F493616
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1394 | 546 | 1394 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300031712|Ga0265342_10159148|Ga0265342_101591483 |
| Length | 112 |
| Sequence | MTYVVTEACIKCKFMDCVEVCPVDCFYEGDNMLVIHPDECIDCGVCEPECPPEAIKADTEPGLEKWLTLNADYAKKWPNITQHGTAPADAKEWEGVPDKFEKYFSDKPGSGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 100 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 101 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 140 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 227 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 241 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 242 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 243 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 244 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 245 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 246 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 254 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 256 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 258 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 262 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 263 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 264 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 265 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 267 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 268 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 269 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 271 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 272 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 273 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 274 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 278 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 279 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 280 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 281 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 283 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 284 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 285 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 286 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 287 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 288 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 289 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 290 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 292 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 300 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 302 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 304 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 306 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 310 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 311 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 312 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 313 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 314 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 315 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 316 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 318 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 319 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 321 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 322 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 323 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 324 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 325 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 326 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 327 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 328 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 329 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 330 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 331 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 332 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 333 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 334 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 335 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 336 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 343 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 344 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 345 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 346 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 347 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 348 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 349 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 350 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 351 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 352 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 353 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 354 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 355 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 356 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 357 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 358 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 359 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 360 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 361 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 362 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 363 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 364 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 365 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 366 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 367 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 368 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 369 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 370 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 371 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 372 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 373 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 374 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 375 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 376 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 377 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 378 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 379 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 380 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 381 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 382 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 383 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 384 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 385 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 386 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 387 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 388 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 389 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 390 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 391 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 392 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 393 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 394 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 395 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 396 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 397 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 452 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 453 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 454 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 455 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 456 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 457 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 458 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 459 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 460 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 461 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 462 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 463 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 464 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 465 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 466 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 467 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 468 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 469 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 470 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 471 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 472 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 473 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 474 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 475 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 504 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 511 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 512 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 513 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 515 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 525 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 526 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 528 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 529 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 530 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 531 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 532 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 533 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 534 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 535 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 536 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 537 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 539 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 540 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 542 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 546 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.13 |
| Metatranscriptomes | 1.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.73 |
| Nodule | 0.65 |
| Rhizoplane | 5.09 |
| Rhizosphere | 82.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000614 | 3300001979 | Bacteria | 15414 |
| 2 | JGI24737J22298_10189215 | 3300001990 | Bacteria | 608 |
| 3 | JGI24750J21931_1095797 | 3300002070 | Bacteria | 506 |
| 4 | JGI25164J39214_1000233 | 3300002772 | Bacteria | 42959 |
| 5 | JGI25159J45721_1041751 | 3300002987 | Bacteria | 666 |
| 6 | JGI25165J46597_1000429 | 3300003214 | Bacteria | 42959 |
| 7 | rootH2_10087634 | 3300003320 | Bacteria | 3176 |
| 8 | rootH1_10043132 | 3300003323 | Bacteria | 15980 |
| 9 | Ga0055536_1003442 | 3300003781 | Bacteria | 8490 |
| 10 | Ga0055530_10008951 | 3300003791 | Bacteria | 3919 |
| 11 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 12 | Ga0058692_1023840 | 3300003856 | Bacteria | 1236 |
| 13 | Ga0058861_10025803 | 3300004800 | Bacteria | 1435 |
| 14 | Ga0058861_11712684 | 3300004800 | Bacteria | 1582 |
| 15 | Ga0058862_10005162 | 3300004803 | Bacteria | 1313 |
| 16 | Ga0058862_12825507 | 3300004803 | Bacteria | 1206 |
| 17 | Ga0065714_10308955 | 3300005288 | Bacteria | 684 |
| 18 | Ga0065704_10071016 | 3300005289 | Bacteria | 13755 |
| 19 | Ga0065704_10071509 | 3300005289 | Bacteria | 10859 |
| 20 | Ga0065704_10140192 | 3300005289 | Bacteria | 1525 |
| 21 | Ga0065712_10068274 | 3300005290 | Bacteria | 12260 |
| 22 | Ga0065712_10765609 | 3300005290 | Bacteria | 523 |
| 23 | Ga0065715_10180944 | 3300005293 | Bacteria | 1477 |
| 24 | Ga0070658_11157558 | 3300005327 | Bacteria | 673 |
| 25 | Ga0070676_10056207 | 3300005328 | Bacteria | 2325 |
| 26 | Ga0070676_10165226 | 3300005328 | Bacteria | 1428 |
| 27 | Ga0070676_10827543 | 3300005328 | Bacteria | 685 |
| 28 | Ga0070683_100023117 | 3300005329 | Bacteria | 5558 |
| 29 | Ga0070683_100252598 | 3300005329 | Bacteria | 1677 |
| 30 | Ga0070683_101273836 | 3300005329 | Bacteria | 707 |
| 31 | Ga0070690_100001135 | 3300005330 | Bacteria | 13691 |
| 32 | Ga0070690_100234733 | 3300005330 | Bacteria | 1291 |
| 33 | Ga0070690_101101741 | 3300005330 | Bacteria | 630 |
| 34 | Ga0070670_100013647 | 3300005331 | Bacteria | 6963 |
| 35 | Ga0070670_100020260 | 3300005331 | Bacteria | 5714 |
| 36 | Ga0070677_10063923 | 3300005333 | Bacteria | 1527 |
| 37 | Ga0070677_10109587 | 3300005333 | Bacteria | 1230 |
| 38 | Ga0068869_100004548 | 3300005334 | Bacteria | 8636 |
| 39 | Ga0068869_100025083 | 3300005334 | Bacteria | 4136 |
| 40 | Ga0068869_100102931 | 3300005334 | Bacteria | 2163 |
| 41 | Ga0068869_100263008 | 3300005334 | Bacteria | 1382 |
| 42 | Ga0070666_10039031 | 3300005335 | Bacteria | 3162 |
| 43 | Ga0070666_10093981 | 3300005335 | Bacteria | 2062 |
| 44 | Ga0070666_10236255 | 3300005335 | Bacteria | 1292 |
| 45 | Ga0070680_100005582 | 3300005336 | Bacteria | 9528 |
| 46 | Ga0070680_100028070 | 3300005336 | Bacteria | 4512 |
| 47 | Ga0070680_100433747 | 3300005336 | Bacteria | 1122 |
| 48 | Ga0068868_101101109 | 3300005338 | Bacteria | 731 |
| 49 | Ga0070660_100220930 | 3300005339 | Bacteria | 1540 |
| 50 | Ga0070660_100240216 | 3300005339 | Bacteria | 1475 |
| 51 | Ga0070689_100005128 | 3300005340 | Bacteria | 8907 |
| 52 | Ga0070689_100222109 | 3300005340 | Bacteria | 1550 |
| 53 | Ga0070689_101220077 | 3300005340 | Bacteria | 675 |
| 54 | Ga0070687_100148833 | 3300005343 | Bacteria | 1372 |
| 55 | Ga0070687_101286316 | 3300005343 | Bacteria | 543 |
| 56 | Ga0070661_100006281 | 3300005344 | Bacteria | 8197 |
| 57 | Ga0070661_100072694 | 3300005344 | Bacteria | 2531 |
| 58 | Ga0070661_100460410 | 3300005344 | Bacteria | 1013 |
| 59 | Ga0070661_100916223 | 3300005344 | Bacteria | 724 |
| 60 | Ga0070692_10041291 | 3300005345 | Bacteria | 2362 |
| 61 | Ga0070668_100032136 | 3300005347 | Bacteria | 3994 |
| 62 | Ga0070668_100199395 | 3300005347 | Bacteria | 1643 |
| 63 | Ga0070669_100006519 | 3300005353 | Bacteria | 8406 |
| 64 | Ga0070669_100025413 | 3300005353 | Bacteria | 4253 |
| 65 | Ga0070669_100641708 | 3300005353 | Bacteria | 893 |
| 66 | Ga0070669_100880817 | 3300005353 | Bacteria | 764 |
| 67 | Ga0070675_100000783 | 3300005354 | Bacteria | 22262 |
| 68 | Ga0070675_100720782 | 3300005354 | Bacteria | 909 |
| 69 | Ga0070671_100000128 | 3300005355 | Bacteria | 48658 |
| 70 | Ga0070671_100011096 | 3300005355 | Bacteria | 7235 |
| 71 | Ga0070671_100030200 | 3300005355 | Bacteria | 4472 |
| 72 | Ga0070671_100575964 | 3300005355 | Bacteria | 972 |
| 73 | Ga0070674_100113366 | 3300005356 | Bacteria | 1994 |
| 74 | Ga0070674_100994786 | 3300005356 | Bacteria | 736 |
| 75 | Ga0070673_100000798 | 3300005364 | Bacteria | 17558 |
| 76 | Ga0070673_100028839 | 3300005364 | Bacteria | 4133 |
| 77 | Ga0070673_100399339 | 3300005364 | Bacteria | 1229 |
| 78 | Ga0070667_100004527 | 3300005367 | Bacteria | 11706 |
| 79 | Ga0070667_100011814 | 3300005367 | Bacteria | 7219 |
| 80 | Ga0070667_100067453 | 3300005367 | Bacteria | 3042 |
| 81 | Ga0070667_100120972 | 3300005367 | Bacteria | 2277 |
| 82 | Ga0070667_100207680 | 3300005367 | Bacteria | 1740 |
| 83 | Ga0070667_100730775 | 3300005367 | Bacteria | 917 |
| 84 | Ga0070667_100764918 | 3300005367 | Bacteria | 896 |
| 85 | Ga0070703_10571961 | 3300005406 | Bacteria | 518 |
| 86 | Ga0070709_10011768 | 3300005434 | Bacteria | 4885 |
| 87 | Ga0070709_11487438 | 3300005434 | Bacteria | 550 |
| 88 | Ga0070714_100011747 | 3300005435 | Bacteria | 6958 |
| 89 | Ga0070714_100665812 | 3300005435 | Bacteria | 1003 |
| 90 | Ga0070713_100020371 | 3300005436 | Bacteria | 5084 |
| 91 | Ga0070713_100751983 | 3300005436 | Bacteria | 933 |
| 92 | Ga0070710_10096327 | 3300005437 | Bacteria | 1754 |
| 93 | Ga0070701_10030430 | 3300005438 | Bacteria | 2671 |
| 94 | Ga0070701_10146729 | 3300005438 | Bacteria | 1355 |
| 95 | Ga0070701_10397767 | 3300005438 | Bacteria | 872 |
| 96 | Ga0070711_100008522 | 3300005439 | Bacteria | 6285 |
| 97 | Ga0070711_100093293 | 3300005439 | Bacteria | 2173 |
| 98 | Ga0070705_100380600 | 3300005440 | Bacteria | 1038 |
| 99 | Ga0070700_100017048 | 3300005441 | Bacteria | 4148 |
| 100 | Ga0070700_100374019 | 3300005441 | Bacteria | 1063 |
| 101 | Ga0070700_100511093 | 3300005441 | Bacteria | 926 |
| 102 | Ga0070694_100422181 | 3300005444 | Bacteria | 1048 |
| 103 | Ga0070663_100159520 | 3300005455 | Bacteria | 1735 |
| 104 | Ga0070663_100254999 | 3300005455 | Bacteria | 1389 |
| 105 | Ga0070678_100314308 | 3300005456 | Bacteria | 1336 |
| 106 | Ga0070678_100526193 | 3300005456 | Bacteria | 1047 |
| 107 | Ga0070662_100004248 | 3300005457 | Bacteria | 9031 |
| 108 | Ga0070662_100058751 | 3300005457 | Bacteria | 2800 |
| 109 | Ga0070681_10004251 | 3300005458 | Bacteria | 13576 |
| 110 | Ga0070681_10013207 | 3300005458 | Bacteria | 8206 |
| 111 | Ga0070681_11449828 | 3300005458 | Bacteria | 611 |
| 112 | Ga0068867_100018889 | 3300005459 | Bacteria | 4905 |
| 113 | Ga0068867_100101694 | 3300005459 | Bacteria | 2196 |
| 114 | Ga0068867_101196437 | 3300005459 | Bacteria | 698 |
| 115 | Ga0068867_102111177 | 3300005459 | Bacteria | 534 |
| 116 | Ga0068867_102412295 | 3300005459 | Bacteria | 501 |
| 117 | Ga0070685_10016903 | 3300005466 | Bacteria | 3894 |
| 118 | Ga0070685_11404084 | 3300005466 | Bacteria | 536 |
| 119 | Ga0070679_100005951 | 3300005530 | Bacteria | 11343 |
| 120 | Ga0070679_100010434 | 3300005530 | Bacteria | 8812 |
| 121 | Ga0070679_100235067 | 3300005530 | Bacteria | 1792 |
| 122 | Ga0070679_101869794 | 3300005530 | Bacteria | 549 |
| 123 | Ga0070684_100000603 | 3300005535 | Bacteria | 24797 |
| 124 | Ga0070684_100015751 | 3300005535 | Bacteria | 6170 |
| 125 | Ga0070684_100870083 | 3300005535 | Bacteria | 844 |
| 126 | Ga0070684_101487875 | 3300005535 | Bacteria | 638 |
| 127 | Ga0068853_100049140 | 3300005539 | Bacteria | 3624 |
| 128 | Ga0068853_100418357 | 3300005539 | Bacteria | 1256 |
| 129 | Ga0070672_100007042 | 3300005543 | Bacteria | 7603 |
| 130 | Ga0070672_100297638 | 3300005543 | Bacteria | 1367 |
| 131 | Ga0070672_100428930 | 3300005543 | Bacteria | 1136 |
| 132 | Ga0070695_100818713 | 3300005545 | Bacteria | 747 |
| 133 | Ga0070696_100000044 | 3300005546 | Bacteria | 57075 |
| 134 | Ga0070696_100838276 | 3300005546 | Bacteria | 759 |
| 135 | Ga0070693_100057425 | 3300005547 | Bacteria | 2250 |
| 136 | Ga0070693_100638643 | 3300005547 | Bacteria | 773 |
| 137 | Ga0070665_100007432 | 3300005548 | Bacteria | 11140 |
| 138 | Ga0070665_100015200 | 3300005548 | Bacteria | 7729 |
| 139 | Ga0070665_100027147 | 3300005548 | Bacteria | 5766 |
| 140 | Ga0070665_100029015 | 3300005548 | Bacteria | 5569 |
| 141 | Ga0070665_100031259 | 3300005548 | Bacteria | 5358 |
| 142 | Ga0070665_100059767 | 3300005548 | Bacteria | 3821 |
| 143 | Ga0070665_100080808 | 3300005548 | Bacteria | 3256 |
| 144 | Ga0070665_100191491 | 3300005548 | Bacteria | 2046 |
| 145 | Ga0070665_100212550 | 3300005548 | Bacteria | 1935 |
| 146 | Ga0070665_101204961 | 3300005548 | Bacteria | 768 |
| 147 | Ga0068855_100000552 | 3300005563 | Bacteria | 45993 |
| 148 | Ga0068855_100001462 | 3300005563 | Bacteria | 29490 |
| 149 | Ga0068855_100001706 | 3300005563 | Bacteria | 27486 |
| 150 | Ga0068855_100354907 | 3300005563 | Bacteria | 1614 |
| 151 | Ga0068855_101286227 | 3300005563 | Bacteria | 757 |
| 152 | Ga0070664_100000712 | 3300005564 | Bacteria | 25469 |
| 153 | Ga0070664_100017162 | 3300005564 | Bacteria | 5943 |
| 154 | Ga0070664_100174452 | 3300005564 | Bacteria | 1908 |
| 155 | Ga0070664_100388368 | 3300005564 | Bacteria | 1275 |
| 156 | Ga0070664_101760174 | 3300005564 | Bacteria | 588 |
| 157 | Ga0068857_100006602 | 3300005577 | Bacteria | 9963 |
| 158 | Ga0068857_100294934 | 3300005577 | Bacteria | 1494 |
| 159 | Ga0068857_100323023 | 3300005577 | Bacteria | 1426 |
| 160 | Ga0068854_100132014 | 3300005578 | Bacteria | 1908 |
| 161 | Ga0068854_100476074 | 3300005578 | Bacteria | 1048 |
| 162 | Ga0068856_100004553 | 3300005614 | Bacteria | 13778 |
| 163 | Ga0068856_100264908 | 3300005614 | Bacteria | 1734 |
| 164 | Ga0070702_100007773 | 3300005615 | Bacteria | 5154 |
| 165 | Ga0068852_100213110 | 3300005616 | Bacteria | 1833 |
| 166 | Ga0068852_100350248 | 3300005616 | Bacteria | 1442 |
| 167 | Ga0068859_100000674 | 3300005617 | Bacteria | 34219 |
| 168 | Ga0068859_100003776 | 3300005617 | Bacteria | 15454 |
| 169 | Ga0068859_100089202 | 3300005617 | Bacteria | 3133 |
| 170 | Ga0068859_100270710 | 3300005617 | Bacteria | 1791 |
| 171 | Ga0068859_100655524 | 3300005617 | Bacteria | 1142 |
| 172 | Ga0068859_100703088 | 3300005617 | Bacteria | 1101 |
| 173 | Ga0068864_100023356 | 3300005618 | Bacteria | 5192 |
| 174 | Ga0068864_100043830 | 3300005618 | Bacteria | 3832 |
| 175 | Ga0068864_100394852 | 3300005618 | Bacteria | 1313 |
| 176 | Ga0068864_100494343 | 3300005618 | Bacteria | 1176 |
| 177 | Ga0068864_102382068 | 3300005618 | Bacteria | 536 |
| 178 | Ga0068866_10111171 | 3300005718 | Bacteria | 1529 |
| 179 | Ga0068866_10455160 | 3300005718 | Bacteria | 838 |
| 180 | Ga0068861_100001382 | 3300005719 | Bacteria | 15229 |
| 181 | Ga0068861_100016209 | 3300005719 | Bacteria | 5268 |
| 182 | Ga0068861_100271776 | 3300005719 | Bacteria | 1456 |
| 183 | Ga0068861_100697963 | 3300005719 | Bacteria | 943 |
| 184 | Ga0068861_101842669 | 3300005719 | Bacteria | 601 |
| 185 | Ga0068851_10106749 | 3300005834 | Bacteria | 1491 |
| 186 | Ga0068851_10824442 | 3300005834 | Bacteria | 577 |
| 187 | Ga0068870_10022377 | 3300005840 | Bacteria | 3105 |
| 188 | Ga0068870_10022596 | 3300005840 | Bacteria | 3092 |
| 189 | Ga0068870_10119722 | 3300005840 | Bacteria | 1515 |
| 190 | Ga0068863_100002456 | 3300005841 | Bacteria | 18419 |
| 191 | Ga0068863_100007485 | 3300005841 | Bacteria | 10683 |
| 192 | Ga0068863_100009083 | 3300005841 | Bacteria | 9705 |
| 193 | Ga0068863_100077118 | 3300005841 | Bacteria | 3154 |
| 194 | Ga0068858_100000838 | 3300005842 | Bacteria | 31992 |
| 195 | Ga0068858_100003187 | 3300005842 | Bacteria | 16393 |
| 196 | Ga0068858_100022237 | 3300005842 | Bacteria | 5921 |
| 197 | Ga0068858_100056706 | 3300005842 | Bacteria | 3620 |
| 198 | Ga0068858_100170456 | 3300005842 | Bacteria | 2052 |
| 199 | Ga0068860_100000941 | 3300005843 | Bacteria | 32265 |
| 200 | Ga0068860_100008051 | 3300005843 | Bacteria | 10509 |
| 201 | Ga0068860_100135634 | 3300005843 | Bacteria | 2363 |
| 202 | Ga0068860_100576966 | 3300005843 | Bacteria | 1129 |
| 203 | Ga0068860_100884921 | 3300005843 | Bacteria | 909 |
| 204 | Ga0068860_101112107 | 3300005843 | Bacteria | 810 |
| 205 | Ga0068862_100000627 | 3300005844 | Bacteria | 36553 |
| 206 | Ga0068862_100107977 | 3300005844 | Bacteria | 2440 |
| 207 | Ga0068862_100405857 | 3300005844 | Bacteria | 1276 |
| 208 | Ga0068862_100469794 | 3300005844 | Bacteria | 1189 |
| 209 | Ga0068862_101645249 | 3300005844 | Bacteria | 650 |
| 210 | Ga0081538_10382639 | 3300005981 | Bacteria | 507 |
| 211 | Ga0070717_10035050 | 3300006028 | Bacteria | 4059 |
| 212 | Ga0075432_10009154 | 3300006058 | Bacteria | 3374 |
| 213 | Ga0075432_10581581 | 3300006058 | Bacteria | 510 |
| 214 | Ga0070715_10148461 | 3300006163 | Bacteria | 1146 |
| 215 | Ga0070715_10434922 | 3300006163 | Bacteria | 737 |
| 216 | Ga0070716_100005257 | 3300006173 | Bacteria | 6257 |
| 217 | Ga0070716_100138150 | 3300006173 | Bacteria | 1550 |
| 218 | Ga0070712_100143198 | 3300006175 | Bacteria | 1827 |
| 219 | Ga0075427_10004374 | 3300006194 | Bacteria | 1979 |
| 220 | Ga0075366_10316459 | 3300006195 | Bacteria | 956 |
| 221 | Ga0075366_10443038 | 3300006195 | Bacteria | 801 |
| 222 | Ga0097621_100062806 | 3300006237 | Bacteria | 3050 |
| 223 | Ga0097621_100166940 | 3300006237 | Bacteria | 1895 |
| 224 | Ga0097621_100301150 | 3300006237 | Bacteria | 1416 |
| 225 | Ga0097621_100514362 | 3300006237 | Bacteria | 1086 |
| 226 | Ga0097621_100549346 | 3300006237 | Bacteria | 1051 |
| 227 | Ga0097621_100674803 | 3300006237 | Bacteria | 950 |
| 228 | Ga0068871_100029047 | 3300006358 | Bacteria | 4341 |
| 229 | Ga0068871_100038270 | 3300006358 | Bacteria | 3829 |
| 230 | Ga0068871_100173839 | 3300006358 | Bacteria | 1848 |
| 231 | Ga0068871_100318102 | 3300006358 | Bacteria | 1370 |
| 232 | Ga0068871_101605762 | 3300006358 | Bacteria | 616 |
| 233 | Ga0075428_100001820 | 3300006844 | Bacteria | 22828 |
| 234 | Ga0075428_100012398 | 3300006844 | Bacteria | 9482 |
| 235 | Ga0075428_100247340 | 3300006844 | Bacteria | 1922 |
| 236 | Ga0075430_100012275 | 3300006846 | Bacteria | 7290 |
| 237 | Ga0075430_100021289 | 3300006846 | Bacteria | 5512 |
| 238 | Ga0075430_100107235 | 3300006846 | Bacteria | 2330 |
| 239 | Ga0075430_100309251 | 3300006846 | Bacteria | 1307 |
| 240 | Ga0075430_100647363 | 3300006846 | Bacteria | 871 |
