 107
447 3300025898 Ga0207692_10349269 Ga0207692_103492692 107
448 3300025898 Ga0207692_10918993 Ga0207692_109189932 107
449 3300025899 Ga0207642_10216896 Ga0207642_102168961 107
450 3300025899 Ga0207642_10544291 Ga0207642_105442912 107
451 3300025899 Ga0207642_10582826 Ga0207642_105828261 107
452 3300025900 Ga0207710_10000345 Ga0207710_100003454 107
453 3300025900 Ga0207710_10006077 Ga0207710_100060774 107
454 3300025900 Ga0207710_10183081 Ga0207710_101830812 107
455 3300025900 Ga0207710_10225776 Ga0207710_102257762 107
456 3300025900 Ga0207710_10411046 Ga0207710_104110462 107
457 3300025901 Ga0207688_10132352 Ga0207688_101323521 107
458 3300025903 Ga0207680_10014536 Ga0207680_100145361 107
459 3300025903 Ga0207680_10117095 Ga0207680_101170951 107
460 3300025904 Ga0207647_10003570 Ga0207647_1000357012 107
461 3300025904 Ga0207647_10261820 Ga0207647_102618201 107
462 3300025905 Ga0207685_10079600 Ga0207685_100796003 107
463 3300025905 Ga0207685_10186387 Ga0207685_101863871 107
464 3300025906 Ga0207699_10167599 Ga0207699_101675992 107
465 3300025906 Ga0207699_10281999 Ga0207699_102819991 107
466 3300025907 Ga0207645_10437530 Ga0207645_104375302 107
467 3300025907 Ga0207645_10669493 Ga0207645_106694931 107
468 3300025907 Ga0207645_10773504 Ga0207645_107735042 107
469 3300025908 Ga0207643_10017683 Ga0207643_100176833 107
470 3300025908 Ga0207643_10035559 Ga0207643_100355593 107
471 3300025908 Ga0207643_10054619 Ga0207643_100546194 107
472 3300025909 Ga0207705_10508878 Ga0207705_105088782 107
473 3300025912 Ga0207707_10002386 Ga0207707_100023867 107
474 3300025912 Ga0207707_10958240 Ga0207707_109582402 107
475 3300025913 Ga0207695_10022267 Ga0207695_100222672 107
476 3300025913 Ga0207695_10027680 Ga0207695_100276803 107
477 3300025913 Ga0207695_10034230 Ga0207695_100342303 107
478 3300025913 Ga0207695_10044843 Ga0207695_100448434 107
479 3300025913 Ga0207695_10045412 Ga0207695_100454122 107
480 3300025913 Ga0207695_10048616 Ga0207695_100486163 107
481 3300025913 Ga0207695_10069991 Ga0207695_100699913 107
482 3300025913 Ga0207695_10186801 Ga0207695_101868012 107
483 3300025913 Ga0207695_10434890 Ga0207695_104348902 107
484 3300025913 Ga0207695_10874344 Ga0207695_108743442 107
485 3300025914 Ga0207671_10000019 Ga0207671_10000019180 107
486 3300025914 Ga0207671_10035517 Ga0207671_100355173 107
487 3300025914 Ga0207671_10228557 Ga0207671_102285572 107
488 3300025914 Ga0207671_10287531 Ga0207671_102875312 107
489 3300025915 Ga0207693_10095446 Ga0207693_100954462 107
490 3300025916 Ga0207663_10003510 Ga0207663_100035109 107
491 3300025916 Ga0207663_10020460 Ga0207663_100204604 107
492 3300025916 Ga0207663_10894535 Ga0207663_108945352 107
493 3300025917 Ga0207660_10018244 Ga0207660_100182442 107
494 3300025917 Ga0207660_10030100 Ga0207660_100301002 107
495 3300025917 Ga0207660_10620298 Ga0207660_106202982 107
496 3300025918 Ga0207662_10077415 Ga0207662_100774152 107
497 3300025919 Ga0207657_10015296 Ga0207657_100152967 107
498 3300025919 Ga0207657_10870238 Ga0207657_108702381 107
499 3300025920 Ga0207649_10000004 Ga0207649_10000004328 107
500 3300025920 Ga0207649_10021407 Ga0207649_100214074 107
501 3300025920 Ga0207649_10031365 Ga0207649_100313653 107
502 3300025921 Ga0207652_10006955 Ga0207652_100069556 107
503 3300025921 Ga0207652_10118222 Ga0207652_101182222 107
504 3300025921 Ga0207652_10550082 Ga0207652_105500821 107
505 3300025923 Ga0207681_10118210 Ga0207681_101182103 107
506 3300025923 Ga0207681_10322039 Ga0207681_103220392 107
507 3300025923 Ga0207681_10547352 Ga0207681_105473521 107
508 3300025923 Ga0207681_10802387 Ga0207681_108023871 107
509 3300025924 Ga0207694_10116328 Ga0207694_101163282 107
510 3300025924 Ga0207694_10285747 Ga0207694_102857472 107
511 3300025924 Ga0207694_10339982 Ga0207694_103399822 107
512 3300025924 Ga0207694_10372263 Ga0207694_103722632 107
513 3300025924 Ga0207694_11815677 Ga0207694_118156771 107
514 3300025925 Ga0207650_10005141 Ga0207650_100051416 107
515 3300025925 Ga0207650_10131542 Ga0207650_101315421 107
516 3300025926 Ga0207659_10010565 Ga0207659_100105653 107
517 3300025926 Ga0207659_10295262 Ga0207659_102952622 107
518 3300025927 Ga0207687_10135083 Ga0207687_101350832 107
519 3300025927 Ga0207687_11163306 Ga0207687_111633062 107
520 3300025928 Ga0207700_10031633 Ga0207700_100316336 107
521 3300025928 Ga0207700_10108684 Ga0207700_101086842 107
522 3300025928 Ga0207700_10422269 Ga0207700_104222691 107
523 3300025928 Ga0207700_10443536 Ga0207700_104435362 107
524 3300025928 Ga0207700_10521674 Ga0207700_105216742 107
525 3300025929 Ga0207664_10046657 Ga0207664_100466572 107
526 3300025929 Ga0207664_11055684 Ga0207664_110556842 107
527 3300025929 Ga0207664_11296888 Ga0207664_112968882 107
528 3300025931 Ga0207644_10000403 Ga0207644_1000040318 107
529 3300025931 Ga0207644_10056591 Ga0207644_100565914 107
530 3300025931 Ga0207644_10281555 Ga0207644_102815553 107
531 3300025931 Ga0207644_10847696 Ga0207644_108476961 107
532 3300025931 Ga0207644_10901383 Ga0207644_109013832 107
533 3300025932 Ga0207690_10055807 Ga0207690_100558071 107
534 3300025933 Ga0207706_10003395 Ga0207706_1000339514 107
535 3300025933 Ga0207706_10088968 Ga0207706_100889683 107
536 3300025933 Ga0207706_10341660 Ga0207706_103416602 107
537 3300025934 Ga0207686_10015382 Ga0207686_100153822 107
538 3300025934 Ga0207686_11724266 Ga0207686_117242661 107
539 3300025935 Ga0207709_10034056 Ga0207709_100340562 107
540 3300025935 Ga0207709_10062436 Ga0207709_100624361 107
541 3300025935 Ga0207709_11141119 Ga0207709_111411191 107
542 3300025936 Ga0207670_10004796 Ga0207670_100047964 107
543 3300025937 Ga0207669_10089723 Ga0207669_100897232 107
544 3300025937 Ga0207669_10107077 Ga0207669_101070773 107
545 3300025937 Ga0207669_10733665 Ga0207669_107336652 107
546 3300025938 Ga0207704_10119037 Ga0207704_101190373 107
547 3300025938 Ga0207704_10145815 Ga0207704_101458152 107
548 3300025938 Ga0207704_10216599 Ga0207704_102165992 107
549 3300025939 Ga0207665_10011416 Ga0207665_100114164 107
550 3300025939 Ga0207665_10020217 Ga0207665_100202176 107
551 3300025940 Ga0207691_10002537 Ga0207691_100025376 107
552 3300025940 Ga0207691_10008772 Ga0207691_100087722 107
553 3300025940 Ga0207691_10009236 Ga0207691_100092367 107
554 3300025941 Ga0207711_10002599 Ga0207711_100025998 107
555 3300025941 Ga0207711_10021913 Ga0207711_100219133 107
556 3300025941 Ga0207711_10041758 Ga0207711_100417583 107
557 3300025941 Ga0207711_10056871 Ga0207711_100568713 107
558 3300025941 Ga0207711_10552991 Ga0207711_105529912 107
559 3300025942 Ga0207689_10041539 Ga0207689_100415395 107
560 3300025942 Ga0207689_10094365 Ga0207689_100943653 107
561 3300025942 Ga0207689_10146715 Ga0207689_101467152 107
562 3300025942 Ga0207689_10404796 Ga0207689_104047962 107
563 3300025944 Ga0207661_10109844 Ga0207661_101098443 107
564 3300025944 Ga0207661_10543209 Ga0207661_105432092 107
565 3300025945 Ga0207679_10000019 Ga0207679_10000019198 107
566 3300025945 Ga0207679_10002358 Ga0207679_100023586 107
567 3300025945 Ga0207679_10294768 Ga0207679_102947682 107
568 3300025945 Ga0207679_11335189 Ga0207679_113351892 107
569 3300025949 Ga0207667_10000618 Ga0207667_1000061810 107
570 3300025949 Ga0207667_10004938 Ga0207667_100049385 107
571 3300025949 Ga0207667_10014059 Ga0207667_100140593 107
572 3300025949 Ga0207667_10890576 Ga0207667_108905761 107
573 3300025949 Ga0207667_10929776 Ga0207667_109297761 107
574 3300025949 Ga0207667_12057893 Ga0207667_120578931 107
575 3300025960 Ga0207651_10496598 Ga0207651_104965981 107
576 3300025960 Ga0207651_11196138 Ga0207651_111961382 107
577 3300025960 Ga0207651_11872218 Ga0207651_118722181 107
578 3300025961 Ga0207712_10062143 Ga0207712_100621432 107
579 3300025961 Ga0207712_10313931 Ga0207712_103139312 107
580 3300025972 Ga0207668_10003932 Ga0207668_100039327 107
581 3300025972 Ga0207668_11184130 Ga0207668_111841302 107
582 3300025981 Ga0207640_10001795 Ga0207640_1000179511 107
583 3300025981 Ga0207640_10128235 Ga0207640_101282353 107
584 3300025981 Ga0207640_10141671 Ga0207640_101416713 107
585 3300025981 Ga0207640_10195006 Ga0207640_101950062 107
586 3300025986 Ga0207658_10061497 Ga0207658_100614973 107
587 3300025986 Ga0207658_10162868 Ga0207658_101628682 107
588 3300025986 Ga0207658_10743435 Ga0207658_107434352 107
589 3300025986 Ga0207658_10786380 Ga0207658_107863802 107
590 3300025986 Ga0207658_10876426 Ga0207658_108764262 107
591 3300025986 Ga0207658_10926464 Ga0207658_109264641 107
592 3300026035 Ga0207703_10000527 Ga0207703_1000052713 107
593 3300026035 Ga0207703_10000649 Ga0207703_100006492 107
594 3300026035 Ga0207703_10011508 Ga0207703_100115085 107
595 3300026035 Ga0207703_10062891 Ga0207703_100628911 107
596 3300026035 Ga0207703_10073316 Ga0207703_100733164 107
597 3300026035 Ga0207703_10084825 Ga0207703_100848253 107
598 3300026041 Ga0207639_10165808 Ga0207639_101658082 107
599 3300026067 Ga0207678_10033565 Ga0207678_100335654 107
600 3300026067 Ga0207678_10053737 Ga0207678_100537373 107
601 3300026075 Ga0207708_10027051 Ga0207708_100270512 107
602 3300026075 Ga0207708_10151184 Ga0207708_101511842 107
603 3300026075 Ga0207708_10221566 Ga0207708_102215661 107
604 3300026075 Ga0207708_10716228 Ga0207708_107162282 107
605 3300026075 Ga0207708_10760680 Ga0207708_107606802 107
606 3300026078 Ga0207702_10327990 Ga0207702_103279901 107
607 3300026078 Ga0207702_10519742 Ga0207702_105197422 107
608 3300026088 Ga0207641_10000604 Ga0207641_100006043 107
609 3300026088 Ga0207641_10006006 Ga0207641_100060062 107
610 3300026088 Ga0207641_10256130 Ga0207641_102561301 107
611 3300026088 Ga0207641_11587977 Ga0207641_115879772 107
612 3300026089 Ga0207648_10004465 Ga0207648_100044657 107
613 3300026095 Ga0207676_10279624 Ga0207676_102796242 107
614 3300026095 Ga0207676_10402730 Ga0207676_104027301 107
615 3300026095 Ga0207676_10578803 Ga0207676_105788032 107
616 3300026095 Ga0207676_11155158 Ga0207676_111551582 107
617 3300026116 Ga0207674_10006753 Ga0207674_100067534 107
618 3300026116 Ga0207674_10131659 Ga0207674_101316592 107
619 3300026116 Ga0207674_10252436 Ga0207674_102524363 107
620 3300026116 Ga0207674_10414235 Ga0207674_104142352 107
621 3300026116 Ga0207674_11778706 Ga0207674_117787061 107
622 3300026118 Ga0207675_100030104 Ga0207675_1000301045 107
623 3300026118 Ga0207675_100037357 Ga0207675_1000373575 107
624 3300026118 Ga0207675_100207390 Ga0207675_1002073902 107
625 3300026118 Ga0207675_100252538 Ga0207675_1002525383 107
626 3300026118 Ga0207675_100335285 Ga0207675_1003352852 107
627 3300026118 Ga0207675_100691444 Ga0207675_1006914442 107
628 3300026118 Ga0207675_101036536 Ga0207675_1010365362 107
629 3300026121 Ga0207683_10889411 Ga0207683_108894112 107
630 3300026142 Ga0207698_10554213 Ga0207698_105542132 107
631 3300026142 Ga0207698_10593692 Ga0207698_105936922 107
632 3300026142 Ga0207698_11063807 Ga0207698_110638073 107
633 3300027111 Ga0209281_1000013 Ga0209281_1000013411 107
634 3300027111 Ga0209281_1000015 Ga0209281_1000015427 107
635 3300027111 Ga0209281_1003287 Ga0209281_10032872 107
636 3300027296 Ga0209389_1000205 Ga0209389_100020527 107
637 3300027312 Ga0209371_1000004 Ga0209371_1000004336 107
638 3300027312 Ga0209371_1000016 Ga0209371_100001615 107
639 3300027312 Ga0209371_1000142 Ga0209371_100014262 107
640 3300027312 Ga0209371_1000584 Ga0209371_100058439 107
641 3300027312 Ga0209371_1027632 Ga0209371_10276322 107
642 3300027312 Ga0209371_1040604 Ga0209371_10406041 107
643 3300027512 Ga0209179_1000006 Ga0209179_100000668 107
644 3300027512 Ga0209179_1007486 Ga0209179_10074862 107
645 3300027666 Ga0209282_1305181 Ga0209282_13051812 107
646 3300027671 Ga0209588_1092973 Ga0209588_10929732 107
647 3300027907 Ga0207428_10004796 Ga0207428_100047968 107
648 3300027907 Ga0207428_10014528 Ga0207428_100145284 107
649 3300027907 Ga0207428_10028912 Ga0207428_100289123 107
650 3300027907 Ga0207428_10718917 Ga0207428_107189171 107
651 3300028017 Ga0265356_1001503 Ga0265356_10015032 107
652 3300028023 Ga0265357_1000734 Ga0265357_10007343 107
653 3300028379 Ga0268266_10005233 Ga0268266_100052335 107
654 3300028379 Ga0268266_10038457 Ga0268266_100384574 107
655 3300028379 Ga0268266_10086540 Ga0268266_100865402 107
656 3300028379 Ga0268266_10175598 Ga0268266_101755982 107
657 3300028379 Ga0268266_10194966 Ga0268266_101949661 107
658 3300028379 Ga0268266_10247583 Ga0268266_102475832 107
659 3300028379 Ga0268266_10285925 Ga0268266_102859252 107
660 3300028379 Ga0268266_10964159 Ga0268266_109641592 107
661 3300028379 Ga0268266_11978083 Ga0268266_119780832 107
662 3300028380 Ga0268265_10000932 Ga0268265_100009329 107
663 3300028380 Ga0268265_10002340 Ga0268265_1000234012 107
664 3300028380 Ga0268265_10358027 Ga0268265_103580271 107
665 3300028380 Ga0268265_11672093 Ga0268265_116720932 107
666 3300028380 Ga0268265_11891787 Ga0268265_118917872 107
667 3300028381 Ga0268264_10000176 Ga0268264_1000017661 107
668 3300028381 Ga0268264_10003702 Ga0268264_100037029 107
669 3300028381 Ga0268264_10005113 Ga0268264_100051132 107
670 3300028381 Ga0268264_10152827 Ga0268264_101528272 107
671 3300028558 Ga0265326_10017083 Ga0265326_100170834 107
672 3300028563 Ga0265319_1010114 Ga0265319_10101144 107
673 3300028573 Ga0265334_10000669 Ga0265334_1000066918 107
674 3300028573 Ga0265334_10026076 Ga0265334_100260762 107
675 3300028577 Ga0265318_10019707 Ga0265318_100197072 107
676 3300028654 Ga0265322_10214651 Ga0265322_102146511 107
677 3300028786 Ga0307517_10226615 Ga0307517_102266152 107
678 3300028794 Ga0307515_10001184 Ga0307515_1000118454 107
679 3300028794 Ga0307515_10371965 Ga0307515_103719652 107
680 3300028800 Ga0265338_10010356 Ga0265338_100103565 107
681 3300028800 Ga0265338_10116545 Ga0265338_101165454 107
682 3300028800 Ga0265338_10209784 Ga0265338_102097842 107
683 3300030500 Ga0268256_1000005 Ga0268256_1000005709 107
684 3300030500 Ga0268256_1000015 Ga0268256_1000015555 107
685 3300030500 Ga0268256_1000111 Ga0268256_100011164 107
686 3300030500 Ga0268256_1000436 Ga0268256_10004363 107
687 3300030500 Ga0268256_1031434 Ga0268256_10314342 107
688 3300030500 Ga0268256_1038012 Ga0268256_10380121 107
689 3300030521 Ga0307511_10029804 Ga0307511_100298043 107
690 3300030731 Ga0316177_1095471 Ga0316177_10954712 107
691 3300030733 Ga0314311_1137878 Ga0314311_11378782 107
692 3300030735 Ga0316178_1009525 Ga0316178_100952527 107
693 3300030742 Ga0316183_1002629 Ga0316183_10026292 107
694 3300030744 Ga0316181_1261844 Ga0316181_12618442 107
695 3300030763 Ga0265763_1006747 Ga0265763_10067472 107
696 3300030836 Ga0265767_106400 Ga0265767_1064001 107
697 3300030879 Ga0265765_1029494 Ga0265765_10294942 107
698 3300031018 Ga0265773_1047532 Ga0265773_10475321 107
699 3300031090 Ga0265760_10010613 Ga0265760_100106132 107
700 3300031090 Ga0265760_10184949 Ga0265760_101849492 107
701 3300031235 Ga0265330_10352430 Ga0265330_103524301 107
702 3300031238 Ga0265332_10034344 Ga0265332_100343442 107
703 3300031239 Ga0265328_10004103 Ga0265328_100041034 107
704 3300031239 Ga0265328_10143135 Ga0265328_101431352 107
705 3300031240 Ga0265320_10022318 Ga0265320_100223185 107
706 3300031241 Ga0265325_10013274 Ga0265325_100132745 107