| 241 | Ga0075430_100826221 | 3300006846 | Bacteria | 764 |
| 242 | Ga0075430_100887335 | 3300006846 | Bacteria | 735 |
| 243 | Ga0075431_100000992 | 3300006847 | Bacteria | 25307 |
| 244 | Ga0075431_100027329 | 3300006847 | Bacteria | 5853 |
| 245 | Ga0075431_100032100 | 3300006847 | Bacteria | 5411 |
| 246 | Ga0075431_100253474 | 3300006847 | Bacteria | 1788 |
| 247 | Ga0075433_11465690 | 3300006852 | Bacteria | 590 |
| 248 | Ga0075434_100149115 | 3300006871 | Bacteria | 2359 |
| 249 | Ga0075429_100004428 | 3300006880 | Bacteria | 12070 |
| 250 | Ga0075429_100007829 | 3300006880 | Bacteria | 9283 |
| 251 | Ga0075429_100823479 | 3300006880 | Bacteria | 813 |
| 252 | Ga0068865_100056496 | 3300006881 | Bacteria | 2735 |
| 253 | Ga0068865_100327331 | 3300006881 | Bacteria | 1234 |
| 254 | Ga0068865_100558094 | 3300006881 | Bacteria | 963 |
| 255 | Ga0097620_100000674 | 3300006931 | Bacteria | 34219 |
| 256 | Ga0097620_100003775 | 3300006931 | Bacteria | 15454 |
| 257 | Ga0097620_100089201 | 3300006931 | Bacteria | 3133 |
| 258 | Ga0097620_100270721 | 3300006931 | Bacteria | 1791 |
| 259 | Ga0097620_100655519 | 3300006931 | Bacteria | 1142 |
| 260 | Ga0097620_100703119 | 3300006931 | Bacteria | 1101 |
| 261 | Ga0099823_1000119 | 3300006944 | Bacteria | 39691 |
| 262 | Ga0079104_1001155 | 3300006946 | Bacteria | 19100 |
| 263 | Ga0079104_1005472 | 3300006946 | Bacteria | 5063 |
| 264 | Ga0099826_10000860 | 3300006948 | Bacteria | 16486 |
| 265 | Ga0075435_100030312 | 3300007076 | Bacteria | 4251 |
| 266 | Ga0099794_10689273 | 3300007265 | Bacteria | 544 |
| 267 | Ga0099794_10723176 | 3300007265 | Bacteria | 531 |
| 268 | Ga0099795_10000001 | 3300007788 | Bacteria | 179944 |
| 269 | Ga0099795_10000342 | 3300007788 | Bacteria | 8410 |
| 270 | Ga0105251_10000396 | 3300009011 | Bacteria | 42564 |
| 271 | Ga0105251_10036856 | 3300009011 | Bacteria | 2403 |
| 272 | Ga0105251_10055931 | 3300009011 | Bacteria | 1869 |
| 273 | Ga0105244_10005072 | 3300009036 | Bacteria | 8854 |
| 274 | Ga0105244_10026994 | 3300009036 | Bacteria | 3100 |
| 275 | Ga0105244_10083463 | 3300009036 | Bacteria | 1579 |
| 276 | Ga0105250_10068877 | 3300009092 | Bacteria | 1429 |
| 277 | Ga0105250_10235653 | 3300009092 | Bacteria | 779 |
| 278 | Ga0105240_10001990 | 3300009093 | Bacteria | 33763 |
| 279 | Ga0105240_10010840 | 3300009093 | Bacteria | 12767 |
| 280 | Ga0105240_10056435 | 3300009093 | Bacteria | 4914 |
| 281 | Ga0105240_10059022 | 3300009093 | Bacteria | 4789 |
| 282 | Ga0105240_10076281 | 3300009093 | Bacteria | 4133 |
| 283 | Ga0105240_10157500 | 3300009093 | Bacteria | 2700 |
| 284 | Ga0105240_10185125 | 3300009093 | Bacteria | 2454 |
| 285 | Ga0105240_10613628 | 3300009093 | Bacteria | 1196 |
| 286 | Ga0105240_11349660 | 3300009093 | Bacteria | 751 |
| 287 | Ga0111539_10002602 | 3300009094 | Bacteria | 23907 |
| 288 | Ga0111539_10012428 | 3300009094 | Bacteria | 10676 |
| 289 | Ga0111539_10043347 | 3300009094 | Bacteria | 5394 |
| 290 | Ga0111539_10056415 | 3300009094 | Bacteria | 4668 |
| 291 | Ga0111539_10059404 | 3300009094 | Bacteria | 4534 |
| 292 | Ga0111539_10560381 | 3300009094 | Bacteria | 1331 |
| 293 | Ga0111539_12194479 | 3300009094 | Bacteria | 641 |
| 294 | Ga0111539_12253282 | 3300009094 | Bacteria | 632 |
| 295 | Ga0105245_10001367 | 3300009098 | Bacteria | 22086 |
| 296 | Ga0105245_10422613 | 3300009098 | Bacteria | 1336 |
| 297 | Ga0105245_10583726 | 3300009098 | Bacteria | 1142 |
| 298 | Ga0105245_11856605 | 3300009098 | Bacteria | 656 |
| 299 | Ga0105245_12079471 | 3300009098 | Bacteria | 621 |
| 300 | Ga0105247_10000613 | 3300009101 | Bacteria | 28740 |
| 301 | Ga0105247_10150643 | 3300009101 | Bacteria | 1532 |
| 302 | Ga0105247_10382570 | 3300009101 | Bacteria | 998 |
| 303 | Ga0105247_10491414 | 3300009101 | Bacteria | 892 |
| 304 | Ga0105247_10893756 | 3300009101 | Bacteria | 685 |
| 305 | Ga0114129_10000246 | 3300009147 | Bacteria | 60999 |
| 306 | Ga0114129_10457595 | 3300009147 | Bacteria | 1673 |
| 307 | Ga0105243_10025874 | 3300009148 | Bacteria | 4488 |
| 308 | Ga0105243_10290588 | 3300009148 | Bacteria | 1476 |
| 309 | Ga0105243_13035728 | 3300009148 | Bacteria | 509 |
| 310 | Ga0105241_10365215 | 3300009174 | Bacteria | 1257 |
| 311 | Ga0105242_10001178 | 3300009176 | Bacteria | 20602 |
| 312 | Ga0105242_10893583 | 3300009176 | Bacteria | 888 |
| 313 | Ga0105242_11786562 | 3300009176 | Bacteria | 653 |
| 314 | Ga0105242_13104048 | 3300009176 | Bacteria | 515 |
| 315 | Ga0105248_10003210 | 3300009177 | Bacteria | 18126 |
| 316 | Ga0105248_10264408 | 3300009177 | Bacteria | 1936 |
| 317 | Ga0105248_10272462 | 3300009177 | Bacteria | 1906 |
| 318 | Ga0105248_10445085 | 3300009177 | Bacteria | 1460 |
| 319 | Ga0105248_11882587 | 3300009177 | Bacteria | 679 |
| 320 | Ga0105237_10000196 | 3300009545 | Bacteria | 85826 |
| 321 | Ga0105237_10027955 | 3300009545 | Bacteria | 5748 |
| 322 | Ga0105237_10031421 | 3300009545 | Bacteria | 5385 |
| 323 | Ga0105237_10120319 | 3300009545 | Bacteria | 2620 |
| 324 | Ga0105237_10254718 | 3300009545 | Bacteria | 1757 |
| 325 | Ga0105237_12156801 | 3300009545 | Bacteria | 566 |
| 326 | Ga0105237_12549370 | 3300009545 | Bacteria | 522 |
| 327 | Ga0105238_10114535 | 3300009551 | Bacteria | 2675 |
| 328 | Ga0105238_10115060 | 3300009551 | Bacteria | 2669 |
| 329 | Ga0105238_10412878 | 3300009551 | Bacteria | 1344 |
| 330 | Ga0105249_10002480 | 3300009553 | Bacteria | 15981 |
| 331 | Ga0105249_10008927 | 3300009553 | Bacteria | 8756 |
| 332 | Ga0105249_10009607 | 3300009553 | Bacteria | 8476 |
| 333 | Ga0105249_10106962 | 3300009553 | Bacteria | 2639 |
| 334 | Ga0105249_10739412 | 3300009553 | Bacteria | 1045 |
| 335 | Ga0099796_10000001 | 3300010159 | Bacteria | 107173 |
| 336 | Ga0099796_10020675 | 3300010159 | Bacteria | 2015 |
| 337 | Ga0105239_10165064 | 3300010375 | Bacteria | 2476 |
| 338 | Ga0105239_10371947 | 3300010375 | Bacteria | 1615 |
| 339 | Ga0105239_10428079 | 3300010375 | Bacteria | 1500 |
| 340 | Ga0105239_10450017 | 3300010375 | Bacteria | 1461 |
| 341 | Ga0105239_10831763 | 3300010375 | Bacteria | 1058 |
| 342 | Ga0105239_11538340 | 3300010375 | Bacteria | 769 |
| 343 | Ga0105246_10124844 | 3300011119 | Bacteria | 1913 |
| 344 | Ga0105246_11056942 | 3300011119 | Bacteria | 739 |
| 345 | Ga0157373_10011711 | 3300013100 | Bacteria | 6441 |
| 346 | Ga0157373_10110281 | 3300013100 | Bacteria | 1935 |
| 347 | Ga0157371_10006276 | 3300013102 | Bacteria | 9843 |
| 348 | Ga0157371_10012444 | 3300013102 | Bacteria | 6503 |
| 349 | Ga0157371_10334666 | 3300013102 | Bacteria | 1100 |
| 350 | Ga0157370_10088182 | 3300013104 | Bacteria | 2914 |
| 351 | Ga0157370_10347025 | 3300013104 | Bacteria | 1368 |
| 352 | Ga0157370_10364787 | 3300013104 | Bacteria | 1331 |
| 353 | Ga0157370_10799407 | 3300013104 | Bacteria | 858 |
| 354 | Ga0157369_10017050 | 3300013105 | Bacteria | 8161 |
| 355 | Ga0157369_10046803 | 3300013105 | Bacteria | 4700 |
| 356 | Ga0157369_10408369 | 3300013105 | Bacteria | 1408 |
| 357 | Ga0157369_12272771 | 3300013105 | Bacteria | 550 |
| 358 | Ga0157374_10006088 | 3300013296 | Bacteria | 10210 |
| 359 | Ga0157374_10219317 | 3300013296 | Bacteria | 1866 |
| 360 | Ga0157374_10415131 | 3300013296 | Bacteria | 1344 |
| 361 | Ga0157378_10007969 | 3300013297 | Bacteria | 9247 |
| 362 | Ga0157378_10107804 | 3300013297 | Bacteria | 2549 |
| 363 | Ga0157378_10332769 | 3300013297 | Bacteria | 1478 |
| 364 | Ga0163162_10003168 | 3300013306 | Bacteria | 15723 |
| 365 | Ga0163162_10401294 | 3300013306 | Bacteria | 1504 |
| 366 | Ga0163162_10662766 | 3300013306 | Bacteria | 1167 |
| 367 | Ga0163162_13131330 | 3300013306 | Bacteria | 531 |
| 368 | Ga0163162_13405246 | 3300013306 | Bacteria | 507 |
| 369 | Ga0157372_10000663 | 3300013307 | Bacteria | 37808 |
| 370 | Ga0157372_10033882 | 3300013307 | Bacteria | 5613 |
| 371 | Ga0157372_10140143 | 3300013307 | Bacteria | 2785 |
| 372 | Ga0157372_10304057 | 3300013307 | Bacteria | 1855 |
| 373 | Ga0157372_10497786 | 3300013307 | Bacteria | 1421 |
| 374 | Ga0157375_10004983 | 3300013308 | Bacteria | 11549 |
| 375 | Ga0157375_10010994 | 3300013308 | Bacteria | 7982 |
| 376 | Ga0157375_10011199 | 3300013308 | Bacteria | 7913 |
| 377 | Ga0157375_10013691 | 3300013308 | Bacteria | 7230 |
| 378 | Ga0163163_10003368 | 3300014325 | Bacteria | 13566 |
| 379 | Ga0163163_10015469 | 3300014325 | Bacteria | 7053 |
| 380 | Ga0163163_10425437 | 3300014325 | Bacteria | 1387 |
| 381 | Ga0163163_10582710 | 3300014325 | Bacteria | 1182 |
| 382 | Ga0157380_10000523 | 3300014326 | Bacteria | 23586 |
| 383 | Ga0157380_10001490 | 3300014326 | Bacteria | 15328 |
| 384 | Ga0157380_10497037 | 3300014326 | Bacteria | 1184 |
| 385 | Ga0157380_10579256 | 3300014326 | Bacteria | 1106 |
| 386 | Ga0157380_10957487 | 3300014326 | Bacteria | 886 |
| 387 | Ga0157379_10000786 | 3300014968 | Bacteria | 25770 |
| 388 | Ga0157379_10020413 | 3300014968 | Bacteria | 5857 |
| 389 | Ga0157379_10023113 | 3300014968 | Bacteria | 5513 |
| 390 | Ga0157379_10225379 | 3300014968 | Bacteria | 1699 |
| 391 | Ga0157379_11152174 | 3300014968 | Bacteria | 744 |
| 392 | Ga0157376_10010282 | 3300014969 | Bacteria | 6834 |
| 393 | Ga0157376_12384523 | 3300014969 | Bacteria | 569 |
| 394 | Ga0182006_1007768 | 3300015261 | Bacteria | 4891 |
| 395 | Ga0182006_1099210 | 3300015261 | Bacteria | 1036 |
| 396 | Ga0182005_1067608 | 3300015265 | Bacteria | 979 |
| 397 | Ga0163161_10038675 | 3300017792 | Bacteria | 3422 |
| 398 | Ga0163161_10141983 | 3300017792 | Bacteria | 1819 |
| 399 | Ga0163161_10260362 | 3300017792 | Bacteria | 1355 |
| 400 | Ga0163161_10288360 | 3300017792 | Bacteria | 1289 |
| 401 | Ga0163161_10604366 | 3300017792 | Bacteria | 904 |
| 402 | Ga0206355_1034253 | 3300020076 | Bacteria | 951 |
| 403 | Ga0154015_1305603 | 3300020610 | Bacteria | 516 |
| 404 | Ga0213874_10038162 | 3300021377 | Bacteria | 1425 |
| 405 | Ga0213874_10249862 | 3300021377 | Bacteria | 653 |
| 406 | Ga0213876_10034937 | 3300021384 | Bacteria | 2652 |
| 407 | Ga0213876_10714319 | 3300021384 | Bacteria | 533 |
| 408 | Ga0224712_10322525 | 3300022467 | Bacteria | 726 |
| 409 | Ga0209760_100046 | 3300025207 | Bacteria | 107840 |
| 410 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 411 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 412 | Ga0207425_1026619 | 3300025245 | Bacteria | 1185 |
| 413 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 414 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 415 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 416 | Ga0209676_1002594 | 3300025292 | Bacteria | 12405 |
| 417 | Ga0209050_1000329 | 3300025298 | Bacteria | 94932 |
| 418 | Ga0209256_1007584 | 3300025299 | Bacteria | 5300 |
| 419 | Ga0209051_1000879 | 3300025303 | Bacteria | 30297 |
| 420 | Ga0209051_1001951 | 3300025303 | Bacteria | 15859 |
| 421 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 422 | Ga0209257_1000231 | 3300025304 | Bacteria | 131226 |
| 423 | Ga0209257_1005149 | 3300025304 | Bacteria | 9435 |
| 424 | Ga0209257_1008743 | 3300025304 | Bacteria | 5638 |
| 425 | Ga0207656_10076352 | 3300025321 | Bacteria | 1498 |
| 426 | Ga0207696_1000164 | 3300025711 | Bacteria | 106057 |
| 427 | Ga0207696_1015856 | 3300025711 | Bacteria | 2539 |
| 428 | Ga0207696_1055096 | 3300025711 | Bacteria | 1129 |
| 429 | Ga0207655_1001023 | 3300025728 | Bacteria | 28252 |
| 430 | Ga0207655_1001119 | 3300025728 | Bacteria | 26209 |
| 431 | Ga0207655_1001253 | 3300025728 | Bacteria | 24224 |
| 432 | Ga0207655_1009566 | 3300025728 | Bacteria | 6005 |
| 433 | Ga0207655_1029036 | 3300025728 | Bacteria | 2597 |
| 434 | Ga0207655_1052855 | 3300025728 | Bacteria | 1630 |
| 435 | Ga0207713_1002179 | 3300025735 | Bacteria | 14516 |
| 436 | Ga0207713_1003704 | 3300025735 | Bacteria | 10275 |
| 437 | Ga0207713_1006408 | 3300025735 | Bacteria | 7174 |
| 438 | Ga0207713_1012464 | 3300025735 | Bacteria | 4541 |
| 439 | Ga0207713_1025353 | 3300025735 | Bacteria | 2741 |
| 440 | Ga0207713_1026428 | 3300025735 | Bacteria | 2660 |
| 441 | Ga0207713_1037828 | 3300025735 | Bacteria | 2053 |
| 442 | Ga0207713_1047478 | 3300025735 | Bacteria | 1737 |
| 443 | Ga0207682_10111450 | 3300025893 | Bacteria | 1205 |
| 444 | Ga0207692_10349269 | 3300025898 | Bacteria | 911 |
| 445 | Ga0207692_10918993 | 3300025898 | Bacteria | 576 |
| 446 | Ga0207642_10216896 | 3300025899 | Bacteria | 1067 |
| 447 | Ga0207642_10544291 | 3300025899 | Bacteria | 716 |
| 448 | Ga0207642_10582826 | 3300025899 | Bacteria | 694 |
| 449 | Ga0207710_10000345 | 3300025900 | Bacteria | 33870 |
| 450 | Ga0207710_10006077 | 3300025900 | Bacteria | 5174 |
| 451 | Ga0207710_10183081 | 3300025900 | Bacteria | 1028 |
| 452 | Ga0207710_10225776 | 3300025900 | Bacteria | 931 |
| 453 | Ga0207710_10411046 | 3300025900 | Bacteria | 695 |
| 454 | Ga0207688_10132352 | 3300025901 | Bacteria | 1463 |
| 455 | Ga0207680_10014536 | 3300025903 | Bacteria | 4078 |
| 456 | Ga0207680_10117095 | 3300025903 | Bacteria | 1737 |
| 457 | Ga0207647_10003570 | 3300025904 | Bacteria | 11674 |
| 458 | Ga0207647_10261820 | 3300025904 | Bacteria | 990 |
| 459 | Ga0207685_10079600 | 3300025905 | Bacteria | 1352 |
| 460 | Ga0207685_10186387 | 3300025905 | Bacteria | 965 |
| 461 | Ga0207699_10167599 | 3300025906 | Bacteria | 1467 |
| 462 | Ga0207699_10281999 | 3300025906 | Bacteria | 1155 |
| 463 | Ga0207645_10437530 | 3300025907 | Bacteria | 882 |
| 464 | Ga0207645_10669493 | 3300025907 | Bacteria | 705 |
| 465 | Ga0207645_10773504 | 3300025907 | Bacteria | 653 |
| 466 | Ga0207643_10017683 | 3300025908 | Bacteria | 3901 |
| 467 | Ga0207643_10035559 | 3300025908 | Bacteria | 2793 |
| 468 | Ga0207643_10054619 | 3300025908 | Bacteria | 2270 |
| 469 | Ga0207705_10508878 | 3300025909 | Bacteria | 935 |
| 470 | Ga0207707_10002386 | 3300025912 | Bacteria | 16904 |
| 471 | Ga0207707_10958240 | 3300025912 | Bacteria | 704 |
| 472 | Ga0207695_10022267 | 3300025913 | Bacteria | 7203 |
| 473 | Ga0207695_10027680 | 3300025913 | Bacteria | 6308 |
| 474 | Ga0207695_10034230 | 3300025913 | Bacteria | 5529 |
| 475 | Ga0207695_10044843 | 3300025913 | Bacteria | 4699 |
| 476 | Ga0207695_10045412 | 3300025913 | Bacteria | 4664 |
| 477 | Ga0207695_10048616 | 3300025913 | Bacteria | 4478 |
| 478 | Ga0207695_10069991 | 3300025913 | Bacteria | 3589 |
| 479 | Ga0207695_10186801 | 3300025913 | Bacteria | 1991 |
| 480 | Ga0207695_10434890 | 3300025913 | Bacteria | 1196 |
| 481 | Ga0207695_10874344 | 3300025913 | Bacteria | 779 |
| 482 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 483 | Ga0207671_10035517 | 3300025914 | Bacteria | 3698 |
| 484 | Ga0207671_10228557 | 3300025914 | Bacteria | 1459 |
| 485 | Ga0207671_10287531 | 3300025914 | Bacteria | 1298 |
| 486 | Ga0207693_10095446 | 3300025915 | Bacteria | 2331 |
| 487 | Ga0207663_10003510 | 3300025916 | Bacteria | 7687 |
| 488 | Ga0207663_10020460 | 3300025916 | Bacteria | 3747 |
| 489 | Ga0207663_10894535 | 3300025916 | Bacteria | 710 |
| 490 | Ga0207660_10018244 | 3300025917 | Bacteria | 4675 |
| 491 | Ga0207660_10030100 | 3300025917 | Bacteria | 3729 |
| 492 | Ga0207660_10620298 | 3300025917 | Bacteria | 881 |
| 493 | Ga0207662_10077415 | 3300025918 | Bacteria | 2023 |
| 494 | Ga0207657_10015296 | 3300025919 | Bacteria | 7437 |
| 495 | Ga0207657_10870238 | 3300025919 | Bacteria | 695 |
| 496 | Ga0207649_10000004 | 3300025920 | Bacteria | 360726 |
| 497 | Ga0207649_10021407 | 3300025920 | Bacteria | 3722 |
| 498 | Ga0207649_10031365 | 3300025920 | Bacteria | 3158 |
| 499 | Ga0207652_10006955 | 3300025921 | Bacteria | 9114 |
| 500 | Ga0207652_10118222 | 3300025921 | Bacteria | 2356 |
| 501 | Ga0207652_10550082 | 3300025921 | Bacteria | 1037 |
| 502 | Ga0207681_10118210 | 3300025923 | Bacteria | 1940 |
| 503 | Ga0207681_10322039 | 3300025923 | Bacteria | 1230 |
| 504 | Ga0207681_10547352 | 3300025923 | Bacteria | 952 |
| 505 | Ga0207681_10802387 | 3300025923 | Bacteria | 786 |
| 506 | Ga0207694_10116328 | 3300025924 | Bacteria | 2131 |
| 507 | Ga0207694_10285747 | 3300025924 | Bacteria | 1356 |
| 508 | Ga0207694_10339982 | 3300025924 | Bacteria | 1241 |
| 509 | Ga0207694_10372263 | 3300025924 | Bacteria | 1185 |
| 510 | Ga0207694_11815677 | 3300025924 | Bacteria | 512 |
| 511 | Ga0207650_10005141 | 3300025925 | Bacteria | 8932 |
| 512 | Ga0207650_10131542 | 3300025925 | Bacteria | 1958 |
| 513 | Ga0207659_10010565 | 3300025926 | Bacteria | 5805 |
| 514 | Ga0207659_10295262 | 3300025926 | Bacteria | 1329 |
| 515 | Ga0207687_10135083 | 3300025927 | Bacteria | 1865 |
| 516 | Ga0207687_11163306 | 3300025927 | Bacteria | 663 |
| 517 | Ga0207700_10031633 | 3300025928 | Bacteria | 3762 |
| 518 | Ga0207700_10108684 | 3300025928 | Bacteria | 2227 |
| 519 | Ga0207700_10422269 | 3300025928 | Bacteria | 1171 |
| 520 | Ga0207700_10443536 | 3300025928 | Bacteria | 1143 |
| 521 | Ga0207700_10521674 | 3300025928 | Bacteria | 1053 |
| 522 | Ga0207664_10046657 | 3300025929 | Bacteria | 3402 |
| 523 | Ga0207664_11055684 | 3300025929 | Bacteria | 727 |
| 524 | Ga0207664_11296888 | 3300025929 | Bacteria | 648 |
| 525 | Ga0207644_10000403 | 3300025931 | Bacteria | 28161 |
| 526 | Ga0207644_10056591 | 3300025931 | Bacteria | 2830 |
| 527 | Ga0207644_10281555 | 3300025931 | Bacteria | 1335 |
| 528 | Ga0207644_10847696 | 3300025931 | Bacteria | 765 |
| 529 | Ga0207644_10901383 | 3300025931 | Bacteria | 741 |
| 530 | Ga0207690_10055807 | 3300025932 | Bacteria | 2662 |
| 531 | Ga0207706_10003395 | 3300025933 | Bacteria | 15225 |
| 532 | Ga0207706_10088968 | 3300025933 | Bacteria | 2714 |
| 533 | Ga0207706_10341660 | 3300025933 | Bacteria | 1302 |
| 534 | Ga0207686_10015382 | 3300025934 | Bacteria | 4278 |
| 535 | Ga0207686_11724266 | 3300025934 | Bacteria | 518 |
| 536 | Ga0207709_10034056 | 3300025935 | Bacteria | 2998 |
| 537 | Ga0207709_10062436 | 3300025935 | Bacteria | 2332 |
| 538 | Ga0207709_11141119 | 3300025935 | Bacteria | 641 |
| 539 | Ga0207670_10004796 | 3300025936 | Bacteria | 7339 |
| 540 | Ga0207669_10089723 | 3300025937 | Bacteria | 1997 |
| 541 | Ga0207669_10107077 | 3300025937 | Bacteria | 1864 |
| 542 | Ga0207669_10733665 | 3300025937 | Bacteria | 814 |
| 543 | Ga0207704_10119037 | 3300025938 | Bacteria | 1803 |
| 544 | Ga0207704_10145815 | 3300025938 | Bacteria | 1663 |
| 545 | Ga0207704_10216599 | 3300025938 | Bacteria | 1413 |
| 546 | Ga0207665_10011416 | 3300025939 | Bacteria | 5835 |
| 547 | Ga0207665_10020217 | 3300025939 | Bacteria | 4374 |
| 548 | Ga0207691_10002537 | 3300025940 | Bacteria | 17844 |
| 549 | Ga0207691_10008772 | 3300025940 | Bacteria | 9701 |
| 550 | Ga0207691_10009236 | 3300025940 | Bacteria | 9461 |
| 551 | Ga0207711_10002599 | 3300025941 | Bacteria | 16038 |
| 552 | Ga0207711_10021913 | 3300025941 | Bacteria | 5338 |
| 553 | Ga0207711_10041758 | 3300025941 | Bacteria | 3907 |
| 554 | Ga0207711_10056871 | 3300025941 | Bacteria | 3362 |
| 555 | Ga0207711_10552991 | 3300025941 | Bacteria | 1073 |
| 556 | Ga0207689_10041539 | 3300025942 | Bacteria | 3806 |
| 557 | Ga0207689_10094365 | 3300025942 | Bacteria | 2457 |
| 558 | Ga0207689_10146715 | 3300025942 | Bacteria | 1944 |
| 559 | Ga0207689_10404796 | 3300025942 | Bacteria | 1138 |
| 560 | Ga0207661_10109844 | 3300025944 | Bacteria | 2330 |
| 561 | Ga0207661_10543209 | 3300025944 | Bacteria | 1064 |
| 562 | Ga0207679_10000019 | 3300025945 | Bacteria | 230270 |
| 563 | Ga0207679_10002358 | 3300025945 | Bacteria | 11620 |
| 564 | Ga0207679_10294768 | 3300025945 | Bacteria | 1396 |
| 565 | Ga0207679_11335189 | 3300025945 | Bacteria | 658 |
| 566 | Ga0207667_10000618 | 3300025949 | Bacteria | 45953 |
| 567 | Ga0207667_10004938 | 3300025949 | Bacteria | 16285 |
| 568 | Ga0207667_10014059 | 3300025949 | Bacteria | 9137 |
| 569 | Ga0207667_10890576 | 3300025949 | Bacteria | 882 |
| 570 | Ga0207667_10929776 | 3300025949 | Bacteria | 860 |
| 571 | Ga0207667_12057893 | 3300025949 | Bacteria | 530 |
| 572 | Ga0207651_10496598 | 3300025960 | Bacteria | 1054 |
| 573 | Ga0207651_11196138 | 3300025960 | Bacteria | 682 |
| 574 | Ga0207651_11872218 | 3300025960 | Bacteria | 540 |
| 575 | Ga0207712_10062143 | 3300025961 | Bacteria | 2653 |
| 576 | Ga0207712_10313931 | 3300025961 | Bacteria | 1291 |
| 577 | Ga0207668_10003932 | 3300025972 | Bacteria | 8760 |
| 578 | Ga0207668_11184130 | 3300025972 | Bacteria | 686 |
| 579 | Ga0207640_10001795 | 3300025981 | Bacteria | 11532 |
| 580 | Ga0207640_10128235 | 3300025981 | Bacteria | 1829 |
| 581 | Ga0207640_10141671 | 3300025981 | Bacteria | 1753 |
| 582 | Ga0207640_10195006 | 3300025981 | Bacteria | 1530 |
| 583 | Ga0207658_10061497 | 3300025986 | Bacteria | 2806 |
| 584 | Ga0207658_10162868 | 3300025986 | Bacteria | 1829 |
| 585 | Ga0207658_10743435 | 3300025986 | Bacteria | 888 |
| 586 | Ga0207658_10786380 | 3300025986 | Bacteria | 863 |
| 587 | Ga0207658_10876426 | 3300025986 | Bacteria | 817 |
| 588 | Ga0207658_10926464 | 3300025986 | Bacteria | 794 |
| 589 | Ga0207703_10000527 | 3300026035 | Bacteria | 39354 |
| 590 | Ga0207703_10000649 | 3300026035 | Bacteria | 34880 |
| 591 | Ga0207703_10011508 | 3300026035 | Bacteria | 6883 |
| 592 | Ga0207703_10062891 | 3300026035 | Bacteria | 3041 |
| 593 | Ga0207703_10073316 | 3300026035 | Bacteria | 2832 |
| 594 | Ga0207703_10084825 | 3300026035 | Bacteria | 2649 |
| 595 | Ga0207639_10165808 | 3300026041 | Bacteria | 1866 |
| 596 | Ga0207678_10033565 | 3300026067 | Bacteria | 4470 |
| 597 | Ga0207678_10053737 | 3300026067 | Bacteria | 3470 |
| 598 | Ga0207708_10027051 | 3300026075 | Bacteria | 4342 |
| 599 | Ga0207708_10151184 | 3300026075 | Bacteria | 1828 |
| 600 | Ga0207708_10221566 | 3300026075 | Bacteria | 1516 |
| 601 | Ga0207708_10716228 | 3300026075 | Bacteria | 856 |
| 602 | Ga0207708_10760680 | 3300026075 | Bacteria | 832 |
| 603 | Ga0207702_10327990 | 3300026078 | Bacteria | 1459 |
| 604 | Ga0207702_10331481 | 3300026078 | Bacteria | 1452 |
| 605 | Ga0207702_10519742 | 3300026078 | Bacteria | 1162 |
| 606 | Ga0207641_10000604 | 3300026088 | Bacteria | 39468 |
| 607 | Ga0207641_10006006 | 3300026088 | Bacteria | 10290 |
| 608 | Ga0207641_10256130 | 3300026088 | Bacteria | 1636 |
| 609 | Ga0207641_11587977 | 3300026088 | Bacteria | 656 |
| 610 | Ga0207648_10004465 | 3300026089 | Bacteria | 14352 |
| 611 | Ga0207676_10279624 | 3300026095 | Bacteria | 1515 |
| 612 | Ga0207676_10402730 | 3300026095 | Bacteria | 1279 |
| 613 | Ga0207676_10578803 | 3300026095 | Bacteria | 1076 |
| 614 | Ga0207676_11155158 | 3300026095 | Bacteria | 766 |
| 615 | Ga0207674_10006753 | 3300026116 | Bacteria | 13469 |
| 616 | Ga0207674_10131659 | 3300026116 | Bacteria | 2464 |
| 617 | Ga0207674_10252436 | 3300026116 | Bacteria | 1711 |
| 618 | Ga0207674_10414235 | 3300026116 | Bacteria | 1302 |
| 619 | Ga0207674_11778706 | 3300026116 | Bacteria | 584 |
| 620 | Ga0207675_100030104 | 3300026118 | Bacteria | 5055 |
| 621 | Ga0207675_100037357 | 3300026118 | Bacteria | 4530 |
| 622 | Ga0207675_100207390 | 3300026118 | Bacteria | 1884 |
| 623 | Ga0207675_100252538 | 3300026118 | Bacteria | 1707 |
| 624 | Ga0207675_100335285 | 3300026118 | Bacteria | 1479 |
| 625 | Ga0207675_100691444 | 3300026118 | Bacteria | 1028 |
| 626 | Ga0207675_101036536 | 3300026118 | Bacteria | 839 |
| 627 | Ga0207683_10889411 | 3300026121 | Bacteria | 827 |
| 628 | Ga0207698_10554213 | 3300026142 | Bacteria | 1127 |
| 629 | Ga0207698_10593692 | 3300026142 | Bacteria | 1091 |
| 630 | Ga0207698_11063807 | 3300026142 | Bacteria | 821 |
| 631 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 632 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 633 | Ga0209281_1003287 | 3300027111 | Bacteria | 5470 |
| 634 | Ga0209389_1000205 | 3300027296 | Bacteria | 42388 |
| 635 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 636 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 637 | Ga0209371_1000142 | 3300027312 | Bacteria | 118726 |
| 638 | Ga0209371_1000584 | 3300027312 | Bacteria | 32775 |
| 639 | Ga0209371_1027632 | 3300027312 | Bacteria | 1274 |
| 640 | Ga0209371_1040604 | 3300027312 | Bacteria | 946 |
| 641 | Ga0209179_1000006 | 3300027512 | Bacteria | 101289 |
| 642 | Ga0209179_1007486 | 3300027512 | Bacteria | 1805 |
| 643 | Ga0209282_1305181 | 3300027666 | Bacteria | 674 |
| 644 | Ga0209588_1092973 | 3300027671 | Bacteria | 972 |
| 645 | Ga0207428_10004796 | 3300027907 | Bacteria | 12774 |
| 646 | Ga0207428_10014528 | 3300027907 | Bacteria | 6832 |
| 647 | Ga0207428_10028912 | 3300027907 | Bacteria | 4600 |
| 648 | Ga0207428_10718917 | 3300027907 | Bacteria | 713 |
| 649 | Ga0265356_1001503 | 3300028017 | Bacteria | 3414 |
| 650 | Ga0265357_1000734 | 3300028023 | Bacteria | 2109 |
| 651 | Ga0268266_10005233 | 3300028379 | Bacteria | 12193 |
| 652 | Ga0268266_10038457 | 3300028379 | Bacteria | 4073 |