707 3300031242 Ga0265329_10008091 Ga0265329_100080914 107
708 3300031247 Ga0265340_10034386 Ga0265340_100343862 107
709 3300031247 Ga0265340_10186057 Ga0265340_101860572 107
710 3300031249 Ga0265339_10017954 Ga0265339_100179545 107
711 3300031250 Ga0265331_10005302 Ga0265331_100053028 107
712 3300031251 Ga0265327_10001379 Ga0265327_100013793 107
713 3300031251 Ga0265327_10003741 Ga0265327_100037418 107
714 3300031251 Ga0265327_10010879 Ga0265327_100108793 107
715 3300031251 Ga0265327_10045765 Ga0265327_100457652 107
716 3300031344 Ga0265316_10000783 Ga0265316_1000078333 107
717 3300031344 Ga0265316_10012865 Ga0265316_1001286510 107
718 3300031344 Ga0265316_10020230 Ga0265316_100202305 107
719 3300031456 Ga0307513_10042643 Ga0307513_100426434 107
720 3300031456 Ga0307513_10179846 Ga0307513_101798463 107
721 3300031456 Ga0307513_10640543 Ga0307513_106405431 107
722 3300031507 Ga0307509_10000021 Ga0307509_10000021211 107
723 3300031507 Ga0307509_10105278 Ga0307509_101052784 107
724 3300031507 Ga0307509_10419708 Ga0307509_104197081 107
725 3300031548 Ga0307408_100045527 Ga0307408_1000455273 107
726 3300031548 Ga0307408_100088657 Ga0307408_1000886572 107
727 3300031548 Ga0307408_100339274 Ga0307408_1003392742 107
728 3300031548 Ga0307408_100594254 Ga0307408_1005942541 107
729 3300031595 Ga0265313_10005492 Ga0265313_1000549210 107
730 3300031595 Ga0265313_10058875 Ga0265313_100588754 107
731 3300031649 Ga0307514_10498177 Ga0307514_104981771 107
732 3300031665 Ga0316575_10250229 Ga0316575_102502292 107
733 3300031691 Ga0316579_10089972 Ga0316579_100899722 107
734 3300031691 Ga0316579_10149269 Ga0316579_101492692 107
735 3300031691 Ga0316579_10299821 Ga0316579_102998212 107
736 3300031711 Ga0265314_10022458 Ga0265314_100224584 107
737 3300031711 Ga0265314_10279726 Ga0265314_102797261 107
738 3300031711 Ga0265314_10715672 Ga0265314_107156722 107
739 3300031712 Ga0265342_10047521 Ga0265342_100475212 107
740 3300031727 Ga0316576_10002013 Ga0316576_100020134 107
741 3300031727 Ga0316576_10005102 Ga0316576_100051026 107
742 3300031727 Ga0316576_10197015 Ga0316576_101970152 107
743 3300031727 Ga0316576_10258572 Ga0316576_102585722 107
744 3300031727 Ga0316576_10381748 Ga0316576_103817482 107
745 3300031728 Ga0316578_10023579 Ga0316578_100235792 107
746 3300031728 Ga0316578_10132478 Ga0316578_101324782 107
747 3300031728 Ga0316578_10144519 Ga0316578_101445192 107
748 3300031728 Ga0316578_10145739 Ga0316578_101457391 107
749 3300031728 Ga0316578_10386358 Ga0316578_103863581 107
750 3300031728 Ga0316578_10451027 Ga0316578_104510272 107
751 3300031728 Ga0316578_10559007 Ga0316578_105590071 107
752 3300031730 Ga0307516_10000050 Ga0307516_1000005075 107
753 3300031730 Ga0307516_10284338 Ga0307516_102843382 107
754 3300031731 Ga0307405_10433782 Ga0307405_104337821 107
755 3300031731 Ga0307405_11166368 Ga0307405_111663681 107
756 3300031731 Ga0307405_11175368 Ga0307405_111753682 107
757 3300031733 Ga0316577_10013474 Ga0316577_100134742 107
758 3300031733 Ga0316577_10043323 Ga0316577_100433232 107
759 3300031733 Ga0316577_10232132 Ga0316577_102321322 107
760 3300031733 Ga0316577_10421347 Ga0316577_104213472 107
761 3300031733 Ga0316577_10544324 Ga0316577_105443241 107
762 3300031824 Ga0307413_10010454 Ga0307413_100104546 107
763 3300031824 Ga0307413_10163301 Ga0307413_101633012 107
764 3300031824 Ga0307413_10942534 Ga0307413_109425342 107
765 3300031824 Ga0307413_11749383 Ga0307413_117493832 107
766 3300031838 Ga0307518_10482099 Ga0307518_104820992 107
767 3300031852 Ga0307410_10023462 Ga0307410_100234624 107
768 3300031852 Ga0307410_10513296 Ga0307410_105132962 107
769 3300031852 Ga0307410_12036100 Ga0307410_120361002 107
770 3300031901 Ga0307406_10064136 Ga0307406_100641363 107
771 3300031901 Ga0307406_10273777 Ga0307406_102737772 107
772 3300031901 Ga0307406_10368777 Ga0307406_103687772 107
773 3300031901 Ga0307406_11263546 Ga0307406_112635461 107
774 3300031903 Ga0307407_10002190 Ga0307407_1000219010 107
775 3300031911 Ga0307412_10590216 Ga0307412_105902162 107
776 3300031911 Ga0307412_10860810 Ga0307412_108608102 107
777 3300031995 Ga0307409_100028163 Ga0307409_1000281635 107
778 3300031995 Ga0307409_100297603 Ga0307409_1002976032 107
779 3300031995 Ga0307409_100423553 Ga0307409_1004235532 107
780 3300031995 Ga0307409_101241970 Ga0307409_1012419702 107
781 3300032002 Ga0307416_100008099 Ga0307416_1000080992 107
782 3300032002 Ga0307416_100053714 Ga0307416_1000537144 107
783 3300032002 Ga0307416_100263336 Ga0307416_1002633362 107
784 3300032002 Ga0307416_100300364 Ga0307416_1003003642 107
785 3300032002 Ga0307416_101194651 Ga0307416_1011946512 107
786 3300032004 Ga0307414_10108541 Ga0307414_101085413 107
787 3300032004 Ga0307414_10182901 Ga0307414_101829012 107
788 3300032004 Ga0307414_10249447 Ga0307414_102494473 107
789 3300032004 Ga0307414_11135916 Ga0307414_111359161 107
790 3300032005 Ga0307411_10191085 Ga0307411_101910853 107
791 3300032005 Ga0307411_10833575 Ga0307411_108335751 107
792 3300032005 Ga0307411_10935178 Ga0307411_109351781 107
793 3300032126 Ga0307415_100539626 Ga0307415_1005396262 107
794 3300032126 Ga0307415_100653888 Ga0307415_1006538882 107
795 3300032126 Ga0307415_100750955 Ga0307415_1007509552 107
796 3300032126 Ga0307415_101254395 Ga0307415_1012543952 107
797 3300032126 Ga0307415_102498791 Ga0307415_1024987911 107
798 3300032133 Ga0316583_10019225 Ga0316583_100192252 107
799 3300032133 Ga0316583_10037476 Ga0316583_100374762 107
800 3300032133 Ga0316583_10060858 Ga0316583_100608582 107
801 3300032137 Ga0316585_10098244 Ga0316585_100982441 107
802 3300032137 Ga0316585_10219646 Ga0316585_102196461 107
803 3300032137 Ga0316585_10238511 Ga0316585_102385111 107
804 3300032139 Ga0316580_10191924 Ga0316580_101919241 107
805 3300032168 Ga0316593_10002261 Ga0316593_100022616 107
806 3300032168 Ga0316593_10008887 Ga0316593_100088872 107
807 3300032168 Ga0316593_10009046 Ga0316593_100090461 107
808 3300032168 Ga0316593_10071900 Ga0316593_100719001 107
809 3300032168 Ga0316593_10132724 Ga0316593_101327242 107
810 3300032168 Ga0316593_10177769 Ga0316593_101777691 107
811 3300033180 Ga0307510_10000002 Ga0307510_10000002123 107
812 3300033180 Ga0307510_10038803 Ga0307510_100388035 107
813 3300033524 Ga0316592_1112428 Ga0316592_11124282 107
814 3300033529 Ga0316587_1110358 Ga0316587_11103581 107
815 3300033541 Ga0316596_1040230 Ga0316596_10402301 107
816 3300033541 Ga0316596_1101239 Ga0316596_11012392 107
817 3300033541 Ga0316596_1201300 Ga0316596_12013002 107
818 3300034817 Ga0373948_0117083 Ga0373948_0117083_79_402 107
819 3300035086 Ga0373934_0172633 Ga0373934_0172633_80_403 107
820 3300035088 Ga0373940_0219738 Ga0373940_0219738_69_392 107
821 3300035091 Ga0373951_0045728 Ga0373951_0045728_20_343 107
822 3300035092 Ga0373952_0086760 Ga0373952_0086760_472_795 107
823 3300035111 Ga0373923_0248228 Ga0373923_0248228_480_803 107
824 3300035111 Ga0373923_0426648 Ga0373923_0426648_223_546 107
825 3300035113 Ga0373936_0022331 Ga0373936_0022331_1093_1416 107
826 3300035113 Ga0373936_0049230 Ga0373936_0049230_94_417 107
827 3300035113 Ga0373936_0500272 Ga0373936_0500272_100_423 107
828 3300035117 Ga0373953_0134980 Ga0373953_0134980_679_1002 107
829 3300035118 Ga0373954_0581950 Ga0373954_0581950_184_507 107
830 3300035119 Ga0373956_0129592 Ga0373956_0129592_175_498 107
831 3300035120 Ga0373957_0208156 Ga0373957_0208156_337_660 107
832 3300035171 Ga0373946_0409211 Ga0373946_0409211_247_570 107
833 3300035172 Ga0373955_0314504 Ga0373955_0314504_502_825 107
834 3300035241 Ga0373961_0192657 Ga0373961_0192657_82_405 107