| 653 | Ga0268266_10086540 | 3300028379 | Bacteria | 2740 |
| 654 | Ga0268266_10175598 | 3300028379 | Bacteria | 1947 |
| 655 | Ga0268266_10194966 | 3300028379 | Bacteria | 1851 |
| 656 | Ga0268266_10247583 | 3300028379 | Bacteria | 1647 |
| 657 | Ga0268266_10285925 | 3300028379 | Bacteria | 1534 |
| 658 | Ga0268266_10964159 | 3300028379 | Bacteria | 825 |
| 659 | Ga0268266_11978083 | 3300028379 | Bacteria | 556 |
| 660 | Ga0268265_10000932 | 3300028380 | Bacteria | 27011 |
| 661 | Ga0268265_10002340 | 3300028380 | Bacteria | 14383 |
| 662 | Ga0268265_10358027 | 3300028380 | Bacteria | 1335 |
| 663 | Ga0268265_11672093 | 3300028380 | Bacteria | 642 |
| 664 | Ga0268265_11891787 | 3300028380 | Bacteria | 603 |
| 665 | Ga0268264_10000176 | 3300028381 | Bacteria | 136166 |
| 666 | Ga0268264_10003702 | 3300028381 | Bacteria | 13128 |
| 667 | Ga0268264_10005113 | 3300028381 | Bacteria | 11118 |
| 668 | Ga0268264_10152827 | 3300028381 | Bacteria | 2071 |
| 669 | Ga0265326_10017083 | 3300028558 | Bacteria | 2095 |
| 670 | Ga0265319_1010114 | 3300028563 | Bacteria | 3955 |
| 671 | Ga0265334_10000669 | 3300028573 | Bacteria | 17205 |
| 672 | Ga0265334_10026076 | 3300028573 | Bacteria | 2362 |
| 673 | Ga0265318_10019707 | 3300028577 | Bacteria | 2732 |
| 674 | Ga0265322_10214651 | 3300028654 | Bacteria | 551 |
| 675 | Ga0307517_10226615 | 3300028786 | Bacteria | 1128 |
| 676 | Ga0307515_10001184 | 3300028794 | Bacteria | 59700 |
| 677 | Ga0307515_10371965 | 3300028794 | Bacteria | 1065 |
| 678 | Ga0265338_10010356 | 3300028800 | Bacteria | 10949 |
| 679 | Ga0265338_10116545 | 3300028800 | Bacteria | 2139 |
| 680 | Ga0265338_10209784 | 3300028800 | Bacteria | 1463 |
| 681 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 682 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 683 | Ga0268256_1000111 | 3300030500 | Bacteria | 118726 |
| 684 | Ga0268256_1000436 | 3300030500 | Bacteria | 37153 |
| 685 | Ga0268256_1031434 | 3300030500 | Bacteria | 1274 |
| 686 | Ga0268256_1038012 | 3300030500 | Bacteria | 1098 |
| 687 | Ga0307511_10029804 | 3300030521 | Bacteria | 4916 |
| 688 | Ga0316177_1095471 | 3300030731 | Bacteria | 1938 |
| 689 | Ga0314311_1137878 | 3300030733 | Bacteria | 4792 |
| 690 | Ga0316178_1009525 | 3300030735 | Bacteria | 55280 |
| 691 | Ga0316183_1002629 | 3300030742 | Bacteria | 2535 |
| 692 | Ga0316181_1261844 | 3300030744 | Bacteria | 1414 |
| 693 | Ga0265763_1006747 | 3300030763 | Bacteria | 994 |
| 694 | Ga0265767_106400 | 3300030836 | Bacteria | 733 |
| 695 | Ga0265765_1029494 | 3300030879 | Bacteria | 694 |
| 696 | Ga0265773_1047532 | 3300031018 | Bacteria | 507 |
| 697 | Ga0265760_10010613 | 3300031090 | Bacteria | 2632 |
| 698 | Ga0265760_10184949 | 3300031090 | Bacteria | 697 |
| 699 | Ga0265330_10352430 | 3300031235 | Bacteria | 622 |
| 700 | Ga0265332_10034344 | 3300031238 | Bacteria | 2204 |
| 701 | Ga0265328_10004103 | 3300031239 | Bacteria | 6358 |
| 702 | Ga0265328_10143135 | 3300031239 | Bacteria | 897 |
| 703 | Ga0265320_10022318 | 3300031240 | Bacteria | 3387 |
| 704 | Ga0265325_10013274 | 3300031241 | Bacteria | 4694 |
| 705 | Ga0265329_10008091 | 3300031242 | Bacteria | 4017 |
| 706 | Ga0265340_10034386 | 3300031247 | Bacteria | 2521 |
| 707 | Ga0265340_10186057 | 3300031247 | Bacteria | 938 |
| 708 | Ga0265339_10017954 | 3300031249 | Bacteria | 4181 |
| 709 | Ga0265331_10005302 | 3300031250 | Bacteria | 7801 |
| 710 | Ga0265327_10001379 | 3300031251 | Bacteria | 31081 |
| 711 | Ga0265327_10003741 | 3300031251 | Bacteria | 14146 |
| 712 | Ga0265327_10010879 | 3300031251 | Bacteria | 6336 |
| 713 | Ga0265327_10045765 | 3300031251 | Bacteria | 2323 |
| 714 | Ga0265316_10000783 | 3300031344 | Bacteria | 35073 |
| 715 | Ga0265316_10012865 | 3300031344 | Bacteria | 7473 |
| 716 | Ga0265316_10020230 | 3300031344 | Bacteria | 5670 |
| 717 | Ga0307513_10042643 | 3300031456 | Bacteria | 4993 |
| 718 | Ga0307513_10179846 | 3300031456 | Bacteria | 1979 |
| 719 | Ga0307513_10640543 | 3300031456 | Bacteria | 770 |
| 720 | Ga0307509_10000021 | 3300031507 | Bacteria | 250589 |
| 721 | Ga0307509_10105278 | 3300031507 | Bacteria | 2843 |
| 722 | Ga0307509_10419708 | 3300031507 | Bacteria | 1039 |
| 723 | Ga0307408_100045527 | 3300031548 | Bacteria | 3134 |
| 724 | Ga0307408_100088657 | 3300031548 | Bacteria | 2330 |
| 725 | Ga0307408_100339274 | 3300031548 | Bacteria | 1271 |
| 726 | Ga0307408_100594254 | 3300031548 | Bacteria | 982 |
| 727 | Ga0265313_10005492 | 3300031595 | Bacteria | 9302 |
| 728 | Ga0265313_10058875 | 3300031595 | Bacteria | 1809 |
| 729 | Ga0307514_10498177 | 3300031649 | Bacteria | 580 |
| 730 | Ga0316575_10250229 | 3300031665 | Bacteria | 743 |
| 731 | Ga0316579_10089972 | 3300031691 | Bacteria | 1465 |
| 732 | Ga0316579_10149269 | 3300031691 | Bacteria | 1127 |
| 733 | Ga0316579_10299821 | 3300031691 | Bacteria | 777 |
| 734 | Ga0265314_10012315 | 3300031711 | Bacteria | 6988 |
| 735 | Ga0265314_10022458 | 3300031711 | Bacteria | 4832 |
| 736 | Ga0265314_10279726 | 3300031711 | Bacteria | 944 |
| 737 | Ga0265314_10715672 | 3300031711 | Bacteria | 505 |
| 738 | Ga0265342_10047521 | 3300031712 | Bacteria | 2575 |
| 739 | Ga0265342_10159148 | 3300031712 | Bacteria | 1249 |
| 740 | Ga0316576_10002013 | 3300031727 | Bacteria | 11385 |
| 741 | Ga0316576_10005102 | 3300031727 | Bacteria | 7967 |
| 742 | Ga0316576_10197015 | 3300031727 | Bacteria | 1518 |
| 743 | Ga0316576_10258572 | 3300031727 | Bacteria | 1306 |
| 744 | Ga0316576_10381748 | 3300031727 | Bacteria | 1046 |
| 745 | Ga0316578_10023579 | 3300031728 | Bacteria | 3444 |
| 746 | Ga0316578_10132478 | 3300031728 | Bacteria | 1500 |
| 747 | Ga0316578_10144519 | 3300031728 | Bacteria | 1432 |
| 748 | Ga0316578_10145739 | 3300031728 | Bacteria | 1426 |
| 749 | Ga0316578_10386358 | 3300031728 | Bacteria | 830 |
| 750 | Ga0316578_10451027 | 3300031728 | Bacteria | 760 |
| 751 | Ga0316578_10559007 | 3300031728 | Bacteria | 672 |
| 752 | Ga0307516_10000050 | 3300031730 | Bacteria | 129848 |
| 753 | Ga0307516_10284338 | 3300031730 | Bacteria | 1335 |
| 754 | Ga0307405_10433782 | 3300031731 | Bacteria | 1037 |
| 755 | Ga0307405_11166368 | 3300031731 | Bacteria | 665 |
| 756 | Ga0307405_11175368 | 3300031731 | Bacteria | 662 |
| 757 | Ga0316577_10013474 | 3300031733 | Bacteria | 4471 |
| 758 | Ga0316577_10043323 | 3300031733 | Bacteria | 2518 |
| 759 | Ga0316577_10232132 | 3300031733 | Bacteria | 1043 |
| 760 | Ga0316577_10421347 | 3300031733 | Bacteria | 758 |
| 761 | Ga0316577_10544324 | 3300031733 | Bacteria | 660 |
| 762 | Ga0307413_10010454 | 3300031824 | Bacteria | 4502 |
| 763 | Ga0307413_10163301 | 3300031824 | Bacteria | 1567 |
| 764 | Ga0307413_10942534 | 3300031824 | Bacteria | 736 |
| 765 | Ga0307413_11749383 | 3300031824 | Bacteria | 555 |
| 766 | Ga0307518_10482099 | 3300031838 | Bacteria | 648 |
| 767 | Ga0307410_10023462 | 3300031852 | Bacteria | 3835 |
| 768 | Ga0307410_10513296 | 3300031852 | Bacteria | 988 |
| 769 | Ga0307410_12036100 | 3300031852 | Bacteria | 513 |
| 770 | Ga0307406_10064136 | 3300031901 | Bacteria | 2383 |
| 771 | Ga0307406_10273777 | 3300031901 | Bacteria | 1284 |
| 772 | Ga0307406_10368777 | 3300031901 | Bacteria | 1128 |
| 773 | Ga0307406_11263546 | 3300031901 | Bacteria | 643 |
| 774 | Ga0307407_10002190 | 3300031903 | Bacteria | 7531 |
| 775 | Ga0307412_10590216 | 3300031911 | Bacteria | 939 |
| 776 | Ga0307412_10860810 | 3300031911 | Bacteria | 791 |
| 777 | Ga0307409_100028163 | 3300031995 | Bacteria | 3997 |
| 778 | Ga0307409_100297603 | 3300031995 | Bacteria | 1499 |
| 779 | Ga0307409_100423553 | 3300031995 | Bacteria | 1278 |
| 780 | Ga0307409_101241970 | 3300031995 | Bacteria | 769 |
| 781 | Ga0307416_100008099 | 3300032002 | Bacteria | 6745 |
| 782 | Ga0307416_100053714 | 3300032002 | Bacteria | 3234 |
| 783 | Ga0307416_100263336 | 3300032002 | Bacteria | 1687 |
| 784 | Ga0307416_100300364 | 3300032002 | Bacteria | 1595 |
| 785 | Ga0307416_101194651 | 3300032002 | Bacteria | 866 |
| 786 | Ga0307414_10108541 | 3300032004 | Bacteria | 2106 |
| 787 | Ga0307414_10182901 | 3300032004 | Bacteria | 1687 |
| 788 | Ga0307414_10249447 | 3300032004 | Bacteria | 1474 |
| 789 | Ga0307414_11135916 | 3300032004 | Bacteria | 722 |
| 790 | Ga0307411_10191085 | 3300032005 | Bacteria | 1563 |
| 791 | Ga0307411_10833575 | 3300032005 | Bacteria | 815 |
| 792 | Ga0307411_10935178 | 3300032005 | Bacteria | 772 |
| 793 | Ga0307415_100539626 | 3300032126 | Bacteria | 1027 |
| 794 | Ga0307415_100653888 | 3300032126 | Bacteria | 943 |
| 795 | Ga0307415_100750955 | 3300032126 | Bacteria | 886 |
| 796 | Ga0307415_101254395 | 3300032126 | Bacteria | 700 |
| 797 | Ga0307415_102498791 | 3300032126 | Bacteria | 509 |
| 798 | Ga0316583_10019225 | 3300032133 | Bacteria | 2452 |
| 799 | Ga0316583_10037476 | 3300032133 | Bacteria | 1719 |
| 800 | Ga0316583_10060858 | 3300032133 | Bacteria | 1323 |
| 801 | Ga0316585_10098244 | 3300032137 | Bacteria | 959 |
| 802 | Ga0316585_10219646 | 3300032137 | Bacteria | 629 |
| 803 | Ga0316585_10238511 | 3300032137 | Bacteria | 602 |
| 804 | Ga0316580_10191924 | 3300032139 | Bacteria | 629 |
| 805 | Ga0316593_10002261 | 3300032168 | Bacteria | 4516 |
| 806 | Ga0316593_10008887 | 3300032168 | Bacteria | 2820 |
| 807 | Ga0316593_10009046 | 3300032168 | Bacteria | 2799 |
| 808 | Ga0316593_10071900 | 3300032168 | Bacteria | 1197 |
| 809 | Ga0316593_10132724 | 3300032168 | Bacteria | 899 |
| 810 | Ga0316593_10177769 | 3300032168 | Bacteria | 782 |
| 811 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 812 | Ga0307510_10038803 | 3300033180 | Bacteria | 5259 |
| 813 | Ga0316592_1112428 | 3300033524 | Bacteria | 630 |
| 814 | Ga0316587_1110358 | 3300033529 | Bacteria | 534 |
| 815 | Ga0316596_1040230 | 3300033541 | Bacteria | 1227 |
| 816 | Ga0316596_1101239 | 3300033541 | Bacteria | 779 |
| 817 | Ga0316596_1201300 | 3300033541 | Bacteria | 554 |
| 818 | Ga0373948_0117083 | 3300034817 | Bacteria | 641 |
| 819 | Ga0373934_0172633 | 3300035086 | Bacteria | 888 |
| 820 | Ga0373940_0219738 | 3300035088 | Bacteria | 631 |
| 821 | Ga0373951_0045728 | 3300035091 | Bacteria | 1066 |
| 822 | Ga0373952_0086760 | 3300035092 | Bacteria | 807 |
| 823 | Ga0373923_0248228 | 3300035111 | Bacteria | 833 |
| 824 | Ga0373923_0426648 | 3300035111 | Bacteria | 641 |
| 825 | Ga0373936_0022331 | 3300035113 | Bacteria | 2464 |
| 826 | Ga0373936_0049230 | 3300035113 | Bacteria | 1702 |
| 827 | Ga0373936_0500272 | 3300035113 | Bacteria | 565 |
| 828 | Ga0373953_0134980 | 3300035117 | Bacteria | 1054 |
| 829 | Ga0373954_0581950 | 3300035118 | Bacteria | 555 |
| 830 | Ga0373956_0129592 | 3300035119 | Bacteria | 1181 |
| 831 | Ga0373957_0208156 | 3300035120 | Bacteria | 817 |
| 832 | Ga0373946_0409211 | 3300035171 | Bacteria | 686 |
| 833 | Ga0373955_0314504 | 3300035172 | Bacteria | 946 |
| 834 | Ga0373961_0192657 | 3300035241 | Bacteria | 716 |
| 835 | Ga0373962_0076741 | 3300035242 | Bacteria | 1008 |
| 836 | Ga0316574_0017689 | 3300035398 | Bacteria | 4177 |
| 837 | Ga0316574_0030031 | 3300035398 | Bacteria | 3288 |
| 838 | Ga0316574_0120412 | 3300035398 | Bacteria | 1685 |
| 839 | Ga0316574_0520826 | 3300035398 | Bacteria | 740 |
| 840 | Ga0316574_0674841 | 3300035398 | Bacteria | 635 |
| 841 | Ga0316574_0878369 | 3300035398 | Bacteria | 543 |
| 842 | Ga0316574_0944990 | 3300035398 | Bacteria | 520 |
| 843 | Ga0373924_0400309 | 3300035410 | Bacteria | 614 |
| 844 | Ga0373931_0074168 | 3300035691 | Bacteria | 1864 |
| 845 | Ga0373935_0098770 | 3300035692 | Bacteria | 1922 |
| 846 | Ga0373935_0649283 | 3300035692 | Bacteria | 774 |
| 847 | Ga0373927_0686543 | 3300035695 | Bacteria | 676 |
| 848 | Ga0373933_0726994 | 3300035724 | Bacteria | 653 |
| 849 | Ga0373937_0230073 | 3300036401 | Bacteria | 1746 |
| 850 | Ga0373937_0352801 | 3300036401 | Bacteria | 1393 |
| 851 | Ga0373937_1810936 | 3300036401 | Bacteria | 557 |
| 852 | Ga0316582_0013733 | 3300036647 | Bacteria | 4568 |
| 853 | Ga0316582_0031308 | 3300036647 | Bacteria | 3250 |
| 854 | Ga0316582_0036762 | 3300036647 | Bacteria | 3032 |
| 855 | Ga0316582_0036824 | 3300036647 | Bacteria | 3030 |
| 856 | Ga0316582_0037163 | 3300036647 | Bacteria | 3017 |
| 857 | Ga0316582_0102210 | 3300036647 | Bacteria | 1899 |
| 858 | Ga0316584_0006541 | 3300036712 | Bacteria | 7895 |
| 859 | Ga0316584_0013058 | 3300036712 | Bacteria | 5870 |
| 860 | Ga0316584_0020240 | 3300036712 | Bacteria | 4821 |
| 861 | Ga0316584_0098654 | 3300036712 | Bacteria | 2187 |
| 862 | Ga0316584_0147131 | 3300036712 | Bacteria | 1755 |
| 863 | Ga0316584_0623978 | 3300036712 | Bacteria | 745 |
| 864 | Ga0316584_0857075 | 3300036712 | Bacteria | 614 |
| 865 | Ga0373925_0280903 | 3300037068 | Bacteria | 1341 |
| 866 | Ga0373925_0412262 | 3300037068 | Bacteria | 1103 |
| 867 | Ga0373925_1367703 | 3300037068 | Bacteria | 580 |
| 868 | Ga0316581_0000292 | 3300037588 | Bacteria | 8862 |
| 869 | Ga0316581_0209325 | 3300037588 | Bacteria | 600 |
| 870 | Ga0316581_0224402 | 3300037588 | Bacteria | 578 |
| 871 | Ga0395901_0749020 | 3300038443 | Bacteria | 970 |
| 872 | Ga0436365_0844919 | 3300039437 | Bacteria | 890 |
| 873 | Ga0436365_1214120 | 3300039437 | Bacteria | 1114 |
| 874 | Ga0436365_1360668 | 3300039437 | Bacteria | 4000 |
| 875 | Ga0436360_0380318 | 3300039438 | Bacteria | 2167 |
| 876 | Ga0436360_0515949 | 3300039438 | Bacteria | 1384 |
| 877 | Ga0436360_0593715 | 3300039438 | Bacteria | 2864 |
| 878 | Ga0436360_0826695 | 3300039438 | Bacteria | 563 |
| 879 | Ga0436360_0942877 | 3300039438 | Bacteria | 594 |
| 880 | Ga0436360_1010070 | 3300039438 | Bacteria | 762 |
| 881 | Ga0436361_0136079 | 3300039447 | Bacteria | 521 |
| 882 | Ga0436361_0201071 | 3300039447 | Bacteria | 2590 |
| 883 | Ga0436361_0567398 | 3300039447 | Bacteria | 751 |
| 884 | Ga0436363_0164591 | 3300039450 | Bacteria | 1696 |
| 885 | Ga0436363_0952595 | 3300039450 | Bacteria | 5360 |
| 886 | Ga0436363_1169546 | 3300039450 | Bacteria | 735 |
| 887 | Ga0436363_1439963 | 3300039450 | Bacteria | 804 |
| 888 | Ga0436363_1687372 | 3300039450 | Bacteria | 829 |
| 889 | Ga0436362_0097055 | 3300039453 | Bacteria | 596 |
| 890 | Ga0436362_0352054 | 3300039453 | Bacteria | 703 |
| 891 | Ga0436362_0519667 | 3300039453 | Bacteria | 1850 |
| 892 | Ga0436362_0645059 | 3300039453 | Bacteria | 706 |
| 893 | Ga0439436_0063145 | 3300041404 | Bacteria | 1035 |
| 894 | Ga0439438_002379 | 3300041405 | Bacteria | 8020 |
| 895 | Ga0439439_0264001 | 3300041406 | Bacteria | 513 |
| 896 | Ga0439461_0002118 | 3300041410 | Bacteria | 3139 |
| 897 | Ga0439466_0173061 | 3300041411 | Bacteria | 659 |
| 898 | Ga0439465_0018419 | 3300041413 | Bacteria | 2181 |
| 899 | Ga0439465_0131668 | 3300041413 | Bacteria | 883 |
| 900 | Ga0451787_099410 | 3300041441 | Bacteria | 1049 |
| 901 | Ga0451787_760742 | 3300041441 | Bacteria | 603 |
| 902 | Ga0451789_0137202 | 3300041443 | Bacteria | 1121 |
| 903 | Ga0451791_0494916 | 3300041451 | Bacteria | 692 |
| 904 | Ga0451791_0961898 | 3300041451 | Bacteria | 1079 |
| 905 | Ga0451791_1050206 | 3300041451 | Bacteria | 1190 |
| 906 | Ga0451791_1425262 | 3300041451 | Bacteria | 757 |
| 907 | Ga0451793_0269673 | 3300041452 | Bacteria | 2306 |
| 908 | Ga0451793_0577701 | 3300041452 | Bacteria | 1267 |
| 909 | Ga0451793_0762201 | 3300041452 | Bacteria | 1445 |
| 910 | Ga0451793_1116150 | 3300041452 | Bacteria | 1913 |
| 911 | Ga0451797_0401209 | 3300041453 | Bacteria | 680 |
| 912 | Ga0451795_0635588 | 3300041456 | Bacteria | 515 |
| 913 | Ga0451798_0142136 | 3300041458 | Bacteria | 814 |
| 914 | Ga0451800_0048791 | 3300041459 | Bacteria | 1945 |
| 915 | Ga0451802_0129455 | 3300041460 | Bacteria | 1291 |
| 916 | Ga0451802_1404507 | 3300041460 | Bacteria | 760 |
| 917 | Ga0451802_2055396 | 3300041460 | Bacteria | 4211 |
| 918 | Ga0451806_211117 | 3300041462 | Bacteria | 1721 |
| 919 | Ga0451804_0417164 | 3300041463 | Bacteria | 748 |
| 920 | Ga0451807_0396063 | 3300041486 | Bacteria | 2401 |
| 921 | Ga0451807_1278800 | 3300041486 | Bacteria | 2893 |
| 922 | Ga0451807_1451139 | 3300041486 | Bacteria | 682 |
| 923 | Ga0451807_2648389 | 3300041486 | Bacteria | 2287 |
| 924 | Ga0451833_0022883 | 3300041491 | Bacteria | 1744 |
| 925 | Ga0451837_1238615 | 3300041494 | Bacteria | 963 |
| 926 | Ga0451841_0161635 | 3300041498 | Bacteria | 840 |
| 927 | Ga0451849_0503352 | 3300041505 | Bacteria | 1015 |
| 928 | Ga0451851_1375299 | 3300041507 | Bacteria | 671 |
| 929 | Ga0451843_0723165 | 3300041509 | Bacteria | 1300 |
| 930 | Ga0451843_1159197 | 3300041509 | Bacteria | 2324 |
| 931 | Ga0451843_1698381 | 3300041509 | Bacteria | 646 |
| 932 | Ga0451853_3357331 | 3300041512 | Bacteria | 633 |
| 933 | Ga0439431_0008517 | 3300041997 | Bacteria | 2309 |
| 934 | Ga0439433_0110391 | 3300041999 | Bacteria | 688 |
| 935 | Ga0439437_009360 | 3300042000 | Bacteria | 1108 |
| 936 | Ga0439442_008746 | 3300042002 | Bacteria | 2044 |
| 937 | Ga0439443_006790 | 3300042003 | Bacteria | 1575 |
| 938 | Ga0439448_0102766 | 3300042005 | Bacteria | 972 |
| 939 | Ga0439432_013881 | 3300042006 | Bacteria | 2731 |
| 940 | Ga0439432_040586 | 3300042006 | Bacteria | 1476 |
| 941 | Ga0439449_0005200 | 3300042007 | Bacteria | 4994 |
| 942 | Ga0439450_064872 | 3300042008 | Bacteria | 888 |
| 943 | Ga0439452_037451 | 3300042010 | Bacteria | 1156 |
| 944 | Ga0439454_035191 | 3300042011 | Bacteria | 801 |
| 945 | Ga0439455_0022714 | 3300042012 | Bacteria | 1506 |
| 946 | Ga0439455_0140419 | 3300042012 | Bacteria | 684 |
| 947 | Ga0439456_000224 | 3300042013 | Bacteria | 15438 |
| 948 | Ga0439456_014967 | 3300042013 | Bacteria | 1618 |
| 949 | Ga0439457_046307 | 3300042014 | Bacteria | 973 |
| 950 | Ga0450911_000005 | 3300042115 | Bacteria | 233469 |
| 951 | Ga0450917_008885 | 3300042120 | Bacteria | 781 |
| 952 | Ga0450892_020384 | 3300042130 | Bacteria | 648 |
| 953 | Ga0450898_151929 | 3300042134 | Bacteria | 507 |
| 954 | Ga0450900_005178 | 3300042136 | Bacteria | 1531 |
| 955 | Ga0450900_025628 | 3300042136 | Bacteria | 840 |
| 956 | Ga0450903_060560 | 3300042138 | Bacteria | 549 |
| 957 | Ga0450903_061596 | 3300042138 | Bacteria | 544 |
| 958 | Ga0450904_000002 | 3300042139 | Bacteria | 82376 |
| 959 | Ga0450905_002387 | 3300042142 | Bacteria | 2410 |
| 960 | Ga0450905_008100 | 3300042142 | Bacteria | 1436 |
| 961 | Ga0450905_099360 | 3300042142 | Bacteria | 521 |
| 962 | Ga0450889_023204 | 3300042144 | Bacteria | 699 |
| 963 | Ga0439446_0375064 | 3300042156 | Bacteria | 510 |
| 964 | Ga0439444_0125881 | 3300042437 | Bacteria | 602 |
| 965 | Ga0439459_0007151 | 3300042438 | Bacteria | 1878 |
| 966 | Ga0439464_0178424 | 3300042439 | Bacteria | 672 |
| 967 | Ga0439464_0238835 | 3300042439 | Bacteria | 585 |
| 968 | Ga0450916_008977 | 3300042530 | Bacteria | 1227 |
| 969 | Ga0450916_009543 | 3300042530 | Bacteria | 1201 |
| 970 | Ga0450901_000683 | 3300042533 | Bacteria | 4010 |
| 971 | Ga0451577_0000105 | 3300042876 | Bacteria | 184360 |
| 972 | Ga0451577_0128767 | 3300042876 | Bacteria | 2270 |
| 973 | Ga0451577_0568651 | 3300042876 | Bacteria | 1029 |
| 974 | Ga0451577_0641866 | 3300042876 | Bacteria | 963 |
| 975 | Ga0439440_0053011 | 3300042993 | Bacteria | 1018 |
| 976 | Ga0439440_0229706 | 3300042993 | Bacteria | 559 |
| 977 | Ga0466969_0014574 | 3300044656 | Bacteria | 4132 |
| 978 | Ga0466969_0088720 | 3300044656 | Bacteria | 1468 |
| 979 | Ga0466972_0143428 | 3300044658 | Bacteria | 1124 |
| 980 | Ga0466972_0283035 | 3300044658 | Bacteria | 775 |
| 981 | Ga0466965_0211482 | 3300044683 | Bacteria | 1031 |
| 982 | Ga0466966_0004186 | 3300044684 | Bacteria | 9527 |
| 983 | Ga0466966_0395644 | 3300044684 | Bacteria | 830 |
| 984 | Ga0466961_0020090 | 3300044693 | Bacteria | 4298 |
| 985 | Ga0466964_0004197 | 3300044706 | Bacteria | 5301 |
| 986 | Ga0453684_0003537 | 3300044712 | Bacteria | 34947 |
| 987 | Ga0453684_0034985 | 3300044712 | Bacteria | 6955 |
| 988 | Ga0453684_0220280 | 3300044712 | Bacteria | 2199 |
| 989 | Ga0466971_0002218 | 3300044719 | Bacteria | 8217 |
| 990 | Ga0466971_0380102 | 3300044719 | Bacteria | 686 |
| 991 | Ga0466968_0218920 | 3300044735 | Bacteria | 896 |
| 992 | Ga0466970_0015790 | 3300044765 | Bacteria | 3887 |
| 993 | Ga0466970_0161945 | 3300044765 | Bacteria | 1238 |
| 994 | Ga0466970_0276325 | 3300044765 | Bacteria | 944 |
| 995 | Ga0466957_0018370 | 3300044842 | Bacteria | 4106 |
| 996 | Ga0466957_0572185 | 3300044842 | Bacteria | 789 |
| 997 | Ga0466959_0022009 | 3300045049 | Bacteria | 4709 |
| 998 | Ga0466959_0048755 | 3300045049 | Bacteria | 3112 |
| 999 | Ga0466959_0072728 | 3300045049 | Bacteria | 2488 |
| 1000 | Ga0466959_0081512 | 3300045049 | Bacteria | 2331 |
| 1001 | Ga0466959_0958262 | 3300045049 | Bacteria | 570 |
| 1002 | Ga0451576_0000741 | 3300045051 | Bacteria | 65303 |
| 1003 | Ga0451576_0014390 | 3300045051 | Bacteria | 8809 |
| 1004 | Ga0451576_0359358 | 3300045051 | Bacteria | 1525 |
| 1005 | Ga0451576_0758278 | 3300045051 | Bacteria | 1019 |
| 1006 | Ga0466958_0114325 | 3300045836 | Bacteria | 1686 |
| 1007 | Ga0495617_024700 | 3300046452 | Bacteria | 2027 |
| 1008 | Ga0495627_000424 | 3300046453 | Bacteria | 36677 |
| 1009 | Ga0495627_000496 | 3300046453 | Bacteria | 33018 |
| 1010 | Ga0495627_001316 | 3300046453 | Bacteria | 15137 |
| 1011 | Ga0495627_008095 | 3300046453 | Bacteria | 3963 |
| 1012 | Ga0495627_079133 | 3300046453 | Bacteria | 954 |
| 1013 | Ga0495591_000849 | 3300046458 | Bacteria | 21493 |
| 1014 | Ga0495591_009341 | 3300046458 | Bacteria | 3906 |
| 1015 | Ga0495591_040223 | 3300046458 | Bacteria | 1334 |
| 1016 | Ga0495629_0299467 | 3300046459 | Bacteria | 1101 |
| 1017 | Ga0495629_0648537 | 3300046459 | Bacteria | 704 |
| 1018 | Ga0495641_0390721 | 3300046461 | Bacteria | 631 |
| 1019 | Ga0495651_0963061 | 3300046462 | Bacteria | 519 |
| 1020 | Ga0495653_0005238 | 3300046463 | Bacteria | 10546 |
| 1021 | Ga0495650_0008755 | 3300046471 | Bacteria | 5856 |
| 1022 | Ga0495650_0018342 | 3300046471 | Bacteria | 3478 |
| 1023 | Ga0495650_0021605 | 3300046471 | Bacteria | 3105 |
| 1024 | Ga0495650_0035382 | 3300046471 | Bacteria | 2199 |
| 1025 | Ga0495580_0107838 | 3300046472 | Bacteria | 1934 |
| 1026 | Ga0495582_0603442 | 3300046473 | Bacteria | 635 |
| 1027 | Ga0495605_0000449 | 3300046474 | Bacteria | 36901 |
| 1028 | Ga0495605_0000461 | 3300046474 | Bacteria | 36449 |
| 1029 | Ga0495664_0740603 | 3300046477 | Bacteria | 580 |
| 1030 | Ga0495584_0052116 | 3300046491 | Bacteria | 2059 |
| 1031 | Ga0495584_0108849 | 3300046491 | Bacteria | 1401 |
| 1032 | Ga0495585_0003113 | 3300046492 | Bacteria | 11385 |
| 1033 | Ga0495607_0000490 | 3300046501 | Bacteria | 39577 |
| 1034 | Ga0495607_0000544 | 3300046501 | Bacteria | 36921 |
| 1035 | Ga0495607_0000841 | 3300046501 | Bacteria | 29029 |
| 1036 | Ga0495607_0063674 | 3300046501 | Bacteria | 2085 |
| 1037 | Ga0495607_0099414 | 3300046501 | Bacteria | 1560 |
| 1038 | Ga0495607_0122780 | 3300046501 | Bacteria | 1361 |
| 1039 | Ga0495607_0184100 | 3300046501 | Bacteria | 1045 |
| 1040 | Ga0495607_0226057 | 3300046501 | Bacteria | 912 |
| 1041 | Ga0495583_0000861 | 3300046506 | Bacteria | 36885 |
| 1042 | Ga0495583_0004417 | 3300046506 | Bacteria | 10076 |
| 1043 | Ga0495583_0032928 | 3300046506 | Bacteria | 2497 |
| 1044 | Ga0495583_0371704 | 3300046506 | Bacteria | 563 |
| 1045 | Ga0495606_0001804 | 3300046507 | Bacteria | 27243 |
| 1046 | Ga0495606_0006268 | 3300046507 | Bacteria | 11034 |
| 1047 | Ga0495606_0168322 | 3300046507 | Bacteria | 1273 |
| 1048 | Ga0495606_0515192 | 3300046507 | Bacteria | 601 |
| 1049 | Ga0495610_0003557 | 3300046512 | Bacteria | 12062 |
| 1050 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 1051 | Ga0495620_0001260 | 3300046515 | Bacteria | 15445 |
| 1052 | Ga0495620_0003107 | 3300046515 | Bacteria | 9537 |
| 1053 | Ga0495631_0004082 | 3300046518 | Bacteria | 7841 |
| 1054 | Ga0495631_0023789 | 3300046518 | Bacteria | 2835 |
| 1055 | Ga0495631_0049517 | 3300046518 | Bacteria | 1839 |
| 1056 | Ga0495632_0003927 | 3300046519 | Bacteria | 10327 |
| 1057 | Ga0495632_0005427 | 3300046519 | Bacteria | 8431 |
| 1058 | Ga0495632_0048630 | 3300046519 | Bacteria | 2099 |
| 1059 | Ga0495632_0125156 | 3300046519 | Bacteria | 1198 |
| 1060 | Ga0495632_0336259 | 3300046519 | Bacteria | 665 |
| 1061 | Ga0495637_0002014 | 3300046520 | Bacteria | 11466 |
| 1062 | Ga0495643_0000917 | 3300046522 | Bacteria | 30970 |
| 1063 | Ga0495643_0003034 | 3300046522 | Bacteria | 12623 |
| 1064 | Ga0495643_0006177 | 3300046522 | Bacteria | 7950 |
| 1065 | Ga0495648_0003639 | 3300046524 | Bacteria | 13473 |
| 1066 | Ga0495648_0003944 | 3300046524 | Bacteria | 12851 |
| 1067 | Ga0495648_0010333 | 3300046524 | Bacteria | 7119 |
| 1068 | Ga0495648_0017142 | 3300046524 | Bacteria | 5189 |
| 1069 | Ga0495648_0312114 | 3300046524 | Bacteria | 732 |