835 3300035242 Ga0373962_0076741 Ga0373962_0076741_449_772 107
836 3300035398 Ga0316574_0017689 Ga0316574_0017689_89_412 107
837 3300035398 Ga0316574_0030031 Ga0316574_0030031_1567_1890 107
838 3300035398 Ga0316574_0120412 Ga0316574_0120412_633_956 107
839 3300035398 Ga0316574_0520826 Ga0316574_0520826_247_570 107
840 3300035398 Ga0316574_0674841 Ga0316574_0674841_292_615 107
841 3300035398 Ga0316574_0878369 Ga0316574_0878369_130_453 107
842 3300035398 Ga0316574_0944990 Ga0316574_0944990_51_374 107
843 3300035410 Ga0373924_0400309 Ga0373924_0400309_74_397 107
844 3300035691 Ga0373931_0074168 Ga0373931_0074168_1085_1408 107
845 3300035692 Ga0373935_0098770 Ga0373935_0098770_833_1156 107
846 3300035692 Ga0373935_0649283 Ga0373935_0649283_116_439 107
847 3300035695 Ga0373927_0686543 Ga0373927_0686543_194_517 107
848 3300035724 Ga0373933_0726994 Ga0373933_0726994_305_628 107
849 3300036401 Ga0373937_0230073 Ga0373937_0230073_418_741 107
850 3300036401 Ga0373937_0352801 Ga0373937_0352801_803_1126 107
851 3300036401 Ga0373937_1810936 Ga0373937_1810936_182_505 107
852 3300036647 Ga0316582_0013733 Ga0316582_0013733_3488_3811 107
853 3300036647 Ga0316582_0031308 Ga0316582_0031308_362_685 107
854 3300036647 Ga0316582_0036762 Ga0316582_0036762_1908_2231 107
855 3300036647 Ga0316582_0036824 Ga0316582_0036824_1080_1403 107
856 3300036647 Ga0316582_0037163 Ga0316582_0037163_64_387 107
857 3300036647 Ga0316582_0102210 Ga0316582_0102210_1244_1567 107
858 3300036712 Ga0316584_0006541 Ga0316584_0006541_1081_1404 107
859 3300036712 Ga0316584_0013058 Ga0316584_0013058_4730_5053 107
860 3300036712 Ga0316584_0020240 Ga0316584_0020240_2348_2671 107
861 3300036712 Ga0316584_0098654 Ga0316584_0098654_523_846 107
862 3300036712 Ga0316584_0147131 Ga0316584_0147131_1214_1537 107
863 3300036712 Ga0316584_0623978 Ga0316584_0623978_299_622 107
864 3300036712 Ga0316584_0857075 Ga0316584_0857075_81_404 107
865 3300037068 Ga0373925_0280903 Ga0373925_0280903_833_1156 107
866 3300037068 Ga0373925_0412262 Ga0373925_0412262_472_795 107
867 3300037068 Ga0373925_1367703 Ga0373925_1367703_97_420 107
868 3300037588 Ga0316581_0000292 Ga0316581_0000292_4493_4816 107
869 3300037588 Ga0316581_0209325 Ga0316581_0209325_71_394 107
870 3300037588 Ga0316581_0224402 Ga0316581_0224402_97_420 107
871 3300038443 Ga0395901_0749020 Ga0395901_0749020_17_340 107
872 3300039437 Ga0436365_0844919 Ga0436365_0844919_160_483 107
873 3300039437 Ga0436365_1214120 Ga0436365_1214120_451_774 107
874 3300039437 Ga0436365_1360668 Ga0436365_1360668_2684_3007 107
875 3300039438 Ga0436360_0380318 Ga0436360_0380318_1645_1968 107
876 3300039438 Ga0436360_0515949 Ga0436360_0515949_263_586 107
877 3300039438 Ga0436360_0593715 Ga0436360_0593715_1783_2106 107
878 3300039438 Ga0436360_0826695 Ga0436360_0826695_97_420 107
879 3300039438 Ga0436360_0942877 Ga0436360_0942877_25_348 107
880 3300039438 Ga0436360_1010070 Ga0436360_1010070_159_482 107
881 3300039447 Ga0436361_0136079 Ga0436361_0136079_147_470 107
882 3300039447 Ga0436361_0201071 Ga0436361_0201071_803_1126 107
883 3300039447 Ga0436361_0567398 Ga0436361_0567398_68_391 107
884 3300039450 Ga0436363_0164591 Ga0436363_0164591_598_921 107
885 3300039450 Ga0436363_0952595 Ga0436363_0952595_2848_3171 107
886 3300039450 Ga0436363_1169546 Ga0436363_1169546_83_406 107
887 3300039450 Ga0436363_1439963 Ga0436363_1439963_170_493 107
888 3300039450 Ga0436363_1687372 Ga0436363_1687372_163_486 107
889 3300039453 Ga0436362_0097055 Ga0436362_0097055_194_517 107
890 3300039453 Ga0436362_0352054 Ga0436362_0352054_250_573 107
891 3300039453 Ga0436362_0519667 Ga0436362_0519667_49_372 107
892 3300039453 Ga0436362_0645059 Ga0436362_0645059_188_511 107
893 3300041404 Ga0439436_0063145 Ga0439436_0063145_22_345 107
894 3300041405 Ga0439438_002379 Ga0439438_002379_7151_7474 107
895 3300041406 Ga0439439_0264001 Ga0439439_0264001_37_360 107
896 3300041410 Ga0439461_0002118 Ga0439461_0002118_1883_2206 107
897 3300041411 Ga0439466_0173061 Ga0439466_0173061_188_511 107
898 3300041413 Ga0439465_0018419 Ga0439465_0018419_707_1030 107
899 3300041413 Ga0439465_0131668 Ga0439465_0131668_296_619 107
900 3300041441 Ga0451787_099410 Ga0451787_099410_150_473 107
901 3300041441 Ga0451787_760742 Ga0451787_760742_15_338 107
902 3300041443 Ga0451789_0137202 Ga0451789_0137202_682_1005 107
903 3300041451 Ga0451791_0494916 Ga0451791_0494916_99_422 107
904 3300041451 Ga0451791_0961898 Ga0451791_0961898_746_1069 107
905 3300041451 Ga0451791_1050206 Ga0451791_1050206_399_722 107
906 3300041451 Ga0451791_1425262 Ga0451791_1425262_198_521 107
907 3300041452 Ga0451793_0269673 Ga0451793_0269673_1962_2285 107
908 3300041452 Ga0451793_0577701 Ga0451793_0577701_255_578 107
909 3300041452 Ga0451793_0762201 Ga0451793_0762201_318_641 107
910 3300041452 Ga0451793_1116150 Ga0451793_1116150_906_1229 107
911 3300041453 Ga0451797_0401209 Ga0451797_0401209_149_472 107
912 3300041456 Ga0451795_0635588 Ga0451795_0635588_54_377 107
913 3300041458 Ga0451798_0142136 Ga0451798_0142136_190_513 107
914 3300041459 Ga0451800_0048791 Ga0451800_0048791_513_836 107
915 3300041460 Ga0451802_0129455 Ga0451802_0129455_231_554 107
916 3300041460 Ga0451802_1404507 Ga0451802_1404507_390_713 107
917 3300041460 Ga0451802_2055396 Ga0451802_2055396_3011_3334 107
918 3300041462 Ga0451806_211117 Ga0451806_211117_525_848 107
919 3300041463 Ga0451804_0417164 Ga0451804_0417164_17_340 107
920 3300041486 Ga0451807_0396063 Ga0451807_0396063_1073_1396 107
921 3300041486 Ga0451807_1278800 Ga0451807_1278800_1980_2303 107
922 3300041486 Ga0451807_1451139 Ga0451807_1451139_59_382 107
923 3300041486 Ga0451807_2648389 Ga0451807_2648389_96_419 107
924 3300041491 Ga0451833_0022883 Ga0451833_0022883_254_577 107
925 3300041494 Ga0451837_1238615 Ga0451837_1238615_23_346 107
926 3300041498 Ga0451841_0161635 Ga0451841_0161635_299_622 107
927 3300041505 Ga0451849_0503352 Ga0451849_0503352_590_913 107
928 3300041507 Ga0451851_1375299 Ga0451851_1375299_113_436 107
929 3300041509 Ga0451843_0723165 Ga0451843_0723165_632_955 107
930 3300041509 Ga0451843_1159197 Ga0451843_1159197_962_1285 107
931 3300041509 Ga0451843_1698381 Ga0451843_1698381_94_417 107
932 3300041512 Ga0451853_3357331 Ga0451853_3357331_38_361 107
933 3300041997 Ga0439431_0008517 Ga0439431_0008517_637_960 107
934 3300041999 Ga0439433_0110391 Ga0439433_0110391_204_527 107
935 3300042000 Ga0439437_009360 Ga0439437_009360_392_715 107
936 3300042002 Ga0439442_008746 Ga0439442_008746_1158_1481 107
937 3300042003 Ga0439443_006790 Ga0439443_006790_699_1022 107
938 3300042005 Ga0439448_0102766 Ga0439448_0102766_619_942 107
939 3300042006 Ga0439432_013881 Ga0439432_013881_606_929 107
940 3300042006 Ga0439432_040586 Ga0439432_040586_475_798 107
941 3300042007 Ga0439449_0005200 Ga0439449_0005200_2895_3218 107
942 3300042008 Ga0439450_064872 Ga0439450_064872_391_714 107
943 3300042010 Ga0439452_037451 Ga0439452_037451_281_604 107
944 3300042011 Ga0439454_035191 Ga0439454_035191_286_609 107
945 3300042012 Ga0439455_0022714 Ga0439455_0022714_656_979 107
946 3300042012 Ga0439455_0140419 Ga0439455_0140419_87_410 107
947 3300042013 Ga0439456_000224 Ga0439456_000224_2307_2630 107
948 3300042013 Ga0439456_014967 Ga0439456_014967_544_867 107
949 3300042014 Ga0439457_046307 Ga0439457_046307_571_894 107
950 3300042115 Ga0450911_000005 Ga0450911_000005_166418_166741 107
951 3300042120 Ga0450917_008885 Ga0450917_008885_174_497 107
952 3300042130 Ga0450892_020384 Ga0450892_020384_64_387 107
953 3300042134 Ga0450898_151929 Ga0450898_151929_130_453 107
954 3300042136 Ga0450900_005178 Ga0450900_005178_996_1319 107