| 1070 | Ga0495642_0521381 | 3300046528 | Bacteria | 527 |
| 1071 | Ga0495654_0020728 | 3300046530 | Bacteria | 3424 |
| 1072 | Ga0495654_0076246 | 3300046530 | Bacteria | 1580 |
| 1073 | Ga0495654_0140619 | 3300046530 | Bacteria | 1076 |
| 1074 | Ga0495654_0254239 | 3300046530 | Bacteria | 730 |
| 1075 | Ga0495587_0018441 | 3300046536 | Bacteria | 4327 |
| 1076 | Ga0495609_0000153 | 3300046538 | Bacteria | 71744 |
| 1077 | Ga0495622_0437774 | 3300046557 | Bacteria | 561 |
| 1078 | Ga0495633_0000300 | 3300046558 | Bacteria | 56356 |
| 1079 | Ga0495633_0016022 | 3300046558 | Bacteria | 3877 |
| 1080 | Ga0495633_0034834 | 3300046558 | Bacteria | 2419 |
| 1081 | Ga0495668_0049124 | 3300046616 | Bacteria | 2339 |
| 1082 | Ga0495668_0215387 | 3300046616 | Bacteria | 1051 |
| 1083 | Ga0495611_0003885 | 3300046648 | Bacteria | 6509 |
| 1084 | Ga0495611_0227622 | 3300046648 | Bacteria | 867 |
| 1085 | Ga0495625_0051346 | 3300046660 | Bacteria | 2956 |
| 1086 | Ga0495625_0116455 | 3300046660 | Bacteria | 1823 |
| 1087 | Ga0495625_0126691 | 3300046660 | Bacteria | 1733 |
| 1088 | Ga0495625_0156283 | 3300046660 | Bacteria | 1530 |
| 1089 | Ga0495661_0000538 | 3300046665 | Bacteria | 39127 |
| 1090 | Ga0495661_0001311 | 3300046665 | Bacteria | 21132 |
| 1091 | Ga0495661_0045241 | 3300046665 | Bacteria | 2693 |
| 1092 | Ga0495661_0225039 | 3300046665 | Bacteria | 970 |
| 1093 | Ga0495599_0886783 | 3300046678 | Bacteria | 506 |
| 1094 | Ga0495646_0231982 | 3300046680 | Bacteria | 994 |
| 1095 | Ga0495613_0097182 | 3300046689 | Bacteria | 2129 |
| 1096 | Ga0495670_0003681 | 3300046691 | Bacteria | 7537 |
| 1097 | Ga0495670_0560107 | 3300046691 | Bacteria | 622 |
| 1098 | Ga0495671_0002986 | 3300046692 | Bacteria | 10508 |
| 1099 | Ga0495671_0003782 | 3300046692 | Bacteria | 9199 |
| 1100 | Ga0495671_0004634 | 3300046692 | Bacteria | 8152 |
| 1101 | Ga0495671_0035909 | 3300046692 | Bacteria | 2514 |
| 1102 | Ga0495649_0177366 | 3300046694 | Bacteria | 1113 |
| 1103 | Ga0495649_0518270 | 3300046694 | Bacteria | 592 |
| 1104 | Ga0495589_0003579 | 3300046794 | Bacteria | 8398 |
| 1105 | Ga0495589_0085799 | 3300046794 | Bacteria | 1529 |
| 1106 | Ga0495589_0527828 | 3300046794 | Bacteria | 538 |
| 1107 | Ga0495600_0048423 | 3300046809 | Bacteria | 2772 |
| 1108 | Ga0495660_0000879 | 3300046810 | Bacteria | 22220 |
| 1109 | Ga0495660_0059143 | 3300046810 | Bacteria | 2062 |
| 1110 | Ga0495672_0004648 | 3300047320 | Bacteria | 11142 |
| 1111 | Ga0495672_0009343 | 3300047320 | Bacteria | 7117 |
| 1112 | Ga0495672_0045928 | 3300047320 | Bacteria | 2609 |
| 1113 | Ga0495672_0073906 | 3300047320 | Bacteria | 1921 |
| 1114 | Ga0495672_0258781 | 3300047320 | Bacteria | 841 |
| 1115 | Ga0495680_0019915 | 3300047322 | Bacteria | 5655 |
| 1116 | Ga0495680_0592466 | 3300047322 | Bacteria | 743 |
| 1117 | Ga0495683_0000371 | 3300047323 | Bacteria | 36984 |
| 1118 | Ga0495683_0020063 | 3300047323 | Bacteria | 3448 |
| 1119 | Ga0495687_011253 | 3300047443 | Bacteria | 4823 |
| 1120 | Ga0495675_0126005 | 3300047444 | Bacteria | 1593 |
| 1121 | Ga0495679_001695 | 3300047446 | Bacteria | 12223 |
| 1122 | Ga0495673_0000441 | 3300047469 | Bacteria | 45987 |
| 1123 | Ga0495673_0005418 | 3300047469 | Bacteria | 7714 |
| 1124 | Ga0495673_0014278 | 3300047469 | Bacteria | 4134 |
| 1125 | Ga0495673_0077839 | 3300047469 | Bacteria | 1380 |
| 1126 | Ga0495673_0316127 | 3300047469 | Bacteria | 557 |
| 1127 | Ga0495681_0010196 | 3300047470 | Bacteria | 5706 |
| 1128 | Ga0495681_0012745 | 3300047470 | Bacteria | 4922 |
| 1129 | Ga0495686_0215600 | 3300047472 | Bacteria | 1094 |
| 1130 | Ga0495615_0157045 | 3300048090 | Bacteria | 681 |
| 1131 | Ga0496100_0171274 | 3300048903 | Bacteria | 1564 |
| 1132 | Ga0496100_0193835 | 3300048903 | Bacteria | 1477 |
| 1133 | Ga0496100_0668261 | 3300048903 | Bacteria | 810 |
| 1134 | Ga0496100_1073885 | 3300048903 | Bacteria | 634 |
| 1135 | Ga0496101_0062886 | 3300048904 | Bacteria | 2700 |
| 1136 | Ga0496101_0256566 | 3300048904 | Bacteria | 1363 |
| 1137 | Ga0496101_0794622 | 3300048904 | Bacteria | 746 |
| 1138 | Ga0496101_0839608 | 3300048904 | Bacteria | 724 |
| 1139 | Ga0496102_0018568 | 3300048905 | Bacteria | 6114 |
| 1140 | Ga0496102_0018878 | 3300048905 | Bacteria | 6066 |
| 1141 | Ga0496102_0664196 | 3300048905 | Bacteria | 965 |
| 1142 | Ga0496103_0145762 | 3300048906 | Bacteria | 1515 |
| 1143 | Ga0496104_0007534 | 3300048907 | Bacteria | 9624 |
| 1144 | Ga0496104_0025932 | 3300048907 | Bacteria | 5405 |
| 1145 | Ga0496104_0291973 | 3300048907 | Bacteria | 1543 |
| 1146 | Ga0496104_0558271 | 3300048907 | Bacteria | 1056 |
| 1147 | Ga0496105_0002244 | 3300048908 | Bacteria | 13996 |
| 1148 | Ga0496105_0003869 | 3300048908 | Bacteria | 11191 |
| 1149 | Ga0496105_1083126 | 3300048908 | Bacteria | 596 |
| 1150 | Ga0496106_0034846 | 3300048909 | Bacteria | 3762 |
| 1151 | Ga0496106_0238810 | 3300048909 | Bacteria | 1452 |
| 1152 | Ga0496106_0956057 | 3300048909 | Bacteria | 675 |
| 1153 | Ga0496108_0011729 | 3300048911 | Bacteria | 7127 |
| 1154 | Ga0496108_0099406 | 3300048911 | Bacteria | 2480 |
| 1155 | Ga0496108_0183338 | 3300048911 | Bacteria | 1813 |
| 1156 | Ga0496108_0521059 | 3300048911 | Bacteria | 1038 |
| 1157 | Ga0496109_0019965 | 3300048912 | Bacteria | 5915 |
| 1158 | Ga0496110_0009253 | 3300048913 | Bacteria | 7962 |
| 1159 | Ga0496110_0013330 | 3300048913 | Bacteria | 6792 |
| 1160 | Ga0496110_0186911 | 3300048913 | Bacteria | 1881 |
| 1161 | Ga0496110_0247943 | 3300048913 | Bacteria | 1621 |
| 1162 | Ga0496110_0258743 | 3300048913 | Bacteria | 1584 |
| 1163 | Ga0496111_0004803 | 3300048914 | Bacteria | 8572 |
| 1164 | Ga0496111_0287462 | 3300048914 | Bacteria | 1219 |
| 1165 | Ga0496111_0297142 | 3300048914 | Bacteria | 1197 |
| 1166 | Ga0496111_0321330 | 3300048914 | Bacteria | 1146 |
| 1167 | Ga0496112_0139570 | 3300048915 | Bacteria | 2393 |
| 1168 | Ga0496112_0236066 | 3300048915 | Bacteria | 1782 |
| 1169 | Ga0496112_0408518 | 3300048915 | Bacteria | 1297 |
| 1170 | Ga0496112_1754343 | 3300048915 | Bacteria | 533 |
| 1171 | Ga0496114_0028572 | 3300048917 | Bacteria | 4577 |
| 1172 | Ga0496114_0040475 | 3300048917 | Bacteria | 3859 |
| 1173 | Ga0496114_0084456 | 3300048917 | Bacteria | 2688 |
| 1174 | Ga0496114_0489139 | 3300048917 | Bacteria | 1088 |
| 1175 | Ga0496115_0082741 | 3300048918 | Bacteria | 2616 |
| 1176 | Ga0496115_0127308 | 3300048918 | Bacteria | 2098 |
| 1177 | Ga0496115_1300079 | 3300048918 | Bacteria | 542 |
| 1178 | Ga0496116_0008971 | 3300048919 | Bacteria | 8599 |
| 1179 | Ga0496116_0016264 | 3300048919 | Bacteria | 5831 |
| 1180 | Ga0496116_0020453 | 3300048919 | Bacteria | 5026 |
| 1181 | Ga0496117_0000054 | 3300048920 | Bacteria | 278013 |
| 1182 | Ga0496117_0000334 | 3300048920 | Bacteria | 83273 |
| 1183 | Ga0496117_0000798 | 3300048920 | Bacteria | 49089 |
| 1184 | Ga0496117_0006004 | 3300048920 | Bacteria | 12502 |
| 1185 | Ga0496117_0017273 | 3300048920 | Bacteria | 6034 |
| 1186 | Ga0496117_0057179 | 3300048920 | Bacteria | 2711 |
| 1187 | Ga0496117_0096534 | 3300048920 | Bacteria | 1885 |
| 1188 | Ga0496118_0000045 | 3300048921 | Bacteria | 275165 |
| 1189 | Ga0496118_0003619 | 3300048921 | Bacteria | 19184 |
| 1190 | Ga0496118_0006724 | 3300048921 | Bacteria | 12529 |
| 1191 | Ga0496118_0013622 | 3300048921 | Bacteria | 7677 |
| 1192 | Ga0496118_0028632 | 3300048921 | Bacteria | 4687 |
| 1193 | Ga0496118_0057707 | 3300048921 | Bacteria | 2907 |
| 1194 | Ga0496118_0063473 | 3300048921 | Bacteria | 2717 |
| 1195 | Ga0496118_0168475 | 3300048921 | Bacteria | 1342 |
| 1196 | Ga0496118_0464672 | 3300048921 | Bacteria | 639 |
| 1197 | Ga0496119_0000380 | 3300048922 | Bacteria | 61208 |
| 1198 | Ga0496119_0007592 | 3300048922 | Bacteria | 9729 |
| 1199 | Ga0496119_0015657 | 3300048922 | Bacteria | 5819 |
| 1200 | Ga0496119_0145844 | 3300048922 | Bacteria | 1273 |
| 1201 | Ga0496119_0264672 | 3300048922 | Bacteria | 861 |
| 1202 | Ga0496120_0000570 | 3300048923 | Bacteria | 56326 |
| 1203 | Ga0496120_0002710 | 3300048923 | Bacteria | 17352 |
| 1204 | Ga0496120_0113063 | 3300048923 | Bacteria | 1415 |
| 1205 | Ga0496120_0190249 | 3300048923 | Bacteria | 1001 |
| 1206 | Ga0496120_0294816 | 3300048923 | Bacteria | 745 |
| 1207 | Ga0496121_0002897 | 3300048924 | Bacteria | 25213 |
| 1208 | Ga0496121_0004919 | 3300048924 | Bacteria | 17531 |
| 1209 | Ga0496121_0015841 | 3300048924 | Bacteria | 7841 |
| 1210 | Ga0496121_0020386 | 3300048924 | Bacteria | 6568 |
| 1211 | Ga0496121_0064016 | 3300048924 | Bacteria | 3000 |
| 1212 | Ga0496121_0072566 | 3300048924 | Bacteria | 2763 |
| 1213 | Ga0496121_0125269 | 3300048924 | Bacteria | 1932 |
| 1214 | Ga0496121_0161763 | 3300048924 | Bacteria | 1636 |
| 1215 | Ga0496121_0200859 | 3300048924 | Bacteria | 1421 |
| 1216 | Ga0496122_0002009 | 3300048925 | Bacteria | 30251 |
| 1217 | Ga0496122_0002614 | 3300048925 | Bacteria | 25219 |
| 1218 | Ga0496122_0027322 | 3300048925 | Bacteria | 4883 |
| 1219 | Ga0496122_0028114 | 3300048925 | Bacteria | 4784 |
| 1220 | Ga0496122_0164164 | 3300048925 | Bacteria | 1349 |
| 1221 | Ga0496122_0293928 | 3300048925 | Bacteria | 880 |
| 1222 | Ga0496123_0000706 | 3300048926 | Bacteria | 54610 |
| 1223 | Ga0496123_0001758 | 3300048926 | Bacteria | 28593 |
| 1224 | Ga0496123_0029385 | 3300048926 | Bacteria | 4047 |
| 1225 | Ga0496123_0063671 | 3300048926 | Bacteria | 2354 |
| 1226 | Ga0496123_0069050 | 3300048926 | Bacteria | 2221 |
| 1227 | Ga0496123_0240888 | 3300048926 | Bacteria | 898 |
| 1228 | Ga0496124_0000132 | 3300048927 | Bacteria | 155405 |
| 1229 | Ga0496124_0001105 | 3300048927 | Bacteria | 42427 |
| 1230 | Ga0496124_0013196 | 3300048927 | Bacteria | 8080 |
| 1231 | Ga0496124_0015927 | 3300048927 | Bacteria | 7178 |
| 1232 | Ga0496124_0017522 | 3300048927 | Bacteria | 6746 |
| 1233 | Ga0496124_0030811 | 3300048927 | Bacteria | 4753 |
| 1234 | Ga0496124_0031893 | 3300048927 | Bacteria | 4660 |
| 1235 | Ga0496124_0152550 | 3300048927 | Bacteria | 1810 |
| 1236 | Ga0496124_0220087 | 3300048927 | Bacteria | 1428 |
| 1237 | Ga0496124_0275591 | 3300048927 | Bacteria | 1229 |
| 1238 | Ga0496124_0491235 | 3300048927 | Bacteria | 826 |
| 1239 | Ga0496124_0519930 | 3300048927 | Bacteria | 793 |
| 1240 | Ga0496125_0001279 | 3300048928 | Bacteria | 37354 |
| 1241 | Ga0496125_0006982 | 3300048928 | Bacteria | 12084 |
| 1242 | Ga0496125_0007611 | 3300048928 | Bacteria | 11497 |
| 1243 | Ga0496125_0019903 | 3300048928 | Bacteria | 6311 |
| 1244 | Ga0496125_0038453 | 3300048928 | Bacteria | 4141 |
| 1245 | Ga0496125_0190724 | 3300048928 | Bacteria | 1353 |
| 1246 | Ga0496125_0378962 | 3300048928 | Bacteria | 834 |
| 1247 | Ga0496125_0512480 | 3300048928 | Bacteria | 672 |
| 1248 | Ga0496126_0025805 | 3300048929 | Bacteria | 5646 |
| 1249 | Ga0496126_0051230 | 3300048929 | Bacteria | 3759 |
| 1250 | Ga0496126_0081305 | 3300048929 | Bacteria | 2864 |
| 1251 | Ga0496126_0085051 | 3300048929 | Bacteria | 2789 |
| 1252 | Ga0496126_0202568 | 3300048929 | Bacteria | 1675 |
| 1253 | Ga0496126_0298740 | 3300048929 | Bacteria | 1329 |
| 1254 | Ga0495678_000536 | 3300049459 | Bacteria | 36666 |
| 1255 | Ga0495678_001447 | 3300049459 | Bacteria | 18697 |
| 1256 | Ga0495678_024441 | 3300049459 | Bacteria | 2609 |
| 1257 | Ga0495682_0000613 | 3300049460 | Bacteria | 24066 |
| 1258 | Ga0495682_0000919 | 3300049460 | Bacteria | 17922 |
| 1259 | Ga0501031_0203939 | 3300049568 | Bacteria | 1290 |
| 1260 | Ga0501032_0202959 | 3300049569 | Bacteria | 1294 |
| 1261 | Ga0501033_0029032 | 3300049570 | Bacteria | 4155 |
| 1262 | Ga0501033_0169901 | 3300049570 | Bacteria | 1566 |
| 1263 | Ga0501034_0000692 | 3300049571 | Bacteria | 51206 |
| 1264 | Ga0501034_0535090 | 3300049571 | Bacteria | 1082 |
| 1265 | Ga0501036_0074554 | 3300049572 | Bacteria | 2870 |
| 1266 | Ga0501036_0738013 | 3300049572 | Bacteria | 813 |
| 1267 | Ga0501036_1348958 | 3300049572 | Bacteria | 579 |
| 1268 | Ga0501037_0899304 | 3300049573 | Bacteria | 580 |
| 1269 | Ga0501038_0151006 | 3300049574 | Bacteria | 1894 |
| 1270 | Ga0501039_1245585 | 3300049575 | Bacteria | 575 |
| 1271 | Ga0501040_0017931 | 3300049576 | Bacteria | 4699 |
| 1272 | Ga0501040_0239186 | 3300049576 | Bacteria | 1294 |
| 1273 | Ga0501041_0062832 | 3300049577 | Bacteria | 2274 |
| 1274 | Ga0501041_0186805 | 3300049577 | Bacteria | 1298 |
| 1275 | Ga0501042_0011940 | 3300049578 | Bacteria | 5870 |
| 1276 | Ga0501042_0153347 | 3300049578 | Bacteria | 1661 |
| 1277 | Ga0501042_1122685 | 3300049578 | Bacteria | 573 |
| 1278 | Ga0501043_0331124 | 3300049579 | Bacteria | 1160 |
| 1279 | Ga0501043_0578753 | 3300049579 | Bacteria | 831 |
| 1280 | Ga0501043_0945438 | 3300049579 | Bacteria | 616 |
| 1281 | Ga0501046_0105464 | 3300049580 | Bacteria | 2158 |
| 1282 | Ga0501046_0155892 | 3300049580 | Bacteria | 1720 |
| 1283 | Ga0501047_0050139 | 3300049581 | Bacteria | 4031 |
| 1284 | Ga0501047_0165008 | 3300049581 | Bacteria | 2086 |
| 1285 | Ga0501047_0340257 | 3300049581 | Bacteria | 1338 |
| 1286 | Ga0501047_0459646 | 3300049581 | Bacteria | 1102 |
| 1287 | Ga0501047_0654394 | 3300049581 | Bacteria | 870 |
| 1288 | Ga0501047_1239098 | 3300049581 | Bacteria | 560 |
| 1289 | Ga0501048_0023751 | 3300049582 | Bacteria | 4477 |
| 1290 | Ga0501048_0865272 | 3300049582 | Bacteria | 650 |
| 1291 | Ga0501067_0006809 | 3300049583 | Bacteria | 6339 |
| 1292 | Ga0501068_0002793 | 3300049584 | Bacteria | 9287 |
| 1293 | Ga0501068_0608237 | 3300049584 | Bacteria | 712 |
| 1294 | Ga0501069_0867641 | 3300049585 | Bacteria | 548 |
| 1295 | Ga0501070_0007573 | 3300049586 | Bacteria | 9227 |
| 1296 | Ga0501070_0063793 | 3300049586 | Bacteria | 3052 |
| 1297 | Ga0501071_0001833 | 3300049587 | Bacteria | 12604 |
| 1298 | Ga0501071_0009669 | 3300049587 | Bacteria | 6436 |
| 1299 | Ga0501072_0035416 | 3300049588 | Bacteria | 3910 |
| 1300 | Ga0501072_0049556 | 3300049588 | Bacteria | 3306 |
| 1301 | Ga0501072_0433281 | 3300049588 | Bacteria | 1042 |
| 1302 | Ga0501073_0000472 | 3300049589 | Bacteria | 27853 |
| 1303 | Ga0501073_0433941 | 3300049589 | Bacteria | 908 |
| 1304 | Ga0501074_0002836 | 3300049590 | Bacteria | 12136 |
| 1305 | Ga0501074_0036301 | 3300049590 | Bacteria | 3571 |
| 1306 | Ga0501075_0000792 | 3300049591 | Bacteria | 19767 |
| 1307 | Ga0501075_0014752 | 3300049591 | Bacteria | 5600 |
| 1308 | Ga0501076_0007783 | 3300049592 | Bacteria | 7809 |
| 1309 | Ga0501076_0035980 | 3300049592 | Bacteria | 3877 |
| 1310 | Ga0501076_0384431 | 3300049592 | Bacteria | 1154 |
| 1311 | Ga0501077_0000280 | 3300049593 | Bacteria | 30354 |
| 1312 | Ga0501077_0171032 | 3300049593 | Bacteria | 1380 |
| 1313 | Ga0501230_040204 | 3300049667 | Bacteria | 904 |
| 1314 | Ga0501079_0001080 | 3300049741 | Bacteria | 18962 |
| 1315 | Ga0501079_0021711 | 3300049741 | Bacteria | 4913 |
| 1316 | Ga0501080_0013669 | 3300049742 | Bacteria | 7474 |
| 1317 | Ga0501080_0072108 | 3300049742 | Bacteria | 3213 |
| 1318 | Ga0501083_0014663 | 3300049744 | Bacteria | 5479 |
| 1319 | Ga0501083_0048506 | 3300049744 | Bacteria | 2866 |
| 1320 | Ga0501083_0491604 | 3300049744 | Bacteria | 799 |
| 1321 | Ga0501035_0675812 | 3300049822 | Bacteria | 835 |
| 1322 | Ga0501044_0000745 | 3300049823 | Bacteria | 39309 |
| 1323 | Ga0501044_1081409 | 3300049823 | Bacteria | 672 |
| 1324 | Ga0501045_0013215 | 3300049824 | Bacteria | 5824 |
| 1325 | Ga0501226_000010 | 3300049853 | Bacteria | 180094 |
| 1326 | nmdc:mga00v17_6749_c1 | 3300050491 | Bacteria | 6099 |
| 1327 | nmdc:mga0k408_321371_c1 | 3300050493 | Bacteria | 923 |
| 1328 | nmdc:mga0k408_653060_c1 | 3300050493 | Bacteria | 618 |
| 1329 | nmdc:mga05p37_22213_c1 | 3300050507 | Bacteria | 7692 |
| 1330 | nmdc:mga05p37_37857_c1 | 3300050507 | Bacteria | 5916 |
| 1331 | nmdc:mga09592_199515_c1 | 3300050508 | Bacteria | 1733 |
| 1332 | nmdc:mga09592_6806_c1 | 3300050508 | Bacteria | 9303 |
| 1333 | nmdc:mga09592_777742_c1 | 3300050508 | Bacteria | 811 |
| 1334 | nmdc:mga09592_895930_c1 | 3300050508 | Bacteria | 746 |
| 1335 | nmdc:mga0qj67_100942_c1 | 3300050509 | Bacteria | 2326 |
| 1336 | nmdc:mga0qj67_187552_c1 | 3300050509 | Bacteria | 1680 |
| 1337 | nmdc:mga0qj67_188850_c1 | 3300050509 | Bacteria | 1674 |
| 1338 | nmdc:mga0qj67_201016_c1 | 3300050509 | Bacteria | 1619 |
| 1339 | nmdc:mga06r32_22391_c1 | 3300050510 | Bacteria | 5842 |
| 1340 | nmdc:mga06r32_328139_c1 | 3300050510 | Bacteria | 1515 |
| 1341 | nmdc:mga06r32_747_c1 | 3300050510 | Bacteria | 28538 |
| 1342 | nmdc:mga06r32_7750_c2 | 3300050510 | Bacteria | 7874 |
| 1343 | nmdc:mga08y16_104026_c1 | 3300050511 | Bacteria | 2956 |
| 1344 | nmdc:mga08y16_1066236_c1 | 3300050511 | Bacteria | 785 |
| 1345 | nmdc:mga08y16_1255_c1 | 3300050511 | Bacteria | 25165 |
| 1346 | nmdc:mga08y16_1641422_c1 | 3300050511 | Bacteria | 600 |
| 1347 | nmdc:mga08y16_211735_c1 | 3300050511 | Bacteria | 2007 |
| 1348 | nmdc:mga08y16_71923_c1 | 3300050511 | Bacteria | 3604 |
| 1349 | nmdc:mga08y16_7261_c1 | 3300050511 | Bacteria | 11631 |
| 1350 | nmdc:mga08y16_899876_c1 | 3300050511 | Bacteria | 871 |
| 1351 | nmdc:mga0n895_565258_c1 | 3300050512 | Bacteria | 1142 |
| 1352 | nmdc:mga0rr50_1357398_c1 | 3300050513 | Bacteria | 602 |
| 1353 | nmdc:mga0rr50_32375_c1 | 3300050513 | Bacteria | 3724 |
| 1354 | nmdc:mga08x19_217959_c1 | 3300050514 | Bacteria | 1311 |
| 1355 | nmdc:mga0a205_557015_c1 | 3300050515 | Bacteria | 1001 |
| 1356 | nmdc:mga0a205_88566_c1 | 3300050515 | Bacteria | 2991 |
| 1357 | Ga0495601_0312189 | 3300053077 | Bacteria | 1024 |
| 1358 | Ga0500644_0062975 | 3300053088 | Bacteria | 1313 |
| 1359 | Ga0500644_0100029 | 3300053088 | Bacteria | 1100 |
| 1360 | Ga0500583_0058297 | 3300053092 | Bacteria | 1816 |
| 1361 | Ga0500583_0073042 | 3300053092 | Bacteria | 1644 |
| 1362 | Ga0500583_0301270 | 3300053092 | Bacteria | 784 |
| 1363 | Ga0500583_0396594 | 3300053092 | Bacteria | 662 |
| 1364 | Ga0500650_0058300 | 3300053098 | Bacteria | 1801 |
| 1365 | Ga0500556_0000442 | 3300053104 | Bacteria | 29531 |
| 1366 | Ga0500572_065710 | 3300053111 | Bacteria | 1111 |
| 1367 | Ga0500591_030876 | 3300053115 | Bacteria | 2585 |
| 1368 | Ga0500595_027112 | 3300053119 | Bacteria | 1966 |
| 1369 | Ga0500658_0080346 | 3300053134 | Bacteria | 1393 |
| 1370 | Ga0500658_0114697 | 3300053134 | Bacteria | 1189 |
| 1371 | Ga0500659_0001435 | 3300053135 | Bacteria | 15111 |
| 1372 | Ga0500559_0252268 | 3300053136 | Bacteria | 831 |
| 1373 | Ga0500588_0005174 | 3300053146 | Bacteria | 2878 |
| 1374 | Ga0500590_239218 | 3300053148 | Bacteria | 732 |
| 1375 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 1376 | Ga0500616_0132122 | 3300053153 | Bacteria | 1178 |
| 1377 | Ga0500622_0004527 | 3300053156 | Bacteria | 8682 |
| 1378 | Ga0500622_0420657 | 3300053156 | Bacteria | 538 |
| 1379 | Ga0500627_0191709 | 3300053158 | Bacteria | 918 |
| 1380 | Ga0500627_0293718 | 3300053158 | Bacteria | 711 |
| 1381 | Ga0500634_0000047 | 3300053161 | Bacteria | 55541 |
| 1382 | Ga0500637_0100378 | 3300053178 | Bacteria | 1679 |
| 1383 | Ga0500637_0100441 | 3300053178 | Bacteria | 1678 |
| 1384 | Ga0501084_0001292 | 3300054114 | Bacteria | 19723 |
| 1385 | Ga0501084_0093387 | 3300054114 | Bacteria | 2526 |
| 1386 | Ga0590075_136468 | 3300059424 | Bacteria | 645 |
| 1387 | Ga0587090_120295 | 3300059510 | Bacteria | 569 |
| 1388 | Ga0587071_165880 | 3300060344 | Bacteria | 558 |
| 1389 | Ga0501082_0025328 | 3300060353 | Bacteria | 5112 |
| 1390 | Ga0501082_0314316 | 3300060353 | Bacteria | 1364 |
| 1391 | Ga0501082_0456958 | 3300060353 | Bacteria | 1116 |
| 1392 | Ga0466962_0001556 | 3300061719 | Bacteria | 10706 |
| 1393 | Ga0466962_0386845 | 3300061719 | Bacteria | 699 |
| 1394 | Ga0530510_0142376 | 3300061734 | Bacteria | 1767 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026078 | Ga0207702_10331481 | Ga0207702_103314812 | 101 |
| 2 | 3300031711 | Ga0265314_10012315 | Ga0265314_100123156 | 102 |
| 3 | 3300031712 | Ga0265342_10159148 | Ga0265342_101591483 | 102 |
| 4 | 3300001979 | JGI24740J21852_10000614 | JGI24740J21852_1000061413 | 107 |
| 5 | 3300001990 | JGI24737J22298_10189215 | JGI24737J22298_101892151 | 107 |
| 6 | 3300002070 | JGI24750J21931_1095797 | JGI24750J21931_10957972 | 107 |
| 7 | 3300002772 | JGI25164J39214_1000233 | JGI25164J39214_100023340 | 107 |
| 8 | 3300002987 | JGI25159J45721_1041751 | JGI25159J45721_10417511 | 107 |
| 9 | 3300003214 | JGI25165J46597_1000429 | JGI25165J46597_100042911 | 107 |
| 10 | 3300003320 | rootH2_10087634 | rootH2_100876342 | 107 |
| 11 | 3300003323 | rootH1_10043132 | rootH1_100431322 | 107 |
| 12 | 3300003781 | Ga0055536_1003442 | Ga0055536_10034428 | 107 |
| 13 | 3300003791 | Ga0055530_10008951 | Ga0055530_100089513 | 107 |
| 14 | 3300003856 | Ga0058692_1000002 | Ga0058692_1000002127 | 107 |
| 15 | 3300003856 | Ga0058692_1023840 | Ga0058692_10238401 | 107 |
| 16 | 3300004800 | Ga0058861_10025803 | Ga0058861_100258031 | 107 |
| 17 | 3300004800 | Ga0058861_11712684 | Ga0058861_117126842 | 107 |
| 18 | 3300004803 | Ga0058862_10005162 | Ga0058862_100051622 | 107 |
| 19 | 3300004803 | Ga0058862_12825507 | Ga0058862_128255071 | 107 |
| 20 | 3300005288 | Ga0065714_10308955 | Ga0065714_103089551 | 107 |
| 21 | 3300005289 | Ga0065704_10071016 | Ga0065704_1007101610 | 107 |
| 22 | 3300005289 | Ga0065704_10071509 | Ga0065704_100715092 | 107 |
| 23 | 3300005289 | Ga0065704_10140192 | Ga0065704_101401921 | 107 |
| 24 | 3300005290 | Ga0065712_10068274 | Ga0065712_100682742 | 107 |
| 25 | 3300005290 | Ga0065712_10765609 | Ga0065712_107656091 | 107 |
| 26 | 3300005293 | Ga0065715_10180944 | Ga0065715_101809443 | 107 |
| 27 | 3300005327 | Ga0070658_11157558 | Ga0070658_111575581 | 107 |
| 28 | 3300005328 | Ga0070676_10056207 | Ga0070676_100562071 | 107 |
| 29 | 3300005328 | Ga0070676_10165226 | Ga0070676_101652262 | 107 |
| 30 | 3300005328 | Ga0070676_10827543 | Ga0070676_108275431 | 107 |
| 31 | 3300005329 | Ga0070683_100023117 | Ga0070683_1000231177 | 107 |
| 32 | 3300005329 | Ga0070683_100252598 | Ga0070683_1002525982 | 107 |
| 33 | 3300005329 | Ga0070683_101273836 | Ga0070683_1012738362 | 107 |
| 34 | 3300005330 | Ga0070690_100001135 | Ga0070690_10000113512 | 107 |
| 35 | 3300005330 | Ga0070690_100234733 | Ga0070690_1002347331 | 107 |
| 36 | 3300005330 | Ga0070690_101101741 | Ga0070690_1011017412 | 107 |
| 37 | 3300005331 | Ga0070670_100013647 | Ga0070670_1000136474 | 107 |
| 38 | 3300005331 | Ga0070670_100020260 | Ga0070670_1000202602 | 107 |
| 39 | 3300005333 | Ga0070677_10063923 | Ga0070677_100639231 | 107 |
| 40 | 3300005333 | Ga0070677_10109587 | Ga0070677_101095872 | 107 |
| 41 | 3300005334 | Ga0068869_100004548 | Ga0068869_1000045483 | 107 |
| 42 | 3300005334 | Ga0068869_100025083 | Ga0068869_1000250832 | 107 |
| 43 | 3300005334 | Ga0068869_100102931 | Ga0068869_1001029312 | 107 |
| 44 | 3300005334 | Ga0068869_100263008 | Ga0068869_1002630082 | 107 |
| 45 | 3300005335 | Ga0070666_10039031 | Ga0070666_100390312 | 107 |
| 46 | 3300005335 | Ga0070666_10093981 | Ga0070666_100939811 | 107 |
| 47 | 3300005335 | Ga0070666_10236255 | Ga0070666_102362552 | 107 |
| 48 | 3300005336 | Ga0070680_100005582 | Ga0070680_1000055827 | 107 |
| 49 | 3300005336 | Ga0070680_100028070 | Ga0070680_1000280703 | 107 |
| 50 | 3300005336 | Ga0070680_100433747 | Ga0070680_1004337472 | 107 |
| 51 | 3300005338 | Ga0068868_101101109 | Ga0068868_1011011092 | 107 |
| 52 | 3300005339 | Ga0070660_100220930 | Ga0070660_1002209302 | 107 |
| 53 | 3300005339 | Ga0070660_100240216 | Ga0070660_1002402162 | 107 |
| 54 | 3300005340 | Ga0070689_100005128 | Ga0070689_1000051285 | 107 |
| 55 | 3300005340 | Ga0070689_100222109 | Ga0070689_1002221092 | 107 |
| 56 | 3300005340 | Ga0070689_101220077 | Ga0070689_1012200772 | 107 |
| 57 | 3300005343 | Ga0070687_100148833 | Ga0070687_1001488331 | 107 |
| 58 | 3300005343 | Ga0070687_101286316 | Ga0070687_1012863161 | 107 |
| 59 | 3300005344 | Ga0070661_100006281 | Ga0070661_1000062818 | 107 |
| 60 | 3300005344 | Ga0070661_100072694 | Ga0070661_1000726942 | 107 |
| 61 | 3300005344 | Ga0070661_100460410 | Ga0070661_1004604102 | 107 |
| 62 | 3300005344 | Ga0070661_100916223 | Ga0070661_1009162232 | 107 |
| 63 | 3300005345 | Ga0070692_10041291 | Ga0070692_100412913 | 107 |
| 64 | 3300005347 | Ga0070668_100032136 | Ga0070668_1000321363 | 107 |
| 65 | 3300005347 | Ga0070668_100199395 | Ga0070668_1001993953 | 107 |
| 66 | 3300005353 | Ga0070669_100006519 | Ga0070669_1000065198 | 107 |
| 67 | 3300005353 | Ga0070669_100025413 | Ga0070669_1000254131 | 107 |
| 68 | 3300005353 | Ga0070669_100641708 | Ga0070669_1006417081 | 107 |
| 69 | 3300005353 | Ga0070669_100880817 | Ga0070669_1008808171 | 107 |
| 70 | 3300005354 | Ga0070675_100000783 | Ga0070675_10000078312 | 107 |