955 3300042136 Ga0450900_025628 Ga0450900_025628_39_362 107
956 3300042138 Ga0450903_060560 Ga0450903_060560_59_382 107
957 3300042138 Ga0450903_061596 Ga0450903_061596_44_367 107
958 3300042139 Ga0450904_000002 Ga0450904_000002_4912_5235 107
959 3300042142 Ga0450905_002387 Ga0450905_002387_1424_1747 107
960 3300042142 Ga0450905_008100 Ga0450905_008100_170_493 107
961 3300042142 Ga0450905_099360 Ga0450905_099360_53_376 107
962 3300042144 Ga0450889_023204 Ga0450889_023204_276_599 107
963 3300042156 Ga0439446_0375064 Ga0439446_0375064_40_363 107
964 3300042437 Ga0439444_0125881 Ga0439444_0125881_156_491 107
965 3300042438 Ga0439459_0007151 Ga0439459_0007151_926_1249 107
966 3300042439 Ga0439464_0178424 Ga0439464_0178424_179_502 107
967 3300042439 Ga0439464_0238835 Ga0439464_0238835_250_573 107
968 3300042530 Ga0450916_008977 Ga0450916_008977_609_932 107
969 3300042530 Ga0450916_009543 Ga0450916_009543_610_933 107
970 3300042533 Ga0450901_000683 Ga0450901_000683_1290_1613 107
971 3300042876 Ga0451577_0000105 Ga0451577_0000105_9934_10257 107
972 3300042876 Ga0451577_0128767 Ga0451577_0128767_411_734 107
973 3300042876 Ga0451577_0568651 Ga0451577_0568651_23_346 107
974 3300042876 Ga0451577_0641866 Ga0451577_0641866_83_406 107
975 3300042993 Ga0439440_0053011 Ga0439440_0053011_586_909 107
976 3300042993 Ga0439440_0229706 Ga0439440_0229706_57_380 107
977 3300044656 Ga0466969_0014574 Ga0466969_0014574_2357_2680 107
978 3300044656 Ga0466969_0088720 Ga0466969_0088720_641_964 107
979 3300044658 Ga0466972_0143428 Ga0466972_0143428_412_735 107
980 3300044658 Ga0466972_0283035 Ga0466972_0283035_219_590 107
981 3300044683 Ga0466965_0211482 Ga0466965_0211482_671_994 107
982 3300044684 Ga0466966_0004186 Ga0466966_0004186_4782_5105 107
983 3300044684 Ga0466966_0395644 Ga0466966_0395644_12_335 107
984 3300044693 Ga0466961_0020090 Ga0466961_0020090_2713_3036 107
985 3300044706 Ga0466964_0004197 Ga0466964_0004197_1468_1791 107
986 3300044712 Ga0453684_0003537 Ga0453684_0003537_24668_24991 107
987 3300044712 Ga0453684_0034985 Ga0453684_0034985_2231_2554 107
988 3300044712 Ga0453684_0220280 Ga0453684_0220280_497_820 107
989 3300044719 Ga0466971_0002218 Ga0466971_0002218_4959_5282 107
990 3300044719 Ga0466971_0380102 Ga0466971_0380102_258_581 107
991 3300044735 Ga0466968_0218920 Ga0466968_0218920_39_362 107
992 3300044765 Ga0466970_0015790 Ga0466970_0015790_181_504 107
993 3300044765 Ga0466970_0161945 Ga0466970_0161945_82_405 107
994 3300044765 Ga0466970_0276325 Ga0466970_0276325_535_858 107
995 3300044842 Ga0466957_0018370 Ga0466957_0018370_3159_3482 107
996 3300044842 Ga0466957_0572185 Ga0466957_0572185_51_374 107
997 3300045049 Ga0466959_0022009 Ga0466959_0022009_4119_4442 107
998 3300045049 Ga0466959_0048755 Ga0466959_0048755_2087_2410 107
999 3300045049 Ga0466959_0072728 Ga0466959_0072728_737_1060 107
1000 3300045049 Ga0466959_0081512 Ga0466959_0081512_1965_2288 107
1001 3300045049 Ga0466959_0958262 Ga0466959_0958262_59_382 107
1002 3300045051 Ga0451576_0000741 Ga0451576_0000741_30427_30750 107
1003 3300045051 Ga0451576_0014390 Ga0451576_0014390_367_690 107
1004 3300045051 Ga0451576_0359358 Ga0451576_0359358_916_1239 107
1005 3300045051 Ga0451576_0758278 Ga0451576_0758278_398_721 107
1006 3300045836 Ga0466958_0114325 Ga0466958_0114325_209_532 107
1007 3300046452 Ga0495617_024700 Ga0495617_024700_684_1007 107
1008 3300046453 Ga0495627_000424 Ga0495627_000424_22405_22728 107
1009 3300046453 Ga0495627_000496 Ga0495627_000496_172_495 107
1010 3300046453 Ga0495627_001316 Ga0495627_001316_6406_6729 107
1011 3300046453 Ga0495627_008095 Ga0495627_008095_2897_3220 107
1012 3300046453 Ga0495627_079133 Ga0495627_079133_497_820 107
1013 3300046458 Ga0495591_000849 Ga0495591_000849_12192_12515 107
1014 3300046458 Ga0495591_009341 Ga0495591_009341_31_354 107
1015 3300046458 Ga0495591_040223 Ga0495591_040223_29_367 107
1016 3300046459 Ga0495629_0299467 Ga0495629_0299467_133_456 107
1017 3300046459 Ga0495629_0648537 Ga0495629_0648537_355_678 107
1018 3300046461 Ga0495641_0390721 Ga0495641_0390721_83_406 107
1019 3300046462 Ga0495651_0963061 Ga0495651_0963061_106_429 107
1020 3300046463 Ga0495653_0005238 Ga0495653_0005238_6435_6758 107
1021 3300046471 Ga0495650_0008755 Ga0495650_0008755_4452_4775 107
1022 3300046471 Ga0495650_0018342 Ga0495650_0018342_3130_3468 107
1023 3300046471 Ga0495650_0021605 Ga0495650_0021605_791_1114 107
1024 3300046471 Ga0495650_0035382 Ga0495650_0035382_1412_1735 107
1025 3300046472 Ga0495580_0107838 Ga0495580_0107838_990_1313 107
1026 3300046473 Ga0495582_0603442 Ga0495582_0603442_249_572 107
1027 3300046474 Ga0495605_0000449 Ga0495605_0000449_22535_22858 107
1028 3300046474 Ga0495605_0000461 Ga0495605_0000461_24664_24987 107
1029 3300046477 Ga0495664_0740603 Ga0495664_0740603_53_376 107
1030 3300046491 Ga0495584_0052116 Ga0495584_0052116_775_1098 107
1031 3300046491 Ga0495584_0108849 Ga0495584_0108849_422_760 107
1032 3300046492 Ga0495585_0003113 Ga0495585_0003113_3964_4287 107
1033 3300046501 Ga0495607_0000490 Ga0495607_0000490_11071_11394 107
1034 3300046501 Ga0495607_0000544 Ga0495607_0000544_13889_14212 107
1035 3300046501 Ga0495607_0000841 Ga0495607_0000841_11088_11411 107
1036 3300046501 Ga0495607_0063674 Ga0495607_0063674_1590_1913 107
1037 3300046501 Ga0495607_0099414 Ga0495607_0099414_641_964 107
1038 3300046501 Ga0495607_0122780 Ga0495607_0122780_951_1274 107
1039 3300046501 Ga0495607_0184100 Ga0495607_0184100_108_431 107
1040 3300046501 Ga0495607_0226057 Ga0495607_0226057_142_465 107
1041 3300046506 Ga0495583_0000861 Ga0495583_0000861_14043_14366 107
1042 3300046506 Ga0495583_0004417 Ga0495583_0004417_5768_6091 107
1043 3300046506 Ga0495583_0032928 Ga0495583_0032928_1468_1791 107
1044 3300046506 Ga0495583_0371704 Ga0495583_0371704_186_509 107
1045 3300046507 Ga0495606_0001804 Ga0495606_0001804_25338_25661 107
1046 3300046507 Ga0495606_0006268 Ga0495606_0006268_6731_7054 107
1047 3300046507 Ga0495606_0168322 Ga0495606_0168322_756_1094 107
1048 3300046507 Ga0495606_0515192 Ga0495606_0515192_260_583 107
1049 3300046512 Ga0495610_0003557 Ga0495610_0003557_11709_12032 107
1050 3300046515 Ga0495620_0000003 Ga0495620_0000003_190492_190815 107
1051 3300046515 Ga0495620_0001260 Ga0495620_0001260_14045_14368 107
1052 3300046515 Ga0495620_0003107 Ga0495620_0003107_4294_4617 107
1053 3300046518 Ga0495631_0004082 Ga0495631_0004082_7321_7659 107
1054 3300046518 Ga0495631_0023789 Ga0495631_0023789_980_1303 107
1055 3300046518 Ga0495631_0049517 Ga0495631_0049517_571_894 107
1056 3300046519 Ga0495632_0003927 Ga0495632_0003927_7635_7958 107
1057 3300046519 Ga0495632_0005427 Ga0495632_0005427_7147_7470 107
1058 3300046519 Ga0495632_0048630 Ga0495632_0048630_745_1068 107
1059 3300046519 Ga0495632_0125156 Ga0495632_0125156_696_1019 107
1060 3300046519 Ga0495632_0336259 Ga0495632_0336259_309_632 107
1061 3300046520 Ga0495637_0002014 Ga0495637_0002014_11093_11416 107
1062 3300046522 Ga0495643_0000917 Ga0495643_0000917_25987_26310 107
1063 3300046522 Ga0495643_0003034 Ga0495643_0003034_2013_2336 107
1064 3300046522 Ga0495643_0006177 Ga0495643_0006177_6679_7002 107
1065 3300046524 Ga0495648_0003639 Ga0495648_0003639_8927_9250 107
1066 3300046524 Ga0495648_0003944 Ga0495648_0003944_11615_11938 107
1067 3300046524 Ga0495648_0010333 Ga0495648_0010333_836_1174 107
1068 3300046524 Ga0495648_0017142 Ga0495648_0017142_3979_4302 107
1069 3300046524 Ga0495648_0312114 Ga0495648_0312114_261_584 107
1070 3300046528 Ga0495642_0521381 Ga0495642_0521381_22_345 107
1071 3300046530 Ga0495654_0020728 Ga0495654_0020728_1787_2110 107