| 71 | 3300005354 | Ga0070675_100720782 | Ga0070675_1007207822 | 107 |
| 72 | 3300005355 | Ga0070671_100000128 | Ga0070671_10000012821 | 107 |
| 73 | 3300005355 | Ga0070671_100011096 | Ga0070671_1000110966 | 107 |
| 74 | 3300005355 | Ga0070671_100030200 | Ga0070671_1000302004 | 107 |
| 75 | 3300005355 | Ga0070671_100575964 | Ga0070671_1005759642 | 107 |
| 76 | 3300005356 | Ga0070674_100113366 | Ga0070674_1001133662 | 107 |
| 77 | 3300005356 | Ga0070674_100994786 | Ga0070674_1009947861 | 107 |
| 78 | 3300005364 | Ga0070673_100000798 | Ga0070673_10000079817 | 107 |
| 79 | 3300005364 | Ga0070673_100028839 | Ga0070673_1000288392 | 107 |
| 80 | 3300005364 | Ga0070673_100399339 | Ga0070673_1003993392 | 107 |
| 81 | 3300005367 | Ga0070667_100004527 | Ga0070667_1000045278 | 107 |
| 82 | 3300005367 | Ga0070667_100011814 | Ga0070667_1000118142 | 107 |
| 83 | 3300005367 | Ga0070667_100067453 | Ga0070667_1000674532 | 107 |
| 84 | 3300005367 | Ga0070667_100120972 | Ga0070667_1001209723 | 107 |
| 85 | 3300005367 | Ga0070667_100207680 | Ga0070667_1002076803 | 107 |
| 86 | 3300005367 | Ga0070667_100730775 | Ga0070667_1007307751 | 107 |
| 87 | 3300005367 | Ga0070667_100764918 | Ga0070667_1007649182 | 107 |
| 88 | 3300005406 | Ga0070703_10571961 | Ga0070703_105719611 | 107 |
| 89 | 3300005434 | Ga0070709_10011768 | Ga0070709_100117684 | 107 |
| 90 | 3300005434 | Ga0070709_11487438 | Ga0070709_114874381 | 107 |
| 91 | 3300005435 | Ga0070714_100011747 | Ga0070714_1000117471 | 107 |
| 92 | 3300005435 | Ga0070714_100665812 | Ga0070714_1006658121 | 107 |
| 93 | 3300005436 | Ga0070713_100020371 | Ga0070713_1000203716 | 107 |
| 94 | 3300005436 | Ga0070713_100751983 | Ga0070713_1007519832 | 107 |
| 95 | 3300005437 | Ga0070710_10096327 | Ga0070710_100963271 | 107 |
| 96 | 3300005438 | Ga0070701_10030430 | Ga0070701_100304302 | 107 |
| 97 | 3300005438 | Ga0070701_10146729 | Ga0070701_101467292 | 107 |
| 98 | 3300005438 | Ga0070701_10397767 | Ga0070701_103977672 | 107 |
| 99 | 3300005439 | Ga0070711_100008522 | Ga0070711_1000085224 | 107 |
| 100 | 3300005439 | Ga0070711_100093293 | Ga0070711_1000932933 | 107 |
| 101 | 3300005440 | Ga0070705_100380600 | Ga0070705_1003806002 | 107 |
| 102 | 3300005441 | Ga0070700_100017048 | Ga0070700_1000170485 | 107 |
| 103 | 3300005441 | Ga0070700_100374019 | Ga0070700_1003740192 | 107 |
| 104 | 3300005441 | Ga0070700_100511093 | Ga0070700_1005110931 | 107 |
| 105 | 3300005444 | Ga0070694_100422181 | Ga0070694_1004221812 | 107 |
| 106 | 3300005455 | Ga0070663_100159520 | Ga0070663_1001595202 | 107 |
| 107 | 3300005455 | Ga0070663_100254999 | Ga0070663_1002549992 | 107 |
| 108 | 3300005456 | Ga0070678_100314308 | Ga0070678_1003143082 | 107 |
| 109 | 3300005456 | Ga0070678_100526193 | Ga0070678_1005261932 | 107 |
| 110 | 3300005457 | Ga0070662_100004248 | Ga0070662_1000042481 | 107 |
| 111 | 3300005457 | Ga0070662_100058751 | Ga0070662_1000587513 | 107 |
| 112 | 3300005458 | Ga0070681_10004251 | Ga0070681_100042517 | 107 |
| 113 | 3300005458 | Ga0070681_10013207 | Ga0070681_100132077 | 107 |
| 114 | 3300005458 | Ga0070681_11449828 | Ga0070681_114498282 | 107 |
| 115 | 3300005459 | Ga0068867_100018889 | Ga0068867_1000188893 | 107 |
| 116 | 3300005459 | Ga0068867_100101694 | Ga0068867_1001016942 | 107 |
| 117 | 3300005459 | Ga0068867_101196437 | Ga0068867_1011964372 | 107 |
| 118 | 3300005459 | Ga0068867_102111177 | Ga0068867_1021111771 | 107 |
| 119 | 3300005459 | Ga0068867_102412295 | Ga0068867_1024122951 | 107 |
| 120 | 3300005466 | Ga0070685_10016903 | Ga0070685_100169033 | 107 |
| 121 | 3300005466 | Ga0070685_11404084 | Ga0070685_114040841 | 107 |
| 122 | 3300005530 | Ga0070679_100005951 | Ga0070679_1000059514 | 107 |
| 123 | 3300005530 | Ga0070679_100010434 | Ga0070679_1000104347 | 107 |
| 124 | 3300005530 | Ga0070679_100235067 | Ga0070679_1002350672 | 107 |
| 125 | 3300005530 | Ga0070679_101869794 | Ga0070679_1018697941 | 107 |
| 126 | 3300005535 | Ga0070684_100000603 | Ga0070684_1000006032 | 107 |
| 127 | 3300005535 | Ga0070684_100015751 | Ga0070684_1000157516 | 107 |
| 128 | 3300005535 | Ga0070684_100870083 | Ga0070684_1008700832 | 107 |
| 129 | 3300005535 | Ga0070684_101487875 | Ga0070684_1014878751 | 107 |
| 130 | 3300005539 | Ga0068853_100049140 | Ga0068853_1000491405 | 107 |
| 131 | 3300005539 | Ga0068853_100418357 | Ga0068853_1004183572 | 107 |
| 132 | 3300005543 | Ga0070672_100007042 | Ga0070672_1000070423 | 107 |
| 133 | 3300005543 | Ga0070672_100297638 | Ga0070672_1002976382 | 107 |
| 134 | 3300005543 | Ga0070672_100428930 | Ga0070672_1004289303 | 107 |
| 135 | 3300005545 | Ga0070695_100818713 | Ga0070695_1008187132 | 107 |
| 136 | 3300005546 | Ga0070696_100000044 | Ga0070696_10000004443 | 107 |
| 137 | 3300005546 | Ga0070696_100838276 | Ga0070696_1008382762 | 107 |
| 138 | 3300005547 | Ga0070693_100057425 | Ga0070693_1000574252 | 107 |
| 139 | 3300005547 | Ga0070693_100638643 | Ga0070693_1006386431 | 107 |
| 140 | 3300005548 | Ga0070665_100007432 | Ga0070665_10000743211 | 107 |
| 141 | 3300005548 | Ga0070665_100015200 | Ga0070665_1000152006 | 107 |
| 142 | 3300005548 | Ga0070665_100027147 | Ga0070665_1000271475 | 107 |
| 143 | 3300005548 | Ga0070665_100029015 | Ga0070665_1000290155 | 107 |
| 144 | 3300005548 | Ga0070665_100031259 | Ga0070665_1000312595 | 107 |
| 145 | 3300005548 | Ga0070665_100059767 | Ga0070665_1000597674 | 107 |
| 146 | 3300005548 | Ga0070665_100080808 | Ga0070665_1000808082 | 107 |
| 147 | 3300005548 | Ga0070665_100191491 | Ga0070665_1001914912 | 107 |
| 148 | 3300005548 | Ga0070665_100212550 | Ga0070665_1002125502 | 107 |
| 149 | 3300005548 | Ga0070665_101204961 | Ga0070665_1012049612 | 107 |
| 150 | 3300005563 | Ga0068855_100000552 | Ga0068855_10000055232 | 107 |
| 151 | 3300005563 | Ga0068855_100001462 | Ga0068855_1000014623 | 107 |
| 152 | 3300005563 | Ga0068855_100001706 | Ga0068855_10000170612 | 107 |
| 153 | 3300005563 | Ga0068855_100354907 | Ga0068855_1003549072 | 107 |
| 154 | 3300005563 | Ga0068855_101286227 | Ga0068855_1012862272 | 107 |
| 155 | 3300005564 | Ga0070664_100000712 | Ga0070664_1000007129 | 107 |
| 156 | 3300005564 | Ga0070664_100017162 | Ga0070664_1000171623 | 107 |
| 157 | 3300005564 | Ga0070664_100174452 | Ga0070664_1001744522 | 107 |
| 158 | 3300005564 | Ga0070664_100388368 | Ga0070664_1003883681 | 107 |
| 159 | 3300005564 | Ga0070664_101760174 | Ga0070664_1017601742 | 107 |
| 160 | 3300005577 | Ga0068857_100006602 | Ga0068857_1000066023 | 107 |
| 161 | 3300005577 | Ga0068857_100294934 | Ga0068857_1002949342 | 107 |
| 162 | 3300005577 | Ga0068857_100323023 | Ga0068857_1003230233 | 107 |
| 163 | 3300005578 | Ga0068854_100132014 | Ga0068854_1001320142 | 107 |
| 164 | 3300005578 | Ga0068854_100476074 | Ga0068854_1004760742 | 107 |
| 165 | 3300005614 | Ga0068856_100004553 | Ga0068856_10000455311 | 107 |
| 166 | 3300005614 | Ga0068856_100264908 | Ga0068856_1002649083 | 107 |
| 167 | 3300005615 | Ga0070702_100007773 | Ga0070702_1000077735 | 107 |
| 168 | 3300005616 | Ga0068852_100213110 | Ga0068852_1002131102 | 107 |
| 169 | 3300005616 | Ga0068852_100350248 | Ga0068852_1003502482 | 107 |
| 170 | 3300005617 | Ga0068859_100000674 | Ga0068859_10000067411 | 107 |
| 171 | 3300005617 | Ga0068859_100003776 | Ga0068859_1000037766 | 107 |
| 172 | 3300005617 | Ga0068859_100089202 | Ga0068859_1000892022 | 107 |
| 173 | 3300005617 | Ga0068859_100270710 | Ga0068859_1002707103 | 107 |
| 174 | 3300005617 | Ga0068859_100655524 | Ga0068859_1006555242 | 107 |
| 175 | 3300005617 | Ga0068859_100703088 | Ga0068859_1007030882 | 107 |
| 176 | 3300005618 | Ga0068864_100023356 | Ga0068864_1000233564 | 107 |
| 177 | 3300005618 | Ga0068864_100043830 | Ga0068864_1000438302 | 107 |
| 178 | 3300005618 | Ga0068864_100394852 | Ga0068864_1003948522 | 107 |
| 179 | 3300005618 | Ga0068864_100494343 | Ga0068864_1004943432 | 107 |
| 180 | 3300005618 | Ga0068864_102382068 | Ga0068864_1023820681 | 107 |
| 181 | 3300005718 | Ga0068866_10111171 | Ga0068866_101111712 | 107 |
| 182 | 3300005718 | Ga0068866_10455160 | Ga0068866_104551602 | 107 |
| 183 | 3300005719 | Ga0068861_100001382 | Ga0068861_10000138213 | 107 |
| 184 | 3300005719 | Ga0068861_100016209 | Ga0068861_1000162095 | 107 |
| 185 | 3300005719 | Ga0068861_100271776 | Ga0068861_1002717762 | 107 |
| 186 | 3300005719 | Ga0068861_100697963 | Ga0068861_1006979631 | 107 |
| 187 | 3300005719 | Ga0068861_101842669 | Ga0068861_1018426691 | 107 |
| 188 | 3300005834 | Ga0068851_10106749 | Ga0068851_101067492 | 107 |
| 189 | 3300005834 | Ga0068851_10824442 | Ga0068851_108244421 | 107 |
| 190 | 3300005840 | Ga0068870_10022377 | Ga0068870_100223776 | 107 |
| 191 | 3300005840 | Ga0068870_10022596 | Ga0068870_100225964 | 107 |
| 192 | 3300005840 | Ga0068870_10119722 | Ga0068870_101197223 | 107 |
| 193 | 3300005841 | Ga0068863_100002456 | Ga0068863_1000024566 | 107 |
| 194 | 3300005841 | Ga0068863_100007485 | Ga0068863_1000074855 | 107 |
| 195 | 3300005841 | Ga0068863_100009083 | Ga0068863_1000090838 | 107 |
| 196 | 3300005841 | Ga0068863_100077118 | Ga0068863_1000771184 | 107 |
| 197 | 3300005842 | Ga0068858_100000838 | Ga0068858_10000083817 | 107 |
| 198 | 3300005842 | Ga0068858_100003187 | Ga0068858_1000031873 | 107 |
| 199 | 3300005842 | Ga0068858_100022237 | Ga0068858_1000222375 | 107 |
| 200 | 3300005842 | Ga0068858_100056706 | Ga0068858_1000567063 | 107 |
| 201 | 3300005842 | Ga0068858_100170456 | Ga0068858_1001704562 | 107 |
| 202 | 3300005843 | Ga0068860_100000941 | Ga0068860_10000094113 | 107 |
| 203 | 3300005843 | Ga0068860_100008051 | Ga0068860_1000080515 | 107 |
| 204 | 3300005843 | Ga0068860_100135634 | Ga0068860_1001356341 | 107 |
| 205 | 3300005843 | Ga0068860_100576966 | Ga0068860_1005769661 | 107 |
| 206 | 3300005843 | Ga0068860_100884921 | Ga0068860_1008849212 | 107 |
| 207 | 3300005843 | Ga0068860_101112107 | Ga0068860_1011121071 | 107 |
| 208 | 3300005844 | Ga0068862_100000627 | Ga0068862_10000062717 | 107 |
| 209 | 3300005844 | Ga0068862_100107977 | Ga0068862_1001079772 | 107 |
| 210 | 3300005844 | Ga0068862_100405857 | Ga0068862_1004058571 | 107 |
| 211 | 3300005844 | Ga0068862_100469794 | Ga0068862_1004697942 | 107 |
| 212 | 3300005844 | Ga0068862_101645249 | Ga0068862_1016452491 | 107 |
| 213 | 3300005981 | Ga0081538_10382639 | Ga0081538_103826391 | 107 |
| 214 | 3300006028 | Ga0070717_10035050 | Ga0070717_100350503 | 107 |
| 215 | 3300006058 | Ga0075432_10009154 | Ga0075432_100091542 | 107 |
| 216 | 3300006058 | Ga0075432_10581581 | Ga0075432_105815812 | 107 |
| 217 | 3300006163 | Ga0070715_10148461 | Ga0070715_101484612 | 107 |
| 218 | 3300006163 | Ga0070715_10434922 | Ga0070715_104349221 | 107 |
| 219 | 3300006173 | Ga0070716_100005257 | Ga0070716_1000052574 | 107 |
| 220 | 3300006173 | Ga0070716_100138150 | Ga0070716_1001381503 | 107 |
| 221 | 3300006175 | Ga0070712_100143198 | Ga0070712_1001431982 | 107 |
| 222 | 3300006194 | Ga0075427_10004374 | Ga0075427_100043742 | 107 |
| 223 | 3300006195 | Ga0075366_10316459 | Ga0075366_103164592 | 107 |
| 224 | 3300006195 | Ga0075366_10443038 | Ga0075366_104430381 | 107 |
| 225 | 3300006237 | Ga0097621_100062806 | Ga0097621_1000628062 | 107 |
| 226 | 3300006237 | Ga0097621_100166940 | Ga0097621_1001669402 | 107 |
| 227 | 3300006237 | Ga0097621_100301150 | Ga0097621_1003011502 | 107 |
| 228 | 3300006237 | Ga0097621_100514362 | Ga0097621_1005143622 | 107 |
| 229 | 3300006237 | Ga0097621_100549346 | Ga0097621_1005493462 | 107 |
| 230 | 3300006237 | Ga0097621_100674803 | Ga0097621_1006748032 | 107 |
| 231 | 3300006358 | Ga0068871_100029047 | Ga0068871_1000290472 | 107 |
| 232 | 3300006358 | Ga0068871_100038270 | Ga0068871_1000382704 | 107 |
| 233 | 3300006358 | Ga0068871_100173839 | Ga0068871_1001738392 | 107 |
| 234 | 3300006358 | Ga0068871_100318102 | Ga0068871_1003181023 | 107 |
| 235 | 3300006358 | Ga0068871_101605762 | Ga0068871_1016057621 | 107 |
| 236 | 3300006844 | Ga0075428_100001820 | Ga0075428_10000182014 | 107 |
| 237 | 3300006844 | Ga0075428_100012398 | Ga0075428_1000123985 | 107 |
| 238 | 3300006844 | Ga0075428_100247340 | Ga0075428_1002473401 | 107 |
| 239 | 3300006846 | Ga0075430_100012275 | Ga0075430_1000122755 | 107 |
| 240 | 3300006846 | Ga0075430_100021289 | Ga0075430_1000212894 | 107 |
| 241 | 3300006846 | Ga0075430_100107235 | Ga0075430_1001072353 | 107 |
| 242 | 3300006846 | Ga0075430_100309251 | Ga0075430_1003092512 | 107 |
| 243 | 3300006846 | Ga0075430_100647363 | Ga0075430_1006473632 | 107 |
| 244 | 3300006846 | Ga0075430_100826221 | Ga0075430_1008262212 | 107 |
| 245 | 3300006846 | Ga0075430_100887335 | Ga0075430_1008873352 | 107 |
| 246 | 3300006847 | Ga0075431_100000992 | Ga0075431_10000099213 | 107 |
| 247 | 3300006847 | Ga0075431_100027329 | Ga0075431_1000273299 | 107 |
| 248 | 3300006847 | Ga0075431_100032100 | Ga0075431_1000321004 | 107 |
| 249 | 3300006847 | Ga0075431_100253474 | Ga0075431_1002534743 | 107 |
| 250 | 3300006852 | Ga0075433_11465690 | Ga0075433_114656902 | 107 |
| 251 | 3300006871 | Ga0075434_100149115 | Ga0075434_1001491152 | 107 |
| 252 | 3300006880 | Ga0075429_100004428 | Ga0075429_10000442816 | 107 |
| 253 | 3300006880 | Ga0075429_100007829 | Ga0075429_1000078292 | 107 |
| 254 | 3300006880 | Ga0075429_100823479 | Ga0075429_1008234791 | 107 |
| 255 | 3300006881 | Ga0068865_100056496 | Ga0068865_1000564964 | 107 |
| 256 | 3300006881 | Ga0068865_100327331 | Ga0068865_1003273313 | 107 |
| 257 | 3300006881 | Ga0068865_100558094 | Ga0068865_1005580941 | 107 |
| 258 | 3300006931 | Ga0097620_100000674 | Ga0097620_10000067421 | 107 |
| 259 | 3300006931 | Ga0097620_100003775 | Ga0097620_1000037756 | 107 |
| 260 | 3300006931 | Ga0097620_100089201 | Ga0097620_1000892012 | 107 |
| 261 | 3300006931 | Ga0097620_100270721 | Ga0097620_1002707213 | 107 |
| 262 | 3300006931 | Ga0097620_100655519 | Ga0097620_1006555192 | 107 |
| 263 | 3300006931 | Ga0097620_100703119 | Ga0097620_1007031192 | 107 |
| 264 | 3300006944 | Ga0099823_1000119 | Ga0099823_100011919 | 107 |
| 265 | 3300006946 | Ga0079104_1001155 | Ga0079104_100115515 | 107 |
| 266 | 3300006946 | Ga0079104_1005472 | Ga0079104_10054722 | 107 |
| 267 | 3300006948 | Ga0099826_10000860 | Ga0099826_1000086010 | 107 |
| 268 | 3300007076 | Ga0075435_100030312 | Ga0075435_1000303124 | 107 |
| 269 | 3300007265 | Ga0099794_10689273 | Ga0099794_106892731 | 107 |
| 270 | 3300007265 | Ga0099794_10723176 | Ga0099794_107231762 | 107 |
| 271 | 3300007788 | Ga0099795_10000001 | Ga0099795_1000000180 | 107 |
| 272 | 3300007788 | Ga0099795_10000342 | Ga0099795_100003427 | 107 |
| 273 | 3300009011 | Ga0105251_10000396 | Ga0105251_1000039621 | 107 |
| 274 | 3300009011 | Ga0105251_10036856 | Ga0105251_100368561 | 107 |
| 275 | 3300009011 | Ga0105251_10055931 | Ga0105251_100559312 | 107 |
| 276 | 3300009036 | Ga0105244_10005072 | Ga0105244_100050722 | 107 |
| 277 | 3300009036 | Ga0105244_10026994 | Ga0105244_100269943 | 107 |
| 278 | 3300009036 | Ga0105244_10083463 | Ga0105244_100834632 | 107 |
| 279 | 3300009092 | Ga0105250_10068877 | Ga0105250_100688772 | 107 |
| 280 | 3300009092 | Ga0105250_10235653 | Ga0105250_102356532 | 107 |
| 281 | 3300009093 | Ga0105240_10001990 | Ga0105240_1000199020 | 107 |
| 282 | 3300009093 | Ga0105240_10010840 | Ga0105240_100108408 | 107 |
| 283 | 3300009093 | Ga0105240_10056435 | Ga0105240_100564353 | 107 |
| 284 | 3300009093 | Ga0105240_10059022 | Ga0105240_100590224 | 107 |
| 285 | 3300009093 | Ga0105240_10076281 | Ga0105240_100762814 | 107 |
| 286 | 3300009093 | Ga0105240_10157500 | Ga0105240_101575002 | 107 |
| 287 | 3300009093 | Ga0105240_10185125 | Ga0105240_101851252 | 107 |
| 288 | 3300009093 | Ga0105240_10613628 | Ga0105240_106136282 | 107 |
| 289 | 3300009093 | Ga0105240_11349660 | Ga0105240_113496602 | 107 |
| 290 | 3300009094 | Ga0111539_10002602 | Ga0111539_100026023 | 107 |
| 291 | 3300009094 | Ga0111539_10012428 | Ga0111539_100124285 | 107 |
| 292 | 3300009094 | Ga0111539_10043347 | Ga0111539_100433475 | 107 |
| 293 | 3300009094 | Ga0111539_10056415 | Ga0111539_100564157 | 107 |
| 294 | 3300009094 | Ga0111539_10059404 | Ga0111539_100594044 | 107 |
| 295 | 3300009094 | Ga0111539_10560381 | Ga0111539_105603811 | 107 |
| 296 | 3300009094 | Ga0111539_12194479 | Ga0111539_121944793 | 107 |
| 297 | 3300009094 | Ga0111539_12253282 | Ga0111539_122532821 | 107 |
| 298 | 3300009098 | Ga0105245_10001367 | Ga0105245_1000136713 | 107 |
| 299 | 3300009098 | Ga0105245_10422613 | Ga0105245_104226132 | 107 |
| 300 | 3300009098 | Ga0105245_10583726 | Ga0105245_105837263 | 107 |
| 301 | 3300009098 | Ga0105245_11856605 | Ga0105245_118566051 | 107 |
| 302 | 3300009098 | Ga0105245_12079471 | Ga0105245_120794711 | 107 |
| 303 | 3300009101 | Ga0105247_10000613 | Ga0105247_100006139 | 107 |
| 304 | 3300009101 | Ga0105247_10150643 | Ga0105247_101506434 | 107 |
| 305 | 3300009101 | Ga0105247_10382570 | Ga0105247_103825701 | 107 |
| 306 | 3300009101 | Ga0105247_10491414 | Ga0105247_104914142 | 107 |
| 307 | 3300009101 | Ga0105247_10893756 | Ga0105247_108937561 | 107 |
| 308 | 3300009147 | Ga0114129_10000246 | Ga0114129_1000024615 | 107 |
| 309 | 3300009147 | Ga0114129_10457595 | Ga0114129_104575952 | 107 |
| 310 | 3300009148 | Ga0105243_10025874 | Ga0105243_100258745 | 107 |
| 311 | 3300009148 | Ga0105243_10290588 | Ga0105243_102905882 | 107 |
| 312 | 3300009148 | Ga0105243_13035728 | Ga0105243_130357281 | 107 |
| 313 | 3300009174 | Ga0105241_10365215 | Ga0105241_103652152 | 107 |
| 314 | 3300009176 | Ga0105242_10001178 | Ga0105242_1000117813 | 107 |
| 315 | 3300009176 | Ga0105242_10893583 | Ga0105242_108935833 | 107 |
| 316 | 3300009176 | Ga0105242_11786562 | Ga0105242_117865622 | 107 |
| 317 | 3300009176 | Ga0105242_13104048 | Ga0105242_131040481 | 107 |
| 318 | 3300009177 | Ga0105248_10003210 | Ga0105248_100032107 | 107 |
| 319 | 3300009177 | Ga0105248_10264408 | Ga0105248_102644083 | 107 |
| 320 | 3300009177 | Ga0105248_10272462 | Ga0105248_102724621 | 107 |
| 321 | 3300009177 | Ga0105248_10445085 | Ga0105248_104450852 | 107 |
| 322 | 3300009177 | Ga0105248_11882587 | Ga0105248_118825871 | 107 |
| 323 | 3300009545 | Ga0105237_10000196 | Ga0105237_1000019679 | 107 |
| 324 | 3300009545 | Ga0105237_10027955 | Ga0105237_100279553 | 107 |
| 325 | 3300009545 | Ga0105237_10031421 | Ga0105237_100314213 | 107 |
| 326 | 3300009545 | Ga0105237_10120319 | Ga0105237_101203191 | 107 |
| 327 | 3300009545 | Ga0105237_10254718 | Ga0105237_102547183 | 107 |
| 328 | 3300009545 | Ga0105237_12156801 | Ga0105237_121568011 | 107 |
| 329 | 3300009545 | Ga0105237_12549370 | Ga0105237_125493701 | 107 |
| 330 | 3300009551 | Ga0105238_10114535 | Ga0105238_101145353 | 107 |
| 331 | 3300009551 | Ga0105238_10115060 | Ga0105238_101150603 | 107 |
| 332 | 3300009551 | Ga0105238_10412878 | Ga0105238_104128781 | 107 |
| 333 | 3300009553 | Ga0105249_10002480 | Ga0105249_100024809 | 107 |
| 334 | 3300009553 | Ga0105249_10008927 | Ga0105249_100089275 | 107 |
| 335 | 3300009553 | Ga0105249_10009607 | Ga0105249_100096078 | 107 |
| 336 | 3300009553 | Ga0105249_10106962 | Ga0105249_101069622 | 107 |
| 337 | 3300009553 | Ga0105249_10739412 | Ga0105249_107394122 | 107 |
| 338 | 3300010159 | Ga0099796_10000001 | Ga0099796_1000000165 | 107 |
| 339 | 3300010159 | Ga0099796_10020675 | Ga0099796_100206752 | 107 |
| 340 | 3300010375 | Ga0105239_10165064 | Ga0105239_101650642 | 107 |
| 341 | 3300010375 | Ga0105239_10371947 | Ga0105239_103719473 | 107 |
| 342 | 3300010375 | Ga0105239_10428079 | Ga0105239_104280791 | 107 |
| 343 | 3300010375 | Ga0105239_10450017 | Ga0105239_104500172 | 107 |
| 344 | 3300010375 | Ga0105239_10831763 | Ga0105239_108317632 | 107 |
| 345 | 3300010375 | Ga0105239_11538340 | Ga0105239_115383402 | 107 |
| 346 | 3300011119 | Ga0105246_10124844 | Ga0105246_101248443 | 107 |
| 347 | 3300011119 | Ga0105246_11056942 | Ga0105246_110569421 | 107 |
| 348 | 3300013100 | Ga0157373_10011711 | Ga0157373_100117114 | 107 |
| 349 | 3300013100 | Ga0157373_10110281 | Ga0157373_101102812 | 107 |
| 350 | 3300013102 | Ga0157371_10006276 | Ga0157371_100062768 | 107 |
| 351 | 3300013102 | Ga0157371_10012444 | Ga0157371_100124443 | 107 |
| 352 | 3300013102 | Ga0157371_10334666 | Ga0157371_103346662 | 107 |
| 353 | 3300013104 | Ga0157370_10088182 | Ga0157370_100881822 | 107 |
| 354 | 3300013104 | Ga0157370_10347025 | Ga0157370_103470251 | 107 |
| 355 | 3300013104 | Ga0157370_10364787 | Ga0157370_103647872 | 107 |
| 356 | 3300013104 | Ga0157370_10799407 | Ga0157370_107994072 | 107 |
| 357 | 3300013105 | Ga0157369_10017050 | Ga0157369_100170506 | 107 |
| 358 | 3300013105 | Ga0157369_10046803 | Ga0157369_100468033 | 107 |
| 359 | 3300013105 | Ga0157369_10408369 | Ga0157369_104083692 | 107 |
| 360 | 3300013105 | Ga0157369_12272771 | Ga0157369_122727711 | 107 |
| 361 | 3300013296 | Ga0157374_10006088 | Ga0157374_100060888 | 107 |
| 362 | 3300013296 | Ga0157374_10219317 | Ga0157374_102193172 | 107 |
| 363 | 3300013296 | Ga0157374_10415131 | Ga0157374_104151312 | 107 |
| 364 | 3300013297 | Ga0157378_10007969 | Ga0157378_100079698 | 107 |
| 365 | 3300013297 | Ga0157378_10107804 | Ga0157378_101078043 | 107 |
| 366 | 3300013297 | Ga0157378_10332769 | Ga0157378_103327692 | 107 |
| 367 | 3300013306 | Ga0163162_10003168 | Ga0163162_100031687 | 107 |
| 368 | 3300013306 | Ga0163162_10401294 | Ga0163162_104012943 | 107 |
| 369 | 3300013306 | Ga0163162_10662766 | Ga0163162_106627662 | 107 |
| 370 | 3300013306 | Ga0163162_13131330 | Ga0163162_131313301 | 107 |
| 371 | 3300013306 | Ga0163162_13405246 | Ga0163162_134052461 | 107 |
| 372 | 3300013307 | Ga0157372_10000663 | Ga0157372_1000066315 | 107 |
| 373 | 3300013307 | Ga0157372_10033882 | Ga0157372_100338824 | 107 |
| 374 | 3300013307 | Ga0157372_10140143 | Ga0157372_101401433 | 107 |
| 375 | 3300013307 | Ga0157372_10304057 | Ga0157372_103040572 | 107 |
| 376 | 3300013307 | Ga0157372_10497786 | Ga0157372_104977862 | 107 |
| 377 | 3300013308 | Ga0157375_10004983 | Ga0157375_1000498314 | 107 |
| 378 | 3300013308 | Ga0157375_10010994 | Ga0157375_100109942 | 107 |
| 379 | 3300013308 | Ga0157375_10011199 | Ga0157375_1001119911 | 107 |
| 380 | 3300013308 | Ga0157375_10013691 | Ga0157375_100136914 | 107 |
| 381 | 3300014325 | Ga0163163_10003368 | Ga0163163_100033682 | 107 |
| 382 | 3300014325 | Ga0163163_10015469 | Ga0163163_100154695 | 107 |
| 383 | 3300014325 | Ga0163163_10425437 | Ga0163163_104254372 | 107 |
| 384 | 3300014325 | Ga0163163_10582710 | Ga0163163_105827102 | 107 |
| 385 | 3300014326 | Ga0157380_10000523 | Ga0157380_1000052312 | 107 |
| 386 | 3300014326 | Ga0157380_10001490 | Ga0157380_100014907 | 107 |
| 387 | 3300014326 | Ga0157380_10497037 | Ga0157380_104970373 | 107 |
| 388 | 3300014326 | Ga0157380_10579256 | Ga0157380_105792562 | 107 |
| 389 | 3300014326 | Ga0157380_10957487 | Ga0157380_109574872 | 107 |
| 390 | 3300014968 | Ga0157379_10000786 | Ga0157379_1000078614 | 107 |
| 391 | 3300014968 | Ga0157379_10020413 | Ga0157379_100204133 | 107 |
| 392 | 3300014968 | Ga0157379_10023113 | Ga0157379_100231135 | 107 |
| 393 | 3300014968 | Ga0157379_10225379 | Ga0157379_102253792 | 107 |
| 394 | 3300014968 | Ga0157379_11152174 | Ga0157379_111521742 | 107 |
| 395 | 3300014969 | Ga0157376_10010282 | Ga0157376_100102822 | 107 |
| 396 | 3300014969 | Ga0157376_12384523 | Ga0157376_123845231 | 107 |
| 397 | 3300015261 | Ga0182006_1007768 | Ga0182006_10077682 | 107 |
| 398 | 3300015261 | Ga0182006_1099210 | Ga0182006_10992102 | 107 |
| 399 | 3300015265 | Ga0182005_1067608 | Ga0182005_10676081 | 107 |
| 400 | 3300017792 | Ga0163161_10038675 | Ga0163161_100386753 | 107 |
| 401 | 3300017792 | Ga0163161_10141983 | Ga0163161_101419833 | 107 |
| 402 | 3300017792 | Ga0163161_10260362 | Ga0163161_102603622 | 107 |
| 403 | 3300017792 | Ga0163161_10288360 | Ga0163161_102883601 | 107 |
| 404 | 3300017792 | Ga0163161_10604366 | Ga0163161_106043661 | 107 |
| 405 | 3300020076 | Ga0206355_1034253 | Ga0206355_10342532 | 107 |
| 406 | 3300020610 | Ga0154015_1305603 | Ga0154015_13056031 | 107 |
| 407 | 3300021377 | Ga0213874_10038162 | Ga0213874_100381622 | 107 |
| 408 | 3300021377 | Ga0213874_10249862 | Ga0213874_102498622 | 107 |
| 409 | 3300021384 | Ga0213876_10034937 | Ga0213876_100349372 | 107 |
| 410 | 3300021384 | Ga0213876_10714319 | Ga0213876_107143191 | 107 |
| 411 | 3300022467 | Ga0224712_10322525 | Ga0224712_103225252 | 107 |
| 412 | 3300025207 | Ga0209760_100046 | Ga0209760_10004661 | 107 |
| 413 | 3300025231 | Ga0207427_100029 | Ga0207427_100029324 | 107 |
| 414 | 3300025233 | Ga0209437_100009 | Ga0209437_100009579 | 107 |
| 415 | 3300025245 | Ga0207425_1026619 | Ga0207425_10266191 | 107 |
| 416 | 3300025261 | Ga0209233_1000032 | Ga0209233_1000032579 | 107 |
| 417 | 3300025292 | Ga0209676_1000047 | Ga0209676_100004794 | 107 |
| 418 | 3300025292 | Ga0209676_1000079 | Ga0209676_1000079176 | 107 |