1072 3300046530 Ga0495654_0076246 Ga0495654_0076246_744_1067 107
1073 3300046530 Ga0495654_0140619 Ga0495654_0140619_417_740 107
1074 3300046530 Ga0495654_0254239 Ga0495654_0254239_98_421 107
1075 3300046536 Ga0495587_0018441 Ga0495587_0018441_1099_1422 107
1076 3300046538 Ga0495609_0000153 Ga0495609_0000153_14141_14464 107
1077 3300046557 Ga0495622_0437774 Ga0495622_0437774_15_338 107
1078 3300046558 Ga0495633_0000300 Ga0495633_0000300_41981_42304 107
1079 3300046558 Ga0495633_0016022 Ga0495633_0016022_112_435 107
1080 3300046558 Ga0495633_0034834 Ga0495633_0034834_183_521 107
1081 3300046616 Ga0495668_0049124 Ga0495668_0049124_435_758 107
1082 3300046616 Ga0495668_0215387 Ga0495668_0215387_323_646 107
1083 3300046648 Ga0495611_0003885 Ga0495611_0003885_3553_3876 107
1084 3300046648 Ga0495611_0227622 Ga0495611_0227622_318_641 107
1085 3300046660 Ga0495625_0051346 Ga0495625_0051346_1770_2108 107
1086 3300046660 Ga0495625_0116455 Ga0495625_0116455_1409_1732 107
1087 3300046660 Ga0495625_0126691 Ga0495625_0126691_53_376 107
1088 3300046660 Ga0495625_0156283 Ga0495625_0156283_642_965 107
1089 3300046665 Ga0495661_0000538 Ga0495661_0000538_3977_4300 107
1090 3300046665 Ga0495661_0001311 Ga0495661_0001311_9268_9591 107
1091 3300046665 Ga0495661_0045241 Ga0495661_0045241_752_1075 107
1092 3300046665 Ga0495661_0225039 Ga0495661_0225039_151_474 107
1093 3300046678 Ga0495599_0886783 Ga0495599_0886783_152_475 107
1094 3300046680 Ga0495646_0231982 Ga0495646_0231982_252_575 107
1095 3300046689 Ga0495613_0097182 Ga0495613_0097182_1218_1541 107
1096 3300046691 Ga0495670_0003681 Ga0495670_0003681_4920_5243 107
1097 3300046691 Ga0495670_0560107 Ga0495670_0560107_164_487 107
1098 3300046692 Ga0495671_0002986 Ga0495671_0002986_6945_7268 107
1099 3300046692 Ga0495671_0003782 Ga0495671_0003782_1962_2285 107
1100 3300046692 Ga0495671_0004634 Ga0495671_0004634_31_354 107
1101 3300046692 Ga0495671_0035909 Ga0495671_0035909_1771_2094 107
1102 3300046694 Ga0495649_0177366 Ga0495649_0177366_501_824 107
1103 3300046694 Ga0495649_0518270 Ga0495649_0518270_16_339 107
1104 3300046794 Ga0495589_0003579 Ga0495589_0003579_931_1254 107
1105 3300046794 Ga0495589_0085799 Ga0495589_0085799_696_1034 107
1106 3300046794 Ga0495589_0527828 Ga0495589_0527828_94_417 107
1107 3300046809 Ga0495600_0048423 Ga0495600_0048423_1231_1554 107
1108 3300046810 Ga0495660_0000879 Ga0495660_0000879_10979_11302 107
1109 3300046810 Ga0495660_0059143 Ga0495660_0059143_726_1049 107
1110 3300047320 Ga0495672_0004648 Ga0495672_0004648_1023_1346 107
1111 3300047320 Ga0495672_0009343 Ga0495672_0009343_873_1196 107
1112 3300047320 Ga0495672_0045928 Ga0495672_0045928_2141_2464 107
1113 3300047320 Ga0495672_0073906 Ga0495672_0073906_65_388 107
1114 3300047320 Ga0495672_0258781 Ga0495672_0258781_95_418 107
1115 3300047322 Ga0495680_0019915 Ga0495680_0019915_3417_3740 107
1116 3300047322 Ga0495680_0592466 Ga0495680_0592466_184_507 107
1117 3300047323 Ga0495683_0000371 Ga0495683_0000371_14073_14396 107
1118 3300047323 Ga0495683_0020063 Ga0495683_0020063_842_1180 107
1119 3300047443 Ga0495687_011253 Ga0495687_011253_3778_4101 107
1120 3300047444 Ga0495675_0126005 Ga0495675_0126005_157_480 107
1121 3300047446 Ga0495679_001695 Ga0495679_001695_15_338 107
1122 3300047469 Ga0495673_0000441 Ga0495673_0000441_45060_45383 107
1123 3300047469 Ga0495673_0005418 Ga0495673_0005418_3481_3804 107
1124 3300047469 Ga0495673_0014278 Ga0495673_0014278_1144_1467 107
1125 3300047469 Ga0495673_0077839 Ga0495673_0077839_107_430 107
1126 3300047469 Ga0495673_0316127 Ga0495673_0316127_177_500 107
1127 3300047470 Ga0495681_0010196 Ga0495681_0010196_914_1237 107
1128 3300047470 Ga0495681_0012745 Ga0495681_0012745_235_558 107
1129 3300047472 Ga0495686_0215600 Ga0495686_0215600_718_1041 107
1130 3300048090 Ga0495615_0157045 Ga0495615_0157045_194_517 107
1131 3300048903 Ga0496100_0171274 Ga0496100_0171274_233_556 107
1132 3300048903 Ga0496100_0193835 Ga0496100_0193835_244_567 107
1133 3300048903 Ga0496100_0668261 Ga0496100_0668261_284_607 107
1134 3300048903 Ga0496100_1073885 Ga0496100_1073885_284_607 107
1135 3300048904 Ga0496101_0062886 Ga0496101_0062886_2046_2369 107
1136 3300048904 Ga0496101_0256566 Ga0496101_0256566_231_554 107
1137 3300048904 Ga0496101_0794622 Ga0496101_0794622_398_721 107
1138 3300048904 Ga0496101_0839608 Ga0496101_0839608_140_463 107
1139 3300048905 Ga0496102_0018568 Ga0496102_0018568_4750_5073 107
1140 3300048905 Ga0496102_0018878 Ga0496102_0018878_5203_5526 107
1141 3300048905 Ga0496102_0664196 Ga0496102_0664196_521_844 107
1142 3300048906 Ga0496103_0145762 Ga0496103_0145762_497_820 107
1143 3300048907 Ga0496104_0007534 Ga0496104_0007534_7827_8150 107
1144 3300048907 Ga0496104_0025932 Ga0496104_0025932_1330_1653 107
1145 3300048907 Ga0496104_0291973 Ga0496104_0291973_616_939 107
1146 3300048907 Ga0496104_0558271 Ga0496104_0558271_384_755 107
1147 3300048908 Ga0496105_0002244 Ga0496105_0002244_309_632 107
1148 3300048908 Ga0496105_0003869 Ga0496105_0003869_5113_5436 107
1149 3300048908 Ga0496105_1083126 Ga0496105_1083126_216_539 107
1150 3300048909 Ga0496106_0034846 Ga0496106_0034846_3362_3685 107
1151 3300048909 Ga0496106_0238810 Ga0496106_0238810_567_890 107
1152 3300048909 Ga0496106_0956057 Ga0496106_0956057_100_423 107
1153 3300048911 Ga0496108_0011729 Ga0496108_0011729_1603_1926 107
1154 3300048911 Ga0496108_0099406 Ga0496108_0099406_1811_2134 107
1155 3300048911 Ga0496108_0183338 Ga0496108_0183338_845_1168 107
1156 3300048911 Ga0496108_0521059 Ga0496108_0521059_249_572 107
1157 3300048912 Ga0496109_0019965 Ga0496109_0019965_264_587 107
1158 3300048913 Ga0496110_0009253 Ga0496110_0009253_6875_7198 107
1159 3300048913 Ga0496110_0013330 Ga0496110_0013330_27_350 107
1160 3300048913 Ga0496110_0186911 Ga0496110_0186911_307_630 107
1161 3300048913 Ga0496110_0247943 Ga0496110_0247943_1101_1424 107
1162 3300048913 Ga0496110_0258743 Ga0496110_0258743_648_971 107
1163 3300048914 Ga0496111_0004803 Ga0496111_0004803_7617_7940 107
1164 3300048914 Ga0496111_0287462 Ga0496111_0287462_270_593 107
1165 3300048914 Ga0496111_0297142 Ga0496111_0297142_492_815 107
1166 3300048914 Ga0496111_0321330 Ga0496111_0321330_35_358 107
1167 3300048915 Ga0496112_0139570 Ga0496112_0139570_692_1015 107
1168 3300048915 Ga0496112_0236066 Ga0496112_0236066_845_1168 107
1169 3300048915 Ga0496112_0408518 Ga0496112_0408518_930_1253 107
1170 3300048915 Ga0496112_1754343 Ga0496112_1754343_115_438 107
1171 3300048917 Ga0496114_0028572 Ga0496114_0028572_826_1149 107
1172 3300048917 Ga0496114_0040475 Ga0496114_0040475_1149_1472 107
1173 3300048917 Ga0496114_0084456 Ga0496114_0084456_1919_2242 107
1174 3300048917 Ga0496114_0489139 Ga0496114_0489139_656_979 107
1175 3300048918 Ga0496115_0082741 Ga0496115_0082741_718_1041 107
1176 3300048918 Ga0496115_0127308 Ga0496115_0127308_1251_1574 107
1177 3300048918 Ga0496115_1300079 Ga0496115_1300079_155_478 107
1178 3300048919 Ga0496116_0008971 Ga0496116_0008971_1851_2174 107
1179 3300048919 Ga0496116_0016264 Ga0496116_0016264_542_865 107
1180 3300048919 Ga0496116_0020453 Ga0496116_0020453_4136_4459 107
1181 3300048920 Ga0496117_0000054 Ga0496117_0000054_92417_92740 107
1182 3300048920 Ga0496117_0000334 Ga0496117_0000334_71636_71959 107
1183 3300048920 Ga0496117_0000798 Ga0496117_0000798_36915_37238 107
1184 3300048920 Ga0496117_0006004 Ga0496117_0006004_12137_12460 107
1185 3300048920 Ga0496117_0017273 Ga0496117_0017273_2799_3122 107
1186 3300048920 Ga0496117_0057179 Ga0496117_0057179_770_1093 107
1187 3300048920 Ga0496117_0096534 Ga0496117_0096534_624_947 107
1188 3300048921 Ga0496118_0000045 Ga0496118_0000045_88175_88498 107