| 419 | 3300025292 | Ga0209676_1002594 | Ga0209676_10025942 | 107 |
| 420 | 3300025298 | Ga0209050_1000329 | Ga0209050_100032910 | 107 |
| 421 | 3300025299 | Ga0209256_1007584 | Ga0209256_10075845 | 107 |
| 422 | 3300025303 | Ga0209051_1000879 | Ga0209051_10008793 | 107 |
| 423 | 3300025303 | Ga0209051_1001951 | Ga0209051_10019519 | 107 |
| 424 | 3300025304 | Ga0209257_1000081 | Ga0209257_1000081186 | 107 |
| 425 | 3300025304 | Ga0209257_1000231 | Ga0209257_100023123 | 107 |
| 426 | 3300025304 | Ga0209257_1005149 | Ga0209257_100514912 | 107 |
| 427 | 3300025304 | Ga0209257_1008743 | Ga0209257_10087431 | 107 |
| 428 | 3300025321 | Ga0207656_10076352 | Ga0207656_100763522 | 107 |
| 429 | 3300025711 | Ga0207696_1000164 | Ga0207696_10001647 | 107 |
| 430 | 3300025711 | Ga0207696_1015856 | Ga0207696_10158562 | 107 |
| 431 | 3300025711 | Ga0207696_1055096 | Ga0207696_10550962 | 107 |
| 432 | 3300025728 | Ga0207655_1001023 | Ga0207655_10010231 | 107 |
| 433 | 3300025728 | Ga0207655_1001119 | Ga0207655_100111924 | 107 |
| 434 | 3300025728 | Ga0207655_1001253 | Ga0207655_100125313 | 107 |
| 435 | 3300025728 | Ga0207655_1009566 | Ga0207655_10095663 | 107 |
| 436 | 3300025728 | Ga0207655_1029036 | Ga0207655_10290362 | 107 |
| 437 | 3300025728 | Ga0207655_1052855 | Ga0207655_10528552 | 107 |
| 438 | 3300025735 | Ga0207713_1002179 | Ga0207713_10021798 | 107 |
| 439 | 3300025735 | Ga0207713_1003704 | Ga0207713_100370413 | 107 |
| 440 | 3300025735 | Ga0207713_1006408 | Ga0207713_10064086 | 107 |
| 441 | 3300025735 | Ga0207713_1012464 | Ga0207713_10124642 | 107 |
| 442 | 3300025735 | Ga0207713_1025353 | Ga0207713_10253531 | 107 |
| 443 | 3300025735 | Ga0207713_1026428 | Ga0207713_10264281 | 107 |
| 444 | 3300025735 | Ga0207713_1037828 | Ga0207713_10378281 | 107 |
| 445 | 3300025735 | Ga0207713_1047478 | Ga0207713_10474782 | 107 |
| 446 | 3300025893 | Ga0207682_10111450 | Ga0207682_101114502 | 107 |
| 447 | 3300025898 | Ga0207692_10349269 | Ga0207692_103492692 | 107 |
| 448 | 3300025898 | Ga0207692_10918993 | Ga0207692_109189932 | 107 |
| 449 | 3300025899 | Ga0207642_10216896 | Ga0207642_102168961 | 107 |
| 450 | 3300025899 | Ga0207642_10544291 | Ga0207642_105442912 | 107 |
| 451 | 3300025899 | Ga0207642_10582826 | Ga0207642_105828261 | 107 |
| 452 | 3300025900 | Ga0207710_10000345 | Ga0207710_100003454 | 107 |
| 453 | 3300025900 | Ga0207710_10006077 | Ga0207710_100060774 | 107 |
| 454 | 3300025900 | Ga0207710_10183081 | Ga0207710_101830812 | 107 |
| 455 | 3300025900 | Ga0207710_10225776 | Ga0207710_102257762 | 107 |
| 456 | 3300025900 | Ga0207710_10411046 | Ga0207710_104110462 | 107 |
| 457 | 3300025901 | Ga0207688_10132352 | Ga0207688_101323521 | 107 |
| 458 | 3300025903 | Ga0207680_10014536 | Ga0207680_100145361 | 107 |
| 459 | 3300025903 | Ga0207680_10117095 | Ga0207680_101170951 | 107 |
| 460 | 3300025904 | Ga0207647_10003570 | Ga0207647_1000357012 | 107 |
| 461 | 3300025904 | Ga0207647_10261820 | Ga0207647_102618201 | 107 |
| 462 | 3300025905 | Ga0207685_10079600 | Ga0207685_100796003 | 107 |
| 463 | 3300025905 | Ga0207685_10186387 | Ga0207685_101863871 | 107 |
| 464 | 3300025906 | Ga0207699_10167599 | Ga0207699_101675992 | 107 |
| 465 | 3300025906 | Ga0207699_10281999 | Ga0207699_102819991 | 107 |
| 466 | 3300025907 | Ga0207645_10437530 | Ga0207645_104375302 | 107 |
| 467 | 3300025907 | Ga0207645_10669493 | Ga0207645_106694931 | 107 |
| 468 | 3300025907 | Ga0207645_10773504 | Ga0207645_107735042 | 107 |
| 469 | 3300025908 | Ga0207643_10017683 | Ga0207643_100176833 | 107 |
| 470 | 3300025908 | Ga0207643_10035559 | Ga0207643_100355593 | 107 |
| 471 | 3300025908 | Ga0207643_10054619 | Ga0207643_100546194 | 107 |
| 472 | 3300025909 | Ga0207705_10508878 | Ga0207705_105088782 | 107 |
| 473 | 3300025912 | Ga0207707_10002386 | Ga0207707_100023867 | 107 |
| 474 | 3300025912 | Ga0207707_10958240 | Ga0207707_109582402 | 107 |
| 475 | 3300025913 | Ga0207695_10022267 | Ga0207695_100222672 | 107 |
| 476 | 3300025913 | Ga0207695_10027680 | Ga0207695_100276803 | 107 |
| 477 | 3300025913 | Ga0207695_10034230 | Ga0207695_100342303 | 107 |
| 478 | 3300025913 | Ga0207695_10044843 | Ga0207695_100448434 | 107 |
| 479 | 3300025913 | Ga0207695_10045412 | Ga0207695_100454122 | 107 |
| 480 | 3300025913 | Ga0207695_10048616 | Ga0207695_100486163 | 107 |
| 481 | 3300025913 | Ga0207695_10069991 | Ga0207695_100699913 | 107 |
| 482 | 3300025913 | Ga0207695_10186801 | Ga0207695_101868012 | 107 |
| 483 | 3300025913 | Ga0207695_10434890 | Ga0207695_104348902 | 107 |
| 484 | 3300025913 | Ga0207695_10874344 | Ga0207695_108743442 | 107 |
| 485 | 3300025914 | Ga0207671_10000019 | Ga0207671_10000019180 | 107 |
| 486 | 3300025914 | Ga0207671_10035517 | Ga0207671_100355173 | 107 |
| 487 | 3300025914 | Ga0207671_10228557 | Ga0207671_102285572 | 107 |
| 488 | 3300025914 | Ga0207671_10287531 | Ga0207671_102875312 | 107 |
| 489 | 3300025915 | Ga0207693_10095446 | Ga0207693_100954462 | 107 |
| 490 | 3300025916 | Ga0207663_10003510 | Ga0207663_100035109 | 107 |
| 491 | 3300025916 | Ga0207663_10020460 | Ga0207663_100204604 | 107 |
| 492 | 3300025916 | Ga0207663_10894535 | Ga0207663_108945352 | 107 |
| 493 | 3300025917 | Ga0207660_10018244 | Ga0207660_100182442 | 107 |
| 494 | 3300025917 | Ga0207660_10030100 | Ga0207660_100301002 | 107 |
| 495 | 3300025917 | Ga0207660_10620298 | Ga0207660_106202982 | 107 |
| 496 | 3300025918 | Ga0207662_10077415 | Ga0207662_100774152 | 107 |
| 497 | 3300025919 | Ga0207657_10015296 | Ga0207657_100152967 | 107 |
| 498 | 3300025919 | Ga0207657_10870238 | Ga0207657_108702381 | 107 |
| 499 | 3300025920 | Ga0207649_10000004 | Ga0207649_10000004328 | 107 |
| 500 | 3300025920 | Ga0207649_10021407 | Ga0207649_100214074 | 107 |
| 501 | 3300025920 | Ga0207649_10031365 | Ga0207649_100313653 | 107 |
| 502 | 3300025921 | Ga0207652_10006955 | Ga0207652_100069556 | 107 |
| 503 | 3300025921 | Ga0207652_10118222 | Ga0207652_101182222 | 107 |
| 504 | 3300025921 | Ga0207652_10550082 | Ga0207652_105500821 | 107 |
| 505 | 3300025923 | Ga0207681_10118210 | Ga0207681_101182103 | 107 |
| 506 | 3300025923 | Ga0207681_10322039 | Ga0207681_103220392 | 107 |
| 507 | 3300025923 | Ga0207681_10547352 | Ga0207681_105473521 | 107 |
| 508 | 3300025923 | Ga0207681_10802387 | Ga0207681_108023871 | 107 |
| 509 | 3300025924 | Ga0207694_10116328 | Ga0207694_101163282 | 107 |
| 510 | 3300025924 | Ga0207694_10285747 | Ga0207694_102857472 | 107 |
| 511 | 3300025924 | Ga0207694_10339982 | Ga0207694_103399822 | 107 |
| 512 | 3300025924 | Ga0207694_10372263 | Ga0207694_103722632 | 107 |
| 513 | 3300025924 | Ga0207694_11815677 | Ga0207694_118156771 | 107 |
| 514 | 3300025925 | Ga0207650_10005141 | Ga0207650_100051416 | 107 |
| 515 | 3300025925 | Ga0207650_10131542 | Ga0207650_101315421 | 107 |
| 516 | 3300025926 | Ga0207659_10010565 | Ga0207659_100105653 | 107 |
| 517 | 3300025926 | Ga0207659_10295262 | Ga0207659_102952622 | 107 |
| 518 | 3300025927 | Ga0207687_10135083 | Ga0207687_101350832 | 107 |
| 519 | 3300025927 | Ga0207687_11163306 | Ga0207687_111633062 | 107 |
| 520 | 3300025928 | Ga0207700_10031633 | Ga0207700_100316336 | 107 |
| 521 | 3300025928 | Ga0207700_10108684 | Ga0207700_101086842 | 107 |
| 522 | 3300025928 | Ga0207700_10422269 | Ga0207700_104222691 | 107 |
| 523 | 3300025928 | Ga0207700_10443536 | Ga0207700_104435362 | 107 |
| 524 | 3300025928 | Ga0207700_10521674 | Ga0207700_105216742 | 107 |
| 525 | 3300025929 | Ga0207664_10046657 | Ga0207664_100466572 | 107 |
| 526 | 3300025929 | Ga0207664_11055684 | Ga0207664_110556842 | 107 |
| 527 | 3300025929 | Ga0207664_11296888 | Ga0207664_112968882 | 107 |
| 528 | 3300025931 | Ga0207644_10000403 | Ga0207644_1000040318 | 107 |
| 529 | 3300025931 | Ga0207644_10056591 | Ga0207644_100565914 | 107 |
| 530 | 3300025931 | Ga0207644_10281555 | Ga0207644_102815553 | 107 |
| 531 | 3300025931 | Ga0207644_10847696 | Ga0207644_108476961 | 107 |
| 532 | 3300025931 | Ga0207644_10901383 | Ga0207644_109013832 | 107 |
| 533 | 3300025932 | Ga0207690_10055807 | Ga0207690_100558071 | 107 |
| 534 | 3300025933 | Ga0207706_10003395 | Ga0207706_1000339514 | 107 |
| 535 | 3300025933 | Ga0207706_10088968 | Ga0207706_100889683 | 107 |
| 536 | 3300025933 | Ga0207706_10341660 | Ga0207706_103416602 | 107 |
| 537 | 3300025934 | Ga0207686_10015382 | Ga0207686_100153822 | 107 |
| 538 | 3300025934 | Ga0207686_11724266 | Ga0207686_117242661 | 107 |
| 539 | 3300025935 | Ga0207709_10034056 | Ga0207709_100340562 | 107 |
| 540 | 3300025935 | Ga0207709_10062436 | Ga0207709_100624361 | 107 |
| 541 | 3300025935 | Ga0207709_11141119 | Ga0207709_111411191 | 107 |
| 542 | 3300025936 | Ga0207670_10004796 | Ga0207670_100047964 | 107 |
| 543 | 3300025937 | Ga0207669_10089723 | Ga0207669_100897232 | 107 |
| 544 | 3300025937 | Ga0207669_10107077 | Ga0207669_101070773 | 107 |
| 545 | 3300025937 | Ga0207669_10733665 | Ga0207669_107336652 | 107 |
| 546 | 3300025938 | Ga0207704_10119037 | Ga0207704_101190373 | 107 |
| 547 | 3300025938 | Ga0207704_10145815 | Ga0207704_101458152 | 107 |
| 548 | 3300025938 | Ga0207704_10216599 | Ga0207704_102165992 | 107 |
| 549 | 3300025939 | Ga0207665_10011416 | Ga0207665_100114164 | 107 |
| 550 | 3300025939 | Ga0207665_10020217 | Ga0207665_100202176 | 107 |
| 551 | 3300025940 | Ga0207691_10002537 | Ga0207691_100025376 | 107 |
| 552 | 3300025940 | Ga0207691_10008772 | Ga0207691_100087722 | 107 |
| 553 | 3300025940 | Ga0207691_10009236 | Ga0207691_100092367 | 107 |
| 554 | 3300025941 | Ga0207711_10002599 | Ga0207711_100025998 | 107 |
| 555 | 3300025941 | Ga0207711_10021913 | Ga0207711_100219133 | 107 |
| 556 | 3300025941 | Ga0207711_10041758 | Ga0207711_100417583 | 107 |
| 557 | 3300025941 | Ga0207711_10056871 | Ga0207711_100568713 | 107 |
| 558 | 3300025941 | Ga0207711_10552991 | Ga0207711_105529912 | 107 |
| 559 | 3300025942 | Ga0207689_10041539 | Ga0207689_100415395 | 107 |
| 560 | 3300025942 | Ga0207689_10094365 | Ga0207689_100943653 | 107 |
| 561 | 3300025942 | Ga0207689_10146715 | Ga0207689_101467152 | 107 |
| 562 | 3300025942 | Ga0207689_10404796 | Ga0207689_104047962 | 107 |
| 563 | 3300025944 | Ga0207661_10109844 | Ga0207661_101098443 | 107 |
| 564 | 3300025944 | Ga0207661_10543209 | Ga0207661_105432092 | 107 |
| 565 | 3300025945 | Ga0207679_10000019 | Ga0207679_10000019198 | 107 |
| 566 | 3300025945 | Ga0207679_10002358 | Ga0207679_100023586 | 107 |
| 567 | 3300025945 | Ga0207679_10294768 | Ga0207679_102947682 | 107 |
| 568 | 3300025945 | Ga0207679_11335189 | Ga0207679_113351892 | 107 |
| 569 | 3300025949 | Ga0207667_10000618 | Ga0207667_1000061810 | 107 |
| 570 | 3300025949 | Ga0207667_10004938 | Ga0207667_100049385 | 107 |
| 571 | 3300025949 | Ga0207667_10014059 | Ga0207667_100140593 | 107 |
| 572 | 3300025949 | Ga0207667_10890576 | Ga0207667_108905761 | 107 |
| 573 | 3300025949 | Ga0207667_10929776 | Ga0207667_109297761 | 107 |
| 574 | 3300025949 | Ga0207667_12057893 | Ga0207667_120578931 | 107 |
| 575 | 3300025960 | Ga0207651_10496598 | Ga0207651_104965981 | 107 |
| 576 | 3300025960 | Ga0207651_11196138 | Ga0207651_111961382 | 107 |
| 577 | 3300025960 | Ga0207651_11872218 | Ga0207651_118722181 | 107 |
| 578 | 3300025961 | Ga0207712_10062143 | Ga0207712_100621432 | 107 |
| 579 | 3300025961 | Ga0207712_10313931 | Ga0207712_103139312 | 107 |
| 580 | 3300025972 | Ga0207668_10003932 | Ga0207668_100039327 | 107 |
| 581 | 3300025972 | Ga0207668_11184130 | Ga0207668_111841302 | 107 |
| 582 | 3300025981 | Ga0207640_10001795 | Ga0207640_1000179511 | 107 |
| 583 | 3300025981 | Ga0207640_10128235 | Ga0207640_101282353 | 107 |
| 584 | 3300025981 | Ga0207640_10141671 | Ga0207640_101416713 | 107 |
| 585 | 3300025981 | Ga0207640_10195006 | Ga0207640_101950062 | 107 |
| 586 | 3300025986 | Ga0207658_10061497 | Ga0207658_100614973 | 107 |
| 587 | 3300025986 | Ga0207658_10162868 | Ga0207658_101628682 | 107 |
| 588 | 3300025986 | Ga0207658_10743435 | Ga0207658_107434352 | 107 |
| 589 | 3300025986 | Ga0207658_10786380 | Ga0207658_107863802 | 107 |
| 590 | 3300025986 | Ga0207658_10876426 | Ga0207658_108764262 | 107 |
| 591 | 3300025986 | Ga0207658_10926464 | Ga0207658_109264641 | 107 |
| 592 | 3300026035 | Ga0207703_10000527 | Ga0207703_1000052713 | 107 |
| 593 | 3300026035 | Ga0207703_10000649 | Ga0207703_100006492 | 107 |
| 594 | 3300026035 | Ga0207703_10011508 | Ga0207703_100115085 | 107 |
| 595 | 3300026035 | Ga0207703_10062891 | Ga0207703_100628911 | 107 |
| 596 | 3300026035 | Ga0207703_10073316 | Ga0207703_100733164 | 107 |
| 597 | 3300026035 | Ga0207703_10084825 | Ga0207703_100848253 | 107 |
| 598 | 3300026041 | Ga0207639_10165808 | Ga0207639_101658082 | 107 |
| 599 | 3300026067 | Ga0207678_10033565 | Ga0207678_100335654 | 107 |
| 600 | 3300026067 | Ga0207678_10053737 | Ga0207678_100537373 | 107 |
| 601 | 3300026075 | Ga0207708_10027051 | Ga0207708_100270512 | 107 |
| 602 | 3300026075 | Ga0207708_10151184 | Ga0207708_101511842 | 107 |
| 603 | 3300026075 | Ga0207708_10221566 | Ga0207708_102215661 | 107 |
| 604 | 3300026075 | Ga0207708_10716228 | Ga0207708_107162282 | 107 |
| 605 | 3300026075 | Ga0207708_10760680 | Ga0207708_107606802 | 107 |
| 606 | 3300026078 | Ga0207702_10327990 | Ga0207702_103279901 | 107 |
| 607 | 3300026078 | Ga0207702_10519742 | Ga0207702_105197422 | 107 |
| 608 | 3300026088 | Ga0207641_10000604 | Ga0207641_100006043 | 107 |
| 609 | 3300026088 | Ga0207641_10006006 | Ga0207641_100060062 | 107 |
| 610 | 3300026088 | Ga0207641_10256130 | Ga0207641_102561301 | 107 |
| 611 | 3300026088 | Ga0207641_11587977 | Ga0207641_115879772 | 107 |
| 612 | 3300026089 | Ga0207648_10004465 | Ga0207648_100044657 | 107 |
| 613 | 3300026095 | Ga0207676_10279624 | Ga0207676_102796242 | 107 |
| 614 | 3300026095 | Ga0207676_10402730 | Ga0207676_104027301 | 107 |
| 615 | 3300026095 | Ga0207676_10578803 | Ga0207676_105788032 | 107 |
| 616 | 3300026095 | Ga0207676_11155158 | Ga0207676_111551582 | 107 |
| 617 | 3300026116 | Ga0207674_10006753 | Ga0207674_100067534 | 107 |
| 618 | 3300026116 | Ga0207674_10131659 | Ga0207674_101316592 | 107 |
| 619 | 3300026116 | Ga0207674_10252436 | Ga0207674_102524363 | 107 |
| 620 | 3300026116 | Ga0207674_10414235 | Ga0207674_104142352 | 107 |
| 621 | 3300026116 | Ga0207674_11778706 | Ga0207674_117787061 | 107 |
| 622 | 3300026118 | Ga0207675_100030104 | Ga0207675_1000301045 | 107 |
| 623 | 3300026118 | Ga0207675_100037357 | Ga0207675_1000373575 | 107 |
| 624 | 3300026118 | Ga0207675_100207390 | Ga0207675_1002073902 | 107 |
| 625 | 3300026118 | Ga0207675_100252538 | Ga0207675_1002525383 | 107 |
| 626 | 3300026118 | Ga0207675_100335285 | Ga0207675_1003352852 | 107 |
| 627 | 3300026118 | Ga0207675_100691444 | Ga0207675_1006914442 | 107 |
| 628 | 3300026118 | Ga0207675_101036536 | Ga0207675_1010365362 | 107 |
| 629 | 3300026121 | Ga0207683_10889411 | Ga0207683_108894112 | 107 |
| 630 | 3300026142 | Ga0207698_10554213 | Ga0207698_105542132 | 107 |
| 631 | 3300026142 | Ga0207698_10593692 | Ga0207698_105936922 | 107 |
| 632 | 3300026142 | Ga0207698_11063807 | Ga0207698_110638073 | 107 |
| 633 | 3300027111 | Ga0209281_1000013 | Ga0209281_1000013411 | 107 |
| 634 | 3300027111 | Ga0209281_1000015 | Ga0209281_1000015427 | 107 |
| 635 | 3300027111 | Ga0209281_1003287 | Ga0209281_10032872 | 107 |
| 636 | 3300027296 | Ga0209389_1000205 | Ga0209389_100020527 | 107 |
| 637 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004336 | 107 |
| 638 | 3300027312 | Ga0209371_1000016 | Ga0209371_100001615 | 107 |
| 639 | 3300027312 | Ga0209371_1000142 | Ga0209371_100014262 | 107 |
| 640 | 3300027312 | Ga0209371_1000584 | Ga0209371_100058439 | 107 |
| 641 | 3300027312 | Ga0209371_1027632 | Ga0209371_10276322 | 107 |
| 642 | 3300027312 | Ga0209371_1040604 | Ga0209371_10406041 | 107 |
| 643 | 3300027512 | Ga0209179_1000006 | Ga0209179_100000668 | 107 |
| 644 | 3300027512 | Ga0209179_1007486 | Ga0209179_10074862 | 107 |
| 645 | 3300027666 | Ga0209282_1305181 | Ga0209282_13051812 | 107 |
| 646 | 3300027671 | Ga0209588_1092973 | Ga0209588_10929732 | 107 |
| 647 | 3300027907 | Ga0207428_10004796 | Ga0207428_100047968 | 107 |
| 648 | 3300027907 | Ga0207428_10014528 | Ga0207428_100145284 | 107 |
| 649 | 3300027907 | Ga0207428_10028912 | Ga0207428_100289123 | 107 |
| 650 | 3300027907 | Ga0207428_10718917 | Ga0207428_107189171 | 107 |
| 651 | 3300028017 | Ga0265356_1001503 | Ga0265356_10015032 | 107 |
| 652 | 3300028023 | Ga0265357_1000734 | Ga0265357_10007343 | 107 |
| 653 | 3300028379 | Ga0268266_10005233 | Ga0268266_100052335 | 107 |
| 654 | 3300028379 | Ga0268266_10038457 | Ga0268266_100384574 | 107 |
| 655 | 3300028379 | Ga0268266_10086540 | Ga0268266_100865402 | 107 |
| 656 | 3300028379 | Ga0268266_10175598 | Ga0268266_101755982 | 107 |
| 657 | 3300028379 | Ga0268266_10194966 | Ga0268266_101949661 | 107 |
| 658 | 3300028379 | Ga0268266_10247583 | Ga0268266_102475832 | 107 |
| 659 | 3300028379 | Ga0268266_10285925 | Ga0268266_102859252 | 107 |
| 660 | 3300028379 | Ga0268266_10964159 | Ga0268266_109641592 | 107 |
| 661 | 3300028379 | Ga0268266_11978083 | Ga0268266_119780832 | 107 |
| 662 | 3300028380 | Ga0268265_10000932 | Ga0268265_100009329 | 107 |
| 663 | 3300028380 | Ga0268265_10002340 | Ga0268265_1000234012 | 107 |
| 664 | 3300028380 | Ga0268265_10358027 | Ga0268265_103580271 | 107 |
| 665 | 3300028380 | Ga0268265_11672093 | Ga0268265_116720932 | 107 |
| 666 | 3300028380 | Ga0268265_11891787 | Ga0268265_118917872 | 107 |
| 667 | 3300028381 | Ga0268264_10000176 | Ga0268264_1000017661 | 107 |
| 668 | 3300028381 | Ga0268264_10003702 | Ga0268264_100037029 | 107 |
| 669 | 3300028381 | Ga0268264_10005113 | Ga0268264_100051132 | 107 |
| 670 | 3300028381 | Ga0268264_10152827 | Ga0268264_101528272 | 107 |
| 671 | 3300028558 | Ga0265326_10017083 | Ga0265326_100170834 | 107 |
| 672 | 3300028563 | Ga0265319_1010114 | Ga0265319_10101144 | 107 |
| 673 | 3300028573 | Ga0265334_10000669 | Ga0265334_1000066918 | 107 |
| 674 | 3300028573 | Ga0265334_10026076 | Ga0265334_100260762 | 107 |
| 675 | 3300028577 | Ga0265318_10019707 | Ga0265318_100197072 | 107 |
| 676 | 3300028654 | Ga0265322_10214651 | Ga0265322_102146511 | 107 |
| 677 | 3300028786 | Ga0307517_10226615 | Ga0307517_102266152 | 107 |
| 678 | 3300028794 | Ga0307515_10001184 | Ga0307515_1000118454 | 107 |
| 679 | 3300028794 | Ga0307515_10371965 | Ga0307515_103719652 | 107 |
| 680 | 3300028800 | Ga0265338_10010356 | Ga0265338_100103565 | 107 |
| 681 | 3300028800 | Ga0265338_10116545 | Ga0265338_101165454 | 107 |
| 682 | 3300028800 | Ga0265338_10209784 | Ga0265338_102097842 | 107 |
| 683 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005709 | 107 |
| 684 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015555 | 107 |
| 685 | 3300030500 | Ga0268256_1000111 | Ga0268256_100011164 | 107 |
| 686 | 3300030500 | Ga0268256_1000436 | Ga0268256_10004363 | 107 |
| 687 | 3300030500 | Ga0268256_1031434 | Ga0268256_10314342 | 107 |
| 688 | 3300030500 | Ga0268256_1038012 | Ga0268256_10380121 | 107 |
| 689 | 3300030521 | Ga0307511_10029804 | Ga0307511_100298043 | 107 |
| 690 | 3300030731 | Ga0316177_1095471 | Ga0316177_10954712 | 107 |
| 691 | 3300030733 | Ga0314311_1137878 | Ga0314311_11378782 | 107 |
| 692 | 3300030735 | Ga0316178_1009525 | Ga0316178_100952527 | 107 |
| 693 | 3300030742 | Ga0316183_1002629 | Ga0316183_10026292 | 107 |
| 694 | 3300030744 | Ga0316181_1261844 | Ga0316181_12618442 | 107 |
| 695 | 3300030763 | Ga0265763_1006747 | Ga0265763_10067472 | 107 |
| 696 | 3300030836 | Ga0265767_106400 | Ga0265767_1064001 | 107 |
| 697 | 3300030879 | Ga0265765_1029494 | Ga0265765_10294942 | 107 |
| 698 | 3300031018 | Ga0265773_1047532 | Ga0265773_10475321 | 107 |
| 699 | 3300031090 | Ga0265760_10010613 | Ga0265760_100106132 | 107 |
| 700 | 3300031090 | Ga0265760_10184949 | Ga0265760_101849492 | 107 |
| 701 | 3300031235 | Ga0265330_10352430 | Ga0265330_103524301 | 107 |
| 702 | 3300031238 | Ga0265332_10034344 | Ga0265332_100343442 | 107 |
| 703 | 3300031239 | Ga0265328_10004103 | Ga0265328_100041034 | 107 |
| 704 | 3300031239 | Ga0265328_10143135 | Ga0265328_101431352 | 107 |
| 705 | 3300031240 | Ga0265320_10022318 | Ga0265320_100223185 | 107 |
| 706 | 3300031241 | Ga0265325_10013274 | Ga0265325_100132745 | 107 |
| 707 | 3300031242 | Ga0265329_10008091 | Ga0265329_100080914 | 107 |
| 708 | 3300031247 | Ga0265340_10034386 | Ga0265340_100343862 | 107 |
| 709 | 3300031247 | Ga0265340_10186057 | Ga0265340_101860572 | 107 |
| 710 | 3300031249 | Ga0265339_10017954 | Ga0265339_100179545 | 107 |
| 711 | 3300031250 | Ga0265331_10005302 | Ga0265331_100053028 | 107 |
| 712 | 3300031251 | Ga0265327_10001379 | Ga0265327_100013793 | 107 |
| 713 | 3300031251 | Ga0265327_10003741 | Ga0265327_100037418 | 107 |
| 714 | 3300031251 | Ga0265327_10010879 | Ga0265327_100108793 | 107 |
| 715 | 3300031251 | Ga0265327_10045765 | Ga0265327_100457652 | 107 |
| 716 | 3300031344 | Ga0265316_10000783 | Ga0265316_1000078333 | 107 |
| 717 | 3300031344 | Ga0265316_10012865 | Ga0265316_1001286510 | 107 |
| 718 | 3300031344 | Ga0265316_10020230 | Ga0265316_100202305 | 107 |
| 719 | 3300031456 | Ga0307513_10042643 | Ga0307513_100426434 | 107 |
| 720 | 3300031456 | Ga0307513_10179846 | Ga0307513_101798463 | 107 |
| 721 | 3300031456 | Ga0307513_10640543 | Ga0307513_106405431 | 107 |
| 722 | 3300031507 | Ga0307509_10000021 | Ga0307509_10000021211 | 107 |
| 723 | 3300031507 | Ga0307509_10105278 | Ga0307509_101052784 | 107 |
| 724 | 3300031507 | Ga0307509_10419708 | Ga0307509_104197081 | 107 |
| 725 | 3300031548 | Ga0307408_100045527 | Ga0307408_1000455273 | 107 |
| 726 | 3300031548 | Ga0307408_100088657 | Ga0307408_1000886572 | 107 |
| 727 | 3300031548 | Ga0307408_100339274 | Ga0307408_1003392742 | 107 |
| 728 | 3300031548 | Ga0307408_100594254 | Ga0307408_1005942541 | 107 |
| 729 | 3300031595 | Ga0265313_10005492 | Ga0265313_1000549210 | 107 |
| 730 | 3300031595 | Ga0265313_10058875 | Ga0265313_100588754 | 107 |
| 731 | 3300031649 | Ga0307514_10498177 | Ga0307514_104981771 | 107 |
| 732 | 3300031665 | Ga0316575_10250229 | Ga0316575_102502292 | 107 |
| 733 | 3300031691 | Ga0316579_10089972 | Ga0316579_100899722 | 107 |
| 734 | 3300031691 | Ga0316579_10149269 | Ga0316579_101492692 | 107 |
| 735 | 3300031691 | Ga0316579_10299821 | Ga0316579_102998212 | 107 |
| 736 | 3300031711 | Ga0265314_10022458 | Ga0265314_100224584 | 107 |
| 737 | 3300031711 | Ga0265314_10279726 | Ga0265314_102797261 | 107 |
| 738 | 3300031711 | Ga0265314_10715672 | Ga0265314_107156722 | 107 |
| 739 | 3300031712 | Ga0265342_10047521 | Ga0265342_100475212 | 107 |
| 740 | 3300031727 | Ga0316576_10002013 | Ga0316576_100020134 | 107 |
| 741 | 3300031727 | Ga0316576_10005102 | Ga0316576_100051026 | 107 |
| 742 | 3300031727 | Ga0316576_10197015 | Ga0316576_101970152 | 107 |
| 743 | 3300031727 | Ga0316576_10258572 | Ga0316576_102585722 | 107 |
| 744 | 3300031727 | Ga0316576_10381748 | Ga0316576_103817482 | 107 |
| 745 | 3300031728 | Ga0316578_10023579 | Ga0316578_100235792 | 107 |
| 746 | 3300031728 | Ga0316578_10132478 | Ga0316578_101324782 | 107 |
| 747 | 3300031728 | Ga0316578_10144519 | Ga0316578_101445192 | 107 |
| 748 | 3300031728 | Ga0316578_10145739 | Ga0316578_101457391 | 107 |
| 749 | 3300031728 | Ga0316578_10386358 | Ga0316578_103863581 | 107 |
| 750 | 3300031728 | Ga0316578_10451027 | Ga0316578_104510272 | 107 |
| 751 | 3300031728 | Ga0316578_10559007 | Ga0316578_105590071 | 107 |
| 752 | 3300031730 | Ga0307516_10000050 | Ga0307516_1000005075 | 107 |
| 753 | 3300031730 | Ga0307516_10284338 | Ga0307516_102843382 | 107 |
| 754 | 3300031731 | Ga0307405_10433782 | Ga0307405_104337821 | 107 |
| 755 | 3300031731 | Ga0307405_11166368 | Ga0307405_111663681 | 107 |
| 756 | 3300031731 | Ga0307405_11175368 | Ga0307405_111753682 | 107 |
| 757 | 3300031733 | Ga0316577_10013474 | Ga0316577_100134742 | 107 |
| 758 | 3300031733 | Ga0316577_10043323 | Ga0316577_100433232 | 107 |
| 759 | 3300031733 | Ga0316577_10232132 | Ga0316577_102321322 | 107 |
| 760 | 3300031733 | Ga0316577_10421347 | Ga0316577_104213472 | 107 |
| 761 | 3300031733 | Ga0316577_10544324 | Ga0316577_105443241 | 107 |
| 762 | 3300031824 | Ga0307413_10010454 | Ga0307413_100104546 | 107 |
| 763 | 3300031824 | Ga0307413_10163301 | Ga0307413_101633012 | 107 |
| 764 | 3300031824 | Ga0307413_10942534 | Ga0307413_109425342 | 107 |
| 765 | 3300031824 | Ga0307413_11749383 | Ga0307413_117493832 | 107 |
| 766 | 3300031838 | Ga0307518_10482099 | Ga0307518_104820992 | 107 |
| 767 | 3300031852 | Ga0307410_10023462 | Ga0307410_100234624 | 107 |
| 768 | 3300031852 | Ga0307410_10513296 | Ga0307410_105132962 | 107 |
| 769 | 3300031852 | Ga0307410_12036100 | Ga0307410_120361002 | 107 |
| 770 | 3300031901 | Ga0307406_10064136 | Ga0307406_100641363 | 107 |
| 771 | 3300031901 | Ga0307406_10273777 | Ga0307406_102737772 | 107 |
| 772 | 3300031901 | Ga0307406_10368777 | Ga0307406_103687772 | 107 |
| 773 | 3300031901 | Ga0307406_11263546 | Ga0307406_112635461 | 107 |
| 774 | 3300031903 | Ga0307407_10002190 | Ga0307407_1000219010 | 107 |
| 775 | 3300031911 | Ga0307412_10590216 | Ga0307412_105902162 | 107 |
| 776 | 3300031911 | Ga0307412_10860810 | Ga0307412_108608102 | 107 |
| 777 | 3300031995 | Ga0307409_100028163 | Ga0307409_1000281635 | 107 |
| 778 | 3300031995 | Ga0307409_100297603 | Ga0307409_1002976032 | 107 |
| 779 | 3300031995 | Ga0307409_100423553 | Ga0307409_1004235532 | 107 |
| 780 | 3300031995 | Ga0307409_101241970 | Ga0307409_1012419702 | 107 |
| 781 | 3300032002 | Ga0307416_100008099 | Ga0307416_1000080992 | 107 |
| 782 | 3300032002 | Ga0307416_100053714 | Ga0307416_1000537144 | 107 |
| 783 | 3300032002 | Ga0307416_100263336 | Ga0307416_1002633362 | 107 |
| 784 | 3300032002 | Ga0307416_100300364 | Ga0307416_1003003642 | 107 |
| 785 | 3300032002 | Ga0307416_101194651 | Ga0307416_1011946512 | 107 |
| 786 | 3300032004 | Ga0307414_10108541 | Ga0307414_101085413 | 107 |
| 787 | 3300032004 | Ga0307414_10182901 | Ga0307414_101829012 | 107 |
| 788 | 3300032004 | Ga0307414_10249447 | Ga0307414_102494473 | 107 |
| 789 | 3300032004 | Ga0307414_11135916 | Ga0307414_111359161 | 107 |
| 790 | 3300032005 | Ga0307411_10191085 | Ga0307411_101910853 | 107 |
| 791 | 3300032005 | Ga0307411_10833575 | Ga0307411_108335751 | 107 |
| 792 | 3300032005 | Ga0307411_10935178 | Ga0307411_109351781 | 107 |
| 793 | 3300032126 | Ga0307415_100539626 | Ga0307415_1005396262 | 107 |
| 794 | 3300032126 | Ga0307415_100653888 | Ga0307415_1006538882 | 107 |
| 795 | 3300032126 | Ga0307415_100750955 | Ga0307415_1007509552 | 107 |
| 796 | 3300032126 | Ga0307415_101254395 | Ga0307415_1012543952 | 107 |
| 797 | 3300032126 | Ga0307415_102498791 | Ga0307415_1024987911 | 107 |
| 798 | 3300032133 | Ga0316583_10019225 | Ga0316583_100192252 | 107 |
| 799 | 3300032133 | Ga0316583_10037476 | Ga0316583_100374762 | 107 |
| 800 | 3300032133 | Ga0316583_10060858 | Ga0316583_100608582 | 107 |
| 801 | 3300032137 | Ga0316585_10098244 | Ga0316585_100982441 | 107 |
| 802 | 3300032137 | Ga0316585_10219646 | Ga0316585_102196461 | 107 |
| 803 | 3300032137 | Ga0316585_10238511 | Ga0316585_102385111 | 107 |
| 804 | 3300032139 | Ga0316580_10191924 | Ga0316580_101919241 | 107 |
| 805 | 3300032168 | Ga0316593_10002261 | Ga0316593_100022616 | 107 |
| 806 | 3300032168 | Ga0316593_10008887 | Ga0316593_100088872 | 107 |
| 807 | 3300032168 | Ga0316593_10009046 | Ga0316593_100090461 | 107 |
| 808 | 3300032168 | Ga0316593_10071900 | Ga0316593_100719001 | 107 |
| 809 | 3300032168 | Ga0316593_10132724 | Ga0316593_101327242 | 107 |
| 810 | 3300032168 | Ga0316593_10177769 | Ga0316593_101777691 | 107 |
| 811 | 3300033180 | Ga0307510_10000002 | Ga0307510_10000002123 | 107 |
| 812 | 3300033180 | Ga0307510_10038803 | Ga0307510_100388035 | 107 |
| 813 | 3300033524 | Ga0316592_1112428 | Ga0316592_11124282 | 107 |
| 814 | 3300033529 | Ga0316587_1110358 | Ga0316587_11103581 | 107 |
| 815 | 3300033541 | Ga0316596_1040230 | Ga0316596_10402301 | 107 |
| 816 | 3300033541 | Ga0316596_1101239 | Ga0316596_11012392 | 107 |
| 817 | 3300033541 | Ga0316596_1201300 | Ga0316596_12013002 | 107 |
| 818 | 3300034817 | Ga0373948_0117083 | Ga0373948_0117083_79_402 | 107 |
| 819 | 3300035086 | Ga0373934_0172633 | Ga0373934_0172633_80_403 | 107 |
| 820 | 3300035088 | Ga0373940_0219738 | Ga0373940_0219738_69_392 | 107 |
| 821 | 3300035091 | Ga0373951_0045728 | Ga0373951_0045728_20_343 | 107 |
| 822 | 3300035092 | Ga0373952_0086760 | Ga0373952_0086760_472_795 | 107 |
| 823 | 3300035111 | Ga0373923_0248228 | Ga0373923_0248228_480_803 | 107 |
| 824 | 3300035111 | Ga0373923_0426648 | Ga0373923_0426648_223_546 | 107 |
| 825 | 3300035113 | Ga0373936_0022331 | Ga0373936_0022331_1093_1416 | 107 |
| 826 | 3300035113 | Ga0373936_0049230 | Ga0373936_0049230_94_417 | 107 |
| 827 | 3300035113 | Ga0373936_0500272 | Ga0373936_0500272_100_423 | 107 |
| 828 | 3300035117 | Ga0373953_0134980 | Ga0373953_0134980_679_1002 | 107 |
| 829 | 3300035118 | Ga0373954_0581950 | Ga0373954_0581950_184_507 | 107 |
| 830 | 3300035119 | Ga0373956_0129592 | Ga0373956_0129592_175_498 | 107 |
| 831 | 3300035120 | Ga0373957_0208156 | Ga0373957_0208156_337_660 | 107 |
| 832 | 3300035171 | Ga0373946_0409211 | Ga0373946_0409211_247_570 | 107 |
| 833 | 3300035172 | Ga0373955_0314504 | Ga0373955_0314504_502_825 | 107 |
| 834 | 3300035241 | Ga0373961_0192657 | Ga0373961_0192657_82_405 | 107 |
| 835 | 3300035242 | Ga0373962_0076741 | Ga0373962_0076741_449_772 | 107 |
| 836 | 3300035398 | Ga0316574_0017689 | Ga0316574_0017689_89_412 | 107 |
| 837 | 3300035398 | Ga0316574_0030031 | Ga0316574_0030031_1567_1890 | 107 |
| 838 | 3300035398 | Ga0316574_0120412 | Ga0316574_0120412_633_956 | 107 |
| 839 | 3300035398 | Ga0316574_0520826 | Ga0316574_0520826_247_570 | 107 |
| 840 | 3300035398 | Ga0316574_0674841 | Ga0316574_0674841_292_615 | 107 |
| 841 | 3300035398 | Ga0316574_0878369 | Ga0316574_0878369_130_453 | 107 |
| 842 | 3300035398 | Ga0316574_0944990 | Ga0316574_0944990_51_374 | 107 |
| 843 | 3300035410 | Ga0373924_0400309 | Ga0373924_0400309_74_397 | 107 |
| 844 | 3300035691 | Ga0373931_0074168 | Ga0373931_0074168_1085_1408 | 107 |
| 845 | 3300035692 | Ga0373935_0098770 | Ga0373935_0098770_833_1156 | 107 |
| 846 | 3300035692 | Ga0373935_0649283 | Ga0373935_0649283_116_439 | 107 |
| 847 | 3300035695 | Ga0373927_0686543 | Ga0373927_0686543_194_517 | 107 |
| 848 | 3300035724 | Ga0373933_0726994 | Ga0373933_0726994_305_628 | 107 |
| 849 | 3300036401 | Ga0373937_0230073 | Ga0373937_0230073_418_741 | 107 |
| 850 | 3300036401 | Ga0373937_0352801 | Ga0373937_0352801_803_1126 | 107 |
| 851 | 3300036401 | Ga0373937_1810936 | Ga0373937_1810936_182_505 | 107 |
| 852 | 3300036647 | Ga0316582_0013733 | Ga0316582_0013733_3488_3811 | 107 |
| 853 | 3300036647 | Ga0316582_0031308 | Ga0316582_0031308_362_685 | 107 |
| 854 | 3300036647 | Ga0316582_0036762 | Ga0316582_0036762_1908_2231 | 107 |
| 855 | 3300036647 | Ga0316582_0036824 | Ga0316582_0036824_1080_1403 | 107 |
| 856 | 3300036647 | Ga0316582_0037163 | Ga0316582_0037163_64_387 | 107 |
| 857 | 3300036647 | Ga0316582_0102210 | Ga0316582_0102210_1244_1567 | 107 |
| 858 | 3300036712 | Ga0316584_0006541 | Ga0316584_0006541_1081_1404 | 107 |
| 859 | 3300036712 | Ga0316584_0013058 | Ga0316584_0013058_4730_5053 | 107 |
| 860 | 3300036712 | Ga0316584_0020240 | Ga0316584_0020240_2348_2671 | 107 |
| 861 | 3300036712 | Ga0316584_0098654 | Ga0316584_0098654_523_846 | 107 |
| 862 | 3300036712 | Ga0316584_0147131 | Ga0316584_0147131_1214_1537 | 107 |
| 863 | 3300036712 | Ga0316584_0623978 | Ga0316584_0623978_299_622 | 107 |
| 864 | 3300036712 | Ga0316584_0857075 | Ga0316584_0857075_81_404 | 107 |
| 865 | 3300037068 | Ga0373925_0280903 | Ga0373925_0280903_833_1156 | 107 |
| 866 | 3300037068 | Ga0373925_0412262 | Ga0373925_0412262_472_795 | 107 |
| 867 | 3300037068 | Ga0373925_1367703 | Ga0373925_1367703_97_420 | 107 |
| 868 | 3300037588 | Ga0316581_0000292 | Ga0316581_0000292_4493_4816 | 107 |
| 869 | 3300037588 | Ga0316581_0209325 | Ga0316581_0209325_71_394 | 107 |
| 870 | 3300037588 | Ga0316581_0224402 | Ga0316581_0224402_97_420 | 107 |
| 871 | 3300038443 | Ga0395901_0749020 | Ga0395901_0749020_17_340 | 107 |
| 872 | 3300039437 | Ga0436365_0844919 | Ga0436365_0844919_160_483 | 107 |
| 873 | 3300039437 | Ga0436365_1214120 | Ga0436365_1214120_451_774 | 107 |
| 874 | 3300039437 | Ga0436365_1360668 | Ga0436365_1360668_2684_3007 | 107 |
| 875 | 3300039438 | Ga0436360_0380318 | Ga0436360_0380318_1645_1968 | 107 |
| 876 | 3300039438 | Ga0436360_0515949 | Ga0436360_0515949_263_586 | 107 |
| 877 | 3300039438 | Ga0436360_0593715 | Ga0436360_0593715_1783_2106 | 107 |
| 878 | 3300039438 | Ga0436360_0826695 | Ga0436360_0826695_97_420 | 107 |
| 879 | 3300039438 | Ga0436360_0942877 | Ga0436360_0942877_25_348 | 107 |
| 880 | 3300039438 | Ga0436360_1010070 | Ga0436360_1010070_159_482 | 107 |
| 881 | 3300039447 | Ga0436361_0136079 | Ga0436361_0136079_147_470 | 107 |
| 882 | 3300039447 | Ga0436361_0201071 | Ga0436361_0201071_803_1126 | 107 |
| 883 | 3300039447 | Ga0436361_0567398 | Ga0436361_0567398_68_391 | 107 |
| 884 | 3300039450 | Ga0436363_0164591 | Ga0436363_0164591_598_921 | 107 |
| 885 | 3300039450 | Ga0436363_0952595 | Ga0436363_0952595_2848_3171 | 107 |
| 886 | 3300039450 | Ga0436363_1169546 | Ga0436363_1169546_83_406 | 107 |
| 887 | 3300039450 | Ga0436363_1439963 | Ga0436363_1439963_170_493 | 107 |
| 888 | 3300039450 | Ga0436363_1687372 | Ga0436363_1687372_163_486 | 107 |
| 889 | 3300039453 | Ga0436362_0097055 | Ga0436362_0097055_194_517 | 107 |
| 890 | 3300039453 | Ga0436362_0352054 | Ga0436362_0352054_250_573 | 107 |
| 891 | 3300039453 | Ga0436362_0519667 | Ga0436362_0519667_49_372 | 107 |
| 892 | 3300039453 | Ga0436362_0645059 | Ga0436362_0645059_188_511 | 107 |
| 893 | 3300041404 | Ga0439436_0063145 | Ga0439436_0063145_22_345 | 107 |
| 894 | 3300041405 | Ga0439438_002379 | Ga0439438_002379_7151_7474 | 107 |
| 895 | 3300041406 | Ga0439439_0264001 | Ga0439439_0264001_37_360 | 107 |
| 896 | 3300041410 | Ga0439461_0002118 | Ga0439461_0002118_1883_2206 | 107 |
| 897 | 3300041411 | Ga0439466_0173061 | Ga0439466_0173061_188_511 | 107 |
| 898 | 3300041413 | Ga0439465_0018419 | Ga0439465_0018419_707_1030 | 107 |
| 899 | 3300041413 | Ga0439465_0131668 | Ga0439465_0131668_296_619 | 107 |
| 900 | 3300041441 | Ga0451787_099410 | Ga0451787_099410_150_473 | 107 |
| 901 | 3300041441 | Ga0451787_760742 | Ga0451787_760742_15_338 | 107 |
| 902 | 3300041443 | Ga0451789_0137202 | Ga0451789_0137202_682_1005 | 107 |
| 903 | 3300041451 | Ga0451791_0494916 | Ga0451791_0494916_99_422 | 107 |
| 904 | 3300041451 | Ga0451791_0961898 | Ga0451791_0961898_746_1069 | 107 |
| 905 | 3300041451 | Ga0451791_1050206 | Ga0451791_1050206_399_722 | 107 |
| 906 | 3300041451 | Ga0451791_1425262 | Ga0451791_1425262_198_521 | 107 |
| 907 | 3300041452 | Ga0451793_0269673 | Ga0451793_0269673_1962_2285 | 107 |
| 908 | 3300041452 | Ga0451793_0577701 | Ga0451793_0577701_255_578 | 107 |
| 909 | 3300041452 | Ga0451793_0762201 | Ga0451793_0762201_318_641 | 107 |
| 910 | 3300041452 | Ga0451793_1116150 | Ga0451793_1116150_906_1229 | 107 |
| 911 | 3300041453 | Ga0451797_0401209 | Ga0451797_0401209_149_472 | 107 |
| 912 | 3300041456 | Ga0451795_0635588 | Ga0451795_0635588_54_377 | 107 |
| 913 | 3300041458 | Ga0451798_0142136 | Ga0451798_0142136_190_513 | 107 |
| 914 | 3300041459 | Ga0451800_0048791 | Ga0451800_0048791_513_836 | 107 |
| 915 | 3300041460 | Ga0451802_0129455 | Ga0451802_0129455_231_554 | 107 |
| 916 | 3300041460 | Ga0451802_1404507 | Ga0451802_1404507_390_713 | 107 |
| 917 | 3300041460 | Ga0451802_2055396 | Ga0451802_2055396_3011_3334 | 107 |
| 918 | 3300041462 | Ga0451806_211117 | Ga0451806_211117_525_848 | 107 |
| 919 | 3300041463 | Ga0451804_0417164 | Ga0451804_0417164_17_340 | 107 |
| 920 | 3300041486 | Ga0451807_0396063 | Ga0451807_0396063_1073_1396 | 107 |
| 921 | 3300041486 | Ga0451807_1278800 | Ga0451807_1278800_1980_2303 | 107 |
| 922 | 3300041486 | Ga0451807_1451139 | Ga0451807_1451139_59_382 | 107 |
| 923 | 3300041486 | Ga0451807_2648389 | Ga0451807_2648389_96_419 | 107 |
| 924 | 3300041491 | Ga0451833_0022883 | Ga0451833_0022883_254_577 | 107 |
| 925 | 3300041494 | Ga0451837_1238615 | Ga0451837_1238615_23_346 | 107 |
| 926 | 3300041498 | Ga0451841_0161635 | Ga0451841_0161635_299_622 | 107 |
| 927 | 3300041505 | Ga0451849_0503352 | Ga0451849_0503352_590_913 | 107 |
| 928 | 3300041507 | Ga0451851_1375299 | Ga0451851_1375299_113_436 | 107 |
| 929 | 3300041509 | Ga0451843_0723165 | Ga0451843_0723165_632_955 | 107 |
| 930 | 3300041509 | Ga0451843_1159197 | Ga0451843_1159197_962_1285 | 107 |
| 931 | 3300041509 | Ga0451843_1698381 | Ga0451843_1698381_94_417 | 107 |
| 932 | 3300041512 | Ga0451853_3357331 | Ga0451853_3357331_38_361 | 107 |
| 933 | 3300041997 | Ga0439431_0008517 | Ga0439431_0008517_637_960 | 107 |
| 934 | 3300041999 | Ga0439433_0110391 | Ga0439433_0110391_204_527 | 107 |
| 935 | 3300042000 | Ga0439437_009360 | Ga0439437_009360_392_715 | 107 |
| 936 | 3300042002 | Ga0439442_008746 | Ga0439442_008746_1158_1481 | 107 |
| 937 | 3300042003 | Ga0439443_006790 | Ga0439443_006790_699_1022 | 107 |
| 938 | 3300042005 | Ga0439448_0102766 | Ga0439448_0102766_619_942 | 107 |
| 939 | 3300042006 | Ga0439432_013881 | Ga0439432_013881_606_929 | 107 |
| 940 | 3300042006 | Ga0439432_040586 | Ga0439432_040586_475_798 | 107 |
| 941 | 3300042007 | Ga0439449_0005200 | Ga0439449_0005200_2895_3218 | 107 |
| 942 | 3300042008 | Ga0439450_064872 | Ga0439450_064872_391_714 | 107 |
| 943 | 3300042010 | Ga0439452_037451 | Ga0439452_037451_281_604 | 107 |
| 944 | 3300042011 | Ga0439454_035191 | Ga0439454_035191_286_609 | 107 |
| 945 | 3300042012 | Ga0439455_0022714 | Ga0439455_0022714_656_979 | 107 |
| 946 | 3300042012 | Ga0439455_0140419 | Ga0439455_0140419_87_410 | 107 |
| 947 | 3300042013 | Ga0439456_000224 | Ga0439456_000224_2307_2630 | 107 |
| 948 | 3300042013 | Ga0439456_014967 | Ga0439456_014967_544_867 | 107 |
| 949 | 3300042014 | Ga0439457_046307 | Ga0439457_046307_571_894 | 107 |
| 950 | 3300042115 | Ga0450911_000005 | Ga0450911_000005_166418_166741 | 107 |
| 951 | 3300042120 | Ga0450917_008885 | Ga0450917_008885_174_497 | 107 |
| 952 | 3300042130 | Ga0450892_020384 | Ga0450892_020384_64_387 | 107 |
| 953 | 3300042134 | Ga0450898_151929 | Ga0450898_151929_130_453 | 107 |
| 954 | 3300042136 | Ga0450900_005178 | Ga0450900_005178_996_1319 | 107 |
| 955 | 3300042136 | Ga0450900_025628 | Ga0450900_025628_39_362 | 107 |
| 956 | 3300042138 | Ga0450903_060560 | Ga0450903_060560_59_382 | 107 |
| 957 | 3300042138 | Ga0450903_061596 | Ga0450903_061596_44_367 | 107 |
| 958 | 3300042139 | Ga0450904_000002 | Ga0450904_000002_4912_5235 | 107 |
| 959 | 3300042142 | Ga0450905_002387 | Ga0450905_002387_1424_1747 | 107 |
| 960 | 3300042142 | Ga0450905_008100 | Ga0450905_008100_170_493 | 107 |
| 961 | 3300042142 | Ga0450905_099360 | Ga0450905_099360_53_376 | 107 |
| 962 | 3300042144 | Ga0450889_023204 | Ga0450889_023204_276_599 | 107 |
| 963 | 3300042156 | Ga0439446_0375064 | Ga0439446_0375064_40_363 | 107 |
| 964 | 3300042437 | Ga0439444_0125881 | Ga0439444_0125881_156_491 | 107 |
| 965 | 3300042438 | Ga0439459_0007151 | Ga0439459_0007151_926_1249 | 107 |
| 966 | 3300042439 | Ga0439464_0178424 | Ga0439464_0178424_179_502 | 107 |
| 967 | 3300042439 | Ga0439464_0238835 | Ga0439464_0238835_250_573 | 107 |
| 968 | 3300042530 | Ga0450916_008977 | Ga0450916_008977_609_932 | 107 |
| 969 | 3300042530 | Ga0450916_009543 | Ga0450916_009543_610_933 | 107 |
| 970 | 3300042533 | Ga0450901_000683 | Ga0450901_000683_1290_1613 | 107 |
| 971 | 3300042876 | Ga0451577_0000105 | Ga0451577_0000105_9934_10257 | 107 |
| 972 | 3300042876 | Ga0451577_0128767 | Ga0451577_0128767_411_734 | 107 |
| 973 | 3300042876 | Ga0451577_0568651 | Ga0451577_0568651_23_346 | 107 |
| 974 | 3300042876 | Ga0451577_0641866 | Ga0451577_0641866_83_406 | 107 |
| 975 | 3300042993 | Ga0439440_0053011 | Ga0439440_0053011_586_909 | 107 |
| 976 | 3300042993 | Ga0439440_0229706 | Ga0439440_0229706_57_380 | 107 |
| 977 | 3300044656 | Ga0466969_0014574 | Ga0466969_0014574_2357_2680 | 107 |
| 978 | 3300044656 | Ga0466969_0088720 | Ga0466969_0088720_641_964 | 107 |
| 979 | 3300044658 | Ga0466972_0143428 | Ga0466972_0143428_412_735 | 107 |
| 980 | 3300044658 | Ga0466972_0283035 | Ga0466972_0283035_219_590 | 107 |
| 981 | 3300044683 | Ga0466965_0211482 | Ga0466965_0211482_671_994 | 107 |
| 982 | 3300044684 | Ga0466966_0004186 | Ga0466966_0004186_4782_5105 | 107 |
| 983 | 3300044684 | Ga0466966_0395644 | Ga0466966_0395644_12_335 | 107 |
| 984 | 3300044693 | Ga0466961_0020090 | Ga0466961_0020090_2713_3036 | 107 |
| 985 | 3300044706 | Ga0466964_0004197 | Ga0466964_0004197_1468_1791 | 107 |
| 986 | 3300044712 | Ga0453684_0003537 | Ga0453684_0003537_24668_24991 | 107 |
| 987 | 3300044712 | Ga0453684_0034985 | Ga0453684_0034985_2231_2554 | 107 |
| 988 | 3300044712 | Ga0453684_0220280 | Ga0453684_0220280_497_820 | 107 |
| 989 | 3300044719 | Ga0466971_0002218 | Ga0466971_0002218_4959_5282 | 107 |
| 990 | 3300044719 | Ga0466971_0380102 | Ga0466971_0380102_258_581 | 107 |
| 991 | 3300044735 | Ga0466968_0218920 | Ga0466968_0218920_39_362 | 107 |
| 992 | 3300044765 | Ga0466970_0015790 | Ga0466970_0015790_181_504 | 107 |
| 993 | 3300044765 | Ga0466970_0161945 | Ga0466970_0161945_82_405 | 107 |
| 994 | 3300044765 | Ga0466970_0276325 | Ga0466970_0276325_535_858 | 107 |
| 995 | 3300044842 | Ga0466957_0018370 | Ga0466957_0018370_3159_3482 | 107 |
| 996 | 3300044842 | Ga0466957_0572185 | Ga0466957_0572185_51_374 | 107 |
| 997 | 3300045049 | Ga0466959_0022009 | Ga0466959_0022009_4119_4442 | 107 |
| 998 | 3300045049 | Ga0466959_0048755 | Ga0466959_0048755_2087_2410 | 107 |
| 999 | 3300045049 | Ga0466959_0072728 | Ga0466959_0072728_737_1060 | 107 |
| 1000 | 3300045049 | Ga0466959_0081512 | Ga0466959_0081512_1965_2288 | 107 |
| 1001 | 3300045049 | Ga0466959_0958262 | Ga0466959_0958262_59_382 | 107 |
| 1002 | 3300045051 | Ga0451576_0000741 | Ga0451576_0000741_30427_30750 | 107 |
| 1003 | 3300045051 | Ga0451576_0014390 | Ga0451576_0014390_367_690 | 107 |
| 1004 | 3300045051 | Ga0451576_0359358 | Ga0451576_0359358_916_1239 | 107 |
| 1005 | 3300045051 | Ga0451576_0758278 | Ga0451576_0758278_398_721 | 107 |
| 1006 | 3300045836 | Ga0466958_0114325 | Ga0466958_0114325_209_532 | 107 |
| 1007 | 3300046452 | Ga0495617_024700 | Ga0495617_024700_684_1007 | 107 |
| 1008 | 3300046453 | Ga0495627_000424 | Ga0495627_000424_22405_22728 | 107 |
| 1009 | 3300046453 | Ga0495627_000496 | Ga0495627_000496_172_495 | 107 |
| 1010 | 3300046453 | Ga0495627_001316 | Ga0495627_001316_6406_6729 | 107 |
| 1011 | 3300046453 | Ga0495627_008095 | Ga0495627_008095_2897_3220 | 107 |
| 1012 | 3300046453 | Ga0495627_079133 | Ga0495627_079133_497_820 | 107 |
| 1013 | 3300046458 | Ga0495591_000849 | Ga0495591_000849_12192_12515 | 107 |
| 1014 | 3300046458 | Ga0495591_009341 | Ga0495591_009341_31_354 | 107 |
| 1015 | 3300046458 | Ga0495591_040223 | Ga0495591_040223_29_367 | 107 |
| 1016 | 3300046459 | Ga0495629_0299467 | Ga0495629_0299467_133_456 | 107 |
| 1017 | 3300046459 | Ga0495629_0648537 | Ga0495629_0648537_355_678 | 107 |
| 1018 | 3300046461 | Ga0495641_0390721 | Ga0495641_0390721_83_406 | 107 |
| 1019 | 3300046462 | Ga0495651_0963061 | Ga0495651_0963061_106_429 | 107 |
| 1020 | 3300046463 | Ga0495653_0005238 | Ga0495653_0005238_6435_6758 | 107 |
| 1021 | 3300046471 | Ga0495650_0008755 | Ga0495650_0008755_4452_4775 | 107 |
| 1022 | 3300046471 | Ga0495650_0018342 | Ga0495650_0018342_3130_3468 | 107 |
| 1023 | 3300046471 | Ga0495650_0021605 | Ga0495650_0021605_791_1114 | 107 |
| 1024 | 3300046471 | Ga0495650_0035382 | Ga0495650_0035382_1412_1735 | 107 |
| 1025 | 3300046472 | Ga0495580_0107838 | Ga0495580_0107838_990_1313 | 107 |
| 1026 | 3300046473 | Ga0495582_0603442 | Ga0495582_0603442_249_572 | 107 |
| 1027 | 3300046474 | Ga0495605_0000449 | Ga0495605_0000449_22535_22858 | 107 |
| 1028 | 3300046474 | Ga0495605_0000461 | Ga0495605_0000461_24664_24987 | 107 |
| 1029 | 3300046477 | Ga0495664_0740603 | Ga0495664_0740603_53_376 | 107 |
| 1030 | 3300046491 | Ga0495584_0052116 | Ga0495584_0052116_775_1098 | 107 |
| 1031 | 3300046491 | Ga0495584_0108849 | Ga0495584_0108849_422_760 | 107 |
| 1032 | 3300046492 | Ga0495585_0003113 | Ga0495585_0003113_3964_4287 | 107 |
| 1033 | 3300046501 | Ga0495607_0000490 | Ga0495607_0000490_11071_11394 | 107 |
| 1034 | 3300046501 | Ga0495607_0000544 | Ga0495607_0000544_13889_14212 | 107 |
| 1035 | 3300046501 | Ga0495607_0000841 | Ga0495607_0000841_11088_11411 | 107 |
| 1036 | 3300046501 | Ga0495607_0063674 | Ga0495607_0063674_1590_1913 | 107 |
| 1037 | 3300046501 | Ga0495607_0099414 | Ga0495607_0099414_641_964 | 107 |
| 1038 | 3300046501 | Ga0495607_0122780 | Ga0495607_0122780_951_1274 | 107 |
| 1039 | 3300046501 | Ga0495607_0184100 | Ga0495607_0184100_108_431 | 107 |
| 1040 | 3300046501 | Ga0495607_0226057 | Ga0495607_0226057_142_465 | 107 |
| 1041 | 3300046506 | Ga0495583_0000861 | Ga0495583_0000861_14043_14366 | 107 |
| 1042 | 3300046506 | Ga0495583_0004417 | Ga0495583_0004417_5768_6091 | 107 |
| 1043 | 3300046506 | Ga0495583_0032928 | Ga0495583_0032928_1468_1791 | 107 |
| 1044 | 3300046506 | Ga0495583_0371704 | Ga0495583_0371704_186_509 | 107 |
| 1045 | 3300046507 | Ga0495606_0001804 | Ga0495606_0001804_25338_25661 | 107 |
| 1046 | 3300046507 | Ga0495606_0006268 | Ga0495606_0006268_6731_7054 | 107 |
| 1047 | 3300046507 | Ga0495606_0168322 | Ga0495606_0168322_756_1094 | 107 |
| 1048 | 3300046507 | Ga0495606_0515192 | Ga0495606_0515192_260_583 | 107 |
| 1049 | 3300046512 | Ga0495610_0003557 | Ga0495610_0003557_11709_12032 | 107 |
| 1050 | 3300046515 | Ga0495620_0000003 | Ga0495620_0000003_190492_190815 | 107 |
| 1051 | 3300046515 | Ga0495620_0001260 | Ga0495620_0001260_14045_14368 | 107 |
| 1052 | 3300046515 | Ga0495620_0003107 | Ga0495620_0003107_4294_4617 | 107 |
| 1053 | 3300046518 | Ga0495631_0004082 | Ga0495631_0004082_7321_7659 | 107 |
| 1054 | 3300046518 | Ga0495631_0023789 | Ga0495631_0023789_980_1303 | 107 |
| 1055 | 3300046518 | Ga0495631_0049517 | Ga0495631_0049517_571_894 | 107 |
| 1056 | 3300046519 | Ga0495632_0003927 | Ga0495632_0003927_7635_7958 | 107 |
| 1057 | 3300046519 | Ga0495632_0005427 | Ga0495632_0005427_7147_7470 | 107 |
| 1058 | 3300046519 | Ga0495632_0048630 | Ga0495632_0048630_745_1068 | 107 |
| 1059 | 3300046519 | Ga0495632_0125156 | Ga0495632_0125156_696_1019 | 107 |
| 1060 | 3300046519 | Ga0495632_0336259 | Ga0495632_0336259_309_632 | 107 |
| 1061 | 3300046520 | Ga0495637_0002014 | Ga0495637_0002014_11093_11416 | 107 |
| 1062 | 3300046522 | Ga0495643_0000917 | Ga0495643_0000917_25987_26310 | 107 |
| 1063 | 3300046522 | Ga0495643_0003034 | Ga0495643_0003034_2013_2336 | 107 |
| 1064 | 3300046522 | Ga0495643_0006177 | Ga0495643_0006177_6679_7002 | 107 |
| 1065 | 3300046524 | Ga0495648_0003639 | Ga0495648_0003639_8927_9250 | 107 |
| 1066 | 3300046524 | Ga0495648_0003944 | Ga0495648_0003944_11615_11938 | 107 |
| 1067 | 3300046524 | Ga0495648_0010333 | Ga0495648_0010333_836_1174 | 107 |
| 1068 | 3300046524 | Ga0495648_0017142 | Ga0495648_0017142_3979_4302 | 107 |
| 1069 | 3300046524 | Ga0495648_0312114 | Ga0495648_0312114_261_584 | 107 |
| 1070 | 3300046528 | Ga0495642_0521381 | Ga0495642_0521381_22_345 | 107 |
| 1071 | 3300046530 | Ga0495654_0020728 | Ga0495654_0020728_1787_2110 | 107 |
| 1072 | 3300046530 | Ga0495654_0076246 | Ga0495654_0076246_744_1067 | 107 |
| 1073 | 3300046530 | Ga0495654_0140619 | Ga0495654_0140619_417_740 | 107 |
| 1074 | 3300046530 | Ga0495654_0254239 | Ga0495654_0254239_98_421 | 107 |
| 1075 | 3300046536 | Ga0495587_0018441 | Ga0495587_0018441_1099_1422 | 107 |
| 1076 | 3300046538 | Ga0495609_0000153 | Ga0495609_0000153_14141_14464 | 107 |
| 1077 | 3300046557 | Ga0495622_0437774 | Ga0495622_0437774_15_338 | 107 |
| 1078 | 3300046558 | Ga0495633_0000300 | Ga0495633_0000300_41981_42304 | 107 |
| 1079 | 3300046558 | Ga0495633_0016022 | Ga0495633_0016022_112_435 | 107 |
| 1080 | 3300046558 | Ga0495633_0034834 | Ga0495633_0034834_183_521 | 107 |
| 1081 | 3300046616 | Ga0495668_0049124 | Ga0495668_0049124_435_758 | 107 |
| 1082 | 3300046616 | Ga0495668_0215387 | Ga0495668_0215387_323_646 | 107 |
| 1083 | 3300046648 | Ga0495611_0003885 | Ga0495611_0003885_3553_3876 | 107 |
| 1084 | 3300046648 | Ga0495611_0227622 | Ga0495611_0227622_318_641 | 107 |
| 1085 | 3300046660 | Ga0495625_0051346 | Ga0495625_0051346_1770_2108 | 107 |
| 1086 | 3300046660 | Ga0495625_0116455 | Ga0495625_0116455_1409_1732 | 107 |
| 1087 | 3300046660 | Ga0495625_0126691 | Ga0495625_0126691_53_376 | 107 |
| 1088 | 3300046660 | Ga0495625_0156283 | Ga0495625_0156283_642_965 | 107 |
| 1089 | 3300046665 | Ga0495661_0000538 | Ga0495661_0000538_3977_4300 | 107 |
| 1090 | 3300046665 | Ga0495661_0001311 | Ga0495661_0001311_9268_9591 | 107 |
| 1091 | 3300046665 | Ga0495661_0045241 | Ga0495661_0045241_752_1075 | 107 |
| 1092 | 3300046665 | Ga0495661_0225039 | Ga0495661_0225039_151_474 | 107 |
| 1093 | 3300046678 | Ga0495599_0886783 | Ga0495599_0886783_152_475 | 107 |
| 1094 | 3300046680 | Ga0495646_0231982 | Ga0495646_0231982_252_575 | 107 |
| 1095 | 3300046689 | Ga0495613_0097182 | Ga0495613_0097182_1218_1541 | 107 |
| 1096 | 3300046691 | Ga0495670_0003681 | Ga0495670_0003681_4920_5243 | 107 |
| 1097 | 3300046691 | Ga0495670_0560107 | Ga0495670_0560107_164_487 | 107 |
| 1098 | 3300046692 | Ga0495671_0002986 | Ga0495671_0002986_6945_7268 | 107 |
| 1099 | 3300046692 | Ga0495671_0003782 | Ga0495671_0003782_1962_2285 | 107 |
| 1100 | 3300046692 | Ga0495671_0004634 | Ga0495671_0004634_31_354 | 107 |