1189 3300048921 Ga0496118_0003619 Ga0496118_0003619_6728_7051 107
1190 3300048921 Ga0496118_0006724 Ga0496118_0006724_9078_9401 107
1191 3300048921 Ga0496118_0013622 Ga0496118_0013622_7200_7523 107
1192 3300048921 Ga0496118_0028632 Ga0496118_0028632_2918_3241 107
1193 3300048921 Ga0496118_0057707 Ga0496118_0057707_1979_2302 107
1194 3300048921 Ga0496118_0063473 Ga0496118_0063473_562_885 107
1195 3300048921 Ga0496118_0168475 Ga0496118_0168475_419_742 107
1196 3300048921 Ga0496118_0464672 Ga0496118_0464672_18_341 107
1197 3300048922 Ga0496119_0000380 Ga0496119_0000380_13618_13941 107
1198 3300048922 Ga0496119_0007592 Ga0496119_0007592_232_555 107
1199 3300048922 Ga0496119_0015657 Ga0496119_0015657_508_831 107
1200 3300048922 Ga0496119_0145844 Ga0496119_0145844_330_653 107
1201 3300048922 Ga0496119_0264672 Ga0496119_0264672_255_578 107
1202 3300048923 Ga0496120_0000570 Ga0496120_0000570_36915_37238 107
1203 3300048923 Ga0496120_0002710 Ga0496120_0002710_13081_13404 107
1204 3300048923 Ga0496120_0113063 Ga0496120_0113063_610_933 107
1205 3300048923 Ga0496120_0190249 Ga0496120_0190249_212_535 107
1206 3300048923 Ga0496120_0294816 Ga0496120_0294816_74_397 107
1207 3300048924 Ga0496121_0002897 Ga0496121_0002897_22735_23058 107
1208 3300048924 Ga0496121_0004919 Ga0496121_0004919_3226_3549 107
1209 3300048924 Ga0496121_0015841 Ga0496121_0015841_6100_6423 107
1210 3300048924 Ga0496121_0020386 Ga0496121_0020386_3147_3470 107
1211 3300048924 Ga0496121_0064016 Ga0496121_0064016_1942_2265 107
1212 3300048924 Ga0496121_0072566 Ga0496121_0072566_39_362 107
1213 3300048924 Ga0496121_0125269 Ga0496121_0125269_1029_1352 107
1214 3300048924 Ga0496121_0161763 Ga0496121_0161763_305_628 107
1215 3300048924 Ga0496121_0200859 Ga0496121_0200859_343_666 107
1216 3300048925 Ga0496122_0002009 Ga0496122_0002009_5388_5711 107
1217 3300048925 Ga0496122_0002614 Ga0496122_0002614_24810_25133 107
1218 3300048925 Ga0496122_0027322 Ga0496122_0027322_1409_1732 107
1219 3300048925 Ga0496122_0028114 Ga0496122_0028114_2611_2934 107
1220 3300048925 Ga0496122_0164164 Ga0496122_0164164_31_354 107
1221 3300048925 Ga0496122_0293928 Ga0496122_0293928_133_456 107
1222 3300048926 Ga0496123_0000706 Ga0496123_0000706_28783_29106 107
1223 3300048926 Ga0496123_0001758 Ga0496123_0001758_411_734 107
1224 3300048926 Ga0496123_0029385 Ga0496123_0029385_2017_2340 107
1225 3300048926 Ga0496123_0063671 Ga0496123_0063671_1137_1460 107
1226 3300048926 Ga0496123_0069050 Ga0496123_0069050_48_371 107
1227 3300048926 Ga0496123_0240888 Ga0496123_0240888_503_826 107
1228 3300048927 Ga0496124_0000132 Ga0496124_0000132_13897_14220 107
1229 3300048927 Ga0496124_0001105 Ga0496124_0001105_19142_19465 107
1230 3300048927 Ga0496124_0013196 Ga0496124_0013196_2441_2764 107
1231 3300048927 Ga0496124_0015927 Ga0496124_0015927_2819_3142 107
1232 3300048927 Ga0496124_0017522 Ga0496124_0017522_5439_5762 107
1233 3300048927 Ga0496124_0030811 Ga0496124_0030811_3202_3525 107
1234 3300048927 Ga0496124_0031893 Ga0496124_0031893_2940_3263 107
1235 3300048927 Ga0496124_0152550 Ga0496124_0152550_1288_1611 107
1236 3300048927 Ga0496124_0220087 Ga0496124_0220087_1041_1364 107
1237 3300048927 Ga0496124_0275591 Ga0496124_0275591_767_1105 107
1238 3300048927 Ga0496124_0491235 Ga0496124_0491235_414_737 107
1239 3300048927 Ga0496124_0519930 Ga0496124_0519930_46_369 107
1240 3300048928 Ga0496125_0001279 Ga0496125_0001279_15916_16239 107
1241 3300048928 Ga0496125_0006982 Ga0496125_0006982_11744_12067 107
1242 3300048928 Ga0496125_0007611 Ga0496125_0007611_2671_2994 107
1243 3300048928 Ga0496125_0019903 Ga0496125_0019903_1356_1679 107
1244 3300048928 Ga0496125_0038453 Ga0496125_0038453_3754_4077 107
1245 3300048928 Ga0496125_0190724 Ga0496125_0190724_896_1219 107
1246 3300048928 Ga0496125_0378962 Ga0496125_0378962_308_631 107
1247 3300048928 Ga0496125_0512480 Ga0496125_0512480_50_373 107
1248 3300048929 Ga0496126_0025805 Ga0496126_0025805_631_954 107
1249 3300048929 Ga0496126_0051230 Ga0496126_0051230_562_885 107
1250 3300048929 Ga0496126_0081305 Ga0496126_0081305_52_375 107
1251 3300048929 Ga0496126_0085051 Ga0496126_0085051_350_673 107
1252 3300048929 Ga0496126_0202568 Ga0496126_0202568_133_456 107
1253 3300048929 Ga0496126_0298740 Ga0496126_0298740_321_644 107
1254 3300049459 Ga0495678_000536 Ga0495678_000536_14109_14432 107
1255 3300049459 Ga0495678_001447 Ga0495678_001447_4344_4667 107
1256 3300049459 Ga0495678_024441 Ga0495678_024441_1365_1688 107
1257 3300049460 Ga0495682_0000613 Ga0495682_0000613_12688_13011 107
1258 3300049460 Ga0495682_0000919 Ga0495682_0000919_13601_13924 107
1259 3300049568 Ga0501031_0203939 Ga0501031_0203939_909_1268 107
1260 3300049569 Ga0501032_0202959 Ga0501032_0202959_71_430 107
1261 3300049570 Ga0501033_0029032 Ga0501033_0029032_3583_3906 107
1262 3300049570 Ga0501033_0169901 Ga0501033_0169901_279_638 107
1263 3300049571 Ga0501034_0000692 Ga0501034_0000692_26243_26566 107
1264 3300049571 Ga0501034_0535090 Ga0501034_0535090_218_541 107
1265 3300049572 Ga0501036_0074554 Ga0501036_0074554_1067_1426 107
1266 3300049572 Ga0501036_0738013 Ga0501036_0738013_19_342 107
1267 3300049572 Ga0501036_1348958 Ga0501036_1348958_13_336 107
1268 3300049573 Ga0501037_0899304 Ga0501037_0899304_34_393 107
1269 3300049574 Ga0501038_0151006 Ga0501038_0151006_444_803 107
1270 3300049575 Ga0501039_1245585 Ga0501039_1245585_72_395 107
1271 3300049576 Ga0501040_0017931 Ga0501040_0017931_4140_4499 107
1272 3300049576 Ga0501040_0239186 Ga0501040_0239186_770_1093 107
1273 3300049577 Ga0501041_0062832 Ga0501041_0062832_1052_1411 107
1274 3300049577 Ga0501041_0186805 Ga0501041_0186805_92_415 107
1275 3300049578 Ga0501042_0011940 Ga0501042_0011940_1778_2137 107
1276 3300049578 Ga0501042_0153347 Ga0501042_0153347_402_725 107
1277 3300049578 Ga0501042_1122685 Ga0501042_1122685_202_525 107
1278 3300049579 Ga0501043_0331124 Ga0501043_0331124_35_358 107
1279 3300049579 Ga0501043_0578753 Ga0501043_0578753_409_768 107
1280 3300049579 Ga0501043_0945438 Ga0501043_0945438_155_478 107
1281 3300049580 Ga0501046_0105464 Ga0501046_0105464_784_1107 107
1282 3300049580 Ga0501046_0155892 Ga0501046_0155892_1018_1377 107
1283 3300049581 Ga0501047_0050139 Ga0501047_0050139_2357_2680 107
1284 3300049581 Ga0501047_0165008 Ga0501047_0165008_236_559 107
1285 3300049581 Ga0501047_0340257 Ga0501047_0340257_483_806 107
1286 3300049581 Ga0501047_0459646 Ga0501047_0459646_10_333 107
1287 3300049581 Ga0501047_0654394 Ga0501047_0654394_433_756 107
1288 3300049581 Ga0501047_1239098 Ga0501047_1239098_146_469 107
1289 3300049582 Ga0501048_0023751 Ga0501048_0023751_2012_2371 107
1290 3300049582 Ga0501048_0865272 Ga0501048_0865272_55_378 107
1291 3300049583 Ga0501067_0006809 Ga0501067_0006809_2137_2460 107
1292 3300049584 Ga0501068_0002793 Ga0501068_0002793_8921_9244 107
1293 3300049584 Ga0501068_0608237 Ga0501068_0608237_207_566 107
1294 3300049585 Ga0501069_0867641 Ga0501069_0867641_35_358 107
1295 3300049586 Ga0501070_0007573 Ga0501070_0007573_2672_2995 107
1296 3300049586 Ga0501070_0063793 Ga0501070_0063793_2450_2809 107
1297 3300049587 Ga0501071_0001833 Ga0501071_0001833_6046_6405 107
1298 3300049587 Ga0501071_0009669 Ga0501071_0009669_651_974 107
1299 3300049588 Ga0501072_0035416 Ga0501072_0035416_2430_2789 107
1300 3300049588 Ga0501072_0049556 Ga0501072_0049556_2075_2398 107
1301 3300049588 Ga0501072_0433281 Ga0501072_0433281_566_889 107
1302 3300049589 Ga0501073_0000472 Ga0501073_0000472_7580_7903 107
1303 3300049589 Ga0501073_0433941 Ga0501073_0433941_399_758 107
1304 3300049590 Ga0501074_0002836 Ga0501074_0002836_7597_7920 107
1305 3300049590 Ga0501074_0036301 Ga0501074_0036301_3110_3469 107
1306 3300049591 Ga0501075_0000792 Ga0501075_0000792_7774_8097 107
1307 3300049591 Ga0501075_0014752 Ga0501075_0014752_1552_1911 107
1308 3300049592 Ga0501076_0007783 Ga0501076_0007783_3744_4067 107
1309 3300049592 Ga0501076_0035980 Ga0501076_0035980_1665_2024 107
1310 3300049592 Ga0501076_0384431 Ga0501076_0384431_782_1105 107
1311 3300049593 Ga0501077_0000280 Ga0501077_0000280_15800_16123 107
1312 3300049593 Ga0501077_0171032 Ga0501077_0171032_774_1133 107
1313 3300049667 Ga0501230_040204 Ga0501230_040204_162_485 107
1314 3300049741 Ga0501079_0001080 Ga0501079_0001080_11437_11760 107
1315 3300049741 Ga0501079_0021711 Ga0501079_0021711_3666_4025 107
1316 3300049742 Ga0501080_0013669 Ga0501080_0013669_2283_2606 107
1317 3300049742 Ga0501080_0072108 Ga0501080_0072108_1903_2262 107
1318 3300049744 Ga0501083_0014663 Ga0501083_0014663_946_1269 107
1319 3300049744 Ga0501083_0048506 Ga0501083_0048506_743_1102 107
1320 3300049744 Ga0501083_0491604 Ga0501083_0491604_74_463 107
1321 3300049822 Ga0501035_0675812 Ga0501035_0675812_357_680 107
1322 3300049823 Ga0501044_0000745 Ga0501044_0000745_12790_13113 107
1323 3300049823 Ga0501044_1081409 Ga0501044_1081409_59_382 107
1324 3300049824 Ga0501045_0013215 Ga0501045_0013215_1158_1517 107
1325 3300049853 Ga0501226_000010 Ga0501226_000010_115488_115811 107
1326 3300050491 nmdc:mga00v17_6749_c1 nmdc:mga00v17_6749_c1_2795_3118 107
1327 3300050493 nmdc:mga0k408_321371_c1 nmdc:mga0k408_321371_c1_199_573 107
1328 3300050493 nmdc:mga0k408_653060_c1 nmdc:mga0k408_653060_c1_172_495 107
1329 3300050507 nmdc:mga05p37_22213_c1 nmdc:mga05p37_22213_c1_4194_4517 107
1330 3300050507 nmdc:mga05p37_37857_c1 nmdc:mga05p37_37857_c1_737_1060 107
1331 3300050508 nmdc:mga09592_199515_c1 nmdc:mga09592_199515_c1_1399_1722 107
1332 3300050508 nmdc:mga09592_6806_c1 nmdc:mga09592_6806_c1_926_1249 107
1333 3300050508 nmdc:mga09592_777742_c1 nmdc:mga09592_777742_c1_435_758 107
1334 3300050508 nmdc:mga09592_895930_c1 nmdc:mga09592_895930_c1_35_358 107
1335 3300050509 nmdc:mga0qj67_100942_c1 nmdc:mga0qj67_100942_c1_647_970 107
1336 3300050509 nmdc:mga0qj67_187552_c1 nmdc:mga0qj67_187552_c1_1124_1447 107
1337 3300050509 nmdc:mga0qj67_188850_c1 nmdc:mga0qj67_188850_c1_163_486 107
1338 3300050509 nmdc:mga0qj67_201016_c1 nmdc:mga0qj67_201016_c1_780_1103 107
1339 3300050510 nmdc:mga06r32_22391_c1 nmdc:mga06r32_22391_c1_4445_4768 107
1340 3300050510 nmdc:mga06r32_328139_c1 nmdc:mga06r32_328139_c1_33_356 107
1341 3300050510 nmdc:mga06r32_747_c1 nmdc:mga06r32_747_c1_19958_20281 107
1342 3300050510 nmdc:mga06r32_7750_c2 nmdc:mga06r32_7750_c2_2033_2356 107
1343 3300050511 nmdc:mga08y16_104026_c1 nmdc:mga08y16_104026_c1_1496_1819 107
1344 3300050511 nmdc:mga08y16_1066236_c1 nmdc:mga08y16_1066236_c1_177_500 107
1345 3300050511 nmdc:mga08y16_1255_c1 nmdc:mga08y16_1255_c1_12189_12512 107
1346 3300050511 nmdc:mga08y16_1641422_c1 nmdc:mga08y16_1641422_c1_62_385 107
1347 3300050511 nmdc:mga08y16_211735_c1 nmdc:mga08y16_211735_c1_400_723 107
1348 3300050511 nmdc:mga08y16_71923_c1 nmdc:mga08y16_71923_c1_2344_2667 107
1349 3300050511 nmdc:mga08y16_7261_c1 nmdc:mga08y16_7261_c1_2470_2793 107
1350 3300050511 nmdc:mga08y16_899876_c1 nmdc:mga08y16_899876_c1_484_807 107
1351 3300050512 nmdc:mga0n895_565258_c1 nmdc:mga0n895_565258_c1_800_1123 107
1352 3300050513 nmdc:mga0rr50_1357398_c1 nmdc:mga0rr50_1357398_c1_143_466 107
1353 3300050513 nmdc:mga0rr50_32375_c1 nmdc:mga0rr50_32375_c1_1930_2253 107
1354 3300050514 nmdc:mga08x19_217959_c1 nmdc:mga08x19_217959_c1_205_528 107
1355 3300050515 nmdc:mga0a205_557015_c1 nmdc:mga0a205_557015_c1_56_379 107
1356 3300050515 nmdc:mga0a205_88566_c1 nmdc:mga0a205_88566_c1_2550_2873 107
1357 3300053077 Ga0495601_0312189 Ga0495601_0312189_569_892 107
1358 3300053088 Ga0500644_0062975 Ga0500644_0062975_287_610 107
1359 3300053088 Ga0500644_0100029 Ga0500644_0100029_86_409 107
1360 3300053092 Ga0500583_0058297 Ga0500583_0058297_1167_1490 107
1361 3300053092 Ga0500583_0073042 Ga0500583_0073042_570_893 107
1362 3300053092 Ga0500583_0301270 Ga0500583_0301270_101_424 107
1363 3300053092 Ga0500583_0396594 Ga0500583_0396594_63_386 107
1364 3300053098 Ga0500650_0058300 Ga0500650_0058300_813_1136 107
1365 3300053104 Ga0500556_0000442 Ga0500556_0000442_25560_25883 107
1366 3300053111 Ga0500572_065710 Ga0500572_065710_112_435 107
1367 3300053115 Ga0500591_030876 Ga0500591_030876_2077_2400 107
1368 3300053119 Ga0500595_027112 Ga0500595_027112_1304_1627 107
1369 3300053134 Ga0500658_0080346 Ga0500658_0080346_1008_1331 107
1370 3300053134 Ga0500658_0114697 Ga0500658_0114697_577_900 107
1371 3300053135 Ga0500659_0001435 Ga0500659_0001435_13817_14140 107
1372 3300053136 Ga0500559_0252268 Ga0500559_0252268_150_473 107
1373 3300053146 Ga0500588_0005174 Ga0500588_0005174_156_479 107
1374 3300053148 Ga0500590_239218 Ga0500590_239218_335_658 107
1375 3300053153 Ga0500616_0000018 Ga0500616_0000018_50188_50511 107
1376 3300053153 Ga0500616_0132122 Ga0500616_0132122_118_441 107
1377 3300053156 Ga0500622_0004527 Ga0500622_0004527_2343_2666 107
1378 3300053156 Ga0500622_0420657 Ga0500622_0420657_10_333 107
1379 3300053158 Ga0500627_0191709 Ga0500627_0191709_69_392 107
1380 3300053158 Ga0500627_0293718 Ga0500627_0293718_194_517 107
1381 3300053161 Ga0500634_0000047 Ga0500634_0000047_14122_14445 107
1382 3300053178 Ga0500637_0100378 Ga0500637_0100378_102_425 107
1383 3300053178 Ga0500637_0100441 Ga0500637_0100441_916_1239 107
1384 3300054114 Ga0501084_0001292 Ga0501084_0001292_7583_7906 107
1385 3300054114 Ga0501084_0093387 Ga0501084_0093387_421_780 107
1386 3300059424 Ga0590075_136468 Ga0590075_136468_160_483 107
1387 3300059510 Ga0587090_120295 Ga0587090_120295_148_471 107
1388 3300060344 Ga0587071_165880 Ga0587071_165880_69_392 107
1389 3300060353 Ga0501082_0025328 Ga0501082_0025328_942_1265 107
1390 3300060353 Ga0501082_0314316 Ga0501082_0314316_628_987 107
1391 3300060353 Ga0501082_0456958 Ga0501082_0456958_316_639 107
1392 3300061719 Ga0466962_0001556 Ga0466962_0001556_6299_6622 107
1393 3300061719 Ga0466962_0386845 Ga0466962_0386845_230_553 107
1394 3300061734 Ga0530510_0142376 Ga0530510_0142376_1028_1387 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11953

DUF3470

Domain of unknown function (DUF3470)

64

105

0.98

PF00037

Fer4

4Fe-4S binding domain

33

56

0.95

PF12800

Fer4_4

4Fe-4S binding domain

37

64

0.94

PF12800

Fer4_4

4Fe-4S binding domain

6

24

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1frl-assembly1.cif.gz_A azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential 0.9974 2 107
1frx-assembly1.cif.gz_A structure and properties of c20s fdi mutant 0.9974 2 107
1frk-assembly1.cif.gz_A azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential 0.9972 2 107
1g6b-assembly1.cif.gz_A crystal structure of p47s mutant of ferredoxin i 0.9971 2 107
1frh-assembly1.cif.gz_A azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential 0.9971 2 107
ID Description Score Start End Superfamily
1ftcB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.993 2 107 3.30.70.20
af_O50433_2_106_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9862 2 73 3.30.70.20
1ftcB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9837 2 107 3.30.70.20
1h98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9708 3 77 3.30.70.20
1h98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9344 3 77 3.30.70.20

Feature Viewer

pLDDT pTM Quality
95.65 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map