| 1101 | 3300046692 | Ga0495671_0035909 | Ga0495671_0035909_1771_2094 | 107 |
| 1102 | 3300046694 | Ga0495649_0177366 | Ga0495649_0177366_501_824 | 107 |
| 1103 | 3300046694 | Ga0495649_0518270 | Ga0495649_0518270_16_339 | 107 |
| 1104 | 3300046794 | Ga0495589_0003579 | Ga0495589_0003579_931_1254 | 107 |
| 1105 | 3300046794 | Ga0495589_0085799 | Ga0495589_0085799_696_1034 | 107 |
| 1106 | 3300046794 | Ga0495589_0527828 | Ga0495589_0527828_94_417 | 107 |
| 1107 | 3300046809 | Ga0495600_0048423 | Ga0495600_0048423_1231_1554 | 107 |
| 1108 | 3300046810 | Ga0495660_0000879 | Ga0495660_0000879_10979_11302 | 107 |
| 1109 | 3300046810 | Ga0495660_0059143 | Ga0495660_0059143_726_1049 | 107 |
| 1110 | 3300047320 | Ga0495672_0004648 | Ga0495672_0004648_1023_1346 | 107 |
| 1111 | 3300047320 | Ga0495672_0009343 | Ga0495672_0009343_873_1196 | 107 |
| 1112 | 3300047320 | Ga0495672_0045928 | Ga0495672_0045928_2141_2464 | 107 |
| 1113 | 3300047320 | Ga0495672_0073906 | Ga0495672_0073906_65_388 | 107 |
| 1114 | 3300047320 | Ga0495672_0258781 | Ga0495672_0258781_95_418 | 107 |
| 1115 | 3300047322 | Ga0495680_0019915 | Ga0495680_0019915_3417_3740 | 107 |
| 1116 | 3300047322 | Ga0495680_0592466 | Ga0495680_0592466_184_507 | 107 |
| 1117 | 3300047323 | Ga0495683_0000371 | Ga0495683_0000371_14073_14396 | 107 |
| 1118 | 3300047323 | Ga0495683_0020063 | Ga0495683_0020063_842_1180 | 107 |
| 1119 | 3300047443 | Ga0495687_011253 | Ga0495687_011253_3778_4101 | 107 |
| 1120 | 3300047444 | Ga0495675_0126005 | Ga0495675_0126005_157_480 | 107 |
| 1121 | 3300047446 | Ga0495679_001695 | Ga0495679_001695_15_338 | 107 |
| 1122 | 3300047469 | Ga0495673_0000441 | Ga0495673_0000441_45060_45383 | 107 |
| 1123 | 3300047469 | Ga0495673_0005418 | Ga0495673_0005418_3481_3804 | 107 |
| 1124 | 3300047469 | Ga0495673_0014278 | Ga0495673_0014278_1144_1467 | 107 |
| 1125 | 3300047469 | Ga0495673_0077839 | Ga0495673_0077839_107_430 | 107 |
| 1126 | 3300047469 | Ga0495673_0316127 | Ga0495673_0316127_177_500 | 107 |
| 1127 | 3300047470 | Ga0495681_0010196 | Ga0495681_0010196_914_1237 | 107 |
| 1128 | 3300047470 | Ga0495681_0012745 | Ga0495681_0012745_235_558 | 107 |
| 1129 | 3300047472 | Ga0495686_0215600 | Ga0495686_0215600_718_1041 | 107 |
| 1130 | 3300048090 | Ga0495615_0157045 | Ga0495615_0157045_194_517 | 107 |
| 1131 | 3300048903 | Ga0496100_0171274 | Ga0496100_0171274_233_556 | 107 |
| 1132 | 3300048903 | Ga0496100_0193835 | Ga0496100_0193835_244_567 | 107 |
| 1133 | 3300048903 | Ga0496100_0668261 | Ga0496100_0668261_284_607 | 107 |
| 1134 | 3300048903 | Ga0496100_1073885 | Ga0496100_1073885_284_607 | 107 |
| 1135 | 3300048904 | Ga0496101_0062886 | Ga0496101_0062886_2046_2369 | 107 |
| 1136 | 3300048904 | Ga0496101_0256566 | Ga0496101_0256566_231_554 | 107 |
| 1137 | 3300048904 | Ga0496101_0794622 | Ga0496101_0794622_398_721 | 107 |
| 1138 | 3300048904 | Ga0496101_0839608 | Ga0496101_0839608_140_463 | 107 |
| 1139 | 3300048905 | Ga0496102_0018568 | Ga0496102_0018568_4750_5073 | 107 |
| 1140 | 3300048905 | Ga0496102_0018878 | Ga0496102_0018878_5203_5526 | 107 |
| 1141 | 3300048905 | Ga0496102_0664196 | Ga0496102_0664196_521_844 | 107 |
| 1142 | 3300048906 | Ga0496103_0145762 | Ga0496103_0145762_497_820 | 107 |
| 1143 | 3300048907 | Ga0496104_0007534 | Ga0496104_0007534_7827_8150 | 107 |
| 1144 | 3300048907 | Ga0496104_0025932 | Ga0496104_0025932_1330_1653 | 107 |
| 1145 | 3300048907 | Ga0496104_0291973 | Ga0496104_0291973_616_939 | 107 |
| 1146 | 3300048907 | Ga0496104_0558271 | Ga0496104_0558271_384_755 | 107 |
| 1147 | 3300048908 | Ga0496105_0002244 | Ga0496105_0002244_309_632 | 107 |
| 1148 | 3300048908 | Ga0496105_0003869 | Ga0496105_0003869_5113_5436 | 107 |
| 1149 | 3300048908 | Ga0496105_1083126 | Ga0496105_1083126_216_539 | 107 |
| 1150 | 3300048909 | Ga0496106_0034846 | Ga0496106_0034846_3362_3685 | 107 |
| 1151 | 3300048909 | Ga0496106_0238810 | Ga0496106_0238810_567_890 | 107 |
| 1152 | 3300048909 | Ga0496106_0956057 | Ga0496106_0956057_100_423 | 107 |
| 1153 | 3300048911 | Ga0496108_0011729 | Ga0496108_0011729_1603_1926 | 107 |
| 1154 | 3300048911 | Ga0496108_0099406 | Ga0496108_0099406_1811_2134 | 107 |
| 1155 | 3300048911 | Ga0496108_0183338 | Ga0496108_0183338_845_1168 | 107 |
| 1156 | 3300048911 | Ga0496108_0521059 | Ga0496108_0521059_249_572 | 107 |
| 1157 | 3300048912 | Ga0496109_0019965 | Ga0496109_0019965_264_587 | 107 |
| 1158 | 3300048913 | Ga0496110_0009253 | Ga0496110_0009253_6875_7198 | 107 |
| 1159 | 3300048913 | Ga0496110_0013330 | Ga0496110_0013330_27_350 | 107 |
| 1160 | 3300048913 | Ga0496110_0186911 | Ga0496110_0186911_307_630 | 107 |
| 1161 | 3300048913 | Ga0496110_0247943 | Ga0496110_0247943_1101_1424 | 107 |
| 1162 | 3300048913 | Ga0496110_0258743 | Ga0496110_0258743_648_971 | 107 |
| 1163 | 3300048914 | Ga0496111_0004803 | Ga0496111_0004803_7617_7940 | 107 |
| 1164 | 3300048914 | Ga0496111_0287462 | Ga0496111_0287462_270_593 | 107 |
| 1165 | 3300048914 | Ga0496111_0297142 | Ga0496111_0297142_492_815 | 107 |
| 1166 | 3300048914 | Ga0496111_0321330 | Ga0496111_0321330_35_358 | 107 |
| 1167 | 3300048915 | Ga0496112_0139570 | Ga0496112_0139570_692_1015 | 107 |
| 1168 | 3300048915 | Ga0496112_0236066 | Ga0496112_0236066_845_1168 | 107 |
| 1169 | 3300048915 | Ga0496112_0408518 | Ga0496112_0408518_930_1253 | 107 |
| 1170 | 3300048915 | Ga0496112_1754343 | Ga0496112_1754343_115_438 | 107 |
| 1171 | 3300048917 | Ga0496114_0028572 | Ga0496114_0028572_826_1149 | 107 |
| 1172 | 3300048917 | Ga0496114_0040475 | Ga0496114_0040475_1149_1472 | 107 |
| 1173 | 3300048917 | Ga0496114_0084456 | Ga0496114_0084456_1919_2242 | 107 |
| 1174 | 3300048917 | Ga0496114_0489139 | Ga0496114_0489139_656_979 | 107 |
| 1175 | 3300048918 | Ga0496115_0082741 | Ga0496115_0082741_718_1041 | 107 |
| 1176 | 3300048918 | Ga0496115_0127308 | Ga0496115_0127308_1251_1574 | 107 |
| 1177 | 3300048918 | Ga0496115_1300079 | Ga0496115_1300079_155_478 | 107 |
| 1178 | 3300048919 | Ga0496116_0008971 | Ga0496116_0008971_1851_2174 | 107 |
| 1179 | 3300048919 | Ga0496116_0016264 | Ga0496116_0016264_542_865 | 107 |
| 1180 | 3300048919 | Ga0496116_0020453 | Ga0496116_0020453_4136_4459 | 107 |
| 1181 | 3300048920 | Ga0496117_0000054 | Ga0496117_0000054_92417_92740 | 107 |
| 1182 | 3300048920 | Ga0496117_0000334 | Ga0496117_0000334_71636_71959 | 107 |
| 1183 | 3300048920 | Ga0496117_0000798 | Ga0496117_0000798_36915_37238 | 107 |
| 1184 | 3300048920 | Ga0496117_0006004 | Ga0496117_0006004_12137_12460 | 107 |
| 1185 | 3300048920 | Ga0496117_0017273 | Ga0496117_0017273_2799_3122 | 107 |
| 1186 | 3300048920 | Ga0496117_0057179 | Ga0496117_0057179_770_1093 | 107 |
| 1187 | 3300048920 | Ga0496117_0096534 | Ga0496117_0096534_624_947 | 107 |
| 1188 | 3300048921 | Ga0496118_0000045 | Ga0496118_0000045_88175_88498 | 107 |
| 1189 | 3300048921 | Ga0496118_0003619 | Ga0496118_0003619_6728_7051 | 107 |
| 1190 | 3300048921 | Ga0496118_0006724 | Ga0496118_0006724_9078_9401 | 107 |
| 1191 | 3300048921 | Ga0496118_0013622 | Ga0496118_0013622_7200_7523 | 107 |
| 1192 | 3300048921 | Ga0496118_0028632 | Ga0496118_0028632_2918_3241 | 107 |
| 1193 | 3300048921 | Ga0496118_0057707 | Ga0496118_0057707_1979_2302 | 107 |
| 1194 | 3300048921 | Ga0496118_0063473 | Ga0496118_0063473_562_885 | 107 |
| 1195 | 3300048921 | Ga0496118_0168475 | Ga0496118_0168475_419_742 | 107 |
| 1196 | 3300048921 | Ga0496118_0464672 | Ga0496118_0464672_18_341 | 107 |
| 1197 | 3300048922 | Ga0496119_0000380 | Ga0496119_0000380_13618_13941 | 107 |
| 1198 | 3300048922 | Ga0496119_0007592 | Ga0496119_0007592_232_555 | 107 |
| 1199 | 3300048922 | Ga0496119_0015657 | Ga0496119_0015657_508_831 | 107 |
| 1200 | 3300048922 | Ga0496119_0145844 | Ga0496119_0145844_330_653 | 107 |
| 1201 | 3300048922 | Ga0496119_0264672 | Ga0496119_0264672_255_578 | 107 |
| 1202 | 3300048923 | Ga0496120_0000570 | Ga0496120_0000570_36915_37238 | 107 |
| 1203 | 3300048923 | Ga0496120_0002710 | Ga0496120_0002710_13081_13404 | 107 |
| 1204 | 3300048923 | Ga0496120_0113063 | Ga0496120_0113063_610_933 | 107 |
| 1205 | 3300048923 | Ga0496120_0190249 | Ga0496120_0190249_212_535 | 107 |
| 1206 | 3300048923 | Ga0496120_0294816 | Ga0496120_0294816_74_397 | 107 |
| 1207 | 3300048924 | Ga0496121_0002897 | Ga0496121_0002897_22735_23058 | 107 |
| 1208 | 3300048924 | Ga0496121_0004919 | Ga0496121_0004919_3226_3549 | 107 |
| 1209 | 3300048924 | Ga0496121_0015841 | Ga0496121_0015841_6100_6423 | 107 |
| 1210 | 3300048924 | Ga0496121_0020386 | Ga0496121_0020386_3147_3470 | 107 |
| 1211 | 3300048924 | Ga0496121_0064016 | Ga0496121_0064016_1942_2265 | 107 |
| 1212 | 3300048924 | Ga0496121_0072566 | Ga0496121_0072566_39_362 | 107 |
| 1213 | 3300048924 | Ga0496121_0125269 | Ga0496121_0125269_1029_1352 | 107 |
| 1214 | 3300048924 | Ga0496121_0161763 | Ga0496121_0161763_305_628 | 107 |
| 1215 | 3300048924 | Ga0496121_0200859 | Ga0496121_0200859_343_666 | 107 |
| 1216 | 3300048925 | Ga0496122_0002009 | Ga0496122_0002009_5388_5711 | 107 |
| 1217 | 3300048925 | Ga0496122_0002614 | Ga0496122_0002614_24810_25133 | 107 |
| 1218 | 3300048925 | Ga0496122_0027322 | Ga0496122_0027322_1409_1732 | 107 |
| 1219 | 3300048925 | Ga0496122_0028114 | Ga0496122_0028114_2611_2934 | 107 |
| 1220 | 3300048925 | Ga0496122_0164164 | Ga0496122_0164164_31_354 | 107 |
| 1221 | 3300048925 | Ga0496122_0293928 | Ga0496122_0293928_133_456 | 107 |
| 1222 | 3300048926 | Ga0496123_0000706 | Ga0496123_0000706_28783_29106 | 107 |
| 1223 | 3300048926 | Ga0496123_0001758 | Ga0496123_0001758_411_734 | 107 |
| 1224 | 3300048926 | Ga0496123_0029385 | Ga0496123_0029385_2017_2340 | 107 |
| 1225 | 3300048926 | Ga0496123_0063671 | Ga0496123_0063671_1137_1460 | 107 |
| 1226 | 3300048926 | Ga0496123_0069050 | Ga0496123_0069050_48_371 | 107 |
| 1227 | 3300048926 | Ga0496123_0240888 | Ga0496123_0240888_503_826 | 107 |
| 1228 | 3300048927 | Ga0496124_0000132 | Ga0496124_0000132_13897_14220 | 107 |
| 1229 | 3300048927 | Ga0496124_0001105 | Ga0496124_0001105_19142_19465 | 107 |
| 1230 | 3300048927 | Ga0496124_0013196 | Ga0496124_0013196_2441_2764 | 107 |
| 1231 | 3300048927 | Ga0496124_0015927 | Ga0496124_0015927_2819_3142 | 107 |
| 1232 | 3300048927 | Ga0496124_0017522 | Ga0496124_0017522_5439_5762 | 107 |
| 1233 | 3300048927 | Ga0496124_0030811 | Ga0496124_0030811_3202_3525 | 107 |
| 1234 | 3300048927 | Ga0496124_0031893 | Ga0496124_0031893_2940_3263 | 107 |
| 1235 | 3300048927 | Ga0496124_0152550 | Ga0496124_0152550_1288_1611 | 107 |
| 1236 | 3300048927 | Ga0496124_0220087 | Ga0496124_0220087_1041_1364 | 107 |
| 1237 | 3300048927 | Ga0496124_0275591 | Ga0496124_0275591_767_1105 | 107 |
| 1238 | 3300048927 | Ga0496124_0491235 | Ga0496124_0491235_414_737 | 107 |
| 1239 | 3300048927 | Ga0496124_0519930 | Ga0496124_0519930_46_369 | 107 |
| 1240 | 3300048928 | Ga0496125_0001279 | Ga0496125_0001279_15916_16239 | 107 |
| 1241 | 3300048928 | Ga0496125_0006982 | Ga0496125_0006982_11744_12067 | 107 |
| 1242 | 3300048928 | Ga0496125_0007611 | Ga0496125_0007611_2671_2994 | 107 |
| 1243 | 3300048928 | Ga0496125_0019903 | Ga0496125_0019903_1356_1679 | 107 |
| 1244 | 3300048928 | Ga0496125_0038453 | Ga0496125_0038453_3754_4077 | 107 |
| 1245 | 3300048928 | Ga0496125_0190724 | Ga0496125_0190724_896_1219 | 107 |
| 1246 | 3300048928 | Ga0496125_0378962 | Ga0496125_0378962_308_631 | 107 |
| 1247 | 3300048928 | Ga0496125_0512480 | Ga0496125_0512480_50_373 | 107 |
| 1248 | 3300048929 | Ga0496126_0025805 | Ga0496126_0025805_631_954 | 107 |
| 1249 | 3300048929 | Ga0496126_0051230 | Ga0496126_0051230_562_885 | 107 |
| 1250 | 3300048929 | Ga0496126_0081305 | Ga0496126_0081305_52_375 | 107 |
| 1251 | 3300048929 | Ga0496126_0085051 | Ga0496126_0085051_350_673 | 107 |
| 1252 | 3300048929 | Ga0496126_0202568 | Ga0496126_0202568_133_456 | 107 |
| 1253 | 3300048929 | Ga0496126_0298740 | Ga0496126_0298740_321_644 | 107 |
| 1254 | 3300049459 | Ga0495678_000536 | Ga0495678_000536_14109_14432 | 107 |
| 1255 | 3300049459 | Ga0495678_001447 | Ga0495678_001447_4344_4667 | 107 |
| 1256 | 3300049459 | Ga0495678_024441 | Ga0495678_024441_1365_1688 | 107 |
| 1257 | 3300049460 | Ga0495682_0000613 | Ga0495682_0000613_12688_13011 | 107 |
| 1258 | 3300049460 | Ga0495682_0000919 | Ga0495682_0000919_13601_13924 | 107 |
| 1259 | 3300049568 | Ga0501031_0203939 | Ga0501031_0203939_909_1268 | 107 |
| 1260 | 3300049569 | Ga0501032_0202959 | Ga0501032_0202959_71_430 | 107 |
| 1261 | 3300049570 | Ga0501033_0029032 | Ga0501033_0029032_3583_3906 | 107 |
| 1262 | 3300049570 | Ga0501033_0169901 | Ga0501033_0169901_279_638 | 107 |
| 1263 | 3300049571 | Ga0501034_0000692 | Ga0501034_0000692_26243_26566 | 107 |
| 1264 | 3300049571 | Ga0501034_0535090 | Ga0501034_0535090_218_541 | 107 |
| 1265 | 3300049572 | Ga0501036_0074554 | Ga0501036_0074554_1067_1426 | 107 |
| 1266 | 3300049572 | Ga0501036_0738013 | Ga0501036_0738013_19_342 | 107 |
| 1267 | 3300049572 | Ga0501036_1348958 | Ga0501036_1348958_13_336 | 107 |
| 1268 | 3300049573 | Ga0501037_0899304 | Ga0501037_0899304_34_393 | 107 |
| 1269 | 3300049574 | Ga0501038_0151006 | Ga0501038_0151006_444_803 | 107 |
| 1270 | 3300049575 | Ga0501039_1245585 | Ga0501039_1245585_72_395 | 107 |
| 1271 | 3300049576 | Ga0501040_0017931 | Ga0501040_0017931_4140_4499 | 107 |
| 1272 | 3300049576 | Ga0501040_0239186 | Ga0501040_0239186_770_1093 | 107 |
| 1273 | 3300049577 | Ga0501041_0062832 | Ga0501041_0062832_1052_1411 | 107 |
| 1274 | 3300049577 | Ga0501041_0186805 | Ga0501041_0186805_92_415 | 107 |
| 1275 | 3300049578 | Ga0501042_0011940 | Ga0501042_0011940_1778_2137 | 107 |
| 1276 | 3300049578 | Ga0501042_0153347 | Ga0501042_0153347_402_725 | 107 |
| 1277 | 3300049578 | Ga0501042_1122685 | Ga0501042_1122685_202_525 | 107 |
| 1278 | 3300049579 | Ga0501043_0331124 | Ga0501043_0331124_35_358 | 107 |
| 1279 | 3300049579 | Ga0501043_0578753 | Ga0501043_0578753_409_768 | 107 |
| 1280 | 3300049579 | Ga0501043_0945438 | Ga0501043_0945438_155_478 | 107 |
| 1281 | 3300049580 | Ga0501046_0105464 | Ga0501046_0105464_784_1107 | 107 |
| 1282 | 3300049580 | Ga0501046_0155892 | Ga0501046_0155892_1018_1377 | 107 |
| 1283 | 3300049581 | Ga0501047_0050139 | Ga0501047_0050139_2357_2680 | 107 |
| 1284 | 3300049581 | Ga0501047_0165008 | Ga0501047_0165008_236_559 | 107 |
| 1285 | 3300049581 | Ga0501047_0340257 | Ga0501047_0340257_483_806 | 107 |
| 1286 | 3300049581 | Ga0501047_0459646 | Ga0501047_0459646_10_333 | 107 |
| 1287 | 3300049581 | Ga0501047_0654394 | Ga0501047_0654394_433_756 | 107 |
| 1288 | 3300049581 | Ga0501047_1239098 | Ga0501047_1239098_146_469 | 107 |
| 1289 | 3300049582 | Ga0501048_0023751 | Ga0501048_0023751_2012_2371 | 107 |
| 1290 | 3300049582 | Ga0501048_0865272 | Ga0501048_0865272_55_378 | 107 |
| 1291 | 3300049583 | Ga0501067_0006809 | Ga0501067_0006809_2137_2460 | 107 |
| 1292 | 3300049584 | Ga0501068_0002793 | Ga0501068_0002793_8921_9244 | 107 |
| 1293 | 3300049584 | Ga0501068_0608237 | Ga0501068_0608237_207_566 | 107 |
| 1294 | 3300049585 | Ga0501069_0867641 | Ga0501069_0867641_35_358 | 107 |
| 1295 | 3300049586 | Ga0501070_0007573 | Ga0501070_0007573_2672_2995 | 107 |
| 1296 | 3300049586 | Ga0501070_0063793 | Ga0501070_0063793_2450_2809 | 107 |
| 1297 | 3300049587 | Ga0501071_0001833 | Ga0501071_0001833_6046_6405 | 107 |
| 1298 | 3300049587 | Ga0501071_0009669 | Ga0501071_0009669_651_974 | 107 |
| 1299 | 3300049588 | Ga0501072_0035416 | Ga0501072_0035416_2430_2789 | 107 |
| 1300 | 3300049588 | Ga0501072_0049556 | Ga0501072_0049556_2075_2398 | 107 |
| 1301 | 3300049588 | Ga0501072_0433281 | Ga0501072_0433281_566_889 | 107 |
| 1302 | 3300049589 | Ga0501073_0000472 | Ga0501073_0000472_7580_7903 | 107 |
| 1303 | 3300049589 | Ga0501073_0433941 | Ga0501073_0433941_399_758 | 107 |
| 1304 | 3300049590 | Ga0501074_0002836 | Ga0501074_0002836_7597_7920 | 107 |
| 1305 | 3300049590 | Ga0501074_0036301 | Ga0501074_0036301_3110_3469 | 107 |
| 1306 | 3300049591 | Ga0501075_0000792 | Ga0501075_0000792_7774_8097 | 107 |
| 1307 | 3300049591 | Ga0501075_0014752 | Ga0501075_0014752_1552_1911 | 107 |
| 1308 | 3300049592 | Ga0501076_0007783 | Ga0501076_0007783_3744_4067 | 107 |
| 1309 | 3300049592 | Ga0501076_0035980 | Ga0501076_0035980_1665_2024 | 107 |
| 1310 | 3300049592 | Ga0501076_0384431 | Ga0501076_0384431_782_1105 | 107 |
| 1311 | 3300049593 | Ga0501077_0000280 | Ga0501077_0000280_15800_16123 | 107 |
| 1312 | 3300049593 | Ga0501077_0171032 | Ga0501077_0171032_774_1133 | 107 |
| 1313 | 3300049667 | Ga0501230_040204 | Ga0501230_040204_162_485 | 107 |
| 1314 | 3300049741 | Ga0501079_0001080 | Ga0501079_0001080_11437_11760 | 107 |
| 1315 | 3300049741 | Ga0501079_0021711 | Ga0501079_0021711_3666_4025 | 107 |
| 1316 | 3300049742 | Ga0501080_0013669 | Ga0501080_0013669_2283_2606 | 107 |
| 1317 | 3300049742 | Ga0501080_0072108 | Ga0501080_0072108_1903_2262 | 107 |
| 1318 | 3300049744 | Ga0501083_0014663 | Ga0501083_0014663_946_1269 | 107 |
| 1319 | 3300049744 | Ga0501083_0048506 | Ga0501083_0048506_743_1102 | 107 |
| 1320 | 3300049744 | Ga0501083_0491604 | Ga0501083_0491604_74_463 | 107 |
| 1321 | 3300049822 | Ga0501035_0675812 | Ga0501035_0675812_357_680 | 107 |
| 1322 | 3300049823 | Ga0501044_0000745 | Ga0501044_0000745_12790_13113 | 107 |
| 1323 | 3300049823 | Ga0501044_1081409 | Ga0501044_1081409_59_382 | 107 |
| 1324 | 3300049824 | Ga0501045_0013215 | Ga0501045_0013215_1158_1517 | 107 |
| 1325 | 3300049853 | Ga0501226_000010 | Ga0501226_000010_115488_115811 | 107 |
| 1326 | 3300050491 | nmdc:mga00v17_6749_c1 | nmdc:mga00v17_6749_c1_2795_3118 | 107 |
| 1327 | 3300050493 | nmdc:mga0k408_321371_c1 | nmdc:mga0k408_321371_c1_199_573 | 107 |
| 1328 | 3300050493 | nmdc:mga0k408_653060_c1 | nmdc:mga0k408_653060_c1_172_495 | 107 |
| 1329 | 3300050507 | nmdc:mga05p37_22213_c1 | nmdc:mga05p37_22213_c1_4194_4517 | 107 |
| 1330 | 3300050507 | nmdc:mga05p37_37857_c1 | nmdc:mga05p37_37857_c1_737_1060 | 107 |
| 1331 | 3300050508 | nmdc:mga09592_199515_c1 | nmdc:mga09592_199515_c1_1399_1722 | 107 |
| 1332 | 3300050508 | nmdc:mga09592_6806_c1 | nmdc:mga09592_6806_c1_926_1249 | 107 |
| 1333 | 3300050508 | nmdc:mga09592_777742_c1 | nmdc:mga09592_777742_c1_435_758 | 107 |
| 1334 | 3300050508 | nmdc:mga09592_895930_c1 | nmdc:mga09592_895930_c1_35_358 | 107 |
| 1335 | 3300050509 | nmdc:mga0qj67_100942_c1 | nmdc:mga0qj67_100942_c1_647_970 | 107 |
| 1336 | 3300050509 | nmdc:mga0qj67_187552_c1 | nmdc:mga0qj67_187552_c1_1124_1447 | 107 |
| 1337 | 3300050509 | nmdc:mga0qj67_188850_c1 | nmdc:mga0qj67_188850_c1_163_486 | 107 |
| 1338 | 3300050509 | nmdc:mga0qj67_201016_c1 | nmdc:mga0qj67_201016_c1_780_1103 | 107 |
| 1339 | 3300050510 | nmdc:mga06r32_22391_c1 | nmdc:mga06r32_22391_c1_4445_4768 | 107 |
| 1340 | 3300050510 | nmdc:mga06r32_328139_c1 | nmdc:mga06r32_328139_c1_33_356 | 107 |
| 1341 | 3300050510 | nmdc:mga06r32_747_c1 | nmdc:mga06r32_747_c1_19958_20281 | 107 |
| 1342 | 3300050510 | nmdc:mga06r32_7750_c2 | nmdc:mga06r32_7750_c2_2033_2356 | 107 |
| 1343 | 3300050511 | nmdc:mga08y16_104026_c1 | nmdc:mga08y16_104026_c1_1496_1819 | 107 |
| 1344 | 3300050511 | nmdc:mga08y16_1066236_c1 | nmdc:mga08y16_1066236_c1_177_500 | 107 |
| 1345 | 3300050511 | nmdc:mga08y16_1255_c1 | nmdc:mga08y16_1255_c1_12189_12512 | 107 |
| 1346 | 3300050511 | nmdc:mga08y16_1641422_c1 | nmdc:mga08y16_1641422_c1_62_385 | 107 |
| 1347 | 3300050511 | nmdc:mga08y16_211735_c1 | nmdc:mga08y16_211735_c1_400_723 | 107 |
| 1348 | 3300050511 | nmdc:mga08y16_71923_c1 | nmdc:mga08y16_71923_c1_2344_2667 | 107 |
| 1349 | 3300050511 | nmdc:mga08y16_7261_c1 | nmdc:mga08y16_7261_c1_2470_2793 | 107 |
| 1350 | 3300050511 | nmdc:mga08y16_899876_c1 | nmdc:mga08y16_899876_c1_484_807 | 107 |
| 1351 | 3300050512 | nmdc:mga0n895_565258_c1 | nmdc:mga0n895_565258_c1_800_1123 | 107 |
| 1352 | 3300050513 | nmdc:mga0rr50_1357398_c1 | nmdc:mga0rr50_1357398_c1_143_466 | 107 |
| 1353 | 3300050513 | nmdc:mga0rr50_32375_c1 | nmdc:mga0rr50_32375_c1_1930_2253 | 107 |
| 1354 | 3300050514 | nmdc:mga08x19_217959_c1 | nmdc:mga08x19_217959_c1_205_528 | 107 |
| 1355 | 3300050515 | nmdc:mga0a205_557015_c1 | nmdc:mga0a205_557015_c1_56_379 | 107 |
| 1356 | 3300050515 | nmdc:mga0a205_88566_c1 | nmdc:mga0a205_88566_c1_2550_2873 | 107 |
| 1357 | 3300053077 | Ga0495601_0312189 | Ga0495601_0312189_569_892 | 107 |
| 1358 | 3300053088 | Ga0500644_0062975 | Ga0500644_0062975_287_610 | 107 |
| 1359 | 3300053088 | Ga0500644_0100029 | Ga0500644_0100029_86_409 | 107 |
| 1360 | 3300053092 | Ga0500583_0058297 | Ga0500583_0058297_1167_1490 | 107 |
| 1361 | 3300053092 | Ga0500583_0073042 | Ga0500583_0073042_570_893 | 107 |
| 1362 | 3300053092 | Ga0500583_0301270 | Ga0500583_0301270_101_424 | 107 |
| 1363 | 3300053092 | Ga0500583_0396594 | Ga0500583_0396594_63_386 | 107 |
| 1364 | 3300053098 | Ga0500650_0058300 | Ga0500650_0058300_813_1136 | 107 |
| 1365 | 3300053104 | Ga0500556_0000442 | Ga0500556_0000442_25560_25883 | 107 |
| 1366 | 3300053111 | Ga0500572_065710 | Ga0500572_065710_112_435 | 107 |
| 1367 | 3300053115 | Ga0500591_030876 | Ga0500591_030876_2077_2400 | 107 |
| 1368 | 3300053119 | Ga0500595_027112 | Ga0500595_027112_1304_1627 | 107 |
| 1369 | 3300053134 | Ga0500658_0080346 | Ga0500658_0080346_1008_1331 | 107 |
| 1370 | 3300053134 | Ga0500658_0114697 | Ga0500658_0114697_577_900 | 107 |
| 1371 | 3300053135 | Ga0500659_0001435 | Ga0500659_0001435_13817_14140 | 107 |
| 1372 | 3300053136 | Ga0500559_0252268 | Ga0500559_0252268_150_473 | 107 |
| 1373 | 3300053146 | Ga0500588_0005174 | Ga0500588_0005174_156_479 | 107 |
| 1374 | 3300053148 | Ga0500590_239218 | Ga0500590_239218_335_658 | 107 |
| 1375 | 3300053153 | Ga0500616_0000018 | Ga0500616_0000018_50188_50511 | 107 |
| 1376 | 3300053153 | Ga0500616_0132122 | Ga0500616_0132122_118_441 | 107 |
| 1377 | 3300053156 | Ga0500622_0004527 | Ga0500622_0004527_2343_2666 | 107 |
| 1378 | 3300053156 | Ga0500622_0420657 | Ga0500622_0420657_10_333 | 107 |
| 1379 | 3300053158 | Ga0500627_0191709 | Ga0500627_0191709_69_392 | 107 |
| 1380 | 3300053158 | Ga0500627_0293718 | Ga0500627_0293718_194_517 | 107 |
| 1381 | 3300053161 | Ga0500634_0000047 | Ga0500634_0000047_14122_14445 | 107 |
| 1382 | 3300053178 | Ga0500637_0100378 | Ga0500637_0100378_102_425 | 107 |
| 1383 | 3300053178 | Ga0500637_0100441 | Ga0500637_0100441_916_1239 | 107 |
| 1384 | 3300054114 | Ga0501084_0001292 | Ga0501084_0001292_7583_7906 | 107 |
| 1385 | 3300054114 | Ga0501084_0093387 | Ga0501084_0093387_421_780 | 107 |
| 1386 | 3300059424 | Ga0590075_136468 | Ga0590075_136468_160_483 | 107 |
| 1387 | 3300059510 | Ga0587090_120295 | Ga0587090_120295_148_471 | 107 |
| 1388 | 3300060344 | Ga0587071_165880 | Ga0587071_165880_69_392 | 107 |
| 1389 | 3300060353 | Ga0501082_0025328 | Ga0501082_0025328_942_1265 | 107 |
| 1390 | 3300060353 | Ga0501082_0314316 | Ga0501082_0314316_628_987 | 107 |
| 1391 | 3300060353 | Ga0501082_0456958 | Ga0501082_0456958_316_639 | 107 |
| 1392 | 3300061719 | Ga0466962_0001556 | Ga0466962_0001556_6299_6622 | 107 |
| 1393 | 3300061719 | Ga0466962_0386845 | Ga0466962_0386845_230_553 | 107 |
| 1394 | 3300061734 | Ga0530510_0142376 | Ga0530510_0142376_1028_1387 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1frl-assembly1.cif.gz_A | azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential | 0.9974 | 2 | 107 |
| 1frx-assembly1.cif.gz_A | structure and properties of c20s fdi mutant | 0.9974 | 2 | 107 |
| 1frk-assembly1.cif.gz_A | azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential | 0.9972 | 2 | 107 |
| 1g6b-assembly1.cif.gz_A | crystal structure of p47s mutant of ferredoxin i | 0.9971 | 2 | 107 |
| 1frh-assembly1.cif.gz_A | azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential | 0.9971 | 2 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ftcB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.993 | 2 | 107 | 3.30.70.20 |
| af_O50433_2_106_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9862 | 2 | 73 | 3.30.70.20 |
| 1ftcB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9837 | 2 | 107 | 3.30.70.20 |
| 1h98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9708 | 3 | 77 | 3.30.70.20 |
| 1h98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9344 | 3 | 77 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4S3KRD0-F1-model_v4 | Ferredoxin | 1.003 | 1 | 107 |
GO:0009055
GO:0046872 GO:0051538 GO:0051539 |
| AF-A0A514EAS2-F1-model_v4 | Ferredoxin | 1.001 | 1 | 107 |
GO:0009055
GO:0046872 GO:0051538 GO:0051539 |
| AF-A0A091B8S9-F1-model_v4 | Ferredoxin | 1.001 | 1 | 107 |
GO:0009055
GO:0046872 GO:0051538 GO:0051539 |
| AF-A0A2W5KS42-F1-model_v4 | Ferredoxin | 1.001 | 1 | 107 |
GO:0009055
GO:0046872 GO:0051538 GO:0051539 |
| AF-A0A1H6Q7X4-F1-model_v4 | Ferredoxin | 1.001 | 1 | 107 |
GO:0009055
GO:0046872 GO:0051538 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar