F492902
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1314 | 592 | 1200 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0637847|Ga0453684_0637847_661_1065 |
| Length | 125 |
| Sequence | MGTPTKRPGPTRPSKKEGKGVAQGLACIQATFNNTIVTITDPTGNVVTWASAGSVGFKGSRKSTPFAAQMIAQGMKEVKVFVKGPGAGREAAIRSLQAAGLEITAIKDVTPIPHNGCRPRKRRRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 5 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 6 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 7 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 8 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 9 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 10 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 11 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 12 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 13 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 14 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 15 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 16 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 17 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 18 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 19 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 20 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 21 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 22 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 23 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 24 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 25 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 26 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 27 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 28 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 29 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 30 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 31 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 32 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 33 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 34 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 35 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 36 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 37 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 38 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 39 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 40 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 41 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 42 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 43 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 44 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 45 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 46 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 47 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 48 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 49 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 50 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 51 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 52 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 53 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 54 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 55 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 56 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 57 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 58 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 59 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 60 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 61 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 62 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 63 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 64 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 65 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 66 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 67 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 68 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 69 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 70 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 71 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 72 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 73 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 74 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 75 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 76 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 77 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 78 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 79 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 80 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 81 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 82 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 83 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 84 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 85 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 86 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 87 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 88 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 89 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 90 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 91 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 92 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 93 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 94 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 95 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 96 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 97 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 98 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 99 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 100 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 101 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 102 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 103 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 104 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 105 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 106 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 107 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 108 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 109 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 110 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 111 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 112 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 113 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 114 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 115 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 116 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 117 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 118 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 119 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 120 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 121 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 122 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 123 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 124 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 125 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 126 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 127 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 128 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 129 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 130 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 131 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 132 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 133 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 134 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 137 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 139 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 140 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 141 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 142 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 143 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 146 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 147 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 149 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 150 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 151 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 163 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 164 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 165 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 166 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 167 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 168 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 172 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 173 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 174 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 175 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 176 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 177 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 178 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 179 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 180 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 181 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 182 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 183 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 184 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 186 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 187 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 188 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 190 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 191 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 192 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 204 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 205 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 207 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 219 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 223 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 224 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 225 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 227 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 228 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 229 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 230 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 231 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 232 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 233 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 234 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 236 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 237 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 241 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 242 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 244 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 246 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 294 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 303 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 304 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 305 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 306 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 307 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 308 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 309 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 310 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 311 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 312 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 313 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 314 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 315 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 316 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 317 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 318 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 319 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 320 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 321 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 322 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 323 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 324 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 325 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 326 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 327 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 328 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 329 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 330 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 331 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 332 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 333 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 334 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 335 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 336 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 337 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 338 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 339 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 340 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 341 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 342 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 344 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 345 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 351 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 352 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 353 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 354 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 355 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 356 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 357 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 358 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 359 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 360 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 361 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 362 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 363 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 364 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 365 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 366 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 367 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 369 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 370 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 371 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 375 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 376 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 377 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 378 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 379 | 3300041500 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT | Metatranscriptome | Unclassified |
| 380 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 381 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 382 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 383 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 384 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 385 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 386 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 387 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 388 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 389 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 390 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 391 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 392 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 393 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 394 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 395 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 396 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 397 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 398 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 452 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 453 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 454 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 455 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 456 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 457 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 458 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 459 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 460 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 461 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 462 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 463 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 464 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 465 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 466 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 467 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 468 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 516 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 517 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 518 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 519 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 520 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 521 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 522 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 523 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 524 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 525 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 526 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 527 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 528 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 529 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 530 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 531 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 532 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 536 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 537 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 540 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 541 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 542 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 543 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 544 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 545 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 546 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 547 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 548 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 549 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 550 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 551 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 552 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 553 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 554 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 555 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 556 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 557 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 558 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 559 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 560 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 561 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 562 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 563 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 579 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 580 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 588 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 589 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 590 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 591 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 592 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.66 |
| Metatranscriptomes | 16.67 |
| Isolates | 8.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 4.87 |
| Nodule | 0.53 |
| Rhizoplane | 2.44 |
| Rhizosphere | 83.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_24813 | 2124908027 | Bacteria | 958 |
| 2 | SwRhRL2b_contig_156102 | 2162886007 | Bacteria | 1577 |
| 3 | SwRhRL2b_contig_1853401 | 2162886007 | Bacteria | 2479 |
| 4 | SwRhRL2b_contig_2489919 | 2162886007 | Bacteria | 1072 |
| 5 | SwRhRL2b_contig_3583939 | 2162886007 | Bacteria | 2057 |
| 6 | MRS1b_contig_1810326 | 2162886011 | Bacteria | 979 |
| 7 | 2214800779 | 2209111006 | Bacteria | 2080 |
| 8 | JGI24741J21665_1003251 | 3300001915 | Bacteria | 3929 |
| 9 | JGI24740J21852_10008913 | 3300001979 | Bacteria | 3965 |
| 10 | JGI24740J21852_10033543 | 3300001979 | Bacteria | 1628 |
| 11 | JGI24737J22298_10001860 | 3300001990 | Bacteria | 7545 |
| 12 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 13 | JGI24735J21928_10005021 | 3300002067 | Bacteria | 4405 |
| 14 | JGI24744J21845_10001128 | 3300002077 | Bacteria | 5201 |
| 15 | JGI25162J39368_1000039 | 3300002737 | Bacteria | 175976 |
| 16 | JGI25162J39368_1001202 | 3300002737 | Bacteria | 15113 |
| 17 | JGI25164J39214_1001166 | 3300002772 | Bacteria | 7290 |
| 18 | JGI25152J39213_1000006 | 3300002773 | Bacteria | 158516 |
| 19 | JGI25150J39212_1000005 | 3300002774 | Bacteria | 311800 |
| 20 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 21 | JGI25165J46597_1000678 | 3300003214 | Bacteria | 27401 |
| 22 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 23 | Ga0006758J48902_1029451 | 3300003300 | Bacteria | 891 |
| 24 | rootH1_10024556 | 3300003316 | Bacteria | 3314 |
| 25 | rootH1_10160693 | 3300003316 | Bacteria | 1292 |
| 26 | rootH2_10056635 | 3300003320 | Bacteria | 7076 |
| 27 | rootL2_10101710 | 3300003322 | Bacteria | 4114 |
| 28 | rootH1_10045781 | 3300003323 | Bacteria | 11513 |
| 29 | rootH1_10193341 | 3300003323 | Bacteria | 1500 |
| 30 | Ga0007409J51694_1063312 | 3300003575 | Bacteria | 2513 |
| 31 | Ga0006562J51391_1003423 | 3300003578 | Bacteria | 13910 |
| 32 | Ga0006562J51391_1007655 | 3300003578 | Bacteria | 3240 |
| 33 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 34 | Ga0055530_10000817 | 3300003791 | Bacteria | 25836 |
| 35 | Ga0058863_10111335 | 3300004799 | Bacteria | 3480 |
| 36 | Ga0058861_10176091 | 3300004800 | Bacteria | 3494 |
| 37 | Ga0058860_10114316 | 3300004801 | Bacteria | 13584 |
| 38 | Ga0058860_10142251 | 3300004801 | Bacteria | 2938 |
| 39 | Ga0058862_10102512 | 3300004803 | Bacteria | 4102 |
| 40 | Ga0065717_1001968 | 3300005276 | Bacteria | 4650 |
| 41 | Ga0065716_1002480 | 3300005277 | Bacteria | 1749 |
| 42 | Ga0065714_10002624 | 3300005288 | Bacteria | 24311 |
| 43 | Ga0065714_10005956 | 3300005288 | Bacteria | 4227 |
| 44 | Ga0065714_10009786 | 3300005288 | Bacteria | 2823 |
| 45 | Ga0065714_10013697 | 3300005288 | Bacteria | 1653 |
| 46 | Ga0065714_10022334 | 3300005288 | Bacteria | 1051 |
| 47 | Ga0065714_10045584 | 3300005288 | Bacteria | 720 |
| 48 | Ga0065714_10047236 | 3300005288 | Bacteria | 915 |
| 49 | Ga0065714_10079789 | 3300005288 | Bacteria | 2486 |
| 50 | Ga0065714_10102584 | 3300005288 | Bacteria | 1620 |
| 51 | Ga0065714_10160851 | 3300005288 | Bacteria | 1052 |
| 52 | Ga0065714_10163029 | 3300005288 | Bacteria | 1034 |
| 53 | Ga0065714_10250665 | 3300005288 | Bacteria | 775 |
| 54 | Ga0065704_10000307 | 3300005289 | Bacteria | 35767 |
| 55 | Ga0065704_10004597 | 3300005289 | Bacteria | 3633 |
| 56 | Ga0065704_10073035 | 3300005289 | Bacteria | 7653 |
| 57 | Ga0065704_10078273 | 3300005289 | Bacteria | 4471 |
| 58 | Ga0065704_10082398 | 3300005289 | Bacteria | 3606 |
| 59 | Ga0065704_10096211 | 3300005289 | Bacteria | 2436 |
| 60 | Ga0065704_10102101 | 3300005289 | Bacteria | 2215 |
| 61 | Ga0065704_10177771 | 3300005289 | Bacteria | 1220 |
| 62 | Ga0065704_10269193 | 3300005289 | Bacteria | 947 |
| 63 | Ga0065704_10346795 | 3300005289 | Bacteria | 810 |
| 64 | Ga0065704_10399407 | 3300005289 | Bacteria | 753 |
| 65 | Ga0065704_10458670 | 3300005289 | Bacteria | 699 |
| 66 | Ga0065715_10036832 | 3300005293 | Bacteria | 2618 |
| 67 | Ga0065715_10521621 | 3300005293 | Bacteria | 763 |
| 68 | Ga0065715_10569858 | 3300005293 | Bacteria | 699 |
| 69 | Ga0065715_10866960 | 3300005293 | Bacteria | 584 |
| 70 | Ga0065715_10927087 | 3300005293 | Bacteria | 561 |
| 71 | Ga0070658_10000153 | 3300005327 | Bacteria | 60625 |
| 72 | Ga0070658_10120312 | 3300005327 | Bacteria | 2181 |
| 73 | Ga0070658_10244897 | 3300005327 | Bacteria | 1520 |
| 74 | Ga0070676_10000312 | 3300005328 | Bacteria | 21945 |
| 75 | Ga0070683_100018688 | 3300005329 | Bacteria | 6143 |
| 76 | Ga0070683_100032136 | 3300005329 | Bacteria | 4777 |
| 77 | Ga0070690_100580742 | 3300005330 | Bacteria | 848 |
| 78 | Ga0070670_100135400 | 3300005331 | Bacteria | 2129 |
| 79 | Ga0070680_100005676 | 3300005336 | Bacteria | 9464 |
| 80 | Ga0070682_100000768 | 3300005337 | Bacteria | 18980 |
| 81 | Ga0068868_100104416 | 3300005338 | Bacteria | 2296 |
| 82 | Ga0068868_100118877 | 3300005338 | Bacteria | 2154 |
| 83 | Ga0070660_100043744 | 3300005339 | Bacteria | 3423 |
| 84 | Ga0070660_100057675 | 3300005339 | Bacteria | 3009 |
| 85 | Ga0070691_10252658 | 3300005341 | Bacteria | 946 |
| 86 | Ga0070668_100276810 | 3300005347 | Bacteria | 1400 |
| 87 | Ga0070669_100349495 | 3300005353 | Bacteria | 1200 |
| 88 | Ga0070671_100045958 | 3300005355 | Bacteria | 3631 |
| 89 | Ga0070671_101121230 | 3300005355 | Bacteria | 691 |
| 90 | Ga0070674_100123468 | 3300005356 | Bacteria | 1920 |
| 91 | Ga0070673_100043212 | 3300005364 | Bacteria | 3480 |
| 92 | Ga0070659_100000375 | 3300005366 | Bacteria | 33764 |
| 93 | Ga0070659_101692991 | 3300005366 | Bacteria | 566 |
| 94 | Ga0070667_101647679 | 3300005367 | Bacteria | 603 |
| 95 | Ga0070678_100032095 | 3300005456 | Bacteria | 3631 |
| 96 | Ga0070678_100234064 | 3300005456 | Bacteria | 1533 |
| 97 | Ga0070662_100000074 | 3300005457 | Bacteria | 54943 |
| 98 | Ga0070662_100794941 | 3300005457 | Bacteria | 804 |
| 99 | Ga0070681_10002985 | 3300005458 | Bacteria | 15692 |
| 100 | Ga0068867_100010877 | 3300005459 | Bacteria | 6418 |
| 101 | Ga0068867_100970210 | 3300005459 | Bacteria | 769 |
| 102 | Ga0074259_10883899 | 3300005507 | Bacteria | 545 |
| 103 | Ga0070679_100006255 | 3300005530 | Bacteria | 11090 |
| 104 | Ga0070679_100727393 | 3300005530 | Bacteria | 935 |
| 105 | Ga0070684_100006351 | 3300005535 | Bacteria | 9136 |
| 106 | Ga0070684_100723154 | 3300005535 | Bacteria | 929 |
| 107 | Ga0068853_100150954 | 3300005539 | Bacteria | 2092 |
| 108 | Ga0068853_100167326 | 3300005539 | Bacteria | 1987 |
| 109 | Ga0070693_101517646 | 3300005547 | Bacteria | 524 |
| 110 | Ga0070665_100000372 | 3300005548 | Bacteria | 66748 |
| 111 | Ga0070704_101084299 | 3300005549 | Bacteria | 727 |
| 112 | Ga0068855_100000360 | 3300005563 | Bacteria | 56448 |
| 113 | Ga0068855_100012268 | 3300005563 | Bacteria | 10356 |
| 114 | Ga0068855_100025831 | 3300005563 | Bacteria | 7023 |
| 115 | Ga0068855_100061070 | 3300005563 | Bacteria | 4405 |
| 116 | Ga0068855_100071470 | 3300005563 | Bacteria | 4035 |
| 117 | Ga0068855_100279474 | 3300005563 | Bacteria | 1854 |
| 118 | Ga0068855_100524481 | 3300005563 | Bacteria | 1285 |
| 119 | Ga0068855_100671044 | 3300005563 | Bacteria | 1112 |
| 120 | Ga0068855_100814966 | 3300005563 | Bacteria | 991 |
| 121 | Ga0068855_100859569 | 3300005563 | Bacteria | 961 |
| 122 | Ga0068855_102101977 | 3300005563 | Bacteria | 569 |
| 123 | Ga0068857_100489716 | 3300005577 | Bacteria | 1153 |
| 124 | Ga0068854_100266832 | 3300005578 | Bacteria | 1373 |
| 125 | Ga0068854_100936506 | 3300005578 | Bacteria | 763 |
| 126 | Ga0068856_100016148 | 3300005614 | Bacteria | 7219 |
| 127 | Ga0068856_100058008 | 3300005614 | Bacteria | 3823 |
| 128 | Ga0068856_100147792 | 3300005614 | Bacteria | 2358 |
| 129 | Ga0068856_100153582 | 3300005614 | Bacteria | 2312 |
| 130 | Ga0068856_100340133 | 3300005614 | Bacteria | 1519 |
| 131 | Ga0068856_100423074 | 3300005614 | Bacteria | 1352 |
| 132 | Ga0068856_100667106 | 3300005614 | Bacteria | 1060 |
| 133 | Ga0068852_100010466 | 3300005616 | Bacteria | 6935 |
| 134 | Ga0068852_100268045 | 3300005616 | Bacteria | 1642 |
| 135 | Ga0068852_100411938 | 3300005616 | Bacteria | 1332 |
| 136 | Ga0068852_100462537 | 3300005616 | Bacteria | 1258 |
| 137 | Ga0068852_101512163 | 3300005616 | Bacteria | 694 |
| 138 | Ga0068859_102399722 | 3300005617 | Bacteria | 581 |
| 139 | Ga0068859_102708143 | 3300005617 | Bacteria | 545 |
| 140 | Ga0068866_10152156 | 3300005718 | Bacteria | 1341 |
| 141 | Ga0068863_100897056 | 3300005841 | Bacteria | 887 |
| 142 | Ga0068863_101631036 | 3300005841 | Unclassified | 654 |
| 143 | Ga0068863_101913908 | 3300005841 | Bacteria | 603 |
| 144 | Ga0068860_100562306 | 3300005843 | Bacteria | 1143 |
| 145 | Ga0070716_100062251 | 3300006173 | Bacteria | 2163 |
| 146 | Ga0075362_10012264 | 3300006177 | Bacteria | 3401 |
| 147 | Ga0075369_10350950 | 3300006186 | Bacteria | 692 |
| 148 | Ga0075366_10089546 | 3300006195 | Bacteria | 1843 |
| 149 | Ga0075366_10252599 | 3300006195 | Bacteria | 1076 |
| 150 | Ga0097621_100007799 | 3300006237 | Bacteria | 7678 |
| 151 | Ga0097621_100200943 | 3300006237 | Bacteria | 1730 |
| 152 | Ga0075370_10177105 | 3300006353 | Bacteria | 1254 |
| 153 | Ga0068871_100000141 | 3300006358 | Bacteria | 46656 |
| 154 | Ga0068871_100350639 | 3300006358 | Bacteria | 1305 |
| 155 | Ga0068865_100000917 | 3300006881 | Bacteria | 16715 |
| 156 | Ga0097620_102399396 | 3300006931 | Bacteria | 581 |
| 157 | Ga0097620_102707874 | 3300006931 | Bacteria | 545 |
| 158 | Ga0099824_1003374 | 3300006942 | Bacteria | 23361 |
| 159 | Ga0079104_1000280 | 3300006946 | Bacteria | 65859 |
| 160 | Ga0099826_10000125 | 3300006948 | Bacteria | 34471 |
| 161 | Ga0105251_10038077 | 3300009011 | Bacteria | 2357 |
| 162 | Ga0105251_10057935 | 3300009011 | Bacteria | 1830 |
| 163 | Ga0105251_10498151 | 3300009011 | Bacteria | 569 |
| 164 | Ga0105244_10000027 | 3300009036 | Bacteria | 207569 |
| 165 | Ga0105244_10000160 | 3300009036 | Bacteria | 69914 |
| 166 | Ga0105244_10015827 | 3300009036 | Bacteria | 4315 |
| 167 | Ga0105240_10000082 | 3300009093 | Bacteria | 195184 |
| 168 | Ga0105240_10073384 | 3300009093 | Bacteria | 4225 |
| 169 | Ga0105240_10204993 | 3300009093 | Bacteria | 2309 |
| 170 | Ga0105240_10432476 | 3300009093 | Bacteria | 1476 |
| 171 | Ga0105240_10481262 | 3300009093 | Bacteria | 1384 |
| 172 | Ga0105240_10924097 | 3300009093 | Bacteria | 937 |
| 173 | Ga0105240_10971270 | 3300009093 | Bacteria | 910 |
| 174 | Ga0105240_11222634 | 3300009093 | Bacteria | 795 |
| 175 | Ga0111539_11039008 | 3300009094 | Bacteria | 952 |
| 176 | Ga0105245_10144700 | 3300009098 | Bacteria | 2242 |
| 177 | Ga0105245_10812450 | 3300009098 | Bacteria | 973 |
| 178 | Ga0105245_11624337 | 3300009098 | Bacteria | 698 |
| 179 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 180 | Ga0105243_10003612 | 3300009148 | Bacteria | 12456 |
| 181 | Ga0105243_10014278 | 3300009148 | Bacteria | 6010 |
| 182 | Ga0105241_10111599 | 3300009174 | Bacteria | 2189 |
| 183 | Ga0105241_10177460 | 3300009174 | Bacteria | 1764 |
| 184 | Ga0105241_10191865 | 3300009174 | Bacteria | 1701 |
| 185 | Ga0105241_10555896 | 3300009174 | Bacteria | 1031 |
| 186 | Ga0105241_11121315 | 3300009174 | Bacteria | 742 |
| 187 | Ga0105241_11613001 | 3300009174 | Bacteria | 628 |
| 188 | Ga0105242_10053982 | 3300009176 | Bacteria | 3283 |
| 189 | Ga0105242_10227333 | 3300009176 | Bacteria | 1670 |
| 190 | Ga0105242_10279101 | 3300009176 | Bacteria | 1517 |
| 191 | Ga0105242_10692446 | 3300009176 | Bacteria | 996 |
| 192 | Ga0105242_10847467 | 3300009176 | Bacteria | 909 |
| 193 | Ga0105237_10000794 | 3300009545 | Bacteria | 43200 |
| 194 | Ga0105237_10002553 | 3300009545 | Bacteria | 22488 |
| 195 | Ga0105237_10006510 | 3300009545 | Bacteria | 12935 |
| 196 | Ga0105237_10015313 | 3300009545 | Bacteria | 7986 |
| 197 | Ga0105237_10015662 | 3300009545 | Bacteria | 7882 |
| 198 | Ga0105237_10047854 | 3300009545 | Bacteria | 4300 |
| 199 | Ga0105237_10071252 | 3300009545 | Bacteria | 3471 |
| 200 | Ga0105237_10083942 | 3300009545 | Bacteria | 3175 |
| 201 | Ga0105237_10185132 | 3300009545 | Bacteria | 2083 |
| 202 | Ga0105237_11452365 | 3300009545 | Bacteria | 692 |
| 203 | Ga0105238_10017754 | 3300009551 | Bacteria | 7234 |
| 204 | Ga0105238_10194984 | 3300009551 | Bacteria | 2001 |
| 205 | Ga0105249_10092720 | 3300009553 | Bacteria | 2828 |
| 206 | Ga0105249_10192006 | 3300009553 | Bacteria | 1994 |
| 207 | Ga0130086_1024805 | 3300009829 | Bacteria | 618 |
| 208 | Ga0130085_1035330 | 3300009850 | Bacteria | 618 |
| 209 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 210 | Ga0105239_10005378 | 3300010375 | Bacteria | 15038 |
| 211 | Ga0105239_10015682 | 3300010375 | Bacteria | 8387 |
| 212 | Ga0105239_10248837 | 3300010375 | Bacteria | 1996 |
| 213 | Ga0105239_10262733 | 3300010375 | Bacteria | 1940 |
| 214 | Ga0105239_10429598 | 3300010375 | Bacteria | 1497 |
| 215 | Ga0105239_12090703 | 3300010375 | Bacteria | 658 |
| 216 | Ga0157327_1007676 | 3300012512 | Bacteria | 946 |
| 217 | Ga0157373_10000006 | 3300013100 | Bacteria | 261768 |
| 218 | Ga0157373_10001033 | 3300013100 | Bacteria | 21448 |
| 219 | Ga0157373_10001369 | 3300013100 | Bacteria | 18710 |
| 220 | Ga0157373_10002831 | 3300013100 | Bacteria | 13113 |
| 221 | Ga0157373_10009996 | 3300013100 | Bacteria | 6992 |
| 222 | Ga0157373_10028999 | 3300013100 | Bacteria | 3989 |
| 223 | Ga0157373_10059430 | 3300013100 | Bacteria | 2709 |
| 224 | Ga0157373_11166423 | 3300013100 | Bacteria | 580 |
| 225 | Ga0157371_10000041 | 3300013102 | Bacteria | 203957 |
| 226 | Ga0157371_10000091 | 3300013102 | Bacteria | 144664 |
| 227 | Ga0157371_10001553 | 3300013102 | Bacteria | 23609 |
| 228 | Ga0157371_10001678 | 3300013102 | Bacteria | 22612 |
| 229 | Ga0157371_10013476 | 3300013102 | Bacteria | 6207 |
| 230 | Ga0157371_10021684 | 3300013102 | Bacteria | 4713 |
| 231 | Ga0157371_10033811 | 3300013102 | Bacteria | 3672 |
| 232 | Ga0157370_10012207 | 3300013104 | Bacteria | 8929 |
| 233 | Ga0157370_10014051 | 3300013104 | Bacteria | 8215 |
| 234 | Ga0157370_10019740 | 3300013104 | Bacteria | 6747 |
| 235 | Ga0157370_10041216 | 3300013104 | Bacteria | 4457 |
| 236 | Ga0157370_10042074 | 3300013104 | Bacteria | 4404 |
| 237 | Ga0157370_10073063 | 3300013104 | Bacteria | 3236 |
| 238 | Ga0157370_10106885 | 3300013104 | Bacteria | 2618 |
| 239 | Ga0157370_10327925 | 3300013104 | Bacteria | 1412 |
| 240 | Ga0157370_10553788 | 3300013104 | Bacteria | 1054 |
| 241 | Ga0157370_10693077 | 3300013104 | Bacteria | 930 |
| 242 | Ga0157370_10856639 | 3300013104 | Bacteria | 826 |
| 243 | Ga0157370_11487469 | 3300013104 | Bacteria | 609 |
| 244 | Ga0157369_10000016 | 3300013105 | Bacteria | 257827 |
| 245 | Ga0157369_10000613 | 3300013105 | Bacteria | 46357 |
| 246 | Ga0157369_10008868 | 3300013105 | Bacteria | 11520 |
| 247 | Ga0157369_10010007 | 3300013105 | Bacteria | 10831 |
| 248 | Ga0157369_10030357 | 3300013105 | Bacteria | 5962 |
| 249 | Ga0157369_10080886 | 3300013105 | Bacteria | 3478 |
| 250 | Ga0157369_10408180 | 3300013105 | Bacteria | 1409 |
| 251 | Ga0157369_11507817 | 3300013105 | Bacteria | 684 |
| 252 | Ga0157374_10030641 | 3300013296 | Bacteria | 4886 |
| 253 | Ga0157374_10077301 | 3300013296 | Bacteria | 3150 |
| 254 | Ga0157374_10104516 | 3300013296 | Bacteria | 2719 |
| 255 | Ga0157374_10208307 | 3300013296 | Bacteria | 1916 |
| 256 | Ga0157374_10210459 | 3300013296 | Bacteria | 1906 |
| 257 | Ga0157374_10371931 | 3300013296 | Bacteria | 1423 |
| 258 | Ga0157374_10454107 | 3300013296 | Bacteria | 1283 |
| 259 | Ga0157374_10986484 | 3300013296 | Bacteria | 861 |
| 260 | Ga0157374_11416639 | 3300013296 | Bacteria | 718 |
| 261 | Ga0157374_11420827 | 3300013296 | Bacteria | 717 |
| 262 | Ga0157378_10008303 | 3300013297 | Bacteria | 9048 |
| 263 | Ga0157378_10060889 | 3300013297 | Bacteria | 3368 |
| 264 | Ga0157378_10378236 | 3300013297 | Bacteria | 1390 |
| 265 | Ga0163162_10003331 | 3300013306 | Bacteria | 15374 |
| 266 | Ga0163162_10033491 | 3300013306 | Bacteria | 5107 |
| 267 | Ga0163162_10047580 | 3300013306 | Bacteria | 4298 |
| 268 | Ga0163162_10068714 | 3300013306 | Bacteria | 3595 |
| 269 | Ga0163162_10106514 | 3300013306 | Bacteria | 2899 |
| 270 | Ga0163162_10278112 | 3300013306 | Bacteria | 1806 |
| 271 | Ga0163162_11176876 | 3300013306 | Bacteria | 870 |
| 272 | Ga0163162_11396126 | 3300013306 | Bacteria | 797 |
| 273 | Ga0157372_10000030 | 3300013307 | Bacteria | 179925 |
| 274 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 275 | Ga0157372_10003430 | 3300013307 | Bacteria | 17111 |
| 276 | Ga0157372_10011651 | 3300013307 | Bacteria | 9360 |
| 277 | Ga0157372_10037880 | 3300013307 | Bacteria | 5321 |
| 278 | Ga0157372_10129288 | 3300013307 | Bacteria | 2905 |
| 279 | Ga0157372_10157361 | 3300013307 | Bacteria | 2625 |
| 280 | Ga0157372_10903284 | 3300013307 | Bacteria | 1025 |
| 281 | Ga0157375_10099030 | 3300013308 | Bacteria | 2993 |
| 282 | Ga0157375_10904988 | 3300013308 | Bacteria | 1026 |
| 283 | Ga0157375_11032639 | 3300013308 | Bacteria | 960 |
| 284 | Ga0157375_11275906 | 3300013308 | Bacteria | 863 |
| 285 | Ga0157375_11403714 | 3300013308 | Bacteria | 823 |
| 286 | Ga0157375_11429406 | 3300013308 | Bacteria | 815 |
| 287 | Ga0157375_11618320 | 3300013308 | Bacteria | 766 |
| 288 | Ga0157375_13212846 | 3300013308 | Bacteria | 545 |
| 289 | Ga0163163_10980641 | 3300014325 | Bacteria | 908 |
| 290 | Ga0163163_11138066 | 3300014325 | Bacteria | 843 |
| 291 | Ga0163163_11580757 | 3300014325 | Bacteria | 717 |
| 292 | Ga0163163_12203559 | 3300014325 | Bacteria | 610 |
| 293 | Ga0157380_10000051 | 3300014326 | Bacteria | 68466 |
| 294 | Ga0157380_10946651 | 3300014326 | Bacteria | 891 |
| 295 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 296 | Ga0182008_10000034 | 3300014497 | Bacteria | 138235 |
| 297 | Ga0182008_10001770 | 3300014497 | Bacteria | 14147 |
| 298 | Ga0182008_10003643 | 3300014497 | Bacteria | 9192 |
| 299 | Ga0182008_10111138 | 3300014497 | Bacteria | 1358 |
| 300 | Ga0182008_10345321 | 3300014497 | Bacteria | 788 |
| 301 | Ga0182008_10716442 | 3300014497 | Bacteria | 573 |
| 302 | Ga0157377_10009989 | 3300014745 | Bacteria | 4682 |
| 303 | Ga0157379_11114424 | 3300014968 | Bacteria | 756 |
| 304 | Ga0157376_10125737 | 3300014969 | Bacteria | 2280 |
| 305 | Ga0157376_10271219 | 3300014969 | Bacteria | 1594 |
| 306 | Ga0182006_1000001 | 3300015261 | Bacteria | 1091090 |
| 307 | Ga0182006_1000103 | 3300015261 | Bacteria | 93638 |
| 308 | Ga0182006_1006389 | 3300015261 | Bacteria | 5486 |
| 309 | Ga0182006_1008481 | 3300015261 | Bacteria | 4656 |
| 310 | Ga0182006_1009290 | 3300015261 | Bacteria | 4412 |
| 311 | Ga0182006_1062134 | 3300015261 | Bacteria | 1406 |
| 312 | Ga0182006_1068748 | 3300015261 | Bacteria | 1318 |
| 313 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 314 | Ga0182007_10005771 | 3300015262 | Bacteria | 5382 |
| 315 | Ga0182007_10015899 | 3300015262 | Bacteria | 2792 |
| 316 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 317 | Ga0163161_10000039 | 3300017792 | Bacteria | 148130 |
| 318 | Ga0163161_10000207 | 3300017792 | Bacteria | 53913 |
| 319 | Ga0163161_10009312 | 3300017792 | Bacteria | 6794 |
| 320 | Ga0163161_10039425 | 3300017792 | Bacteria | 3391 |
| 321 | Ga0163161_10054256 | 3300017792 | Bacteria | 2908 |
| 322 | Ga0163161_10097976 | 3300017792 | Bacteria | 2178 |
| 323 | Ga0163161_10125798 | 3300017792 | Bacteria | 1930 |
| 324 | Ga0163161_10317631 | 3300017792 | Bacteria | 1230 |
| 325 | Ga0163161_10554453 | 3300017792 | Bacteria | 942 |
| 326 | Ga0163161_10628450 | 3300017792 | Bacteria | 888 |
| 327 | Ga0163161_10709095 | 3300017792 | Bacteria | 838 |
| 328 | Ga0163161_10739282 | 3300017792 | Bacteria | 822 |
| 329 | Ga0163161_11250984 | 3300017792 | Bacteria | 643 |
| 330 | Ga0197907_10757494 | 3300020069 | Bacteria | 1550 |
| 331 | Ga0197907_11138220 | 3300020069 | Bacteria | 1021 |
| 332 | Ga0206356_10991038 | 3300020070 | Bacteria | 2728 |
| 333 | Ga0206356_11209637 | 3300020070 | Bacteria | 1368 |
| 334 | Ga0206356_11535795 | 3300020070 | Bacteria | 1012 |
| 335 | Ga0206349_1692805 | 3300020075 | Bacteria | 840 |
| 336 | Ga0206351_10267476 | 3300020077 | Bacteria | 15418 |
| 337 | Ga0206351_10387294 | 3300020077 | Bacteria | 4610 |
| 338 | Ga0206351_10512829 | 3300020077 | Bacteria | 15076 |
| 339 | Ga0206351_10991482 | 3300020077 | Bacteria | 3143 |
| 340 | Ga0206352_10226992 | 3300020078 | Bacteria | 1800 |
| 341 | Ga0206352_10382572 | 3300020078 | Bacteria | 889 |
| 342 | Ga0206352_10622029 | 3300020078 | Bacteria | 2482 |
| 343 | Ga0206352_10835038 | 3300020078 | Bacteria | 2111 |
| 344 | Ga0206350_10018304 | 3300020080 | Bacteria | 4056 |
| 345 | Ga0206350_11221028 | 3300020080 | Bacteria | 1722 |
| 346 | Ga0206354_10248047 | 3300020081 | Bacteria | 1770 |
| 347 | Ga0206354_10263498 | 3300020081 | Bacteria | 1624 |
| 348 | Ga0206354_11507030 | 3300020081 | Bacteria | 837 |
| 349 | Ga0206353_10159245 | 3300020082 | Bacteria | 898 |
| 350 | Ga0206353_10736142 | 3300020082 | Bacteria | 1941 |
| 351 | Ga0154015_1024308 | 3300020610 | Bacteria | 3636 |
| 352 | Ga0154015_1037437 | 3300020610 | Bacteria | 13281 |
| 353 | Ga0154015_1309672 | 3300020610 | Bacteria | 3231 |
| 354 | Ga0213872_10051000 | 3300021361 | Bacteria | 1878 |
| 355 | Ga0224712_10004189 | 3300022467 | Bacteria | 3860 |
| 356 | Ga0224712_10045345 | 3300022467 | Bacteria | 1682 |
| 357 | Ga0224712_10082607 | 3300022467 | Bacteria | 1329 |
| 358 | Ga0209563_127189 | 3300025230 | Bacteria | 575 |
| 359 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 360 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 361 | Ga0209437_100135 | 3300025233 | Bacteria | 176455 |
| 362 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 363 | Ga0209026_1000610 | 3300025250 | Bacteria | 22917 |
| 364 | Ga0209026_1004574 | 3300025250 | Bacteria | 4059 |
| 365 | Ga0209148_1033295 | 3300025254 | Bacteria | 753 |
| 366 | Ga0209148_1037006 | 3300025254 | Bacteria | 694 |
| 367 | Ga0209129_1000040 | 3300025258 | Bacteria | 313043 |
| 368 | Ga0209129_1049492 | 3300025258 | Bacteria | 645 |
| 369 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 370 | Ga0209233_1032971 | 3300025261 | Bacteria | 1192 |
| 371 | Ga0209675_1000200 | 3300025291 | Bacteria | 63684 |
| 372 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 373 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 374 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 375 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 376 | Ga0207655_1000016 | 3300025728 | Bacteria | 551476 |
| 377 | Ga0207655_1000038 | 3300025728 | Bacteria | 348340 |
| 378 | Ga0207655_1062533 | 3300025728 | Bacteria | 1431 |
| 379 | Ga0207713_1057298 | 3300025735 | Bacteria | 1507 |
| 380 | Ga0207642_10051496 | 3300025899 | Bacteria | 1863 |
| 381 | Ga0207642_10122961 | 3300025899 | Bacteria | 1342 |
| 382 | Ga0207647_10000303 | 3300025904 | Bacteria | 40536 |
| 383 | Ga0207647_10032931 | 3300025904 | Bacteria | 3324 |
| 384 | Ga0207647_10036461 | 3300025904 | Bacteria | 3124 |
| 385 | Ga0207645_10000035 | 3300025907 | Bacteria | 89345 |
| 386 | Ga0207705_10000108 | 3300025909 | Bacteria | 93501 |
| 387 | Ga0207705_10328136 | 3300025909 | Bacteria | 1176 |
| 388 | Ga0207654_10023808 | 3300025911 | Bacteria | 3286 |
| 389 | Ga0207654_10124200 | 3300025911 | Bacteria | 1625 |
| 390 | Ga0207654_10648325 | 3300025911 | Bacteria | 756 |
| 391 | Ga0207654_10982565 | 3300025911 | Bacteria | 614 |
| 392 | Ga0207707_10032972 | 3300025912 | Bacteria | 4534 |
| 393 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 394 | Ga0207695_10039657 | 3300025913 | Bacteria | 5060 |
| 395 | Ga0207695_10062421 | 3300025913 | Bacteria | 3847 |
| 396 | Ga0207695_10080728 | 3300025913 | Bacteria | 3293 |
| 397 | Ga0207695_10085252 | 3300025913 | Bacteria | 3188 |
| 398 | Ga0207695_10288044 | 3300025913 | Bacteria | 1535 |
| 399 | Ga0207671_10005849 | 3300025914 | Bacteria | 11173 |
| 400 | Ga0207671_10011776 | 3300025914 | Bacteria | 7082 |
| 401 | Ga0207671_10013363 | 3300025914 | Bacteria | 6541 |
| 402 | Ga0207671_10018120 | 3300025914 | Bacteria | 5410 |
| 403 | Ga0207671_10020602 | 3300025914 | Bacteria | 5016 |
| 404 | Ga0207671_10034795 | 3300025914 | Bacteria | 3742 |
| 405 | Ga0207671_10072375 | 3300025914 | Bacteria | 2573 |
| 406 | Ga0207671_10722220 | 3300025914 | Bacteria | 792 |
| 407 | Ga0207671_10847229 | 3300025914 | Bacteria | 724 |
| 408 | Ga0207660_10360566 | 3300025917 | Bacteria | 1166 |
| 409 | Ga0207657_10055251 | 3300025919 | Bacteria | 3431 |
| 410 | Ga0207657_10111319 | 3300025919 | Bacteria | 2261 |
| 411 | Ga0207657_10231799 | 3300025919 | Bacteria | 1476 |
| 412 | Ga0207657_10398871 | 3300025919 | Bacteria | 1082 |
| 413 | Ga0207649_10253338 | 3300025920 | Bacteria | 1269 |
| 414 | Ga0207652_10002419 | 3300025921 | Bacteria | 15754 |
| 415 | Ga0207652_10095693 | 3300025921 | Bacteria | 2616 |
| 416 | Ga0207652_11552987 | 3300025921 | Bacteria | 566 |
| 417 | Ga0207681_10486661 | 3300025923 | Bacteria | 1008 |
| 418 | Ga0207694_10009649 | 3300025924 | Bacteria | 7276 |
| 419 | Ga0207694_10042226 | 3300025924 | Bacteria | 3517 |
| 420 | Ga0207650_10136672 | 3300025925 | Bacteria | 1923 |
| 421 | Ga0207687_10126670 | 3300025927 | Bacteria | 1918 |
| 422 | Ga0207687_11130250 | 3300025927 | Bacteria | 673 |
| 423 | Ga0207664_10602438 | 3300025929 | Bacteria | 987 |
| 424 | Ga0207644_11375596 | 3300025931 | Bacteria | 593 |
| 425 | Ga0207690_10000936 | 3300025932 | Bacteria | 18684 |
| 426 | Ga0207690_10069096 | 3300025932 | Bacteria | 2429 |
| 427 | Ga0207706_10019009 | 3300025933 | Bacteria | 6180 |
| 428 | Ga0207706_10854126 | 3300025933 | Bacteria | 771 |
| 429 | Ga0207686_10059526 | 3300025934 | Bacteria | 2414 |
| 430 | Ga0207686_10187305 | 3300025934 | Bacteria | 1472 |
| 431 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 432 | Ga0207709_10000084 | 3300025935 | Bacteria | 161002 |
| 433 | Ga0207709_10020248 | 3300025935 | Bacteria | 3750 |
| 434 | Ga0207709_11582225 | 3300025935 | Bacteria | 544 |
| 435 | Ga0207704_10000036 | 3300025938 | Bacteria | 94574 |
| 436 | Ga0207665_10034201 | 3300025939 | Bacteria | 3373 |
| 437 | Ga0207691_10186142 | 3300025940 | Bacteria | 1812 |
| 438 | Ga0207691_10275349 | 3300025940 | Bacteria | 1449 |
| 439 | Ga0207689_10558361 | 3300025942 | Bacteria | 962 |
| 440 | Ga0207661_10013292 | 3300025944 | Bacteria | 6012 |
| 441 | Ga0207661_10014621 | 3300025944 | Bacteria | 5756 |
| 442 | Ga0207667_10000430 | 3300025949 | Bacteria | 56466 |
| 443 | Ga0207667_10022849 | 3300025949 | Bacteria | 6898 |
| 444 | Ga0207667_10023666 | 3300025949 | Bacteria | 6761 |
| 445 | Ga0207667_10041900 | 3300025949 | Bacteria | 4869 |
| 446 | Ga0207667_10093127 | 3300025949 | Bacteria | 3112 |
| 447 | Ga0207667_10242746 | 3300025949 | Bacteria | 1843 |
| 448 | Ga0207667_10265903 | 3300025949 | Bacteria | 1753 |
| 449 | Ga0207651_10009416 | 3300025960 | Bacteria | 5347 |
| 450 | Ga0207712_10542484 | 3300025961 | Bacteria | 999 |
| 451 | Ga0207668_10020698 | 3300025972 | Bacteria | 4186 |
| 452 | Ga0207668_11671342 | 3300025972 | Bacteria | 575 |
| 453 | Ga0207640_10192986 | 3300025981 | Bacteria | 1537 |
| 454 | Ga0207640_10666795 | 3300025981 | Bacteria | 888 |
| 455 | Ga0207640_10912444 | 3300025981 | Bacteria | 768 |
| 456 | Ga0207658_10494531 | 3300025986 | Bacteria | 1089 |
| 457 | Ga0207658_10975083 | 3300025986 | Bacteria | 773 |
| 458 | Ga0207677_11055425 | 3300026023 | Bacteria | 739 |
| 459 | Ga0207639_10167234 | 3300026041 | Bacteria | 1859 |
| 460 | Ga0207639_10380458 | 3300026041 | Bacteria | 1267 |
| 461 | Ga0207639_10546031 | 3300026041 | Bacteria | 1063 |
| 462 | Ga0207639_11132541 | 3300026041 | Bacteria | 734 |
| 463 | Ga0207702_10010443 | 3300026078 | Bacteria | 7766 |
| 464 | Ga0207702_10068465 | 3300026078 | Bacteria | 3050 |
| 465 | Ga0207702_10069982 | 3300026078 | Bacteria | 3017 |
| 466 | Ga0207702_10311424 | 3300026078 | Bacteria | 1497 |
| 467 | Ga0207702_10318830 | 3300026078 | Bacteria | 1480 |
| 468 | Ga0207702_10322206 | 3300026078 | Bacteria | 1472 |
| 469 | Ga0207702_10370041 | 3300026078 | Bacteria | 1376 |
| 470 | Ga0207702_10567715 | 3300026078 | Bacteria | 1111 |
| 471 | Ga0207702_12422588 | 3300026078 | Bacteria | 512 |
| 472 | Ga0207648_10000333 | 3300026089 | Bacteria | 51656 |
| 473 | Ga0207648_11039269 | 3300026089 | Bacteria | 768 |
| 474 | Ga0207676_11854756 | 3300026095 | Bacteria | 602 |
| 475 | Ga0207674_10641092 | 3300026116 | Bacteria | 1026 |
| 476 | Ga0207674_10812864 | 3300026116 | Bacteria | 902 |
| 477 | Ga0207674_11110581 | 3300026116 | Bacteria | 760 |
| 478 | Ga0207683_10003418 | 3300026121 | Bacteria | 13828 |
| 479 | Ga0207683_10918146 | 3300026121 | Bacteria | 813 |
| 480 | Ga0207698_10013453 | 3300026142 | Bacteria | 5399 |
| 481 | Ga0207698_10137832 | 3300026142 | Bacteria | 2096 |
| 482 | Ga0207698_10150675 | 3300026142 | Bacteria | 2018 |
| 483 | Ga0207698_10337062 | 3300026142 | Bacteria | 1419 |
| 484 | Ga0207698_10485173 | 3300026142 | Bacteria | 1200 |
| 485 | Ga0209281_1000337 | 3300027111 | Bacteria | 79938 |
| 486 | Ga0209489_111364 | 3300027361 | Bacteria | 9138 |
| 487 | Ga0209995_1079267 | 3300027471 | Bacteria | 564 |
| 488 | Ga0209968_1001995 | 3300027526 | Bacteria | 3102 |
| 489 | Ga0209968_1042388 | 3300027526 | Bacteria | 780 |
| 490 | Ga0209999_1008578 | 3300027543 | Bacteria | 1845 |
| 491 | Ga0210002_1004025 | 3300027617 | Bacteria | 2181 |
| 492 | Ga0209282_1014100 | 3300027666 | Bacteria | 5087 |
| 493 | Ga0268266_10000658 | 3300028379 | Bacteria | 46741 |
| 494 | Ga0268264_10861207 | 3300028381 | Bacteria | 908 |
| 495 | Ga0265337_1069686 | 3300028556 | Bacteria | 968 |
| 496 | Ga0265337_1133038 | 3300028556 | Bacteria | 674 |
| 497 | Ga0265326_10159196 | 3300028558 | Bacteria | 645 |
| 498 | Ga0265334_10025950 | 3300028573 | Bacteria | 2369 |
| 499 | Ga0265334_10102722 | 3300028573 | Bacteria | 1033 |
| 500 | Ga0265318_10048406 | 3300028577 | Bacteria | 1601 |
| 501 | Ga0265323_10000040 | 3300028653 | Bacteria | 70373 |
| 502 | Ga0265336_10018763 | 3300028666 | Bacteria | 2237 |
| 503 | Ga0307517_10012583 | 3300028786 | Bacteria | 11593 |
| 504 | Ga0307517_10233819 | 3300028786 | Bacteria | 1099 |
| 505 | Ga0307517_10295128 | 3300028786 | Bacteria | 913 |
| 506 | Ga0307515_10179470 | 3300028794 | Bacteria | 2074 |
| 507 | Ga0307515_10302211 | 3300028794 | Bacteria | 1284 |
| 508 | Ga0307515_10339301 | 3300028794 | Bacteria | 1156 |
| 509 | Ga0307515_10669408 | 3300028794 | Bacteria | 651 |
| 510 | Ga0265338_10001162 | 3300028800 | Bacteria | 43495 |
| 511 | Ga0265338_10007954 | 3300028800 | Bacteria | 12991 |
| 512 | Ga0265338_10570954 | 3300028800 | Bacteria | 790 |
| 513 | Ga0316177_1073605 | 3300030731 | Bacteria | 20644 |
| 514 | Ga0316176_1042405 | 3300030732 | Bacteria | 10258 |
| 515 | Ga0314311_1036826 | 3300030733 | Bacteria | 876 |
| 516 | Ga0316183_1033300 | 3300030742 | Bacteria | 31987 |
| 517 | Ga0316181_1007760 | 3300030744 | Bacteria | 1229 |
| 518 | Ga0316181_1034557 | 3300030744 | Bacteria | 9867 |
| 519 | Ga0316182_1143329 | 3300030745 | Bacteria | 2798 |
| 520 | Ga0316182_1415427 | 3300030745 | Bacteria | 3110 |
| 521 | Ga0265330_10109929 | 3300031235 | Bacteria | 1178 |
| 522 | Ga0265339_10431907 | 3300031249 | Bacteria | 613 |
| 523 | Ga0265327_10000370 | 3300031251 | Bacteria | 84921 |
| 524 | Ga0265327_10075375 | 3300031251 | Bacteria | 1678 |
| 525 | Ga0265327_10134823 | 3300031251 | Bacteria | 1159 |
| 526 | Ga0265316_10000486 | 3300031344 | Bacteria | 45040 |
| 527 | Ga0265316_10004585 | 3300031344 | Bacteria | 13715 |
| 528 | Ga0265316_10065971 | 3300031344 | Bacteria | 2802 |
| 529 | Ga0265316_10363451 | 3300031344 | Bacteria | 1046 |
| 530 | Ga0307509_10114085 | 3300031507 | Bacteria | 2698 |
| 531 | Ga0307408_100003785 | 3300031548 | Bacteria | 10304 |
| 532 | Ga0307408_100003845 | 3300031548 | Bacteria | 10216 |
| 533 | Ga0307408_100005144 | 3300031548 | Bacteria | 8770 |
| 534 | Ga0307408_100015317 | 3300031548 | Bacteria | 5105 |
| 535 | Ga0307408_100966780 | 3300031548 | Bacteria | 783 |
| 536 | Ga0316575_10072812 | 3300031665 | Bacteria | 1382 |
| 537 | Ga0316579_10126698 | 3300031691 | Bacteria | 1229 |
| 538 | Ga0316579_10303502 | 3300031691 | Bacteria | 772 |
| 539 | Ga0316579_10397442 | 3300031691 | Bacteria | 666 |
| 540 | Ga0265342_10069939 | 3300031712 | Bacteria | 2049 |
| 541 | Ga0265342_10106285 | 3300031712 | Bacteria | 1593 |
| 542 | Ga0265342_10165993 | 3300031712 | Bacteria | 1218 |
| 543 | Ga0265342_10234540 | 3300031712 | Bacteria | 984 |
| 544 | Ga0316576_10017698 | 3300031727 | Bacteria | 4849 |
| 545 | Ga0316576_10018128 | 3300031727 | Bacteria | 4799 |
| 546 | Ga0316576_10021761 | 3300031727 | Bacteria | 4440 |
| 547 | Ga0316576_10027616 | 3300031727 | Bacteria | 3992 |
| 548 | Ga0316576_10039513 | 3300031727 | Bacteria | 3387 |
| 549 | Ga0316576_10044468 | 3300031727 | Bacteria | 3208 |
| 550 | Ga0316576_10060515 | 3300031727 | Bacteria | 2774 |
| 551 | Ga0316576_10106177 | 3300031727 | Bacteria | 2102 |
| 552 | Ga0316576_10141263 | 3300031727 | Bacteria | 1813 |
| 553 | Ga0316576_10208640 | 3300031727 | Bacteria | 1471 |
| 554 | Ga0316576_10452242 | 3300031727 | Bacteria | 948 |
| 555 | Ga0316576_10620299 | 3300031727 | Bacteria | 788 |
| 556 | Ga0316578_10023848 | 3300031728 | Bacteria | 3427 |
| 557 | Ga0316578_10042897 | 3300031728 | Bacteria | 2625 |
| 558 | Ga0316578_10081543 | 3300031728 | Bacteria | 1925 |
| 559 | Ga0316578_10312557 | 3300031728 | Bacteria | 939 |
| 560 | Ga0316578_10334512 | 3300031728 | Bacteria | 902 |
| 561 | Ga0307405_10000005 | 3300031731 | Bacteria | 376536 |
| 562 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 563 | Ga0307405_10080775 | 3300031731 | Bacteria | 2123 |
| 564 | Ga0307405_10217445 | 3300031731 | Bacteria | 1400 |
| 565 | Ga0316577_10039011 | 3300031733 | Bacteria | 2658 |
| 566 | Ga0316577_10251991 | 3300031733 | Bacteria | 999 |
| 567 | Ga0307413_10001014 | 3300031824 | Bacteria | 10155 |
| 568 | Ga0307413_10001307 | 3300031824 | Bacteria | 9311 |
| 569 | Ga0307413_10464591 | 3300031824 | Bacteria | 1008 |
| 570 | Ga0307413_10685145 | 3300031824 | Bacteria | 850 |
| 571 | Ga0307410_10000034 | 3300031852 | Bacteria | 48449 |
| 572 | Ga0307410_10428957 | 3300031852 | Bacteria | 1074 |
| 573 | Ga0307406_10000004 | 3300031901 | Bacteria | 179772 |
| 574 | Ga0307407_10000003 | 3300031903 | Bacteria | 271723 |
| 575 | Ga0307407_10000196 | 3300031903 | Bacteria | 18233 |
| 576 | Ga0307412_10002079 | 3300031911 | Bacteria | 11112 |
| 577 | Ga0307412_10003796 | 3300031911 | Bacteria | 8399 |
| 578 | Ga0307412_10012909 | 3300031911 | Bacteria | 4881 |
| 579 | Ga0307412_10014189 | 3300031911 | Bacteria | 4692 |
| 580 | Ga0307412_10014929 | 3300031911 | Bacteria | 4592 |
| 581 | Ga0307412_10041647 | 3300031911 | Bacteria | 2978 |
| 582 | Ga0307412_10248062 | 3300031911 | Bacteria | 1381 |
| 583 | Ga0307412_10465219 | 3300031911 | Bacteria | 1045 |
| 584 | Ga0307412_10932103 | 3300031911 | Bacteria | 763 |
| 585 | Ga0307409_100068515 | 3300031995 | Bacteria | 2807 |
| 586 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 587 | Ga0307416_100000006 | 3300032002 | Bacteria | 466074 |
| 588 | Ga0307416_100079899 | 3300032002 | Bacteria | 2758 |
| 589 | Ga0307414_10000011 | 3300032004 | Bacteria | 338253 |
| 590 | Ga0307414_10000030 | 3300032004 | Bacteria | 187373 |
| 591 | Ga0307414_10000527 | 3300032004 | Bacteria | 19931 |
| 592 | Ga0307414_10000673 | 3300032004 | Bacteria | 17502 |
| 593 | Ga0307414_10005329 | 3300032004 | Bacteria | 7075 |
| 594 | Ga0307414_10005856 | 3300032004 | Bacteria | 6798 |
| 595 | Ga0307414_10008647 | 3300032004 | Bacteria | 5791 |
| 596 | Ga0307414_10009488 | 3300032004 | Bacteria | 5593 |
| 597 | Ga0307414_10012166 | 3300032004 | Bacteria | 5077 |
| 598 | Ga0307414_10019816 | 3300032004 | Bacteria | 4178 |
| 599 | Ga0307414_10043096 | 3300032004 | Bacteria | 3071 |
| 600 | Ga0307414_10065136 | 3300032004 | Bacteria | 2598 |
| 601 | Ga0307414_10082843 | 3300032004 | Bacteria | 2353 |
| 602 | Ga0307414_10085579 | 3300032004 | Bacteria | 2323 |
| 603 | Ga0307414_10087301 | 3300032004 | Bacteria | 2304 |
| 604 | Ga0307414_10125747 | 3300032004 | Bacteria | 1980 |
| 605 | Ga0307414_10126650 | 3300032004 | Bacteria | 1974 |
| 606 | Ga0307414_10198743 | 3300032004 | Bacteria | 1629 |
| 607 | Ga0307414_10457857 | 3300032004 | Bacteria | 1120 |
| 608 | Ga0307414_10606466 | 3300032004 | Bacteria | 982 |
| 609 | Ga0307414_10904314 | 3300032004 | Bacteria | 809 |
| 610 | Ga0307414_11331723 | 3300032004 | Bacteria | 666 |
| 611 | Ga0307414_11349251 | 3300032004 | Bacteria | 662 |
| 612 | Ga0307411_10000004 | 3300032005 | Bacteria | 460327 |
| 613 | Ga0307411_10001861 | 3300032005 | Bacteria | 8973 |
| 614 | Ga0307411_10055855 | 3300032005 | Bacteria | 2599 |
| 615 | Ga0307411_10892300 | 3300032005 | Bacteria | 789 |
| 616 | Ga0307411_11077058 | 3300032005 | Bacteria | 723 |
| 617 | Ga0307411_11551145 | 3300032005 | Bacteria | 610 |
| 618 | Ga0316583_10220733 | 3300032133 | Bacteria | 657 |
| 619 | Ga0316585_10003939 | 3300032137 | Bacteria | 4109 |
| 620 | Ga0316585_10053022 | 3300032137 | Bacteria | 1304 |
| 621 | Ga0316585_10072804 | 3300032137 | Bacteria | 1116 |
| 622 | Ga0316585_10175678 | 3300032137 | Bacteria | 708 |
| 623 | Ga0316580_10075571 | 3300032139 | Bacteria | 1031 |
| 624 | Ga0316580_10095681 | 3300032139 | Bacteria | 909 |
| 625 | Ga0316580_10138765 | 3300032139 | Bacteria | 746 |
| 626 | Ga0316593_10000201 | 3300032168 | Bacteria | 9314 |
| 627 | Ga0316593_10003117 | 3300032168 | Bacteria | 4063 |
| 628 | Ga0316593_10003954 | 3300032168 | Bacteria | 3746 |
| 629 | Ga0316593_10006093 | 3300032168 | Bacteria | 3234 |
| 630 | Ga0316593_10040978 | 3300032168 | Bacteria | 1540 |
| 631 | Ga0316593_10066960 | 3300032168 | Bacteria | 1237 |
| 632 | Ga0316593_10094169 | 3300032168 | Bacteria | 1057 |
| 633 | Ga0316593_10119539 | 3300032168 | Bacteria | 945 |
| 634 | Ga0316593_10157582 | 3300032168 | Bacteria | 828 |
| 635 | Ga0316593_10162772 | 3300032168 | Bacteria | 815 |
| 636 | Ga0316593_10193787 | 3300032168 | Bacteria | 750 |
| 637 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 638 | Ga0307510_10003892 | 3300033180 | Bacteria | 17498 |
| 639 | Ga0307510_10030428 | 3300033180 | Bacteria | 6119 |
| 640 | Ga0316592_1000331 | 3300033524 | Bacteria | 6138 |
| 641 | Ga0316592_1000945 | 3300033524 | Bacteria | 4451 |
| 642 | Ga0316592_1001036 | 3300033524 | Bacteria | 4325 |
| 643 | Ga0316592_1014787 | 3300033524 | Bacteria | 1621 |
| 644 | Ga0316592_1015296 | 3300033524 | Bacteria | 1597 |
| 645 | Ga0316592_1015321 | 3300033524 | Bacteria | 1596 |
| 646 | Ga0316592_1080804 | 3300033524 | Bacteria | 739 |
| 647 | Ga0316586_1009678 | 3300033527 | Bacteria | 1447 |
| 648 | Ga0316588_1001461 | 3300033528 | Bacteria | 3879 |
| 649 | Ga0316588_1047427 | 3300033528 | Bacteria | 1037 |
| 650 | Ga0316588_1049774 | 3300033528 | Bacteria | 1015 |
| 651 | Ga0316588_1062965 | 3300033528 | Bacteria | 906 |
| 652 | Ga0316587_1009264 | 3300033529 | Bacteria | 1559 |
| 653 | Ga0316596_1000052 | 3300033541 | Bacteria | 12700 |
| 654 | Ga0316596_1000348 | 3300033541 | Bacteria | 7561 |
| 655 | Ga0316596_1000575 | 3300033541 | Bacteria | 6430 |
| 656 | Ga0316596_1003747 | 3300033541 | Bacteria | 3360 |
| 657 | Ga0316596_1003898 | 3300033541 | Bacteria | 3305 |
| 658 | Ga0316596_1006680 | 3300033541 | Bacteria | 2693 |
| 659 | Ga0316596_1019521 | 3300033541 | Bacteria | 1720 |
| 660 | Ga0316596_1021732 | 3300033541 | Bacteria | 1637 |
| 661 | Ga0316596_1031647 | 3300033541 | Bacteria | 1375 |
| 662 | Ga0316596_1032001 | 3300033541 | Bacteria | 1368 |
| 663 | Ga0316596_1049625 | 3300033541 | Bacteria | 1109 |
| 664 | Ga0316596_1052248 | 3300033541 | Bacteria | 1083 |
| 665 | Ga0316596_1106897 | 3300033541 | Bacteria | 758 |
| 666 | Ga0316596_1119275 | 3300033541 | Bacteria | 717 |
| 667 | Ga0316596_1143532 | 3300033541 | Bacteria | 654 |
| 668 | Ga0316596_1154244 | 3300033541 | Bacteria | 631 |
| 669 | Ga0373955_0376856 | 3300035172 | Bacteria | 861 |
| 670 | Ga0316574_0027184 | 3300035398 | Bacteria | 3445 |
| 671 | Ga0316574_0047218 | 3300035398 | Bacteria | 2672 |
| 672 | Ga0316574_0056124 | 3300035398 | Bacteria | 2463 |
| 673 | Ga0316574_0056810 | 3300035398 | Unclassified | 2449 |
| 674 | Ga0316574_0068566 | 3300035398 | Bacteria | 2237 |
| 675 | Ga0316574_0165017 | 3300035398 | Bacteria | 1426 |
| 676 | Ga0316574_0246045 | 3300035398 | Bacteria | 1143 |
| 677 | Ga0316574_0481877 | 3300035398 | Bacteria | 775 |
| 678 | Ga0316574_0850595 | 3300035398 | Bacteria | 554 |
| 679 | Ga0373937_1708080 | 3300036401 | Bacteria | 576 |
| 680 | Ga0316582_0014930 | 3300036647 | Bacteria | 4424 |
| 681 | Ga0316582_0036309 | 3300036647 | Bacteria | 3049 |
| 682 | Ga0316582_0196506 | 3300036647 | Bacteria | 1375 |
| 683 | Ga0316582_0638495 | 3300036647 | Bacteria | 732 |
| 684 | Ga0316584_0005378 | 3300036712 | Bacteria | 8592 |
| 685 | Ga0316584_0048368 | 3300036712 | Bacteria | 3177 |
| 686 | Ga0316584_0087726 | 3300036712 | Bacteria | 2329 |
| 687 | Ga0316584_0277900 | 3300036712 | Bacteria | 1217 |
| 688 | Ga0316584_0284516 | 3300036712 | Bacteria | 1201 |
| 689 | Ga0316584_0285033 | 3300036712 | Bacteria | 1199 |
| 690 | Ga0316584_0658427 | 3300036712 | Bacteria | 721 |
| 691 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 692 | Ga0395899_0000472 | 3300037312 | Bacteria | 45477 |
| 693 | Ga0395899_0000499 | 3300037312 | Bacteria | 43572 |
| 694 | Ga0395899_0000673 | 3300037312 | Bacteria | 34566 |
| 695 | Ga0395900_0000346 | 3300037418 | Bacteria | 68020 |
| 696 | Ga0395900_0000441 | 3300037418 | Bacteria | 59413 |
| 697 | Ga0395900_0169281 | 3300037418 | Bacteria | 2225 |
| 698 | Ga0395900_0208359 | 3300037418 | Bacteria | 1975 |
| 699 | Ga0395900_0827767 | 3300037418 | Bacteria | 852 |
| 700 | Ga0395898_0021701 | 3300037466 | Bacteria | 6509 |
| 701 | Ga0395898_1478469 | 3300037466 | Bacteria | 606 |
| 702 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 703 | Ga0395905_0000376 | 3300037471 | Bacteria | 63695 |
| 704 | Ga0395905_0000528 | 3300037471 | Bacteria | 52404 |
| 705 | Ga0395905_0127136 | 3300037471 | Bacteria | 2397 |
| 706 | Ga0395901_0000351 | 3300038443 | Bacteria | 56004 |
| 707 | Ga0395901_0003122 | 3300038443 | Bacteria | 16635 |
| 708 | Ga0395901_0896929 | 3300038443 | Bacteria | 869 |
| 709 | Ga0400483_035362 | 3300039062 | Bacteria | 41412 |
| 710 | Ga0400483_183866 | 3300039062 | Bacteria | 1535 |
| 711 | Ga0400489_00932 | 3300039093 | Bacteria | 9350 |
| 712 | Ga0400489_18980 | 3300039093 | Bacteria | 1041 |
| 713 | Ga0436361_0433548 | 3300039447 | Bacteria | 14679 |
| 714 | Ga0439447_002479 | 3300041407 | Bacteria | 6716 |
| 715 | Ga0439466_0014751 | 3300041411 | Bacteria | 2841 |
| 716 | Ga0439465_0002928 | 3300041413 | Bacteria | 5595 |
| 717 | Ga0451788_26116 | 3300041442 | Bacteria | 548 |
| 718 | Ga0451789_0913588 | 3300041443 | Bacteria | 1260 |
| 719 | Ga0451790_03894 | 3300041444 | Bacteria | 794 |
| 720 | Ga0451790_15122 | 3300041444 | Bacteria | 1162 |
| 721 | Ga0451790_24363 | 3300041444 | Bacteria | 866 |
| 722 | Ga0451790_25357 | 3300041444 | Bacteria | 751 |
| 723 | Ga0451790_36804 | 3300041444 | Bacteria | 515 |
| 724 | Ga0451792_07354 | 3300041445 | Bacteria | 562 |
| 725 | Ga0451794_08398 | 3300041446 | Bacteria | 628 |
| 726 | Ga0451794_24707 | 3300041446 | Bacteria | 871 |
| 727 | Ga0451794_25189 | 3300041446 | Bacteria | 750 |
| 728 | Ga0451794_39000 | 3300041446 | Bacteria | 623 |
| 729 | Ga0451791_0489072 | 3300041451 | Bacteria | 1708 |
| 730 | Ga0451791_1291585 | 3300041451 | Bacteria | 838 |
| 731 | Ga0451793_0486272 | 3300041452 | Bacteria | 869 |
| 732 | Ga0451795_0972033 | 3300041456 | Bacteria | 563 |
| 733 | Ga0451798_0268261 | 3300041458 | Bacteria | 541 |
| 734 | Ga0451802_1884876 | 3300041460 | Bacteria | 1066 |
| 735 | Ga0451804_0735281 | 3300041463 | Bacteria | 857 |
| 736 | Ga0451804_1059666 | 3300041463 | Bacteria | 1135 |
| 737 | Ga0451807_0242729 | 3300041486 | Bacteria | 897 |
| 738 | Ga0451807_1458215 | 3300041486 | Bacteria | 932 |
| 739 | Ga0451837_0551105 | 3300041494 | Bacteria | 627 |
| 740 | Ga0451844_23593 | 3300041500 | Bacteria | 631 |
| 741 | Ga0451849_1177343 | 3300041505 | Bacteria | 865 |
| 742 | Ga0451851_0089935 | 3300041507 | Bacteria | 1105 |
| 743 | Ga0451843_1098053 | 3300041509 | Bacteria | 612 |
| 744 | Ga0451843_1638388 | 3300041509 | Bacteria | 1120 |
| 745 | Ga0451855_0333792 | 3300041511 | Bacteria | 882 |
| 746 | Ga0451855_0440306 | 3300041511 | Bacteria | 509 |
| 747 | Ga0451855_0497909 | 3300041511 | Bacteria | 3019 |
| 748 | Ga0452271_37402 | 3300041916 | Bacteria | 829 |
| 749 | Ga0452271_80664 | 3300041916 | Bacteria | 637 |
| 750 | Ga0439445_0000090 | 3300042004 | Bacteria | 14230 |
| 751 | Ga0439445_0036329 | 3300042004 | Bacteria | 1296 |
| 752 | Ga0439448_0001990 | 3300042005 | Bacteria | 5465 |
| 753 | Ga0439432_122979 | 3300042006 | Bacteria | 768 |
| 754 | Ga0439457_024112 | 3300042014 | Bacteria | 1346 |
| 755 | Ga0450901_005819 | 3300042533 | Bacteria | 1267 |
| 756 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 757 | Ga0451577_0000690 | 3300042876 | Bacteria | 52905 |
| 758 | Ga0451577_0005144 | 3300042876 | Bacteria | 13458 |
| 759 | Ga0451577_0023389 | 3300042876 | Bacteria | 5637 |
| 760 | Ga0451577_0024955 | 3300042876 | Bacteria | 5429 |
| 761 | Ga0451577_0025303 | 3300042876 | Bacteria | 5388 |
| 762 | Ga0451577_0028546 | 3300042876 | Bacteria | 5045 |
| 763 | Ga0451577_0047949 | 3300042876 | Bacteria | 3818 |
| 764 | Ga0451577_0066417 | 3300042876 | Bacteria | 3217 |
| 765 | Ga0451577_0091067 | 3300042876 | Bacteria | 2722 |
| 766 | Ga0451577_0107299 | 3300042876 | Bacteria | 2496 |
| 767 | Ga0451577_0300325 | 3300042876 | Bacteria | 1455 |
| 768 | Ga0451577_0360457 | 3300042876 | Bacteria | 1319 |
| 769 | Ga0451577_0389652 | 3300042876 | Bacteria | 1264 |
| 770 | Ga0451577_0487687 | 3300042876 | Bacteria | 1119 |
| 771 | Ga0451577_0551316 | 3300042876 | Bacteria | 1047 |
| 772 | Ga0451577_0801834 | 3300042876 | Bacteria | 850 |
| 773 | Ga0451577_1658807 | 3300042876 | Bacteria | 563 |
| 774 | Ga0451577_1721338 | 3300042876 | Bacteria | 551 |
| 775 | Ga0453683_0000066 | 3300044673 | Bacteria | 164788 |
| 776 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 777 | Ga0453683_0006727 | 3300044673 | Bacteria | 7859 |
| 778 | Ga0453683_0010256 | 3300044673 | Bacteria | 6213 |
| 779 | Ga0453683_0118753 | 3300044673 | Bacteria | 1664 |
| 780 | Ga0453683_0139064 | 3300044673 | Bacteria | 1532 |
| 781 | Ga0453683_0162196 | 3300044673 | Bacteria | 1414 |
| 782 | Ga0453683_0214162 | 3300044673 | Bacteria | 1224 |
| 783 | Ga0453683_0215687 | 3300044673 | Bacteria | 1219 |
| 784 | Ga0453683_0215753 | 3300044673 | Bacteria | 1219 |
| 785 | Ga0453683_0216051 | 3300044673 | Bacteria | 1218 |
| 786 | Ga0453683_0278281 | 3300044673 | Bacteria | 1068 |
| 787 | Ga0453683_0318967 | 3300044673 | Bacteria | 996 |
| 788 | Ga0453683_0621848 | 3300044673 | Bacteria | 705 |
| 789 | Ga0466966_0001476 | 3300044684 | Bacteria | 15131 |
| 790 | Ga0466961_0182800 | 3300044693 | Bacteria | 1301 |
| 791 | Ga0466961_0863931 | 3300044693 | Bacteria | 539 |
| 792 | Ga0453684_0000440 | 3300044712 | Bacteria | 169397 |
| 793 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 794 | Ga0453684_0001121 | 3300044712 | Bacteria | 83919 |
| 795 | Ga0453684_0001382 | 3300044712 | Bacteria | 70292 |
| 796 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 797 | Ga0453684_0004131 | 3300044712 | Bacteria | 31439 |
| 798 | Ga0453684_0004169 | 3300044712 | Bacteria | 31186 |
| 799 | Ga0453684_0004492 | 3300044712 | Bacteria | 29332 |
| 800 | Ga0453684_0009769 | 3300044712 | Bacteria | 16659 |
| 801 | Ga0453684_0012437 | 3300044712 | Bacteria | 14033 |
| 802 | Ga0453684_0035092 | 3300044712 | Bacteria | 6941 |
| 803 | Ga0453684_0049674 | 3300044712 | Bacteria | 5527 |
| 804 | Ga0453684_0064505 | 3300044712 | Bacteria | 4678 |
| 805 | Ga0453684_0076172 | 3300044712 | Bacteria | 4212 |
| 806 | Ga0453684_0104626 | 3300044712 | Bacteria | 3455 |
| 807 | Ga0453684_0133450 | 3300044712 | Bacteria | 2976 |
| 808 | Ga0453684_0143337 | 3300044712 | Bacteria | 2849 |
| 809 | Ga0453684_0145941 | 3300044712 | Bacteria | 2819 |
| 810 | Ga0453684_0182883 | 3300044712 | Bacteria | 2459 |
| 811 | Ga0453684_0213872 | 3300044712 | Bacteria | 2238 |
| 812 | Ga0453684_0267728 | 3300044712 | Bacteria | 1954 |
| 813 | Ga0453684_0385184 | 3300044712 | Bacteria | 1573 |
| 814 | Ga0453684_0417493 | 3300044712 | Bacteria | 1499 |
| 815 | Ga0453684_0532547 | 3300044712 | Bacteria | 1296 |
| 816 | Ga0453684_0577897 | 3300044712 | Bacteria | 1234 |
| 817 | Ga0453684_0637847 | 3300044712 | Bacteria | 1164 |
| 818 | Ga0453684_0811243 | 3300044712 | Bacteria | 1008 |
| 819 | Ga0453684_1058534 | 3300044712 | Bacteria | 859 |
| 820 | Ga0453684_1398372 | 3300044712 | Bacteria | 726 |
| 821 | Ga0453684_1490826 | 3300044712 | Bacteria | 698 |
| 822 | Ga0453684_1491245 | 3300044712 | Bacteria | 698 |
| 823 | Ga0466959_0124272 | 3300045049 | Bacteria | 1832 |
| 824 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 825 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 826 | Ga0451576_0000204 | 3300045051 | Bacteria | 149459 |
| 827 | Ga0451576_0000783 | 3300045051 | Bacteria | 62485 |
| 828 | Ga0451576_0003652 | 3300045051 | Bacteria | 20883 |
| 829 | Ga0451576_0011102 | 3300045051 | Bacteria | 10274 |
| 830 | Ga0451576_0013908 | 3300045051 | Bacteria | 8986 |
| 831 | Ga0451576_0022652 | 3300045051 | Bacteria | 6807 |
| 832 | Ga0451576_0047948 | 3300045051 | Bacteria | 4490 |
| 833 | Ga0451576_0083654 | 3300045051 | Bacteria | 3319 |
| 834 | Ga0451576_0088919 | 3300045051 | Bacteria | 3212 |
| 835 | Ga0451576_0143234 | 3300045051 | Bacteria | 2492 |
| 836 | Ga0451576_0277421 | 3300045051 | Bacteria | 1753 |
| 837 | Ga0451576_0291923 | 3300045051 | Bacteria | 1705 |
| 838 | Ga0451576_0438926 | 3300045051 | Bacteria | 1370 |
| 839 | Ga0451576_0937455 | 3300045051 | Bacteria | 908 |
| 840 | Ga0451576_0995907 | 3300045051 | Bacteria | 878 |
| 841 | Ga0451576_1846002 | 3300045051 | Bacteria | 624 |
| 842 | Ga0451576_2409690 | 3300045051 | Bacteria | 538 |
| 843 | Ga0466958_0007843 | 3300045836 | Bacteria | 5897 |
| 844 | Ga0495627_000022 | 3300046453 | Bacteria | 254672 |
| 845 | Ga0495627_002474 | 3300046453 | Bacteria | 8853 |
| 846 | Ga0495627_051473 | 3300046453 | Bacteria | 1237 |
| 847 | Ga0495592_0123750 | 3300046454 | Bacteria | 1817 |
| 848 | Ga0495590_0000627 | 3300046457 | Bacteria | 16440 |
| 849 | Ga0495638_0616280 | 3300046460 | Bacteria | 531 |
| 850 | Ga0495651_0082640 | 3300046462 | Bacteria | 2423 |
| 851 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 852 | Ga0495650_0122333 | 3300046471 | Bacteria | 957 |
| 853 | Ga0495662_0053308 | 3300046476 | Bacteria | 1953 |
| 854 | Ga0495585_0000476 | 3300046492 | Bacteria | 38316 |
| 855 | Ga0495585_0001907 | 3300046492 | Bacteria | 15677 |
| 856 | Ga0495585_0079477 | 3300046492 | Bacteria | 1779 |
| 857 | Ga0495607_0068813 | 3300046501 | Bacteria | 1984 |
| 858 | Ga0495607_0109464 | 3300046501 | Bacteria | 1467 |
| 859 | Ga0495583_0045267 | 3300046506 | Bacteria | 2036 |
| 860 | Ga0495606_0003554 | 3300046507 | Bacteria | 16456 |
| 861 | Ga0495606_0011558 | 3300046507 | Bacteria | 7186 |
| 862 | Ga0495606_0042764 | 3300046507 | Bacteria | 3027 |
| 863 | Ga0495606_0131694 | 3300046507 | Bacteria | 1486 |
| 864 | Ga0495606_0157197 | 3300046507 | Bacteria | 1329 |
| 865 | Ga0495606_0284996 | 3300046507 | Bacteria | 901 |
| 866 | Ga0495606_0608547 | 3300046507 | Bacteria | 535 |
| 867 | Ga0495610_0000005 | 3300046512 | Bacteria | 924111 |
| 868 | Ga0495610_0020639 | 3300046512 | Bacteria | 3652 |
| 869 | Ga0495610_0033472 | 3300046512 | Bacteria | 2656 |
| 870 | Ga0495610_0155940 | 3300046512 | Bacteria | 969 |
| 871 | Ga0495610_0402938 | 3300046512 | Bacteria | 504 |
| 872 | Ga0495616_0022430 | 3300046513 | Bacteria | 3410 |
| 873 | Ga0495616_0073426 | 3300046513 | Bacteria | 1650 |
| 874 | Ga0495616_0244907 | 3300046513 | Bacteria | 772 |
| 875 | Ga0495628_1034669 | 3300046516 | Bacteria | 564 |
| 876 | Ga0495631_0002385 | 3300046518 | Bacteria | 10650 |
| 877 | Ga0495631_0061979 | 3300046518 | Bacteria | 1621 |
| 878 | Ga0495632_0004162 | 3300046519 | Bacteria | 9918 |
| 879 | Ga0495632_0110742 | 3300046519 | Bacteria | 1289 |
| 880 | Ga0495632_0520565 | 3300046519 | Bacteria | 512 |
| 881 | Ga0495637_0066720 | 3300046520 | Bacteria | 1462 |
| 882 | Ga0495643_0000294 | 3300046522 | Bacteria | 70329 |
| 883 | Ga0495643_0024720 | 3300046522 | Bacteria | 3405 |
| 884 | Ga0495644_0017124 | 3300046523 | Bacteria | 2772 |
| 885 | Ga0495648_0017616 | 3300046524 | Bacteria | 5097 |
| 886 | Ga0495648_0098997 | 3300046524 | Bacteria | 1614 |
| 887 | Ga0495648_0387851 | 3300046524 | Bacteria | 628 |
| 888 | Ga0495663_0000053 | 3300046525 | Bacteria | 53554 |
| 889 | Ga0495663_0019140 | 3300046525 | Bacteria | 1956 |
| 890 | Ga0495663_0081759 | 3300046525 | Bacteria | 1041 |
| 891 | Ga0495642_0031330 | 3300046528 | Bacteria | 2132 |
| 892 | Ga0495652_0033059 | 3300046529 | Bacteria | 4519 |
| 893 | Ga0495654_0000003 | 3300046530 | Bacteria | 863485 |
| 894 | Ga0495654_0070029 | 3300046530 | Bacteria | 1664 |
| 895 | Ga0495587_0586209 | 3300046536 | Bacteria | 614 |
| 896 | Ga0495609_0000003 | 3300046538 | Bacteria | 711547 |
| 897 | Ga0495609_0004523 | 3300046538 | Bacteria | 7572 |
| 898 | Ga0495609_0006730 | 3300046538 | Bacteria | 5828 |
| 899 | Ga0495609_0014049 | 3300046538 | Bacteria | 3771 |
| 900 | Ga0495597_0206106 | 3300046542 | Bacteria | 786 |
| 901 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 902 | Ga0495633_0003150 | 3300046558 | Bacteria | 11168 |
| 903 | Ga0495633_0016150 | 3300046558 | Bacteria | 3858 |
| 904 | Ga0495633_0020940 | 3300046558 | Bacteria | 3278 |
| 905 | Ga0495633_0501692 | 3300046558 | Bacteria | 547 |
| 906 | Ga0495668_0000165 | 3300046616 | Bacteria | 98016 |
| 907 | Ga0495668_0069683 | 3300046616 | Bacteria | 1934 |
| 908 | Ga0495634_0138088 | 3300046642 | Bacteria | 1549 |
| 909 | Ga0495634_0610215 | 3300046642 | Bacteria | 633 |
| 910 | Ga0495611_0042182 | 3300046648 | Bacteria | 2037 |
| 911 | Ga0495625_0000096 | 3300046660 | Bacteria | 142609 |
| 912 | Ga0495625_0000308 | 3300046660 | Bacteria | 74661 |
| 913 | Ga0495625_0001933 | 3300046660 | Bacteria | 23424 |
| 914 | Ga0495625_0106019 | 3300046660 | Bacteria | 1925 |
| 915 | Ga0495625_0171535 | 3300046660 | Bacteria | 1448 |
| 916 | Ga0495625_0217728 | 3300046660 | Bacteria | 1252 |
| 917 | Ga0495625_0225335 | 3300046660 | Bacteria | 1226 |
| 918 | Ga0495625_0465596 | 3300046660 | Bacteria | 778 |
| 919 | Ga0495661_0103742 | 3300046665 | Bacteria | 1595 |
| 920 | Ga0495661_0133006 | 3300046665 | Bacteria | 1361 |
| 921 | Ga0495588_0076305 | 3300046674 | Bacteria | 1747 |
| 922 | Ga0495658_0058588 | 3300046683 | Bacteria | 2203 |
| 923 | Ga0495658_0333467 | 3300046683 | Bacteria | 963 |
| 924 | Ga0495669_0043303 | 3300046684 | Bacteria | 2004 |
| 925 | Ga0495613_0400814 | 3300046689 | Bacteria | 936 |
| 926 | Ga0495670_0127741 | 3300046691 | Bacteria | 1324 |
| 927 | Ga0495671_0036148 | 3300046692 | Bacteria | 2504 |
| 928 | Ga0495671_0476054 | 3300046692 | Bacteria | 596 |
| 929 | Ga0495649_0000105 | 3300046694 | Bacteria | 74750 |
| 930 | Ga0495649_0066186 | 3300046694 | Bacteria | 1939 |
| 931 | Ga0495589_0317863 | 3300046794 | Bacteria | 720 |
| 932 | Ga0495600_0108075 | 3300046809 | Bacteria | 1812 |
| 933 | Ga0495660_0216941 | 3300046810 | Bacteria | 904 |
| 934 | Ga0495660_0256013 | 3300046810 | Bacteria | 810 |
| 935 | Ga0495604_0590296 | 3300047317 | Bacteria | 713 |
| 936 | Ga0495680_1103152 | 3300047322 | Bacteria | 501 |
| 937 | Ga0495687_000233 | 3300047443 | Bacteria | 77056 |
| 938 | Ga0495687_098283 | 3300047443 | Bacteria | 1104 |
| 939 | Ga0495685_050912 | 3300047447 | Bacteria | 1405 |
| 940 | Ga0495673_0025163 | 3300047469 | Bacteria | 2862 |
| 941 | Ga0495681_0032669 | 3300047470 | Bacteria | 2617 |
| 942 | Ga0495686_0000133 | 3300047472 | Bacteria | 151597 |
| 943 | Ga0495686_0002422 | 3300047472 | Bacteria | 17639 |
| 944 | Ga0495686_0010199 | 3300047472 | Bacteria | 6696 |
| 945 | Ga0495686_0244332 | 3300047472 | Bacteria | 1011 |
| 946 | Ga0495686_0390316 | 3300047472 | Bacteria | 749 |
| 947 | Ga0495686_0417035 | 3300047472 | Bacteria | 718 |
| 948 | Ga0495593_0572900 | 3300047673 | Bacteria | 567 |
| 949 | Ga0495614_0023016 | 3300048089 | Bacteria | 2687 |
| 950 | Ga0496100_0514498 | 3300048903 | Bacteria | 923 |
| 951 | Ga0496102_0094764 | 3300048905 | Bacteria | 2766 |
| 952 | Ga0496103_0207758 | 3300048906 | Bacteria | 1259 |
| 953 | Ga0496104_0513882 | 3300048907 | Bacteria | 1109 |
| 954 | Ga0496110_0286115 | 3300048913 | Bacteria | 1501 |
| 955 | Ga0496113_0105034 | 3300048916 | Bacteria | 2193 |
| 956 | Ga0496114_0091395 | 3300048917 | Bacteria | 2585 |
| 957 | Ga0496115_0022950 | 3300048918 | Bacteria | 4839 |
| 958 | Ga0496115_0738107 | 3300048918 | Bacteria | 771 |
| 959 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 960 | Ga0496116_0000029 | 3300048919 | Bacteria | 422187 |
| 961 | Ga0496116_0005535 | 3300048919 | Bacteria | 11653 |
| 962 | Ga0496117_0000007 | 3300048920 | Bacteria | 720505 |
| 963 | Ga0496117_0001863 | 3300048920 | Bacteria | 28457 |
| 964 | Ga0496117_0170046 | 3300048920 | Bacteria | 1266 |
| 965 | Ga0496118_0022242 | 3300048921 | Bacteria | 5551 |
| 966 | Ga0496118_0025644 | 3300048921 | Bacteria | 5047 |
| 967 | Ga0496119_0000007 | 3300048922 | Bacteria | 475920 |
| 968 | Ga0496119_0261209 | 3300048922 | Bacteria | 869 |
| 969 | Ga0496121_0183138 | 3300048924 | Bacteria | 1509 |
| 970 | Ga0496121_0473852 | 3300048924 | Bacteria | 801 |
| 971 | Ga0496122_0000862 | 3300048925 | Bacteria | 57049 |
| 972 | Ga0496122_0006922 | 3300048925 | Bacteria | 12808 |
| 973 | Ga0496122_0025542 | 3300048925 | Bacteria | 5126 |
| 974 | Ga0496123_0013292 | 3300048926 | Bacteria | 6932 |
| 975 | Ga0496123_0015001 | 3300048926 | Bacteria | 6383 |
| 976 | Ga0496123_0058126 | 3300048926 | Bacteria | 2511 |
| 977 | Ga0496123_0211468 | 3300048926 | Bacteria | 985 |
| 978 | Ga0496124_0013719 | 3300048927 | Bacteria | 7890 |
| 979 | Ga0496124_0039503 | 3300048927 | Bacteria | 4091 |
| 980 | Ga0496124_0438807 | 3300048927 | Bacteria | 894 |
| 981 | Ga0496124_0894352 | 3300048927 | Bacteria | 539 |
| 982 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 983 | Ga0496125_0000031 | 3300048928 | Bacteria | 365156 |
| 984 | Ga0496125_0048493 | 3300048928 | Bacteria | 3541 |
| 985 | Ga0496125_0056896 | 3300048928 | Bacteria | 3172 |
| 986 | Ga0496125_0179552 | 3300048928 | Bacteria | 1412 |
| 987 | Ga0496125_0758204 | 3300048928 | Bacteria | 507 |
| 988 | Ga0496126_0002974 | 3300048929 | Bacteria | 21999 |
| 989 | Ga0496126_0645820 | 3300048929 | Bacteria | 828 |
| 990 | Ga0501306_002387 | 3300049127 | Bacteria | 1919 |
| 991 | Ga0501306_029242 | 3300049127 | Bacteria | 811 |
| 992 | Ga0501306_088956 | 3300049127 | Bacteria | 541 |
| 993 | Ga0501309_079192 | 3300049129 | Bacteria | 549 |
| 994 | Ga0501310_000149 | 3300049130 | Bacteria | 6887 |
| 995 | Ga0501310_006583 | 3300049130 | Bacteria | 1222 |
| 996 | Ga0501310_033025 | 3300049130 | Bacteria | 694 |
| 997 | Ga0501310_044778 | 3300049130 | Bacteria | 626 |
| 998 | Ga0501310_048367 | 3300049130 | Bacteria | 609 |
| 999 | Ga0501343_016908 | 3300049132 | Bacteria | 628 |
| 1000 | Ga0501305_006266 | 3300049161 | Bacteria | 1471 |
| 1001 | Ga0501305_013964 | 3300049161 | Bacteria | 1118 |
| 1002 | Ga0501307_001686 | 3300049162 | Bacteria | 1924 |
| 1003 | Ga0501307_003414 | 3300049162 | Bacteria | 1556 |
| 1004 | Ga0501307_005780 | 3300049162 | Bacteria | 1315 |
| 1005 | Ga0501307_022615 | 3300049162 | Bacteria | 828 |
| 1006 | Ga0495678_012530 | 3300049459 | Bacteria | 4016 |
| 1007 | Ga0495682_0007766 | 3300049460 | Bacteria | 4250 |
| 1008 | Ga0501311_000988 | 3300049527 | Bacteria | 2306 |
| 1009 | Ga0501311_013259 | 3300049527 | Bacteria | 1038 |
| 1010 | Ga0501312_002704 | 3300049528 | Bacteria | 1938 |
| 1011 | Ga0501312_007913 | 3300049528 | Bacteria | 1367 |
| 1012 | Ga0501313_037565 | 3300049529 | Bacteria | 644 |
| 1013 | Ga0501314_000001 | 3300049530 | Bacteria | 13837 |
| 1014 | Ga0501315_004584 | 3300049531 | Bacteria | 1454 |
| 1015 | Ga0501315_009200 | 3300049531 | Bacteria | 1164 |
| 1016 | Ga0501315_020543 | 3300049531 | Bacteria | 887 |
| 1017 | Ga0501315_089576 | 3300049531 | Bacteria | 532 |
| 1018 | Ga0501316_001608 | 3300049532 | Bacteria | 1957 |
| 1019 | Ga0501316_001710 | 3300049532 | Bacteria | 1925 |
| 1020 | Ga0501316_027774 | 3300049532 | Bacteria | 745 |
| 1021 | Ga0501316_042567 | 3300049532 | Bacteria | 637 |
| 1022 | Ga0501317_005939 | 3300049533 | Bacteria | 1326 |
| 1023 | Ga0501317_036702 | 3300049533 | Bacteria | 733 |
| 1024 | Ga0501319_000002 | 3300049535 | Bacteria | 13675 |
| 1025 | Ga0501319_001107 | 3300049535 | Bacteria | 1493 |
| 1026 | Ga0501320_000034 | 3300049536 | Bacteria | 6599 |
| 1027 | Ga0501320_000628 | 3300049536 | Bacteria | 2173 |
| 1028 | Ga0501320_004699 | 3300049536 | Bacteria | 1215 |
| 1029 | Ga0501320_013307 | 3300049536 | Bacteria | 877 |
| 1030 | Ga0501320_050179 | 3300049536 | Bacteria | 567 |
| 1031 | Ga0501321_000590 | 3300049537 | Bacteria | 2423 |
| 1032 | Ga0501321_003707 | 3300049537 | Bacteria | 1418 |
| 1033 | Ga0501321_008543 | 3300049537 | Bacteria | 1089 |
| 1034 | Ga0501321_066804 | 3300049537 | Bacteria | 553 |
| 1035 | Ga0501322_000883 | 3300049538 | Bacteria | 1552 |
| 1036 | Ga0501323_000002 | 3300049539 | Bacteria | 14311 |
| 1037 | Ga0501323_001313 | 3300049539 | Bacteria | 2167 |
| 1038 | Ga0501323_015373 | 3300049539 | Bacteria | 966 |
| 1039 | Ga0501323_020427 | 3300049539 | Bacteria | 869 |
| 1040 | Ga0501323_026262 | 3300049539 | Bacteria | 797 |
| 1041 | Ga0501324_000002 | 3300049540 | Bacteria | 14212 |
| 1042 | Ga0501324_010331 | 3300049540 | Bacteria | 849 |
| 1043 | Ga0501324_014502 | 3300049540 | Bacteria | 756 |
| 1044 | Ga0501324_038845 | 3300049540 | Bacteria | 539 |
| 1045 | Ga0501325_000056 | 3300049541 | Bacteria | 3420 |
| 1046 | Ga0501325_013523 | 3300049541 | Bacteria | 783 |
| 1047 | Ga0501326_00020 | 3300049542 | Bacteria | 5374 |
| 1048 | Ga0501326_09971 | 3300049542 | Bacteria | 566 |
| 1049 | Ga0501327_01292 | 3300049543 | Bacteria | 1180 |
| 1050 | Ga0501328_00037 | 3300049544 | Bacteria | 2833 |
| 1051 | Ga0501328_11067 | 3300049544 | Bacteria | 516 |
| 1052 | Ga0501329_01391 | 3300049545 | Bacteria | 1051 |
| 1053 | Ga0501329_13237 | 3300049545 | Bacteria | 542 |
| 1054 | Ga0501330_001422 | 3300049546 | Bacteria | 1236 |
| 1055 | Ga0501330_001661 | 3300049546 | Bacteria | 1186 |
| 1056 | Ga0501330_006234 | 3300049546 | Bacteria | 777 |
| 1057 | Ga0501331_00092 | 3300049547 | Bacteria | 2734 |
| 1058 | Ga0501333_009569 | 3300049549 | Bacteria | 682 |
| 1059 | Ga0501334_01349 | 3300049550 | Bacteria | 1342 |
| 1060 | Ga0501334_03288 | 3300049550 | Bacteria | 997 |
| 1061 | Ga0501335_000742 | 3300049551 | Bacteria | 2246 |
| 1062 | Ga0501335_001452 | 3300049551 | Bacteria | 1822 |
| 1063 | Ga0501335_008567 | 3300049551 | Bacteria | 963 |
| 1064 | Ga0501335_014867 | 3300049551 | Bacteria | 790 |
| 1065 | Ga0501335_020269 | 3300049551 | Bacteria | 707 |
| 1066 | Ga0501335_035351 | 3300049551 | Bacteria | 576 |
| 1067 | Ga0501336_009708 | 3300049552 | Bacteria | 762 |
| 1068 | Ga0501336_009945 | 3300049552 | Bacteria | 756 |
| 1069 | Ga0501337_000031 | 3300049553 | Bacteria | 5086 |
| 1070 | Ga0501337_001289 | 3300049553 | Bacteria | 1414 |
| 1071 | Ga0501337_003436 | 3300049553 | Bacteria | 1006 |
| 1072 | Ga0501338_00373 | 3300049554 | Bacteria | 1952 |
| 1073 | Ga0501340_001429 | 3300049556 | Bacteria | 1289 |
| 1074 | Ga0501340_006416 | 3300049556 | Bacteria | 790 |
| 1075 | Ga0501031_0026756 | 3300049568 | Bacteria | 3760 |
| 1076 | Ga0501032_0007271 | 3300049569 | Bacteria | 8100 |
| 1077 | Ga0501032_0048968 | 3300049569 | Bacteria | 2852 |
| 1078 | Ga0501032_0396137 | 3300049569 | Bacteria | 887 |
| 1079 | Ga0501033_0000011 | 3300049570 | Bacteria | 259130 |
| 1080 | Ga0501033_0131892 | 3300049570 | Bacteria | 1810 |
| 1081 | Ga0501034_0001265 | 3300049571 | Bacteria | 34324 |
| 1082 | Ga0501034_0390568 | 3300049571 | Bacteria | 1315 |
| 1083 | Ga0501036_0019659 | 3300049572 | Bacteria | 5670 |
| 1084 | Ga0501036_0166298 | 3300049572 | Bacteria | 1859 |
| 1085 | Ga0501037_0013217 | 3300049573 | Bacteria | 6084 |
| 1086 | Ga0501038_0002395 | 3300049574 | Bacteria | 17463 |
| 1087 | Ga0501038_0075723 | 3300049574 | Bacteria | 2844 |
| 1088 | Ga0501039_0023075 | 3300049575 | Bacteria | 4773 |
| 1089 | Ga0501040_0522141 | 3300049576 | Bacteria | 856 |
| 1090 | Ga0501043_0024223 | 3300049579 | Bacteria | 4762 |
| 1091 | Ga0501043_0881339 | 3300049579 | Bacteria | 643 |
| 1092 | Ga0501047_0406992 | 3300049581 | Bacteria | 1193 |
| 1093 | Ga0501048_0268643 | 3300049582 | Bacteria | 1212 |
| 1094 | Ga0501198_001947 | 3300049649 | Bacteria | 2740 |
| 1095 | Ga0501217_014128 | 3300049661 | Bacteria | 1800 |
| 1096 | Ga0501223_025877 | 3300049663 | Bacteria | 1142 |
| 1097 | Ga0501224_004359 | 3300049664 | Bacteria | 2011 |
| 1098 | Ga0501235_139173 | 3300049669 | Bacteria | 620 |
| 1099 | Ga0501238_000015 | 3300049671 | Bacteria | 31964 |
| 1100 | Ga0501238_001674 | 3300049671 | Bacteria | 2579 |
| 1101 | Ga0501249_004157 | 3300049679 | Bacteria | 2931 |
| 1102 | Ga0501249_016566 | 3300049679 | Bacteria | 1584 |
| 1103 | Ga0501249_022408 | 3300049679 | Bacteria | 1382 |
| 1104 | Ga0501251_000697 | 3300049681 | Bacteria | 3019 |
| 1105 | Ga0501252_060643 | 3300049682 | Bacteria | 591 |
| 1106 | Ga0501255_024276 | 3300049684 | Bacteria | 806 |
| 1107 | Ga0501225_0310649 | 3300049705 | Bacteria | 536 |
| 1108 | Ga0501241_000002 | 3300049758 | Bacteria | 194532 |
| 1109 | Ga0501241_001391 | 3300049758 | Bacteria | 4970 |
| 1110 | Ga0501241_003188 | 3300049758 | Bacteria | 3112 |
| 1111 | Ga0501263_016694 | 3300049760 | Bacteria | 958 |
| 1112 | Ga0501266_000002 | 3300049763 | Bacteria | 459947 |
| 1113 | Ga0501269_000004 | 3300049766 | Bacteria | 91854 |
| 1114 | Ga0501269_015808 | 3300049766 | Bacteria | 928 |
| 1115 | Ga0501280_000239 | 3300049776 | Bacteria | 13899 |
| 1116 | Ga0501280_027081 | 3300049776 | Bacteria | 881 |
| 1117 | Ga0501282_022136 | 3300049778 | Bacteria | 701 |
| 1118 | Ga0501035_0004622 | 3300049822 | Bacteria | 13050 |
| 1119 | Ga0501035_0018430 | 3300049822 | Bacteria | 6432 |
| 1120 | Ga0501044_0023913 | 3300049823 | Bacteria | 6493 |
| 1121 | Ga0501045_0000053 | 3300049824 | Bacteria | 51403 |
| 1122 | Ga0501204_002065 | 3300049850 | Bacteria | 2022 |
| 1123 | nmdc:mga0k408_150668_c1 | 3300050493 | Bacteria | 965 |
| 1124 | nmdc:mga0k408_22365_c1 | 3300050493 | Bacteria | 3560 |
| 1125 | nmdc:mga0k408_349_c2 | 3300050493 | Bacteria | 1877 |
| 1126 | nmdc:mga0k408_452852_c1 | 3300050493 | Bacteria | 762 |
| 1127 | nmdc:mga07m45_530437_c1 | 3300050496 | Bacteria | 681 |
| 1128 | nmdc:mga08y16_946750_c1 | 3300050511 | Bacteria | 844 |
| 1129 | Ga0500578_0670910 | 3300053086 | Bacteria | 561 |
| 1130 | Ga0500646_0004786 | 3300053090 | Bacteria | 3426 |
| 1131 | Ga0500646_0064896 | 3300053090 | Bacteria | 1083 |
| 1132 | Ga0500651_0000078 | 3300053093 | Bacteria | 62741 |
| 1133 | Ga0500641_0000168 | 3300053096 | Bacteria | 24462 |
| 1134 | Ga0500641_0005947 | 3300053096 | Bacteria | 4321 |
| 1135 | Ga0500650_0464662 | 3300053098 | Bacteria | 541 |
| 1136 | Ga0500594_0227933 | 3300053118 | Bacteria | 617 |
| 1137 | Ga0500608_000214 | 3300053122 | Bacteria | 23145 |
| 1138 | Ga0500608_087806 | 3300053122 | Bacteria | 1458 |
| 1139 | Ga0500618_000057 | 3300053125 | Bacteria | 98383 |
| 1140 | Ga0500642_0057580 | 3300053130 | Bacteria | 1734 |
| 1141 | Ga0500652_245013 | 3300053131 | Bacteria | 712 |
| 1142 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 1143 | Ga0500559_0077755 | 3300053136 | Bacteria | 1504 |
| 1144 | Ga0500559_0173989 | 3300053136 | Bacteria | 1013 |
| 1145 | Ga0500561_0057890 | 3300053137 | Bacteria | 1077 |
| 1146 | Ga0500564_099097 | 3300053138 | Bacteria | 1290 |
| 1147 | Ga0500568_0122186 | 3300053139 | Bacteria | 970 |
| 1148 | Ga0500573_0377679 | 3300053140 | Bacteria | 679 |
| 1149 | Ga0500579_261869 | 3300053143 | Bacteria | 548 |
| 1150 | Ga0500588_0421235 | 3300053146 | Bacteria | 509 |
| 1151 | Ga0500589_068495 | 3300053147 | Bacteria | 1611 |
| 1152 | Ga0500616_0068519 | 3300053153 | Bacteria | 1817 |
| 1153 | Ga0500624_000412 | 3300053157 | Bacteria | 13199 |
| 1154 | Ga0500634_0195996 | 3300053161 | Bacteria | 892 |
| 1155 | Ga0500584_196186 | 3300053726 | Bacteria | 681 |
| 1156 | Ga0500645_045549 | 3300053730 | Bacteria | 1289 |
| 1157 | Ga0587093_002351 | 3300059478 | Bacteria | 1745 |
| 1158 | Ga0587093_005525 | 3300059478 | Bacteria | 1339 |
| 1159 | Ga0587093_008088 | 3300059478 | Bacteria | 1189 |
| 1160 | Ga0587066_001010 | 3300059490 | Bacteria | 2663 |
| 1161 | Ga0587070_012110 | 3300059491 | Bacteria | 1304 |
| 1162 | Ga0587070_077901 | 3300059491 | Bacteria | 721 |
| 1163 | Ga0587073_0004228 | 3300059492 | Bacteria | 2042 |
| 1164 | Ga0587073_0136105 | 3300059492 | Bacteria | 680 |
| 1165 | Ga0587077_000755 | 3300059493 | Bacteria | 3065 |
| 1166 | Ga0587077_004049 | 3300059493 | Bacteria | 1896 |
| 1167 | Ga0587080_032855 | 3300059503 | Bacteria | 912 |
| 1168 | Ga0587080_052037 | 3300059503 | Bacteria | 776 |
| 1169 | Ga0587083_0007032 | 3300059505 | Bacteria | 1704 |
| 1170 | Ga0587083_0009203 | 3300059505 | Bacteria | 1569 |
| 1171 | Ga0587083_0010186 | 3300059505 | Bacteria | 1518 |
| 1172 | Ga0587083_0067751 | 3300059505 | Bacteria | 821 |
| 1173 | Ga0587086_069553 | 3300059507 | Bacteria | 602 |
| 1174 | Ga0587088_002584 | 3300059508 | Bacteria | 2082 |
| 1175 | Ga0587089_041766 | 3300059509 | Bacteria | 712 |
| 1176 | Ga0587089_100535 | 3300059509 | Bacteria | 524 |
| 1177 | Ga0587090_035231 | 3300059510 | Bacteria | 856 |
| 1178 | Ga0587091_007866 | 3300059511 | Bacteria | 1553 |
| 1179 | Ga0587091_071736 | 3300059511 | Bacteria | 759 |
| 1180 | Ga0587092_004572 | 3300059512 | Bacteria | 1659 |
| 1181 | Ga0587092_005398 | 3300059512 | Bacteria | 1574 |
| 1182 | Ga0587092_034923 | 3300059512 | Bacteria | 850 |
| 1183 | Ga0587094_013211 | 3300059513 | Bacteria | 1113 |
| 1184 | Ga0587094_027056 | 3300059513 | Bacteria | 868 |
| 1185 | Ga0587095_006475 | 3300059514 | Bacteria | 911 |
| 1186 | Ga0587106_000803 | 3300059605 | Bacteria | 2469 |
| 1187 | Ga0587109_069356 | 3300059624 | Bacteria | 759 |
| 1188 | Ga0587117_033747 | 3300059627 | Bacteria | 784 |
| 1189 | Ga0587062_029117 | 3300059639 | Bacteria | 835 |
| 1190 | Ga0587067_011887 | 3300059640 | Bacteria | 1350 |
| 1191 | Ga0587067_026246 | 3300059640 | Bacteria | 1042 |
| 1192 | Ga0587068_030243 | 3300059641 | Bacteria | 935 |
| 1193 | Ga0587068_042434 | 3300059641 | Bacteria | 827 |
| 1194 | Ga0587069_010109 | 3300059642 | Bacteria | 1233 |
| 1195 | Ga0587076_001180 | 3300059645 | Bacteria | 2578 |
| 1196 | Ga0587076_007250 | 3300059645 | Bacteria | 1508 |
| 1197 | Ga0587076_018545 | 3300059645 | Bacteria | 1122 |
| 1198 | Ga0587076_031564 | 3300059645 | Bacteria | 942 |
| 1199 | Ga0587076_067595 | 3300059645 | Bacteria | 735 |
| 1200 | Ga0587079_096182 | 3300059647 | Bacteria | 700 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049671 | Ga0501238_000015 | Ga0501238_000015_679_1056 | 114 |
| 2 | 3300042876 | Ga0451577_0091067 | Ga0451577_0091067_1461_1865 | 117 |
| 3 | 3300044712 | Ga0453684_0637847 | Ga0453684_0637847_661_1065 | 117 |
| 4 | 3300049568 | Ga0501031_0026756 | Ga0501031_0026756_1683_2090 | 118 |
| 5 | 3300049569 | Ga0501032_0007271 | Ga0501032_0007271_3378_3785 | 118 |
| 6 | 3300049569 | Ga0501032_0048968 | Ga0501032_0048968_1729_2136 | 118 |
| 7 | 3300049570 | Ga0501033_0000011 | Ga0501033_0000011_49596_50003 | 118 |
| 8 | 3300049571 | Ga0501034_0001265 | Ga0501034_0001265_4766_5173 | 118 |
| 9 | 3300049572 | Ga0501036_0019659 | Ga0501036_0019659_3310_3717 | 118 |
| 10 | 3300049573 | Ga0501037_0013217 | Ga0501037_0013217_790_1197 | 118 |
| 11 | 3300049574 | Ga0501038_0002395 | Ga0501038_0002395_4161_4568 | 118 |
| 12 | 3300049574 | Ga0501038_0075723 | Ga0501038_0075723_1626_2033 | 118 |
| 13 | 3300049575 | Ga0501039_0023075 | Ga0501039_0023075_1763_2170 | 118 |
| 14 | 3300049579 | Ga0501043_0024223 | Ga0501043_0024223_1107_1514 | 118 |
| 15 | 3300049581 | Ga0501047_0406992 | Ga0501047_0406992_672_1079 | 118 |
| 16 | 3300049582 | Ga0501048_0268643 | Ga0501048_0268643_629_1036 | 118 |
| 17 | 3300049822 | Ga0501035_0004622 | Ga0501035_0004622_6264_6671 | 118 |
| 18 | 3300049823 | Ga0501044_0023913 | Ga0501044_0023913_4760_5167 | 118 |
| 19 | 3300049824 | Ga0501045_0000053 | Ga0501045_0000053_4898_5305 | 118 |
| 20 | 3300005616 | Ga0068852_100268045 | Ga0068852_1002680454 | 119 |
| 21 | 3300026142 | Ga0207698_10137832 | Ga0207698_101378324 | 119 |
| 22 | 3300005367 | Ga0070667_101647679 | Ga0070667_1016476792 | 120 |
| 23 | 3300005617 | Ga0068859_102708143 | Ga0068859_1027081432 | 120 |
| 24 | 3300006931 | Ga0097620_102707874 | Ga0097620_1027078742 | 120 |
| 25 | 3300014326 | Ga0157380_10946651 | Ga0157380_109466512 | 120 |
| 26 | 3300025986 | Ga0207658_10975083 | Ga0207658_109750832 | 120 |
| 27 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_967546_967971 | 120 |
| 28 | 3300049569 | Ga0501032_0396137 | Ga0501032_0396137_161_571 | 120 |
| 29 | 3300042876 | Ga0451577_0360457 | Ga0451577_0360457_546_950 | 121 |
| 30 | 3300028577 | Ga0265318_10048406 | Ga0265318_100484062 | 122 |
| 31 | 3300042876 | Ga0451577_0000690 | Ga0451577_0000690_5011_5421 | 122 |
| 32 | 3300005355 | Ga0070671_101121230 | Ga0070671_1011212301 | 123 |
| 33 | 3300013306 | Ga0163162_11396126 | Ga0163162_113961262 | 123 |
| 34 | 3300014325 | Ga0163163_10980641 | Ga0163163_109806411 | 123 |
| 35 | 3300035172 | Ga0373955_0376856 | Ga0373955_0376856_338_751 | 123 |
| 36 | 3300036401 | Ga0373937_1708080 | Ga0373937_1708080_12_425 | 123 |
| 37 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_263169_263579 | 123 |
| 38 | iso_pu_bacteria | 2513020052 | 2513232387 | 123 |
| 39 | iso_pu_bacteria | 2519899754 | 2520879552 | 123 |
| 40 | iso_pu_bacteria | 2643221600 | 2644009213 | 123 |
| 41 | iso_pu_bacteria | 2643221667 | 2644373950 | 123 |
| 42 | iso_pu_bacteria | 2643221716 | 2644643918 | 123 |
| 43 | iso_pu_bacteria | 2643221725 | 2644681813 | 123 |
| 44 | iso_pu_bacteria | 2738541279 | 2738733048 | 123 |
| 45 | iso_pu_bacteria | 2738541285 | 2738765586 | 123 |
| 46 | iso_pu_bacteria | 2738543007 | 2739214629 | 123 |
| 47 | iso_pu_bacteria | 2739367857 | 2740002856 | 123 |
| 48 | iso_pu_bacteria | 2739367858 | 2740007673 | 123 |
| 49 | iso_pu_bacteria | 2802428842 | 2802655278 | 123 |
| 50 | iso_pu_bacteria | 2816332280 | 2817413529 | 123 |
| 51 | iso_pu_bacteria | 2857613821 | 2857617068 | 123 |
| 52 | iso_pu_bacteria | 2857618242 | 2857619737 | 123 |
| 53 | iso_pu_bacteria | 2881247448 | 2881247594 | 123 |
| 54 | iso_pu_bacteria | 2881359912 | 2881364121 | 123 |
| 55 | iso_pu_bacteria | 2903895155 | 2903898680 | 123 |
| 56 | iso_pu_bacteria | 2904419702 | 2904422380 | 123 |
| 57 | iso_pu_bacteria | 2904555929 | 2904558514 | 123 |
| 58 | iso_pu_bacteria | 2919191525 | 2919194240 | 123 |
| 59 | iso_pu_bacteria | 2919509842 | 2919511845 | 123 |
| 60 | iso_pu_bacteria | 2919683626 | 2919684596 | 123 |
| 61 | iso_pu_bacteria | 2929150217 | 2929150585 | 123 |
| 62 | iso_pu_bacteria | 2958458903 | 2958461982 | 123 |
| 63 | iso_pu_bacteria | 2958512119 | 2958514517 | 123 |
| 64 | iso_pu_bacteria | 2965320100 | 2965321941 | 123 |
| 65 | iso_pu_bacteria | 2977268062 | 2977272057 | 123 |
| 66 | iso_pu_bacteria | 8036736890 | 8036739246 | 123 |
| 67 | iso_pu_bacteria | 8054307821 | 8054311448 | 123 |
| 68 | iso_pu_bacteria | 8055419101 | 8055423564 | 123 |
| 69 | iso_pu_bacteria | 8055592153 | 8055595082 | 123 |
| 70 | iso_pu_bacteria | 8056440228 | 8056443499 | 123 |
| 71 | 3300009098 | Ga0105245_10144700 | Ga0105245_101447002 | 124 |
| 72 | 3300025927 | Ga0207687_10126670 | Ga0207687_101266704 | 124 |
| 73 | 3300025931 | Ga0207644_11375596 | Ga0207644_113755962 | 125 |
| 74 | iso_pu_bacteria | 2511231000 | 2511231097 | 125 |
| 75 | iso_pu_bacteria | 2523533629 | 2524006248 | 125 |
| 76 | iso_pu_bacteria | 2582581278 | 2585143598 | 125 |
| 77 | iso_pu_bacteria | 2582581281 | 2585156561 | 125 |
| 78 | iso_pu_bacteria | 2582581282 | 2585160788 | 125 |
| 79 | iso_pu_bacteria | 2582581873 | 2585427001 | 125 |
| 80 | iso_pu_bacteria | 2585427687 | 2586210041 | 125 |
| 81 | iso_pu_bacteria | 2585428045 | 2587679988 | 125 |
| 82 | iso_pu_bacteria | 2585428060 | 2587748646 | 125 |
| 83 | iso_pu_bacteria | 2585428061 | 2587753444 | 125 |
| 84 | iso_pu_bacteria | 2585428095 | 2587864971 | 125 |
| 85 | iso_pu_bacteria | 2585428115 | 2587945325 | 125 |
| 86 | iso_pu_bacteria | 2585428182 | 2588211504 | 125 |
| 87 | iso_pu_bacteria | 2585428183 | 2588215886 | 125 |
| 88 | iso_pu_bacteria | 2585428184 | 2588219308 | 125 |
| 89 | iso_pu_bacteria | 2585428185 | 2588224786 | 125 |
| 90 | iso_pu_bacteria | 2585428187 | 2588234621 | 125 |
| 91 | iso_pu_bacteria | 2588253712 | 2588447581 | 125 |
| 92 | iso_pu_bacteria | 2588254255 | 2590603208 | 125 |
| 93 | iso_pu_bacteria | 2588254257 | 2590610229 | 125 |
| 94 | iso_pu_bacteria | 2599185184 | 2599479370 | 125 |
| 95 | iso_pu_bacteria | 2721755487 | 2722726189 | 125 |
| 96 | iso_pu_bacteria | 2728369107 | 2729200742 | 125 |
| 97 | iso_pu_bacteria | 2738541273 | 2738698364 | 125 |
| 98 | iso_pu_bacteria | 2738541283 | 2738755664 | 125 |
| 99 | iso_pu_bacteria | 2738541284 | 2738762119 | 125 |
| 100 | iso_pu_bacteria | 2738541302 | 2738854414 | 125 |
| 101 | iso_pu_bacteria | 2738543014 | 2739252690 | 125 |
| 102 | iso_pu_bacteria | 2738543023 | 2739301901 | 125 |
| 103 | iso_pu_bacteria | 2739367651 | 2739587966 | 125 |
| 104 | iso_pu_bacteria | 2739367656 | 2739614383 | 125 |
| 105 | iso_pu_bacteria | 2739367663 | 2739646685 | 125 |
| 106 | iso_pu_bacteria | 2739367874 | 2740060442 | 125 |
| 107 | iso_pu_bacteria | 2751185877 | 2753674221 | 125 |
| 108 | iso_pu_bacteria | 2765235839 | 2765575692 | 125 |
| 109 | iso_pu_bacteria | 2772190705 | 2772605797 | 125 |
| 110 | iso_pu_bacteria | 2775506739 | 2775674325 | 125 |
| 111 | iso_pu_bacteria | 2775506987 | 2776615255 | 125 |
| 112 | iso_pu_bacteria | 2816332188 | 2816875539 | 125 |
| 113 | iso_pu_bacteria | 2818991437 | 2819545841 | 125 |
| 114 | iso_pu_bacteria | 2842083920 | 2842086269 | 125 |
| 115 | iso_pu_bacteria | 2842722452 | 2842724266 | 125 |
| 116 | iso_pu_bacteria | 2842903701 | 2842908283 | 125 |
| 117 | iso_pu_bacteria | 2842909656 | 2842913600 | 125 |
| 118 | iso_pu_bacteria | 2849281842 | 2849282587 | 125 |
| 119 | iso_pu_bacteria | 2852623160 | 2852625381 | 125 |
| 120 | iso_pu_bacteria | 2852627209 | 2852629125 | 125 |
| 121 | iso_pu_bacteria | 2857627736 | 2857631664 | 125 |
| 122 | iso_pu_bacteria | 2871720351 | 2871723618 | 125 |
| 123 | iso_pu_bacteria | 2884933994 | 2884934392 | 125 |
| 124 | iso_pu_bacteria | 2887375801 | 2887379696 | 125 |
| 125 | iso_pu_bacteria | 2889290771 | 2889293804 | 125 |
| 126 | iso_pu_bacteria | 2890737413 | 2890740650 | 125 |
| 127 | iso_pu_bacteria | 2896317667 | 2896320825 | 125 |
| 128 | iso_pu_bacteria | 2902048731 | 2902051176 | 125 |
| 129 | iso_pu_bacteria | 2904445276 | 2904449081 | 125 |
| 130 | iso_pu_bacteria | 2904780799 | 2904782800 | 125 |
| 131 | iso_pu_bacteria | 2905999023 | 2906001161 | 125 |
| 132 | iso_pu_bacteria | 2906799679 | 2906800153 | 125 |
| 133 | iso_pu_bacteria | 2919097161 | 2919097940 | 125 |
| 134 | iso_pu_bacteria | 2919177583 | 2919180411 | 125 |
| 135 | iso_pu_bacteria | 2919186247 | 2919189083 | 125 |
| 136 | iso_pu_bacteria | 2919399522 | 2919403179 | 125 |
| 137 | iso_pu_bacteria | 2919437846 | 2919438030 | 125 |
| 138 | iso_pu_bacteria | 2928078545 | 2928082321 | 125 |
| 139 | iso_pu_bacteria | 2928147474 | 2928149100 | 125 |
| 140 | iso_pu_bacteria | 2932082852 | 2932085033 | 125 |
| 141 | iso_pu_bacteria | 2939664404 | 2939666762 | 125 |
| 142 | iso_pu_bacteria | 2945924605 | 2945924786 | 125 |
| 143 | iso_pu_bacteria | 2945997725 | 2945998911 | 125 |
| 144 | iso_pu_bacteria | 2946019816 | 2946024099 | 125 |
| 145 | iso_pu_bacteria | 2954016120 | 2954021354 | 125 |
| 146 | iso_pu_bacteria | 2977232053 | 2977235866 | 125 |
| 147 | iso_pu_bacteria | 2977243572 | 2977247739 | 125 |
| 148 | iso_pu_bacteria | 2984572630 | 2984574464 | 125 |
| 149 | iso_pu_bacteria | 2984606641 | 2984607913 | 125 |
| 150 | iso_pu_bacteria | 2993372514 | 2993375088 | 125 |
| 151 | iso_pu_bacteria | 2993480792 | 2993481951 | 125 |
| 152 | iso_pu_bacteria | 3003233435 | 3003234779 | 125 |
| 153 | iso_pu_bacteria | 8055588893 | 8055591273 | 125 |
| 154 | 2162886007 | SwRhRL2b_contig_1853401 | SwRhRL2b_0345.00003120 | 126 |
| 155 | 3300003300 | Ga0006758J48902_1029451 | Ga0006758J48902_10294512 | 126 |
| 156 | 3300005289 | Ga0065704_10004597 | Ga0065704_100045972 | 126 |
| 157 | 3300005341 | Ga0070691_10252658 | Ga0070691_102526582 | 126 |
| 158 | 3300028794 | Ga0307515_10302211 | Ga0307515_103022112 | 126 |
| 159 | 3300031548 | Ga0307408_100003845 | Ga0307408_1000038452 | 126 |
| 160 | 3300032005 | Ga0307411_10001861 | Ga0307411_100018613 | 126 |
| 161 | 3300033541 | Ga0316596_1000052 | Ga0316596_100005224 | 126 |
| 162 | 3300035398 | Ga0316574_0047218 | Ga0316574_0047218_1705_2094 | 126 |
| 163 | 3300036712 | Ga0316584_0277900 | Ga0316584_0277900_732_1121 | 126 |
| 164 | 3300042876 | Ga0451577_0300325 | Ga0451577_0300325_49_432 | 126 |
| 165 | 3300044712 | Ga0453684_0009769 | Ga0453684_0009769_10036_10419 | 126 |
| 166 | 3300048913 | Ga0496110_0286115 | Ga0496110_0286115_581_967 | 126 |
| 167 | 3300049130 | Ga0501310_033025 | Ga0501310_033025_204_590 | 126 |
| 168 | 3300049162 | Ga0501307_001686 | Ga0501307_001686_100_486 | 126 |
| 169 | 3300049162 | Ga0501307_022615 | Ga0501307_022615_162_551 | 126 |
| 170 | 3300049527 | Ga0501311_000988 | Ga0501311_000988_1108_1494 | 126 |
| 171 | 3300049528 | Ga0501312_002704 | Ga0501312_002704_1455_1841 | 126 |
| 172 | 3300049529 | Ga0501313_037565 | Ga0501313_037565_103_492 | 126 |
| 173 | 3300049532 | Ga0501316_001710 | Ga0501316_001710_242_631 | 126 |
| 174 | 3300049536 | Ga0501320_000628 | Ga0501320_000628_666_1052 | 126 |
| 175 | 3300049539 | Ga0501323_001313 | Ga0501323_001313_1188_1574 | 126 |
| 176 | 3300049540 | Ga0501324_010331 | Ga0501324_010331_223_612 | 126 |
| 177 | 3300049540 | Ga0501324_038845 | Ga0501324_038845_49_435 | 126 |
| 178 | 3300049542 | Ga0501326_09971 | Ga0501326_09971_81_467 | 126 |
| 179 | 3300049550 | Ga0501334_03288 | Ga0501334_03288_174_560 | 126 |
| 180 | 3300049649 | Ga0501198_001947 | Ga0501198_001947_1619_2005 | 126 |
| 181 | 3300049663 | Ga0501223_025877 | Ga0501223_025877_531_917 | 126 |
| 182 | 3300049679 | Ga0501249_016566 | Ga0501249_016566_608_997 | 126 |
| 183 | 3300049705 | Ga0501225_0310649 | Ga0501225_0310649_106_495 | 126 |
| 184 | 3300049758 | Ga0501241_001391 | Ga0501241_001391_1635_2024 | 126 |
| 185 | 3300049850 | Ga0501204_002065 | Ga0501204_002065_1035_1421 | 126 |
| 186 | iso_pu_bacteria | 2833640130 | 2833640602 | 126 |
| 187 | 2162886007 | SwRhRL2b_contig_2489919 | SwRhRL2b_0572.00005130 | 127 |
| 188 | 2162886011 | MRS1b_contig_1810326 | MRS1b_0199.00000980 | 127 |
| 189 | 2209111006 | 2214800779 | 2213830272 | 127 |
| 190 | 3300003575 | Ga0007409J51694_1063312 | Ga0007409J51694_10633122 | 127 |
| 191 | 3300003578 | Ga0006562J51391_1003423 | Ga0006562J51391_100342324 | 127 |
| 192 | 3300004801 | Ga0058860_10114316 | Ga0058860_101143164 | 127 |
| 193 | 3300005276 | Ga0065717_1001968 | Ga0065717_10019685 | 127 |
| 194 | 3300005277 | Ga0065716_1002480 | Ga0065716_10024801 | 127 |
| 195 | 3300005288 | Ga0065714_10045584 | Ga0065714_100455842 | 127 |
| 196 | 3300005288 | Ga0065714_10047236 | Ga0065714_100472362 | 127 |
| 197 | 3300005288 | Ga0065714_10163029 | Ga0065714_101630292 | 127 |
| 198 | 3300005288 | Ga0065714_10250665 | Ga0065714_102506652 | 127 |
| 199 | 3300005289 | Ga0065704_10082398 | Ga0065704_100823981 | 127 |
| 200 | 3300005289 | Ga0065704_10096211 | Ga0065704_100962114 | 127 |
| 201 | 3300005289 | Ga0065704_10102101 | Ga0065704_101021014 | 127 |
| 202 | 3300005293 | Ga0065715_10036832 | Ga0065715_100368323 | 127 |
| 203 | 3300005293 | Ga0065715_10521621 | Ga0065715_105216211 | 127 |
| 204 | 3300005293 | Ga0065715_10569858 | Ga0065715_105698582 | 127 |
| 205 | 3300005331 | Ga0070670_100135400 | Ga0070670_1001354002 | 127 |
| 206 | 3300005456 | Ga0070678_100234064 | Ga0070678_1002340643 | 127 |
| 207 | 3300005459 | Ga0068867_100970210 | Ga0068867_1009702101 | 127 |
| 208 | 3300005507 | Ga0074259_10883899 | Ga0074259_108838991 | 127 |
| 209 | 3300005547 | Ga0070693_101517646 | Ga0070693_1015176461 | 127 |
| 210 | 3300005616 | Ga0068852_100411938 | Ga0068852_1004119382 | 127 |
| 211 | 3300005841 | Ga0068863_100897056 | Ga0068863_1008970562 | 127 |
| 212 | 3300006173 | Ga0070716_100062251 | Ga0070716_1000622513 | 127 |
| 213 | 3300006177 | Ga0075362_10012264 | Ga0075362_100122644 | 127 |
| 214 | 3300006237 | Ga0097621_100200943 | Ga0097621_1002009431 | 127 |
| 215 | 3300006358 | Ga0068871_100350639 | Ga0068871_1003506391 | 127 |
| 216 | 3300006942 | Ga0099824_1003374 | Ga0099824_100337419 | 127 |
| 217 | 3300006946 | Ga0079104_1000280 | Ga0079104_100028028 | 127 |
| 218 | 3300006948 | Ga0099826_10000125 | Ga0099826_100001259 | 127 |
| 219 | 3300009011 | Ga0105251_10038077 | Ga0105251_100380773 | 127 |
| 220 | 3300009036 | Ga0105244_10000027 | Ga0105244_10000027184 | 127 |
| 221 | 3300009176 | Ga0105242_10053982 | Ga0105242_100539822 | 127 |
| 222 | 3300009553 | Ga0105249_10192006 | Ga0105249_101920062 | 127 |
| 223 | 3300012512 | Ga0157327_1007676 | Ga0157327_10076762 | 127 |
| 224 | 3300013100 | Ga0157373_10001369 | Ga0157373_100013698 | 127 |
| 225 | 3300013100 | Ga0157373_11166423 | Ga0157373_111664232 | 127 |
| 226 | 3300013102 | Ga0157371_10001678 | Ga0157371_1000167828 | 127 |
| 227 | 3300013104 | Ga0157370_10073063 | Ga0157370_100730632 | 127 |
| 228 | 3300013104 | Ga0157370_10106885 | Ga0157370_101068853 | 127 |
| 229 | 3300013104 | Ga0157370_10553788 | Ga0157370_105537881 | 127 |
| 230 | 3300013105 | Ga0157369_10000613 | Ga0157369_1000061316 | 127 |
| 231 | 3300013296 | Ga0157374_10104516 | Ga0157374_101045163 | 127 |
| 232 | 3300013297 | Ga0157378_10378236 | Ga0157378_103782364 | 127 |
| 233 | 3300013306 | Ga0163162_10068714 | Ga0163162_100687145 | 127 |
| 234 | 3300013308 | Ga0157375_11032639 | Ga0157375_110326391 | 127 |
| 235 | 3300014969 | Ga0157376_10271219 | Ga0157376_102712192 | 127 |
| 236 | 3300015261 | Ga0182006_1009290 | Ga0182006_10092904 | 127 |
| 237 | 3300015261 | Ga0182006_1062134 | Ga0182006_10621342 | 127 |
| 238 | 3300017792 | Ga0163161_10000039 | Ga0163161_1000003928 | 127 |
| 239 | 3300017792 | Ga0163161_10009312 | Ga0163161_100093128 | 127 |
| 240 | 3300017792 | Ga0163161_10054256 | Ga0163161_100542565 | 127 |
| 241 | 3300017792 | Ga0163161_10317631 | Ga0163161_103176312 | 127 |
| 242 | 3300020070 | Ga0206356_11535795 | Ga0206356_115357952 | 127 |
| 243 | 3300020077 | Ga0206351_10991482 | Ga0206351_109914824 | 127 |
| 244 | 3300025728 | Ga0207655_1000038 | Ga0207655_1000038185 | 127 |
| 245 | 3300025735 | Ga0207713_1057298 | Ga0207713_10572982 | 127 |
| 246 | 3300025925 | Ga0207650_10136672 | Ga0207650_101366723 | 127 |
| 247 | 3300025934 | Ga0207686_10059526 | Ga0207686_100595263 | 127 |
| 248 | 3300025939 | Ga0207665_10034201 | Ga0207665_100342014 | 127 |
| 249 | 3300025940 | Ga0207691_10186142 | Ga0207691_101861422 | 127 |
| 250 | 3300025981 | Ga0207640_10666795 | Ga0207640_106667952 | 127 |
| 251 | 3300025986 | Ga0207658_10494531 | Ga0207658_104945311 | 127 |
| 252 | 3300026041 | Ga0207639_10380458 | Ga0207639_103804583 | 127 |
| 253 | 3300026089 | Ga0207648_11039269 | Ga0207648_110392692 | 127 |
| 254 | 3300026095 | Ga0207676_11854756 | Ga0207676_118547561 | 127 |
| 255 | 3300026116 | Ga0207674_11110581 | Ga0207674_111105812 | 127 |
| 256 | 3300026121 | Ga0207683_10918146 | Ga0207683_109181462 | 127 |
| 257 | 3300026142 | Ga0207698_10485173 | Ga0207698_104851732 | 127 |
| 258 | 3300027111 | Ga0209281_1000337 | Ga0209281_100033739 | 127 |
| 259 | 3300027361 | Ga0209489_111364 | Ga0209489_1113642 | 127 |
| 260 | 3300027471 | Ga0209995_1079267 | Ga0209995_10792672 | 127 |
| 261 | 3300027526 | Ga0209968_1001995 | Ga0209968_10019951 | 127 |
| 262 | 3300027526 | Ga0209968_1042388 | Ga0209968_10423882 | 127 |
| 263 | 3300027543 | Ga0209999_1008578 | Ga0209999_10085783 | 127 |
| 264 | 3300027617 | Ga0210002_1004025 | Ga0210002_10040253 | 127 |
| 265 | 3300027666 | Ga0209282_1014100 | Ga0209282_10141004 | 127 |
| 266 | 3300028786 | Ga0307517_10233819 | Ga0307517_102338192 | 127 |
| 267 | 3300030744 | Ga0316181_1007760 | Ga0316181_10077603 | 127 |
| 268 | 3300031548 | Ga0307408_100015317 | Ga0307408_1000153174 | 127 |
| 269 | 3300031727 | Ga0316576_10044468 | Ga0316576_100444682 | 127 |
| 270 | 3300031731 | Ga0307405_10000005 | Ga0307405_10000005205 | 127 |
| 271 | 3300031824 | Ga0307413_10001014 | Ga0307413_1000101415 | 127 |
| 272 | 3300031824 | Ga0307413_10001307 | Ga0307413_100013072 | 127 |
| 273 | 3300031852 | Ga0307410_10000034 | Ga0307410_1000003413 | 127 |
| 274 | 3300031901 | Ga0307406_10000004 | Ga0307406_10000004131 | 127 |
| 275 | 3300031903 | Ga0307407_10000196 | Ga0307407_100001965 | 127 |
| 276 | 3300031911 | Ga0307412_10014189 | Ga0307412_100141895 | 127 |
| 277 | 3300032004 | Ga0307414_10000011 | Ga0307414_10000011326 | 127 |
| 278 | 3300032004 | Ga0307414_10000527 | Ga0307414_1000052710 | 127 |
| 279 | 3300032004 | Ga0307414_10000673 | Ga0307414_1000067315 | 127 |
| 280 | 3300032004 | Ga0307414_10043096 | Ga0307414_100430966 | 127 |
| 281 | 3300032004 | Ga0307414_10125747 | Ga0307414_101257474 | 127 |
| 282 | 3300032004 | Ga0307414_10198743 | Ga0307414_101987432 | 127 |
| 283 | 3300032005 | Ga0307411_10000004 | Ga0307411_1000000423 | 127 |
| 284 | 3300032168 | Ga0316593_10157582 | Ga0316593_101575822 | 127 |
| 285 | 3300033180 | Ga0307510_10030428 | Ga0307510_100304282 | 127 |
| 286 | 3300035398 | Ga0316574_0056124 | Ga0316574_0056124_1102_1485 | 127 |
| 287 | 3300035398 | Ga0316574_0165017 | Ga0316574_0165017_271_654 | 127 |
| 288 | 3300036712 | Ga0316584_0285033 | Ga0316584_0285033_276_668 | 127 |
| 289 | 3300041407 | Ga0439447_002479 | Ga0439447_002479_3656_4039 | 127 |
| 290 | 3300041411 | Ga0439466_0014751 | Ga0439466_0014751_2221_2604 | 127 |
| 291 | 3300041443 | Ga0451789_0913588 | Ga0451789_0913588_419_802 | 127 |
| 292 | 3300041444 | Ga0451790_15122 | Ga0451790_15122_30_413 | 127 |
| 293 | 3300041446 | Ga0451794_39000 | Ga0451794_39000_24_407 | 127 |
| 294 | 3300041451 | Ga0451791_0489072 | Ga0451791_0489072_122_505 | 127 |
| 295 | 3300041460 | Ga0451802_1884876 | Ga0451802_1884876_389_772 | 127 |
| 296 | 3300041463 | Ga0451804_0735281 | Ga0451804_0735281_345_728 | 127 |
| 297 | 3300041463 | Ga0451804_1059666 | Ga0451804_1059666_71_454 | 127 |
| 298 | 3300041486 | Ga0451807_0242729 | Ga0451807_0242729_22_405 | 127 |
| 299 | 3300041500 | Ga0451844_23593 | Ga0451844_23593_14_397 | 127 |
| 300 | 3300041505 | Ga0451849_1177343 | Ga0451849_1177343_156_539 | 127 |
| 301 | 3300041509 | Ga0451843_1098053 | Ga0451843_1098053_73_456 | 127 |
| 302 | 3300041509 | Ga0451843_1638388 | Ga0451843_1638388_378_761 | 127 |
| 303 | 3300042004 | Ga0439445_0036329 | Ga0439445_0036329_816_1199 | 127 |
| 304 | 3300042006 | Ga0439432_122979 | Ga0439432_122979_267_650 | 127 |
| 305 | 3300044673 | Ga0453683_0318967 | Ga0453683_0318967_343_735 | 127 |
| 306 | 3300044712 | Ga0453684_1491245 | Ga0453684_1491245_166_582 | 127 |
| 307 | 3300046453 | Ga0495627_002474 | Ga0495627_002474_1742_2125 | 127 |
| 308 | 3300046507 | Ga0495606_0157197 | Ga0495606_0157197_784_1167 | 127 |
| 309 | 3300046512 | Ga0495610_0402938 | Ga0495610_0402938_28_411 | 127 |
| 310 | 3300046522 | Ga0495643_0000294 | Ga0495643_0000294_53525_53908 | 127 |
| 311 | 3300046524 | Ga0495648_0387851 | Ga0495648_0387851_95_478 | 127 |
| 312 | 3300046660 | Ga0495625_0001933 | Ga0495625_0001933_15714_16097 | 127 |
| 313 | 3300046660 | Ga0495625_0225335 | Ga0495625_0225335_772_1155 | 127 |
| 314 | 3300046683 | Ga0495658_0333467 | Ga0495658_0333467_314_697 | 127 |
| 315 | 3300046689 | Ga0495613_0400814 | Ga0495613_0400814_452_835 | 127 |
| 316 | 3300046692 | Ga0495671_0476054 | Ga0495671_0476054_149_532 | 127 |
| 317 | 3300046810 | Ga0495660_0216941 | Ga0495660_0216941_229_612 | 127 |
| 318 | 3300048918 | Ga0496115_0022950 | Ga0496115_0022950_2920_3303 | 127 |
| 319 | 3300048919 | Ga0496116_0000024 | Ga0496116_0000024_103413_103796 | 127 |
| 320 | 3300048920 | Ga0496117_0170046 | Ga0496117_0170046_122_505 | 127 |
| 321 | 3300048922 | Ga0496119_0261209 | Ga0496119_0261209_73_456 | 127 |
| 322 | 3300048924 | Ga0496121_0183138 | Ga0496121_0183138_714_1097 | 127 |
| 323 | 3300048924 | Ga0496121_0473852 | Ga0496121_0473852_176_559 | 127 |
| 324 | 3300048927 | Ga0496124_0894352 | Ga0496124_0894352_12_395 | 127 |
| 325 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_376398_376781 | 127 |
| 326 | 3300048928 | Ga0496125_0000031 | Ga0496125_0000031_35789_36172 | 127 |
| 327 | 3300048929 | Ga0496126_0645820 | Ga0496126_0645820_413_796 | 127 |
| 328 | 3300049130 | Ga0501310_000149 | Ga0501310_000149_4254_4637 | 127 |
| 329 | 3300049530 | Ga0501314_000001 | Ga0501314_000001_11070_11453 | 127 |
| 330 | 3300049533 | Ga0501317_005939 | Ga0501317_005939_190_573 | 127 |
| 331 | 3300049535 | Ga0501319_000002 | Ga0501319_000002_2259_2642 | 127 |
| 332 | 3300049536 | Ga0501320_000034 | Ga0501320_000034_3709_4092 | 127 |
| 333 | 3300049537 | Ga0501321_003707 | Ga0501321_003707_442_825 | 127 |
| 334 | 3300049538 | Ga0501322_000883 | Ga0501322_000883_757_1140 | 127 |
| 335 | 3300049539 | Ga0501323_000002 | Ga0501323_000002_2762_3145 | 127 |
| 336 | 3300049539 | Ga0501323_026262 | Ga0501323_026262_48_431 | 127 |
| 337 | 3300049540 | Ga0501324_000002 | Ga0501324_000002_11211_11594 | 127 |
| 338 | 3300049541 | Ga0501325_000056 | Ga0501325_000056_2507_2890 | 127 |
| 339 | 3300049542 | Ga0501326_00020 | Ga0501326_00020_771_1154 | 127 |
| 340 | 3300049544 | Ga0501328_00037 | Ga0501328_00037_300_683 | 127 |
| 341 | 3300049545 | Ga0501329_01391 | Ga0501329_01391_464_847 | 127 |
| 342 | 3300049546 | Ga0501330_001661 | Ga0501330_001661_381_764 | 127 |
| 343 | 3300049547 | Ga0501331_00092 | Ga0501331_00092_149_532 | 127 |
| 344 | 3300049553 | Ga0501337_000031 | Ga0501337_000031_2363_2746 | 127 |
| 345 | 3300049554 | Ga0501338_00373 | Ga0501338_00373_1055_1438 | 127 |
| 346 | 3300049572 | Ga0501036_0166298 | Ga0501036_0166298_26_409 | 127 |
| 347 | 3300049576 | Ga0501040_0522141 | Ga0501040_0522141_150_533 | 127 |
| 348 | 3300049579 | Ga0501043_0881339 | Ga0501043_0881339_17_400 | 127 |
| 349 | 3300049664 | Ga0501224_004359 | Ga0501224_004359_1191_1574 | 127 |
| 350 | 3300049679 | Ga0501249_004157 | Ga0501249_004157_2471_2854 | 127 |
| 351 | 3300049679 | Ga0501249_022408 | Ga0501249_022408_922_1305 | 127 |
| 352 | 3300049682 | Ga0501252_060643 | Ga0501252_060643_183_566 | 127 |
| 353 | 3300049684 | Ga0501255_024276 | Ga0501255_024276_366_749 | 127 |
| 354 | 3300049758 | Ga0501241_003188 | Ga0501241_003188_1848_2231 | 127 |
| 355 | 3300049763 | Ga0501266_000002 | Ga0501266_000002_338234_338617 | 127 |
| 356 | 3300049776 | Ga0501280_000239 | Ga0501280_000239_2194_2577 | 127 |
| 357 | 3300049778 | Ga0501282_022136 | Ga0501282_022136_199_582 | 127 |
| 358 | 3300049822 | Ga0501035_0018430 | Ga0501035_0018430_675_1058 | 127 |
| 359 | 3300053086 | Ga0500578_0670910 | Ga0500578_0670910_142_525 | 127 |
| 360 | 3300053090 | Ga0500646_0004786 | Ga0500646_0004786_1007_1390 | 127 |
| 361 | 3300053096 | Ga0500641_0000168 | Ga0500641_0000168_6364_6747 | 127 |
| 362 | 3300053096 | Ga0500641_0005947 | Ga0500641_0005947_1089_1472 | 127 |
| 363 | 3300053118 | Ga0500594_0227933 | Ga0500594_0227933_77_460 | 127 |
| 364 | 3300053134 | Ga0500658_0000002 | Ga0500658_0000002_202077_202460 | 127 |
| 365 | 3300053136 | Ga0500559_0077755 | Ga0500559_0077755_130_513 | 127 |
| 366 | 3300053147 | Ga0500589_068495 | Ga0500589_068495_925_1308 | 127 |
| 367 | 3300053726 | Ga0500584_196186 | Ga0500584_196186_129_512 | 127 |
| 368 | 3300028556 | Ga0265337_1069686 | Ga0265337_10696862 | 128 |
| 369 | 3300028556 | Ga0265337_1133038 | Ga0265337_11330382 | 128 |
| 370 | 3300028558 | Ga0265326_10159196 | Ga0265326_101591962 | 128 |
| 371 | 3300028573 | Ga0265334_10102722 | Ga0265334_101027222 | 128 |
| 372 | 3300028653 | Ga0265323_10000040 | Ga0265323_1000004045 | 128 |
| 373 | 3300028666 | Ga0265336_10018763 | Ga0265336_100187634 | 128 |
| 374 | 3300028800 | Ga0265338_10001162 | Ga0265338_1000116241 | 128 |
| 375 | 3300031235 | Ga0265330_10109929 | Ga0265330_101099292 | 128 |
| 376 | 3300031251 | Ga0265327_10000370 | Ga0265327_1000037055 | 128 |
| 377 | 3300031344 | Ga0265316_10000486 | Ga0265316_1000048623 | 128 |
| 378 | 3300031344 | Ga0265316_10004585 | Ga0265316_1000458515 | 128 |
| 379 | 3300031344 | Ga0265316_10065971 | Ga0265316_100659712 | 128 |
| 380 | 3300031344 | Ga0265316_10363451 | Ga0265316_103634511 | 128 |
| 381 | 3300031665 | Ga0316575_10072812 | Ga0316575_100728122 | 128 |
| 382 | 3300031691 | Ga0316579_10126698 | Ga0316579_101266983 | 128 |
| 383 | 3300031691 | Ga0316579_10303502 | Ga0316579_103035022 | 128 |
| 384 | 3300031691 | Ga0316579_10397442 | Ga0316579_103974421 | 128 |
| 385 | 3300031712 | Ga0265342_10069939 | Ga0265342_100699393 | 128 |
| 386 | 3300031712 | Ga0265342_10106285 | Ga0265342_101062853 | 128 |
| 387 | 3300031712 | Ga0265342_10165993 | Ga0265342_101659932 | 128 |
| 388 | 3300031712 | Ga0265342_10234540 | Ga0265342_102345402 | 128 |
| 389 | 3300031727 | Ga0316576_10017698 | Ga0316576_100176985 | 128 |
| 390 | 3300031727 | Ga0316576_10018128 | Ga0316576_100181285 | 128 |
| 391 | 3300031727 | Ga0316576_10021761 | Ga0316576_100217613 | 128 |
| 392 | 3300031727 | Ga0316576_10027616 | Ga0316576_100276167 | 128 |
| 393 | 3300031727 | Ga0316576_10039513 | Ga0316576_100395134 | 128 |
| 394 | 3300031727 | Ga0316576_10060515 | Ga0316576_100605152 | 128 |
| 395 | 3300031727 | Ga0316576_10106177 | Ga0316576_101061772 | 128 |
| 396 | 3300031727 | Ga0316576_10141263 | Ga0316576_101412632 | 128 |
| 397 | 3300031727 | Ga0316576_10208640 | Ga0316576_102086403 | 128 |
| 398 | 3300031727 | Ga0316576_10620299 | Ga0316576_106202992 | 128 |
| 399 | 3300031728 | Ga0316578_10023848 | Ga0316578_100238482 | 128 |
| 400 | 3300031728 | Ga0316578_10042897 | Ga0316578_100428975 | 128 |
| 401 | 3300031728 | Ga0316578_10081543 | Ga0316578_100815433 | 128 |
| 402 | 3300031728 | Ga0316578_10312557 | Ga0316578_103125572 | 128 |
| 403 | 3300031728 | Ga0316578_10334512 | Ga0316578_103345122 | 128 |
| 404 | 3300031733 | Ga0316577_10039011 | Ga0316577_100390113 | 128 |
| 405 | 3300031733 | Ga0316577_10251991 | Ga0316577_102519912 | 128 |
| 406 | 3300032004 | Ga0307414_10019816 | Ga0307414_100198164 | 128 |
| 407 | 3300032133 | Ga0316583_10220733 | Ga0316583_102207332 | 128 |
| 408 | 3300032137 | Ga0316585_10003939 | Ga0316585_100039394 | 128 |
| 409 | 3300032137 | Ga0316585_10053022 | Ga0316585_100530222 | 128 |
| 410 | 3300032137 | Ga0316585_10072804 | Ga0316585_100728042 | 128 |
| 411 | 3300032137 | Ga0316585_10175678 | Ga0316585_101756782 | 128 |
| 412 | 3300032139 | Ga0316580_10075571 | Ga0316580_100755712 | 128 |
| 413 | 3300032139 | Ga0316580_10095681 | Ga0316580_100956812 | 128 |
| 414 | 3300032139 | Ga0316580_10138765 | Ga0316580_101387651 | 128 |
| 415 | 3300032168 | Ga0316593_10000201 | Ga0316593_1000020120 | 128 |
| 416 | 3300032168 | Ga0316593_10003117 | Ga0316593_100031175 | 128 |
| 417 | 3300032168 | Ga0316593_10003954 | Ga0316593_100039544 | 128 |
| 418 | 3300032168 | Ga0316593_10006093 | Ga0316593_100060934 | 128 |
| 419 | 3300032168 | Ga0316593_10040978 | Ga0316593_100409785 | 128 |
| 420 | 3300032168 | Ga0316593_10066960 | Ga0316593_100669602 | 128 |
| 421 | 3300032168 | Ga0316593_10094169 | Ga0316593_100941693 | 128 |
| 422 | 3300032168 | Ga0316593_10119539 | Ga0316593_101195392 | 128 |
| 423 | 3300032168 | Ga0316593_10162772 | Ga0316593_101627722 | 128 |
| 424 | 3300032168 | Ga0316593_10193787 | Ga0316593_101937872 | 128 |
| 425 | 3300033524 | Ga0316592_1000331 | Ga0316592_10003314 | 128 |
| 426 | 3300033524 | Ga0316592_1000945 | Ga0316592_10009455 | 128 |
| 427 | 3300033524 | Ga0316592_1001036 | Ga0316592_10010365 | 128 |
| 428 | 3300033524 | Ga0316592_1015296 | Ga0316592_10152961 | 128 |
| 429 | 3300033524 | Ga0316592_1015321 | Ga0316592_10153211 | 128 |
| 430 | 3300033524 | Ga0316592_1080804 | Ga0316592_10808041 | 128 |
| 431 | 3300033528 | Ga0316588_1001461 | Ga0316588_10014614 | 128 |
| 432 | 3300033528 | Ga0316588_1047427 | Ga0316588_10474272 | 128 |
| 433 | 3300033528 | Ga0316588_1049774 | Ga0316588_10497742 | 128 |
| 434 | 3300033541 | Ga0316596_1000348 | Ga0316596_10003489 | 128 |
| 435 | 3300033541 | Ga0316596_1000575 | Ga0316596_10005759 | 128 |
| 436 | 3300033541 | Ga0316596_1003747 | Ga0316596_10037473 | 128 |
| 437 | 3300033541 | Ga0316596_1006680 | Ga0316596_10066804 | 128 |
| 438 | 3300033541 | Ga0316596_1019521 | Ga0316596_10195211 | 128 |
| 439 | 3300033541 | Ga0316596_1021732 | Ga0316596_10217322 | 128 |
| 440 | 3300033541 | Ga0316596_1031647 | Ga0316596_10316472 | 128 |
| 441 | 3300033541 | Ga0316596_1032001 | Ga0316596_10320012 | 128 |
| 442 | 3300033541 | Ga0316596_1049625 | Ga0316596_10496252 | 128 |
| 443 | 3300033541 | Ga0316596_1052248 | Ga0316596_10522483 | 128 |
| 444 | 3300033541 | Ga0316596_1106897 | Ga0316596_11068972 | 128 |
| 445 | 3300033541 | Ga0316596_1119275 | Ga0316596_11192752 | 128 |
| 446 | 3300033541 | Ga0316596_1143532 | Ga0316596_11435321 | 128 |
| 447 | 3300033541 | Ga0316596_1154244 | Ga0316596_11542441 | 128 |
| 448 | 3300035398 | Ga0316574_0027184 | Ga0316574_0027184_1718_2107 | 128 |
| 449 | 3300035398 | Ga0316574_0056810 | Ga0316574_0056810_383_772 | 128 |
| 450 | 3300035398 | Ga0316574_0068566 | Ga0316574_0068566_58_447 | 128 |
| 451 | 3300035398 | Ga0316574_0246045 | Ga0316574_0246045_379_768 | 128 |
| 452 | 3300035398 | Ga0316574_0481877 | Ga0316574_0481877_115_504 | 128 |
| 453 | 3300035398 | Ga0316574_0850595 | Ga0316574_0850595_26_415 | 128 |
| 454 | 3300036647 | Ga0316582_0014930 | Ga0316582_0014930_3473_3862 | 128 |
| 455 | 3300036647 | Ga0316582_0036309 | Ga0316582_0036309_2243_2632 | 128 |
| 456 | 3300036647 | Ga0316582_0196506 | Ga0316582_0196506_41_430 | 128 |
| 457 | 3300036647 | Ga0316582_0638495 | Ga0316582_0638495_264_653 | 128 |
| 458 | 3300036712 | Ga0316584_0005378 | Ga0316584_0005378_5689_6078 | 128 |
| 459 | 3300036712 | Ga0316584_0048368 | Ga0316584_0048368_2494_2883 | 128 |
| 460 | 3300036712 | Ga0316584_0087726 | Ga0316584_0087726_1346_1735 | 128 |
| 461 | 3300036712 | Ga0316584_0284516 | Ga0316584_0284516_407_796 | 128 |
| 462 | 3300036712 | Ga0316584_0658427 | Ga0316584_0658427_121_510 | 128 |
| 463 | 3300039062 | Ga0400483_035362 | Ga0400483_035362_12376_12765 | 128 |
| 464 | 3300039062 | Ga0400483_183866 | Ga0400483_183866_384_773 | 128 |
| 465 | 3300039093 | Ga0400489_00932 | Ga0400489_00932_5230_5619 | 128 |
| 466 | 3300039093 | Ga0400489_18980 | Ga0400489_18980_423_812 | 128 |
| 467 | 3300041456 | Ga0451795_0972033 | Ga0451795_0972033_164_553 | 128 |
| 468 | 3300041494 | Ga0451837_0551105 | Ga0451837_0551105_204_593 | 128 |
| 469 | 3300041511 | Ga0451855_0333792 | Ga0451855_0333792_168_557 | 128 |
| 470 | 3300041511 | Ga0451855_0440306 | Ga0451855_0440306_94_483 | 128 |
| 471 | 3300041511 | Ga0451855_0497909 | Ga0451855_0497909_1404_1793 | 128 |
| 472 | 3300042876 | Ga0451577_0000092 | Ga0451577_0000092_140543_140932 | 128 |
| 473 | 3300042876 | Ga0451577_0005144 | Ga0451577_0005144_5025_5414 | 128 |
| 474 | 3300042876 | Ga0451577_0023389 | Ga0451577_0023389_1700_2092 | 128 |
| 475 | 3300042876 | Ga0451577_0024955 | Ga0451577_0024955_3210_3599 | 128 |
| 476 | 3300042876 | Ga0451577_0025303 | Ga0451577_0025303_491_880 | 128 |
| 477 | 3300042876 | Ga0451577_0028546 | Ga0451577_0028546_4343_4732 | 128 |
| 478 | 3300042876 | Ga0451577_0047949 | Ga0451577_0047949_458_847 | 128 |
| 479 | 3300042876 | Ga0451577_0066417 | Ga0451577_0066417_2745_3134 | 128 |
| 480 | 3300042876 | Ga0451577_0107299 | Ga0451577_0107299_1432_1824 | 128 |
| 481 | 3300042876 | Ga0451577_0389652 | Ga0451577_0389652_404_793 | 128 |
| 482 | 3300042876 | Ga0451577_0487687 | Ga0451577_0487687_465_854 | 128 |
| 483 | 3300042876 | Ga0451577_0551316 | Ga0451577_0551316_104_493 | 128 |
| 484 | 3300042876 | Ga0451577_0801834 | Ga0451577_0801834_163_552 | 128 |
| 485 | 3300042876 | Ga0451577_1658807 | Ga0451577_1658807_32_421 | 128 |
| 486 | 3300042876 | Ga0451577_1721338 | Ga0451577_1721338_75_464 | 128 |
| 487 | 3300044673 | Ga0453683_0000066 | Ga0453683_0000066_163998_164387 | 128 |
| 488 | 3300044673 | Ga0453683_0000522 | Ga0453683_0000522_18699_19088 | 128 |
| 489 | 3300044673 | Ga0453683_0006727 | Ga0453683_0006727_1764_2153 | 128 |
| 490 | 3300044673 | Ga0453683_0010256 | Ga0453683_0010256_4338_4727 | 128 |
| 491 | 3300044673 | Ga0453683_0118753 | Ga0453683_0118753_628_1017 | 128 |
| 492 | 3300044673 | Ga0453683_0139064 | Ga0453683_0139064_967_1356 | 128 |
| 493 | 3300044673 | Ga0453683_0162196 | Ga0453683_0162196_522_911 | 128 |
| 494 | 3300044673 | Ga0453683_0214162 | Ga0453683_0214162_322_711 | 128 |
| 495 | 3300044673 | Ga0453683_0215687 | Ga0453683_0215687_770_1159 | 128 |
| 496 | 3300044673 | Ga0453683_0215753 | Ga0453683_0215753_51_440 | 128 |
| 497 | 3300044673 | Ga0453683_0216051 | Ga0453683_0216051_403_792 | 128 |
| 498 | 3300044673 | Ga0453683_0278281 | Ga0453683_0278281_628_1017 | 128 |
| 499 | 3300044673 | Ga0453683_0621848 | Ga0453683_0621848_120_509 | 128 |
| 500 | 3300044712 | Ga0453684_0000440 | Ga0453684_0000440_97033_97422 | 128 |
| 501 | 3300044712 | Ga0453684_0000506 | Ga0453684_0000506_11212_11601 | 128 |
| 502 | 3300044712 | Ga0453684_0001121 | Ga0453684_0001121_45677_46069 | 128 |
| 503 | 3300044712 | Ga0453684_0001382 | Ga0453684_0001382_11123_11512 | 128 |
| 504 | 3300044712 | Ga0453684_0001549 | Ga0453684_0001549_41923_42312 | 128 |
| 505 | 3300044712 | Ga0453684_0004131 | Ga0453684_0004131_25952_26341 | 128 |
| 506 | 3300044712 | Ga0453684_0004169 | Ga0453684_0004169_24991_25380 | 128 |
| 507 | 3300044712 | Ga0453684_0004492 | Ga0453684_0004492_3492_3881 | 128 |
| 508 | 3300044712 | Ga0453684_0012437 | Ga0453684_0012437_8367_8756 | 128 |
| 509 | 3300044712 | Ga0453684_0035092 | Ga0453684_0035092_1714_2103 | 128 |
| 510 | 3300044712 | Ga0453684_0049674 | Ga0453684_0049674_2157_2546 | 128 |
| 511 | 3300044712 | Ga0453684_0064505 | Ga0453684_0064505_1745_2134 | 128 |
| 512 | 3300044712 | Ga0453684_0076172 | Ga0453684_0076172_2628_3017 | 128 |
| 513 | 3300044712 | Ga0453684_0104626 | Ga0453684_0104626_2332_2721 | 128 |
| 514 | 3300044712 | Ga0453684_0133450 | Ga0453684_0133450_331_720 | 128 |
| 515 | 3300044712 | Ga0453684_0143337 | Ga0453684_0143337_601_990 | 128 |
| 516 | 3300044712 | Ga0453684_0145941 | Ga0453684_0145941_1515_1904 | 128 |
| 517 | 3300044712 | Ga0453684_0182883 | Ga0453684_0182883_51_440 | 128 |
| 518 | 3300044712 | Ga0453684_0213872 | Ga0453684_0213872_1518_1907 | 128 |
| 519 | 3300044712 | Ga0453684_0267728 | Ga0453684_0267728_727_1116 | 128 |
| 520 | 3300044712 | Ga0453684_0385184 | Ga0453684_0385184_128_517 | 128 |
| 521 | 3300044712 | Ga0453684_0417493 | Ga0453684_0417493_780_1169 | 128 |
| 522 | 3300044712 | Ga0453684_0532547 | Ga0453684_0532547_390_779 | 128 |
| 523 | 3300044712 | Ga0453684_0577897 | Ga0453684_0577897_108_497 | 128 |
| 524 | 3300044712 | Ga0453684_0811243 | Ga0453684_0811243_123_512 | 128 |
| 525 | 3300044712 | Ga0453684_1058534 | Ga0453684_1058534_295_684 | 128 |
| 526 | 3300044712 | Ga0453684_1398372 | Ga0453684_1398372_295_684 | 128 |
| 527 | 3300044712 | Ga0453684_1490826 | Ga0453684_1490826_127_516 | 128 |
| 528 | 3300045051 | Ga0451576_0000113 | Ga0451576_0000113_182120_182509 | 128 |
| 529 | 3300045051 | Ga0451576_0000204 | Ga0451576_0000204_140543_140932 | 128 |
| 530 | 3300045051 | Ga0451576_0000783 | Ga0451576_0000783_402_791 | 128 |
| 531 | 3300045051 | Ga0451576_0003652 | Ga0451576_0003652_4446_4835 | 128 |
| 532 | 3300045051 | Ga0451576_0011102 | Ga0451576_0011102_6906_7295 | 128 |
| 533 | 3300045051 | Ga0451576_0013908 | Ga0451576_0013908_5228_5617 | 128 |
| 534 | 3300045051 | Ga0451576_0022652 | Ga0451576_0022652_6185_6574 | 128 |
| 535 | 3300045051 | Ga0451576_0083654 | Ga0451576_0083654_403_792 | 128 |
| 536 | 3300045051 | Ga0451576_0088919 | Ga0451576_0088919_1426_1815 | 128 |
| 537 | 3300045051 | Ga0451576_0143234 | Ga0451576_0143234_189_578 | 128 |
| 538 | 3300045051 | Ga0451576_0277421 | Ga0451576_0277421_360_749 | 128 |
| 539 | 3300045051 | Ga0451576_0291923 | Ga0451576_0291923_204_596 | 128 |
| 540 | 3300045051 | Ga0451576_0438926 | Ga0451576_0438926_779_1168 | 128 |
| 541 | 3300045051 | Ga0451576_0937455 | Ga0451576_0937455_23_412 | 128 |
| 542 | 3300045051 | Ga0451576_0995907 | Ga0451576_0995907_366_755 | 128 |
| 543 | 3300045051 | Ga0451576_1846002 | Ga0451576_1846002_108_497 | 128 |
| 544 | 3300045051 | Ga0451576_2409690 | Ga0451576_2409690_130_519 | 128 |
| 545 | 3300049571 | Ga0501034_0390568 | Ga0501034_0390568_747_1136 | 128 |
| 546 | 2124908027 | MRS2a_Contig_24813 | MRS2a_00669080 | 129 |
| 547 | 2162886007 | SwRhRL2b_contig_156102 | SwRhRL2b_0800.00002340 | 129 |
| 548 | 2162886007 | SwRhRL2b_contig_3583939 | SwRhRL2b_0788.00003260 | 129 |
| 549 | 3300001915 | JGI24741J21665_1003251 | JGI24741J21665_10032514 | 129 |
| 550 | 3300001979 | JGI24740J21852_10008913 | JGI24740J21852_100089133 | 129 |
| 551 | 3300001979 | JGI24740J21852_10033543 | JGI24740J21852_100335432 | 129 |
| 552 | 3300001990 | JGI24737J22298_10001860 | JGI24737J22298_1000186010 | 129 |
| 553 | 3300002067 | JGI24735J21928_10000003 | JGI24735J21928_10000003360 | 129 |
| 554 | 3300002067 | JGI24735J21928_10005021 | JGI24735J21928_100050215 | 129 |
| 555 | 3300002077 | JGI24744J21845_10001128 | JGI24744J21845_100011284 | 129 |
| 556 | 3300002737 | JGI25162J39368_1000039 | JGI25162J39368_1000039104 | 129 |
| 557 | 3300002737 | JGI25162J39368_1001202 | JGI25162J39368_100120212 | 129 |
| 558 | 3300002772 | JGI25164J39214_1001166 | JGI25164J39214_10011665 | 129 |
| 559 | 3300002773 | JGI25152J39213_1000006 | JGI25152J39213_100000621 | 129 |
| 560 | 3300002774 | JGI25150J39212_1000005 | JGI25150J39212_1000005212 | 129 |
| 561 | 3300003187 | JGI25151J46595_10000004 | JGI25151J46595_10000004380 | 129 |
| 562 | 3300003214 | JGI25165J46597_1000678 | JGI25165J46597_10006786 | 129 |
| 563 | 3300003215 | JGI25153J46596_10000004 | JGI25153J46596_10000004380 | 129 |
| 564 | 3300003316 | rootH1_10024556 | rootH1_100245565 | 129 |
| 565 | 3300003316 | rootH1_10160693 | rootH1_101606932 | 129 |
| 566 | 3300003320 | rootH2_10056635 | rootH2_100566355 | 129 |
| 567 | 3300003322 | rootL2_10101710 | rootL2_101017107 | 129 |
| 568 | 3300003323 | rootH1_10045781 | rootH1_1004578110 | 129 |
| 569 | 3300003323 | rootH1_10193341 | rootH1_101933414 | 129 |
| 570 | 3300003578 | Ga0006562J51391_1007655 | Ga0006562J51391_10076554 | 129 |
| 571 | 3300003781 | Ga0055536_1000004 | Ga0055536_1000004121 | 129 |
| 572 | 3300003791 | Ga0055530_10000817 | Ga0055530_100008177 | 129 |
| 573 | 3300004799 | Ga0058863_10111335 | Ga0058863_101113352 | 129 |
| 574 | 3300004800 | Ga0058861_10176091 | Ga0058861_101760914 | 129 |
| 575 | 3300004801 | Ga0058860_10142251 | Ga0058860_101422512 | 129 |
| 576 | 3300004803 | Ga0058862_10102512 | Ga0058862_101025124 | 129 |
| 577 | 3300005288 | Ga0065714_10002624 | Ga0065714_1000262421 | 129 |
| 578 | 3300005288 | Ga0065714_10005956 | Ga0065714_100059564 | 129 |
| 579 | 3300005288 | Ga0065714_10009786 | Ga0065714_100097862 | 129 |
| 580 | 3300005288 | Ga0065714_10013697 | Ga0065714_100136972 | 129 |
| 581 | 3300005288 | Ga0065714_10022334 | Ga0065714_100223342 | 129 |
| 582 | 3300005288 | Ga0065714_10079789 | Ga0065714_100797891 | 129 |
| 583 | 3300005288 | Ga0065714_10102584 | Ga0065714_101025843 | 129 |
| 584 | 3300005288 | Ga0065714_10160851 | Ga0065714_101608512 | 129 |
| 585 | 3300005289 | Ga0065704_10000307 | Ga0065704_1000030730 | 129 |
| 586 | 3300005289 | Ga0065704_10073035 | Ga0065704_100730353 | 129 |
| 587 | 3300005289 | Ga0065704_10078273 | Ga0065704_100782732 | 129 |
| 588 | 3300005289 | Ga0065704_10177771 | Ga0065704_101777712 | 129 |
| 589 | 3300005289 | Ga0065704_10269193 | Ga0065704_102691931 | 129 |
| 590 | 3300005289 | Ga0065704_10346795 | Ga0065704_103467952 | 129 |
| 591 | 3300005289 | Ga0065704_10399407 | Ga0065704_103994072 | 129 |
| 592 | 3300005289 | Ga0065704_10458670 | Ga0065704_104586701 | 129 |
| 593 | 3300005293 | Ga0065715_10866960 | Ga0065715_108669601 | 129 |
| 594 | 3300005293 | Ga0065715_10927087 | Ga0065715_109270871 | 129 |
| 595 | 3300005327 | Ga0070658_10000153 | Ga0070658_1000015314 | 129 |
| 596 | 3300005327 | Ga0070658_10120312 | Ga0070658_101203123 | 129 |
| 597 | 3300005327 | Ga0070658_10244897 | Ga0070658_102448972 | 129 |
| 598 | 3300005328 | Ga0070676_10000312 | Ga0070676_1000031227 | 129 |
| 599 | 3300005329 | Ga0070683_100018688 | Ga0070683_1000186884 | 129 |
| 600 | 3300005329 | Ga0070683_100032136 | Ga0070683_1000321363 | 129 |
| 601 | 3300005330 | Ga0070690_100580742 | Ga0070690_1005807422 | 129 |
| 602 | 3300005336 | Ga0070680_100005676 | Ga0070680_10000567611 | 129 |
| 603 | 3300005337 | Ga0070682_100000768 | Ga0070682_10000076812 | 129 |
| 604 | 3300005338 | Ga0068868_100104416 | Ga0068868_1001044163 | 129 |
| 605 | 3300005338 | Ga0068868_100118877 | Ga0068868_1001188771 | 129 |
| 606 | 3300005339 | Ga0070660_100043744 | Ga0070660_1000437443 | 129 |
| 607 | 3300005339 | Ga0070660_100057675 | Ga0070660_1000576754 | 129 |
| 608 | 3300005347 | Ga0070668_100276810 | Ga0070668_1002768102 | 129 |
| 609 | 3300005353 | Ga0070669_100349495 | Ga0070669_1003494952 | 129 |
| 610 | 3300005355 | Ga0070671_100045958 | Ga0070671_1000459584 | 129 |
| 611 | 3300005356 | Ga0070674_100123468 | Ga0070674_1001234683 | 129 |
| 612 | 3300005364 | Ga0070673_100043212 | Ga0070673_1000432123 | 129 |
| 613 | 3300005366 | Ga0070659_100000375 | Ga0070659_10000037514 | 129 |
| 614 | 3300005366 | Ga0070659_101692991 | Ga0070659_1016929911 | 129 |
| 615 | 3300005456 | Ga0070678_100032095 | Ga0070678_1000320953 | 129 |
| 616 | 3300005457 | Ga0070662_100000074 | Ga0070662_10000007413 | 129 |
| 617 | 3300005457 | Ga0070662_100794941 | Ga0070662_1007949412 | 129 |
| 618 | 3300005458 | Ga0070681_10002985 | Ga0070681_1000298512 | 129 |
| 619 | 3300005459 | Ga0068867_100010877 | Ga0068867_10001087710 | 129 |
| 620 | 3300005530 | Ga0070679_100006255 | Ga0070679_1000062557 | 129 |
| 621 | 3300005530 | Ga0070679_100727393 | Ga0070679_1007273931 | 129 |
| 622 | 3300005535 | Ga0070684_100006351 | Ga0070684_1000063512 | 129 |
| 623 | 3300005535 | Ga0070684_100723154 | Ga0070684_1007231542 | 129 |
| 624 | 3300005539 | Ga0068853_100150954 | Ga0068853_1001509544 | 129 |
| 625 | 3300005539 | Ga0068853_100167326 | Ga0068853_1001673263 | 129 |
| 626 | 3300005548 | Ga0070665_100000372 | Ga0070665_10000037226 | 129 |
| 627 | 3300005549 | Ga0070704_101084299 | Ga0070704_1010842992 | 129 |
| 628 | 3300005563 | Ga0068855_100000360 | Ga0068855_10000036035 | 129 |
| 629 | 3300005563 | Ga0068855_100012268 | Ga0068855_1000122688 | 129 |
| 630 | 3300005563 | Ga0068855_100025831 | Ga0068855_10002583111 | 129 |
| 631 | 3300005563 | Ga0068855_100061070 | Ga0068855_1000610705 | 129 |
| 632 | 3300005563 | Ga0068855_100071470 | Ga0068855_1000714702 | 129 |
| 633 | 3300005563 | Ga0068855_100279474 | Ga0068855_1002794743 | 129 |
| 634 | 3300005563 | Ga0068855_100524481 | Ga0068855_1005244812 | 129 |
| 635 | 3300005563 | Ga0068855_100671044 | Ga0068855_1006710442 | 129 |
| 636 | 3300005563 | Ga0068855_100814966 | Ga0068855_1008149662 | 129 |
| 637 | 3300005563 | Ga0068855_100859569 | Ga0068855_1008595692 | 129 |
| 638 | 3300005563 | Ga0068855_102101977 | Ga0068855_1021019771 | 129 |
| 639 | 3300005577 | Ga0068857_100489716 | Ga0068857_1004897162 | 129 |
| 640 | 3300005578 | Ga0068854_100266832 | Ga0068854_1002668321 | 129 |
| 641 | 3300005578 | Ga0068854_100936506 | Ga0068854_1009365062 | 129 |
| 642 | 3300005614 | Ga0068856_100016148 | Ga0068856_1000161489 | 129 |
| 643 | 3300005614 | Ga0068856_100058008 | Ga0068856_1000580082 | 129 |
| 644 | 3300005614 | Ga0068856_100147792 | Ga0068856_1001477922 | 129 |
| 645 | 3300005614 | Ga0068856_100153582 | Ga0068856_1001535825 | 129 |
| 646 | 3300005614 | Ga0068856_100340133 | Ga0068856_1003401333 | 129 |
| 647 | 3300005614 | Ga0068856_100423074 | Ga0068856_1004230743 | 129 |
| 648 | 3300005614 | Ga0068856_100667106 | Ga0068856_1006671062 | 129 |
| 649 | 3300005616 | Ga0068852_100010466 | Ga0068852_1000104666 | 129 |
| 650 | 3300005616 | Ga0068852_100462537 | Ga0068852_1004625372 | 129 |
| 651 | 3300005616 | Ga0068852_101512163 | Ga0068852_1015121632 | 129 |
| 652 | 3300005617 | Ga0068859_102399722 | Ga0068859_1023997222 | 129 |
| 653 | 3300005718 | Ga0068866_10152156 | Ga0068866_101521562 | 129 |
| 654 | 3300005841 | Ga0068863_101631036 | Ga0068863_1016310361 | 129 |
| 655 | 3300005841 | Ga0068863_101913908 | Ga0068863_1019139081 | 129 |
| 656 | 3300005843 | Ga0068860_100562306 | Ga0068860_1005623062 | 129 |
| 657 | 3300006186 | Ga0075369_10350950 | Ga0075369_103509501 | 129 |
| 658 | 3300006195 | Ga0075366_10089546 | Ga0075366_100895463 | 129 |
| 659 | 3300006195 | Ga0075366_10252599 | Ga0075366_102525991 | 129 |
| 660 | 3300006237 | Ga0097621_100007799 | Ga0097621_10000779916 | 129 |
| 661 | 3300006353 | Ga0075370_10177105 | Ga0075370_101771052 | 129 |
| 662 | 3300006358 | Ga0068871_100000141 | Ga0068871_10000014112 | 129 |
| 663 | 3300006881 | Ga0068865_100000917 | Ga0068865_10000091716 | 129 |
| 664 | 3300006931 | Ga0097620_102399396 | Ga0097620_1023993962 | 129 |
| 665 | 3300009011 | Ga0105251_10057935 | Ga0105251_100579353 | 129 |
| 666 | 3300009011 | Ga0105251_10498151 | Ga0105251_104981511 | 129 |
| 667 | 3300009036 | Ga0105244_10000160 | Ga0105244_100001607 | 129 |
| 668 | 3300009036 | Ga0105244_10015827 | Ga0105244_100158276 | 129 |
| 669 | 3300009093 | Ga0105240_10000082 | Ga0105240_1000008212 | 129 |
| 670 | 3300009093 | Ga0105240_10073384 | Ga0105240_100733844 | 129 |
| 671 | 3300009093 | Ga0105240_10204993 | Ga0105240_102049932 | 129 |
| 672 | 3300009093 | Ga0105240_10432476 | Ga0105240_104324761 | 129 |
| 673 | 3300009093 | Ga0105240_10481262 | Ga0105240_104812622 | 129 |
| 674 | 3300009093 | Ga0105240_10924097 | Ga0105240_109240972 | 129 |
| 675 | 3300009093 | Ga0105240_10971270 | Ga0105240_109712701 | 129 |
| 676 | 3300009093 | Ga0105240_11222634 | Ga0105240_112226341 | 129 |
| 677 | 3300009094 | Ga0111539_11039008 | Ga0111539_110390082 | 129 |
| 678 | 3300009098 | Ga0105245_10812450 | Ga0105245_108124502 | 129 |
| 679 | 3300009098 | Ga0105245_11624337 | Ga0105245_116243371 | 129 |
| 680 | 3300009148 | Ga0105243_10000009 | Ga0105243_10000009224 | 129 |
| 681 | 3300009148 | Ga0105243_10003612 | Ga0105243_1000361214 | 129 |
| 682 | 3300009148 | Ga0105243_10014278 | Ga0105243_100142786 | 129 |
| 683 | 3300009174 | Ga0105241_10111599 | Ga0105241_101115995 | 129 |
| 684 | 3300009174 | Ga0105241_10177460 | Ga0105241_101774602 | 129 |
| 685 | 3300009174 | Ga0105241_10191865 | Ga0105241_101918654 | 129 |
| 686 | 3300009174 | Ga0105241_10555896 | Ga0105241_105558961 | 129 |
| 687 | 3300009174 | Ga0105241_11121315 | Ga0105241_111213151 | 129 |
| 688 | 3300009174 | Ga0105241_11613001 | Ga0105241_116130011 | 129 |
| 689 | 3300009176 | Ga0105242_10227333 | Ga0105242_102273334 | 129 |
| 690 | 3300009176 | Ga0105242_10279101 | Ga0105242_102791011 | 129 |
| 691 | 3300009176 | Ga0105242_10692446 | Ga0105242_106924462 | 129 |
| 692 | 3300009176 | Ga0105242_10847467 | Ga0105242_108474672 | 129 |
| 693 | 3300009545 | Ga0105237_10000794 | Ga0105237_100007946 | 129 |
| 694 | 3300009545 | Ga0105237_10002553 | Ga0105237_1000255335 | 129 |
| 695 | 3300009545 | Ga0105237_10006510 | Ga0105237_100065107 | 129 |
| 696 | 3300009545 | Ga0105237_10015313 | Ga0105237_100153136 | 129 |
| 697 | 3300009545 | Ga0105237_10015662 | Ga0105237_100156623 | 129 |
| 698 | 3300009545 | Ga0105237_10047854 | Ga0105237_100478545 | 129 |
| 699 | 3300009545 | Ga0105237_10071252 | Ga0105237_100712522 | 129 |
| 700 | 3300009545 | Ga0105237_10083942 | Ga0105237_100839422 | 129 |
| 701 | 3300009545 | Ga0105237_10185132 | Ga0105237_101851323 | 129 |
| 702 | 3300009545 | Ga0105237_11452365 | Ga0105237_114523652 | 129 |
| 703 | 3300009551 | Ga0105238_10017754 | Ga0105238_1001775414 | 129 |
| 704 | 3300009551 | Ga0105238_10194984 | Ga0105238_101949842 | 129 |
| 705 | 3300009553 | Ga0105249_10092720 | Ga0105249_100927202 | 129 |
| 706 | 3300009829 | Ga0130086_1024805 | Ga0130086_10248051 | 129 |
| 707 | 3300009850 | Ga0130085_1035330 | Ga0130085_10353301 | 129 |
| 708 | 3300010375 | Ga0105239_10000011 | Ga0105239_10000011112 | 129 |
| 709 | 3300010375 | Ga0105239_10005378 | Ga0105239_1000537815 | 129 |
| 710 | 3300010375 | Ga0105239_10015682 | Ga0105239_1001568212 | 129 |
| 711 | 3300010375 | Ga0105239_10248837 | Ga0105239_102488372 | 129 |
| 712 | 3300010375 | Ga0105239_10262733 | Ga0105239_102627334 | 129 |
| 713 | 3300010375 | Ga0105239_10429598 | Ga0105239_104295983 | 129 |
| 714 | 3300010375 | Ga0105239_12090703 | Ga0105239_120907032 | 129 |
| 715 | 3300013100 | Ga0157373_10000006 | Ga0157373_100000069 | 129 |
| 716 | 3300013100 | Ga0157373_10001033 | Ga0157373_1000103316 | 129 |
| 717 | 3300013100 | Ga0157373_10002831 | Ga0157373_100028319 | 129 |
| 718 | 3300013100 | Ga0157373_10009996 | Ga0157373_100099966 | 129 |
| 719 | 3300013100 | Ga0157373_10028999 | Ga0157373_100289993 | 129 |
| 720 | 3300013100 | Ga0157373_10059430 | Ga0157373_100594303 | 129 |
| 721 | 3300013102 | Ga0157371_10000041 | Ga0157371_1000004118 | 129 |
| 722 | 3300013102 | Ga0157371_10000091 | Ga0157371_10000091111 | 129 |
| 723 | 3300013102 | Ga0157371_10001553 | Ga0157371_100015532 | 129 |
| 724 | 3300013102 | Ga0157371_10013476 | Ga0157371_100134761 | 129 |
| 725 | 3300013102 | Ga0157371_10021684 | Ga0157371_100216844 | 129 |
| 726 | 3300013102 | Ga0157371_10033811 | Ga0157371_100338116 | 129 |
| 727 | 3300013104 | Ga0157370_10012207 | Ga0157370_100122076 | 129 |
| 728 | 3300013104 | Ga0157370_10014051 | Ga0157370_100140516 | 129 |
| 729 | 3300013104 | Ga0157370_10019740 | Ga0157370_100197403 | 129 |
| 730 | 3300013104 | Ga0157370_10041216 | Ga0157370_100412167 | 129 |
| 731 | 3300013104 | Ga0157370_10042074 | Ga0157370_100420741 | 129 |
| 732 | 3300013104 | Ga0157370_10327925 | Ga0157370_103279251 | 129 |
| 733 | 3300013104 | Ga0157370_10693077 | Ga0157370_106930771 | 129 |
| 734 | 3300013104 | Ga0157370_10856639 | Ga0157370_108566392 | 129 |
| 735 | 3300013104 | Ga0157370_11487469 | Ga0157370_114874691 | 129 |
| 736 | 3300013105 | Ga0157369_10000016 | Ga0157369_10000016222 | 129 |
| 737 | 3300013105 | Ga0157369_10008868 | Ga0157369_100088682 | 129 |
| 738 | 3300013105 | Ga0157369_10010007 | Ga0157369_100100075 | 129 |
| 739 | 3300013105 | Ga0157369_10030357 | Ga0157369_1003035710 | 129 |
| 740 | 3300013105 | Ga0157369_10080886 | Ga0157369_100808862 | 129 |
| 741 | 3300013105 | Ga0157369_10408180 | Ga0157369_104081803 | 129 |
| 742 | 3300013105 | Ga0157369_11507817 | Ga0157369_115078171 | 129 |
| 743 | 3300013296 | Ga0157374_10030641 | Ga0157374_1003064110 | 129 |
| 744 | 3300013296 | Ga0157374_10077301 | Ga0157374_100773016 | 129 |
| 745 | 3300013296 | Ga0157374_10208307 | Ga0157374_102083075 | 129 |
| 746 | 3300013296 | Ga0157374_10210459 | Ga0157374_102104595 | 129 |
| 747 | 3300013296 | Ga0157374_10371931 | Ga0157374_103719311 | 129 |
| 748 | 3300013296 | Ga0157374_10454107 | Ga0157374_104541072 | 129 |
| 749 | 3300013296 | Ga0157374_10986484 | Ga0157374_109864842 | 129 |
| 750 | 3300013296 | Ga0157374_11416639 | Ga0157374_114166392 | 129 |
| 751 | 3300013296 | Ga0157374_11420827 | Ga0157374_114208272 | 129 |
| 752 | 3300013297 | Ga0157378_10008303 | Ga0157378_1000830314 | 129 |
| 753 | 3300013297 | Ga0157378_10060889 | Ga0157378_100608891 | 129 |
| 754 | 3300013306 | Ga0163162_10003331 | Ga0163162_100033312 | 129 |
| 755 | 3300013306 | Ga0163162_10033491 | Ga0163162_100334915 | 129 |
| 756 | 3300013306 | Ga0163162_10047580 | Ga0163162_100475802 | 129 |
| 757 | 3300013306 | Ga0163162_10106514 | Ga0163162_101065142 | 129 |
| 758 | 3300013306 | Ga0163162_10278112 | Ga0163162_102781123 | 129 |
| 759 | 3300013306 | Ga0163162_11176876 | Ga0163162_111768762 | 129 |
| 760 | 3300013307 | Ga0157372_10000030 | Ga0157372_1000003011 | 129 |
| 761 | 3300013307 | Ga0157372_10000332 | Ga0157372_1000033211 | 129 |
| 762 | 3300013307 | Ga0157372_10003430 | Ga0157372_100034305 | 129 |
| 763 | 3300013307 | Ga0157372_10011651 | Ga0157372_1001165120 | 129 |
| 764 | 3300013307 | Ga0157372_10037880 | Ga0157372_100378808 | 129 |
| 765 | 3300013307 | Ga0157372_10129288 | Ga0157372_101292882 | 129 |
| 766 | 3300013307 | Ga0157372_10157361 | Ga0157372_101573612 | 129 |
| 767 | 3300013307 | Ga0157372_10903284 | Ga0157372_109032842 | 129 |
| 768 | 3300013308 | Ga0157375_10099030 | Ga0157375_100990304 | 129 |
| 769 | 3300013308 | Ga0157375_10904988 | Ga0157375_109049881 | 129 |
| 770 | 3300013308 | Ga0157375_11275906 | Ga0157375_112759062 | 129 |
| 771 | 3300013308 | Ga0157375_11403714 | Ga0157375_114037141 | 129 |
| 772 | 3300013308 | Ga0157375_11429406 | Ga0157375_114294061 | 129 |
| 773 | 3300013308 | Ga0157375_11618320 | Ga0157375_116183201 | 129 |
| 774 | 3300013308 | Ga0157375_13212846 | Ga0157375_132128462 | 129 |
| 775 | 3300014325 | Ga0163163_11138066 | Ga0163163_111380662 | 129 |
| 776 | 3300014325 | Ga0163163_11580757 | Ga0163163_115807572 | 129 |
| 777 | 3300014325 | Ga0163163_12203559 | Ga0163163_122035591 | 129 |
| 778 | 3300014326 | Ga0157380_10000051 | Ga0157380_1000005129 | 129 |
| 779 | 3300014497 | Ga0182008_10000003 | Ga0182008_10000003184 | 129 |
| 780 | 3300014497 | Ga0182008_10000034 | Ga0182008_1000003416 | 129 |
| 781 | 3300014497 | Ga0182008_10001770 | Ga0182008_1000177013 | 129 |
| 782 | 3300014497 | Ga0182008_10003643 | Ga0182008_1000364315 | 129 |
| 783 | 3300014497 | Ga0182008_10111138 | Ga0182008_101111382 | 129 |
| 784 | 3300014497 | Ga0182008_10345321 | Ga0182008_103453211 | 129 |
| 785 | 3300014497 | Ga0182008_10716442 | Ga0182008_107164421 | 129 |
| 786 | 3300014745 | Ga0157377_10009989 | Ga0157377_100099894 | 129 |
| 787 | 3300014968 | Ga0157379_11114424 | Ga0157379_111144241 | 129 |
| 788 | 3300014969 | Ga0157376_10125737 | Ga0157376_101257375 | 129 |
| 789 | 3300015261 | Ga0182006_1000001 | Ga0182006_1000001874 | 129 |
| 790 | 3300015261 | Ga0182006_1000103 | Ga0182006_100010372 | 129 |
| 791 | 3300015261 | Ga0182006_1006389 | Ga0182006_10063892 | 129 |
| 792 | 3300015261 | Ga0182006_1008481 | Ga0182006_10084815 | 129 |
| 793 | 3300015261 | Ga0182006_1068748 | Ga0182006_10687482 | 129 |
| 794 | 3300015262 | Ga0182007_10000002 | Ga0182007_10000002421 | 129 |
| 795 | 3300015262 | Ga0182007_10005771 | Ga0182007_100057716 | 129 |
| 796 | 3300015262 | Ga0182007_10015899 | Ga0182007_100158993 | 129 |
| 797 | 3300015682 | Ga0183373_1004 | Ga0183373_100475 | 129 |
| 798 | 3300017792 | Ga0163161_10000207 | Ga0163161_1000020747 | 129 |
| 799 | 3300017792 | Ga0163161_10039425 | Ga0163161_100394253 | 129 |
| 800 | 3300017792 | Ga0163161_10097976 | Ga0163161_100979761 | 129 |
| 801 | 3300017792 | Ga0163161_10125798 | Ga0163161_101257982 | 129 |
| 802 | 3300017792 | Ga0163161_10554453 | Ga0163161_105544531 | 129 |
| 803 | 3300017792 | Ga0163161_10628450 | Ga0163161_106284502 | 129 |
| 804 | 3300017792 | Ga0163161_10709095 | Ga0163161_107090952 | 129 |
| 805 | 3300017792 | Ga0163161_10739282 | Ga0163161_107392822 | 129 |
| 806 | 3300017792 | Ga0163161_11250984 | Ga0163161_112509841 | 129 |
| 807 | 3300020069 | Ga0197907_10757494 | Ga0197907_107574943 | 129 |
| 808 | 3300020069 | Ga0197907_11138220 | Ga0197907_111382202 | 129 |
| 809 | 3300020070 | Ga0206356_10991038 | Ga0206356_109910383 | 129 |
| 810 | 3300020070 | Ga0206356_11209637 | Ga0206356_112096371 | 129 |
| 811 | 3300020075 | Ga0206349_1692805 | Ga0206349_16928051 | 129 |
| 812 | 3300020077 | Ga0206351_10267476 | Ga0206351_102674764 | 129 |
| 813 | 3300020077 | Ga0206351_10387294 | Ga0206351_103872946 | 129 |
| 814 | 3300020077 | Ga0206351_10512829 | Ga0206351_105128294 | 129 |
| 815 | 3300020078 | Ga0206352_10226992 | Ga0206352_102269922 | 129 |
| 816 | 3300020078 | Ga0206352_10382572 | Ga0206352_103825722 | 129 |
| 817 | 3300020078 | Ga0206352_10622029 | Ga0206352_106220294 | 129 |
| 818 | 3300020078 | Ga0206352_10835038 | Ga0206352_108350383 | 129 |
| 819 | 3300020080 | Ga0206350_10018304 | Ga0206350_100183045 | 129 |
| 820 | 3300020080 | Ga0206350_11221028 | Ga0206350_112210282 | 129 |
| 821 | 3300020081 | Ga0206354_10248047 | Ga0206354_102480472 | 129 |
| 822 | 3300020081 | Ga0206354_10263498 | Ga0206354_102634982 | 129 |
| 823 | 3300020081 | Ga0206354_11507030 | Ga0206354_115070302 | 129 |
| 824 | 3300020082 | Ga0206353_10159245 | Ga0206353_101592452 | 129 |
| 825 | 3300020082 | Ga0206353_10736142 | Ga0206353_107361424 | 129 |
| 826 | 3300020610 | Ga0154015_1024308 | Ga0154015_10243084 | 129 |
| 827 | 3300020610 | Ga0154015_1037437 | Ga0154015_10374374 | 129 |
| 828 | 3300020610 | Ga0154015_1309672 | Ga0154015_13096722 | 129 |
| 829 | 3300021361 | Ga0213872_10051000 | Ga0213872_100510002 | 129 |
| 830 | 3300022467 | Ga0224712_10004189 | Ga0224712_100041894 | 129 |
| 831 | 3300022467 | Ga0224712_10045345 | Ga0224712_100453453 | 129 |
| 832 | 3300022467 | Ga0224712_10082607 | Ga0224712_100826072 | 129 |
| 833 | 3300025230 | Ga0209563_127189 | Ga0209563_1271891 | 129 |
| 834 | 3300025231 | Ga0207427_100025 | Ga0207427_100025314 | 129 |
| 835 | 3300025233 | Ga0209437_100010 | Ga0209437_100010576 | 129 |
| 836 | 3300025233 | Ga0209437_100135 | Ga0209437_10013576 | 129 |
| 837 | 3300025245 | Ga0207425_1000008 | Ga0207425_100000858 | 129 |
| 838 | 3300025250 | Ga0209026_1000610 | Ga0209026_100061032 | 129 |
| 839 | 3300025250 | Ga0209026_1004574 | Ga0209026_10045744 | 129 |
| 840 | 3300025254 | Ga0209148_1033295 | Ga0209148_10332951 | 129 |
| 841 | 3300025254 | Ga0209148_1037006 | Ga0209148_10370061 | 129 |
| 842 | 3300025258 | Ga0209129_1000040 | Ga0209129_1000040207 | 129 |
| 843 | 3300025258 | Ga0209129_1049492 | Ga0209129_10494922 | 129 |
| 844 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017589 | 129 |
| 845 | 3300025261 | Ga0209233_1032971 | Ga0209233_10329711 | 129 |
| 846 | 3300025291 | Ga0209675_1000200 | Ga0209675_10002004 | 129 |
| 847 | 3300025292 | Ga0209676_1000009 | Ga0209676_1000009432 | 129 |
| 848 | 3300025294 | Ga0209025_1000020 | Ga0209025_100002058 | 129 |
| 849 | 3300025297 | Ga0209758_1000022 | Ga0209758_100002258 | 129 |
| 850 | 3300025298 | Ga0209050_1000048 | Ga0209050_1000048228 | 129 |
| 851 | 3300025728 | Ga0207655_1000016 | Ga0207655_1000016452 | 129 |
| 852 | 3300025728 | Ga0207655_1062533 | Ga0207655_10625332 | 129 |
| 853 | 3300025899 | Ga0207642_10051496 | Ga0207642_100514961 | 129 |
| 854 | 3300025899 | Ga0207642_10122961 | Ga0207642_101229612 | 129 |
| 855 | 3300025904 | Ga0207647_10000303 | Ga0207647_1000030337 | 129 |
| 856 | 3300025904 | Ga0207647_10032931 | Ga0207647_100329316 | 129 |
| 857 | 3300025904 | Ga0207647_10036461 | Ga0207647_100364614 | 129 |
| 858 | 3300025907 | Ga0207645_10000035 | Ga0207645_1000003569 | 129 |
| 859 | 3300025909 | Ga0207705_10000108 | Ga0207705_1000010899 | 129 |
| 860 | 3300025909 | Ga0207705_10328136 | Ga0207705_103281362 | 129 |
| 861 | 3300025911 | Ga0207654_10023808 | Ga0207654_100238084 | 129 |
| 862 | 3300025911 | Ga0207654_10124200 | Ga0207654_101242002 | 129 |
| 863 | 3300025911 | Ga0207654_10648325 | Ga0207654_106483252 | 129 |
| 864 | 3300025911 | Ga0207654_10982565 | Ga0207654_109825651 | 129 |
| 865 | 3300025912 | Ga0207707_10032972 | Ga0207707_100329722 | 129 |
| 866 | 3300025913 | Ga0207695_10000053 | Ga0207695_10000053339 | 129 |
| 867 | 3300025913 | Ga0207695_10039657 | Ga0207695_100396573 | 129 |
| 868 | 3300025913 | Ga0207695_10062421 | Ga0207695_100624214 | 129 |
| 869 | 3300025913 | Ga0207695_10080728 | Ga0207695_100807285 | 129 |
| 870 | 3300025913 | Ga0207695_10085252 | Ga0207695_100852521 | 129 |
| 871 | 3300025913 | Ga0207695_10288044 | Ga0207695_102880442 | 129 |
| 872 | 3300025914 | Ga0207671_10005849 | Ga0207671_1000584919 | 129 |
| 873 | 3300025914 | Ga0207671_10011776 | Ga0207671_100117764 | 129 |
| 874 | 3300025914 | Ga0207671_10013363 | Ga0207671_100133633 | 129 |
| 875 | 3300025914 | Ga0207671_10018120 | Ga0207671_100181204 | 129 |
| 876 | 3300025914 | Ga0207671_10020602 | Ga0207671_100206026 | 129 |
| 877 | 3300025914 | Ga0207671_10034795 | Ga0207671_100347956 | 129 |
| 878 | 3300025914 | Ga0207671_10072375 | Ga0207671_100723753 | 129 |
| 879 | 3300025914 | Ga0207671_10722220 | Ga0207671_107222202 | 129 |
| 880 | 3300025914 | Ga0207671_10847229 | Ga0207671_108472292 | 129 |
| 881 | 3300025917 | Ga0207660_10360566 | Ga0207660_103605662 | 129 |
| 882 | 3300025919 | Ga0207657_10055251 | Ga0207657_100552514 | 129 |
| 883 | 3300025919 | Ga0207657_10111319 | Ga0207657_101113192 | 129 |
| 884 | 3300025919 | Ga0207657_10231799 | Ga0207657_102317992 | 129 |
| 885 | 3300025919 | Ga0207657_10398871 | Ga0207657_103988711 | 129 |
| 886 | 3300025920 | Ga0207649_10253338 | Ga0207649_102533382 | 129 |
| 887 | 3300025921 | Ga0207652_10002419 | Ga0207652_1000241912 | 129 |
| 888 | 3300025921 | Ga0207652_10095693 | Ga0207652_100956933 | 129 |
| 889 | 3300025921 | Ga0207652_11552987 | Ga0207652_115529871 | 129 |
| 890 | 3300025923 | Ga0207681_10486661 | Ga0207681_104866612 | 129 |
| 891 | 3300025924 | Ga0207694_10009649 | Ga0207694_1000964915 | 129 |
| 892 | 3300025924 | Ga0207694_10042226 | Ga0207694_100422265 | 129 |
| 893 | 3300025927 | Ga0207687_11130250 | Ga0207687_111302501 | 129 |
| 894 | 3300025929 | Ga0207664_10602438 | Ga0207664_106024382 | 129 |
| 895 | 3300025932 | Ga0207690_10000936 | Ga0207690_1000093613 | 129 |
| 896 | 3300025932 | Ga0207690_10069096 | Ga0207690_100690963 | 129 |
| 897 | 3300025933 | Ga0207706_10019009 | Ga0207706_100190098 | 129 |
| 898 | 3300025933 | Ga0207706_10854126 | Ga0207706_108541262 | 129 |
| 899 | 3300025934 | Ga0207686_10187305 | Ga0207686_101873051 | 129 |
| 900 | 3300025935 | Ga0207709_10000026 | Ga0207709_10000026225 | 129 |
| 901 | 3300025935 | Ga0207709_10000084 | Ga0207709_10000084128 | 129 |
| 902 | 3300025935 | Ga0207709_10020248 | Ga0207709_100202484 | 129 |
| 903 | 3300025935 | Ga0207709_11582225 | Ga0207709_115822251 | 129 |
| 904 | 3300025938 | Ga0207704_10000036 | Ga0207704_1000003661 | 129 |
| 905 | 3300025940 | Ga0207691_10275349 | Ga0207691_102753492 | 129 |
| 906 | 3300025942 | Ga0207689_10558361 | Ga0207689_105583612 | 129 |
| 907 | 3300025944 | Ga0207661_10013292 | Ga0207661_100132926 | 129 |
| 908 | 3300025944 | Ga0207661_10014621 | Ga0207661_100146218 | 129 |
| 909 | 3300025949 | Ga0207667_10000430 | Ga0207667_1000043035 | 129 |
| 910 | 3300025949 | Ga0207667_10022849 | Ga0207667_100228493 | 129 |
| 911 | 3300025949 | Ga0207667_10023666 | Ga0207667_100236667 | 129 |
| 912 | 3300025949 | Ga0207667_10041900 | Ga0207667_100419003 | 129 |
| 913 | 3300025949 | Ga0207667_10093127 | Ga0207667_100931273 | 129 |
| 914 | 3300025949 | Ga0207667_10242746 | Ga0207667_102427463 | 129 |
| 915 | 3300025949 | Ga0207667_10265903 | Ga0207667_102659031 | 129 |
| 916 | 3300025960 | Ga0207651_10009416 | Ga0207651_100094163 | 129 |
| 917 | 3300025961 | Ga0207712_10542484 | Ga0207712_105424841 | 129 |
| 918 | 3300025972 | Ga0207668_10020698 | Ga0207668_100206983 | 129 |
| 919 | 3300025972 | Ga0207668_11671342 | Ga0207668_116713421 | 129 |
| 920 | 3300025981 | Ga0207640_10192986 | Ga0207640_101929861 | 129 |
| 921 | 3300025981 | Ga0207640_10912444 | Ga0207640_109124441 | 129 |
| 922 | 3300026023 | Ga0207677_11055425 | Ga0207677_110554251 | 129 |
| 923 | 3300026041 | Ga0207639_10167234 | Ga0207639_101672342 | 129 |
| 924 | 3300026041 | Ga0207639_10546031 | Ga0207639_105460311 | 129 |
| 925 | 3300026041 | Ga0207639_11132541 | Ga0207639_111325411 | 129 |
| 926 | 3300026078 | Ga0207702_10010443 | Ga0207702_100104438 | 129 |
| 927 | 3300026078 | Ga0207702_10068465 | Ga0207702_100684654 | 129 |
| 928 | 3300026078 | Ga0207702_10069982 | Ga0207702_100699824 | 129 |
| 929 | 3300026078 | Ga0207702_10311424 | Ga0207702_103114242 | 129 |
| 930 | 3300026078 | Ga0207702_10318830 | Ga0207702_103188303 | 129 |
| 931 | 3300026078 | Ga0207702_10322206 | Ga0207702_103222062 | 129 |
| 932 | 3300026078 | Ga0207702_10370041 | Ga0207702_103700412 | 129 |
| 933 | 3300026078 | Ga0207702_10567715 | Ga0207702_105677151 | 129 |
| 934 | 3300026078 | Ga0207702_12422588 | Ga0207702_124225882 | 129 |
| 935 | 3300026089 | Ga0207648_10000333 | Ga0207648_1000033327 | 129 |
| 936 | 3300026116 | Ga0207674_10641092 | Ga0207674_106410922 | 129 |
| 937 | 3300026116 | Ga0207674_10812864 | Ga0207674_108128642 | 129 |
| 938 | 3300026121 | Ga0207683_10003418 | Ga0207683_100034189 | 129 |
| 939 | 3300026142 | Ga0207698_10013453 | Ga0207698_100134532 | 129 |
| 940 | 3300026142 | Ga0207698_10150675 | Ga0207698_101506751 | 129 |
| 941 | 3300026142 | Ga0207698_10337062 | Ga0207698_103370622 | 129 |
| 942 | 3300028379 | Ga0268266_10000658 | Ga0268266_1000065826 | 129 |
| 943 | 3300028381 | Ga0268264_10861207 | Ga0268264_108612072 | 129 |
| 944 | 3300028573 | Ga0265334_10025950 | Ga0265334_100259505 | 129 |
| 945 | 3300028786 | Ga0307517_10012583 | Ga0307517_100125833 | 129 |
| 946 | 3300028786 | Ga0307517_10295128 | Ga0307517_102951282 | 129 |
| 947 | 3300028794 | Ga0307515_10179470 | Ga0307515_101794703 | 129 |
| 948 | 3300028794 | Ga0307515_10339301 | Ga0307515_103393011 | 129 |
| 949 | 3300028794 | Ga0307515_10669408 | Ga0307515_106694081 | 129 |
| 950 | 3300028800 | Ga0265338_10007954 | Ga0265338_1000795421 | 129 |
| 951 | 3300028800 | Ga0265338_10570954 | Ga0265338_105709542 | 129 |
| 952 | 3300030731 | Ga0316177_1073605 | Ga0316177_107360514 | 129 |
| 953 | 3300030732 | Ga0316176_1042405 | Ga0316176_10424055 | 129 |
| 954 | 3300030733 | Ga0314311_1036826 | Ga0314311_10368261 | 129 |
| 955 | 3300030742 | Ga0316183_1033300 | Ga0316183_103330020 | 129 |
| 956 | 3300030744 | Ga0316181_1034557 | Ga0316181_103455711 | 129 |
| 957 | 3300030745 | Ga0316182_1143329 | Ga0316182_11433292 | 129 |
| 958 | 3300030745 | Ga0316182_1415427 | Ga0316182_14154274 | 129 |
| 959 | 3300031249 | Ga0265339_10431907 | Ga0265339_104319071 | 129 |
| 960 | 3300031251 | Ga0265327_10075375 | Ga0265327_100753753 | 129 |
| 961 | 3300031251 | Ga0265327_10134823 | Ga0265327_101348232 | 129 |
| 962 | 3300031507 | Ga0307509_10114085 | Ga0307509_101140853 | 129 |
| 963 | 3300031548 | Ga0307408_100003785 | Ga0307408_10000378515 | 129 |
| 964 | 3300031548 | Ga0307408_100005144 | Ga0307408_1000051442 | 129 |
| 965 | 3300031548 | Ga0307408_100966780 | Ga0307408_1009667802 | 129 |
| 966 | 3300031727 | Ga0316576_10452242 | Ga0316576_104522422 | 129 |
| 967 | 3300031731 | Ga0307405_10000006 | Ga0307405_1000000672 | 129 |
| 968 | 3300031731 | Ga0307405_10080775 | Ga0307405_100807751 | 129 |
| 969 | 3300031731 | Ga0307405_10217445 | Ga0307405_102174452 | 129 |
| 970 | 3300031824 | Ga0307413_10464591 | Ga0307413_104645912 | 129 |
| 971 | 3300031824 | Ga0307413_10685145 | Ga0307413_106851452 | 129 |
| 972 | 3300031852 | Ga0307410_10428957 | Ga0307410_104289572 | 129 |
| 973 | 3300031903 | Ga0307407_10000003 | Ga0307407_10000003176 | 129 |
| 974 | 3300031911 | Ga0307412_10002079 | Ga0307412_1000207910 | 129 |
| 975 | 3300031911 | Ga0307412_10003796 | Ga0307412_100037965 | 129 |
| 976 | 3300031911 | Ga0307412_10012909 | Ga0307412_100129098 | 129 |
| 977 | 3300031911 | Ga0307412_10014929 | Ga0307412_100149292 | 129 |
| 978 | 3300031911 | Ga0307412_10041647 | Ga0307412_100416475 | 129 |
| 979 | 3300031911 | Ga0307412_10248062 | Ga0307412_102480622 | 129 |
| 980 | 3300031911 | Ga0307412_10465219 | Ga0307412_104652192 | 129 |
| 981 | 3300031911 | Ga0307412_10932103 | Ga0307412_109321032 | 129 |
| 982 | 3300031995 | Ga0307409_100068515 | Ga0307409_1000685152 | 129 |
| 983 | 3300032002 | Ga0307416_100000002 | Ga0307416_100000002420 | 129 |
| 984 | 3300032002 | Ga0307416_100000006 | Ga0307416_10000000671 | 129 |
| 985 | 3300032002 | Ga0307416_100079899 | Ga0307416_1000798995 | 129 |
| 986 | 3300032004 | Ga0307414_10000030 | Ga0307414_1000003015 | 129 |
| 987 | 3300032004 | Ga0307414_10005329 | Ga0307414_1000532910 | 129 |
| 988 | 3300032004 | Ga0307414_10005856 | Ga0307414_100058564 | 129 |
| 989 | 3300032004 | Ga0307414_10008647 | Ga0307414_100086477 | 129 |
| 990 | 3300032004 | Ga0307414_10009488 | Ga0307414_100094882 | 129 |
| 991 | 3300032004 | Ga0307414_10012166 | Ga0307414_100121662 | 129 |
| 992 | 3300032004 | Ga0307414_10065136 | Ga0307414_100651362 | 129 |
| 993 | 3300032004 | Ga0307414_10082843 | Ga0307414_100828435 | 129 |
| 994 | 3300032004 | Ga0307414_10085579 | Ga0307414_100855791 | 129 |
| 995 | 3300032004 | Ga0307414_10087301 | Ga0307414_100873013 | 129 |
| 996 | 3300032004 | Ga0307414_10126650 | Ga0307414_101266503 | 129 |
| 997 | 3300032004 | Ga0307414_10457857 | Ga0307414_104578572 | 129 |
| 998 | 3300032004 | Ga0307414_10606466 | Ga0307414_106064661 | 129 |
| 999 | 3300032004 | Ga0307414_10904314 | Ga0307414_109043142 | 129 |
| 1000 | 3300032004 | Ga0307414_11331723 | Ga0307414_113317232 | 129 |
| 1001 | 3300032004 | Ga0307414_11349251 | Ga0307414_113492512 | 129 |
| 1002 | 3300032005 | Ga0307411_10055855 | Ga0307411_100558554 | 129 |
| 1003 | 3300032005 | Ga0307411_10892300 | Ga0307411_108923002 | 129 |
| 1004 | 3300032005 | Ga0307411_11077058 | Ga0307411_110770582 | 129 |
| 1005 | 3300032005 | Ga0307411_11551145 | Ga0307411_115511451 | 129 |
| 1006 | 3300033179 | Ga0307507_10000034 | Ga0307507_10000034125 | 129 |
| 1007 | 3300033180 | Ga0307510_10003892 | Ga0307510_1000389211 | 129 |
| 1008 | 3300033524 | Ga0316592_1014787 | Ga0316592_10147873 | 129 |
| 1009 | 3300033527 | Ga0316586_1009678 | Ga0316586_10096783 | 129 |
| 1010 | 3300033528 | Ga0316588_1062965 | Ga0316588_10629652 | 129 |
| 1011 | 3300033529 | Ga0316587_1009264 | Ga0316587_10092642 | 129 |
| 1012 | 3300033541 | Ga0316596_1003898 | Ga0316596_10038984 | 129 |
| 1013 | 3300037312 | Ga0395899_0000034 | Ga0395899_0000034_32158_32547 | 129 |
| 1014 | 3300037312 | Ga0395899_0000472 | Ga0395899_0000472_39274_39663 | 129 |
| 1015 | 3300037312 | Ga0395899_0000499 | Ga0395899_0000499_39076_39465 | 129 |
| 1016 | 3300037312 | Ga0395899_0000673 | Ga0395899_0000673_13758_14177 | 129 |
| 1017 | 3300037418 | Ga0395900_0000346 | Ga0395900_0000346_42591_42980 | 129 |
| 1018 | 3300037418 | Ga0395900_0000441 | Ga0395900_0000441_755_1144 | 129 |
| 1019 | 3300037418 | Ga0395900_0169281 | Ga0395900_0169281_1578_1997 | 129 |
| 1020 | 3300037418 | Ga0395900_0208359 | Ga0395900_0208359_701_1129 | 129 |
| 1021 | 3300037418 | Ga0395900_0827767 | Ga0395900_0827767_181_570 | 129 |
| 1022 | 3300037466 | Ga0395898_0021701 | Ga0395898_0021701_1491_1880 | 129 |
| 1023 | 3300037466 | Ga0395898_1478469 | Ga0395898_1478469_74_463 | 129 |
| 1024 | 3300037471 | Ga0395905_0000376 | Ga0395905_0000376_21231_21644 | 129 |
| 1025 | 3300037471 | Ga0395905_0000528 | Ga0395905_0000528_25024_25413 | 129 |
| 1026 | 3300037471 | Ga0395905_0127136 | Ga0395905_0127136_1964_2353 | 129 |
| 1027 | 3300038443 | Ga0395901_0000351 | Ga0395901_0000351_24525_24914 | 129 |
| 1028 | 3300038443 | Ga0395901_0003122 | Ga0395901_0003122_2081_2497 | 129 |
| 1029 | 3300038443 | Ga0395901_0896929 | Ga0395901_0896929_129_518 | 129 |
| 1030 | 3300039447 | Ga0436361_0433548 | Ga0436361_0433548_6729_7118 | 129 |
| 1031 | 3300041413 | Ga0439465_0002928 | Ga0439465_0002928_1814_2203 | 129 |
| 1032 | 3300041442 | Ga0451788_26116 | Ga0451788_26116_75_464 | 129 |
| 1033 | 3300041444 | Ga0451790_03894 | Ga0451790_03894_226_615 | 129 |
| 1034 | 3300041444 | Ga0451790_24363 | Ga0451790_24363_102_491 | 129 |
| 1035 | 3300041444 | Ga0451790_25357 | Ga0451790_25357_70_459 | 129 |
| 1036 | 3300041444 | Ga0451790_36804 | Ga0451790_36804_24_413 | 129 |
| 1037 | 3300041445 | Ga0451792_07354 | Ga0451792_07354_64_453 | 129 |
| 1038 | 3300041446 | Ga0451794_08398 | Ga0451794_08398_46_435 | 129 |
| 1039 | 3300041446 | Ga0451794_24707 | Ga0451794_24707_380_769 | 129 |
| 1040 | 3300041446 | Ga0451794_25189 | Ga0451794_25189_90_479 | 129 |
| 1041 | 3300041451 | Ga0451791_1291585 | Ga0451791_1291585_343_732 | 129 |
| 1042 | 3300041452 | Ga0451793_0486272 | Ga0451793_0486272_376_765 | 129 |
| 1043 | 3300041458 | Ga0451798_0268261 | Ga0451798_0268261_35_424 | 129 |
| 1044 | 3300041486 | Ga0451807_1458215 | Ga0451807_1458215_100_489 | 129 |
| 1045 | 3300041507 | Ga0451851_0089935 | Ga0451851_0089935_471_860 | 129 |
| 1046 | 3300041916 | Ga0452271_37402 | Ga0452271_37402_292_681 | 129 |
| 1047 | 3300041916 | Ga0452271_80664 | Ga0452271_80664_76_465 | 129 |
| 1048 | 3300042004 | Ga0439445_0000090 | Ga0439445_0000090_13170_13559 | 129 |
| 1049 | 3300042005 | Ga0439448_0001990 | Ga0439448_0001990_909_1298 | 129 |
| 1050 | 3300042014 | Ga0439457_024112 | Ga0439457_024112_500_889 | 129 |
| 1051 | 3300042533 | Ga0450901_005819 | Ga0450901_005819_688_1077 | 129 |
| 1052 | 3300044684 | Ga0466966_0001476 | Ga0466966_0001476_12696_13085 | 129 |
| 1053 | 3300044693 | Ga0466961_0182800 | Ga0466961_0182800_746_1135 | 129 |
| 1054 | 3300044693 | Ga0466961_0863931 | Ga0466961_0863931_133_525 | 129 |
| 1055 | 3300045049 | Ga0466959_0124272 | Ga0466959_0124272_299_691 | 129 |
| 1056 | 3300045051 | Ga0451576_0047948 | Ga0451576_0047948_3139_3531 | 129 |
| 1057 | 3300045836 | Ga0466958_0007843 | Ga0466958_0007843_2400_2789 | 129 |
| 1058 | 3300046453 | Ga0495627_000022 | Ga0495627_000022_198007_198396 | 129 |
| 1059 | 3300046453 | Ga0495627_051473 | Ga0495627_051473_762_1151 | 129 |
| 1060 | 3300046454 | Ga0495592_0123750 | Ga0495592_0123750_1312_1701 | 129 |
| 1061 | 3300046457 | Ga0495590_0000627 | Ga0495590_0000627_10045_10434 | 129 |
| 1062 | 3300046460 | Ga0495638_0616280 | Ga0495638_0616280_16_405 | 129 |
| 1063 | 3300046462 | Ga0495651_0082640 | Ga0495651_0082640_822_1211 | 129 |
| 1064 | 3300046471 | Ga0495650_0000023 | Ga0495650_0000023_61364_61753 | 129 |
| 1065 | 3300046471 | Ga0495650_0122333 | Ga0495650_0122333_383_772 | 129 |
| 1066 | 3300046476 | Ga0495662_0053308 | Ga0495662_0053308_695_1105 | 129 |
| 1067 | 3300046492 | Ga0495585_0000476 | Ga0495585_0000476_36411_36800 | 129 |
| 1068 | 3300046492 | Ga0495585_0001907 | Ga0495585_0001907_12871_13260 | 129 |
| 1069 | 3300046492 | Ga0495585_0079477 | Ga0495585_0079477_837_1226 | 129 |
| 1070 | 3300046501 | Ga0495607_0068813 | Ga0495607_0068813_1486_1875 | 129 |
| 1071 | 3300046501 | Ga0495607_0109464 | Ga0495607_0109464_1001_1390 | 129 |
| 1072 | 3300046506 | Ga0495583_0045267 | Ga0495583_0045267_839_1228 | 129 |
| 1073 | 3300046507 | Ga0495606_0003554 | Ga0495606_0003554_5349_5738 | 129 |
| 1074 | 3300046507 | Ga0495606_0011558 | Ga0495606_0011558_2442_2831 | 129 |
| 1075 | 3300046507 | Ga0495606_0042764 | Ga0495606_0042764_2076_2465 | 129 |
| 1076 | 3300046507 | Ga0495606_0131694 | Ga0495606_0131694_234_623 | 129 |
| 1077 | 3300046507 | Ga0495606_0284996 | Ga0495606_0284996_123_512 | 129 |
| 1078 | 3300046507 | Ga0495606_0608547 | Ga0495606_0608547_134_523 | 129 |
| 1079 | 3300046512 | Ga0495610_0000005 | Ga0495610_0000005_188160_188549 | 129 |
| 1080 | 3300046512 | Ga0495610_0020639 | Ga0495610_0020639_175_564 | 129 |
| 1081 | 3300046512 | Ga0495610_0033472 | Ga0495610_0033472_760_1149 | 129 |
| 1082 | 3300046512 | Ga0495610_0155940 | Ga0495610_0155940_405_794 | 129 |
| 1083 | 3300046513 | Ga0495616_0022430 | Ga0495616_0022430_298_687 | 129 |
| 1084 | 3300046513 | Ga0495616_0073426 | Ga0495616_0073426_980_1369 | 129 |
| 1085 | 3300046513 | Ga0495616_0244907 | Ga0495616_0244907_56_445 | 129 |
| 1086 | 3300046516 | Ga0495628_1034669 | Ga0495628_1034669_53_442 | 129 |
| 1087 | 3300046518 | Ga0495631_0002385 | Ga0495631_0002385_4865_5254 | 129 |
| 1088 | 3300046518 | Ga0495631_0061979 | Ga0495631_0061979_643_1032 | 129 |
| 1089 | 3300046519 | Ga0495632_0004162 | Ga0495632_0004162_6458_6847 | 129 |
| 1090 | 3300046519 | Ga0495632_0110742 | Ga0495632_0110742_370_759 | 129 |
| 1091 | 3300046519 | Ga0495632_0520565 | Ga0495632_0520565_42_431 | 129 |
| 1092 | 3300046520 | Ga0495637_0066720 | Ga0495637_0066720_282_671 | 129 |
| 1093 | 3300046522 | Ga0495643_0024720 | Ga0495643_0024720_1693_2082 | 129 |
| 1094 | 3300046523 | Ga0495644_0017124 | Ga0495644_0017124_1180_1569 | 129 |
| 1095 | 3300046524 | Ga0495648_0017616 | Ga0495648_0017616_4007_4396 | 129 |
| 1096 | 3300046524 | Ga0495648_0098997 | Ga0495648_0098997_1059_1448 | 129 |
| 1097 | 3300046525 | Ga0495663_0000053 | Ga0495663_0000053_50262_50651 | 129 |
| 1098 | 3300046525 | Ga0495663_0019140 | Ga0495663_0019140_1364_1753 | 129 |
| 1099 | 3300046525 | Ga0495663_0081759 | Ga0495663_0081759_634_1023 | 129 |
| 1100 | 3300046528 | Ga0495642_0031330 | Ga0495642_0031330_886_1275 | 129 |
| 1101 | 3300046529 | Ga0495652_0033059 | Ga0495652_0033059_4072_4461 | 129 |
| 1102 | 3300046530 | Ga0495654_0000003 | Ga0495654_0000003_695997_696386 | 129 |
| 1103 | 3300046530 | Ga0495654_0070029 | Ga0495654_0070029_1242_1631 | 129 |
| 1104 | 3300046536 | Ga0495587_0586209 | Ga0495587_0586209_141_530 | 129 |
| 1105 | 3300046538 | Ga0495609_0000003 | Ga0495609_0000003_682385_682774 | 129 |
| 1106 | 3300046538 | Ga0495609_0004523 | Ga0495609_0004523_2867_3256 | 129 |
| 1107 | 3300046538 | Ga0495609_0006730 | Ga0495609_0006730_964_1353 | 129 |
| 1108 | 3300046538 | Ga0495609_0014049 | Ga0495609_0014049_1399_1788 | 129 |
| 1109 | 3300046542 | Ga0495597_0206106 | Ga0495597_0206106_138_527 | 129 |
| 1110 | 3300046558 | Ga0495633_0000072 | Ga0495633_0000072_84380_84769 | 129 |
| 1111 | 3300046558 | Ga0495633_0003150 | Ga0495633_0003150_1711_2100 | 129 |
| 1112 | 3300046558 | Ga0495633_0016150 | Ga0495633_0016150_2697_3086 | 129 |
| 1113 | 3300046558 | Ga0495633_0020940 | Ga0495633_0020940_1317_1706 | 129 |
| 1114 | 3300046558 | Ga0495633_0501692 | Ga0495633_0501692_42_431 | 129 |
| 1115 | 3300046616 | Ga0495668_0000165 | Ga0495668_0000165_4584_4973 | 129 |
| 1116 | 3300046616 | Ga0495668_0069683 | Ga0495668_0069683_535_924 | 129 |
| 1117 | 3300046642 | Ga0495634_0138088 | Ga0495634_0138088_278_688 | 129 |
| 1118 | 3300046642 | Ga0495634_0610215 | Ga0495634_0610215_16_405 | 129 |
| 1119 | 3300046648 | Ga0495611_0042182 | Ga0495611_0042182_183_572 | 129 |
| 1120 | 3300046660 | Ga0495625_0000096 | Ga0495625_0000096_82247_82636 | 129 |
| 1121 | 3300046660 | Ga0495625_0000308 | Ga0495625_0000308_10624_11013 | 129 |
| 1122 | 3300046660 | Ga0495625_0106019 | Ga0495625_0106019_1009_1398 | 129 |
| 1123 | 3300046660 | Ga0495625_0171535 | Ga0495625_0171535_541_930 | 129 |
| 1124 | 3300046660 | Ga0495625_0217728 | Ga0495625_0217728_572_961 | 129 |
| 1125 | 3300046660 | Ga0495625_0465596 | Ga0495625_0465596_67_456 | 129 |
| 1126 | 3300046665 | Ga0495661_0103742 | Ga0495661_0103742_135_524 | 129 |
| 1127 | 3300046665 | Ga0495661_0133006 | Ga0495661_0133006_155_544 | 129 |
| 1128 | 3300046674 | Ga0495588_0076305 | Ga0495588_0076305_1348_1737 | 129 |
| 1129 | 3300046683 | Ga0495658_0058588 | Ga0495658_0058588_564_953 | 129 |
| 1130 | 3300046684 | Ga0495669_0043303 | Ga0495669_0043303_875_1264 | 129 |
| 1131 | 3300046691 | Ga0495670_0127741 | Ga0495670_0127741_246_635 | 129 |
| 1132 | 3300046692 | Ga0495671_0036148 | Ga0495671_0036148_957_1346 | 129 |
| 1133 | 3300046694 | Ga0495649_0000105 | Ga0495649_0000105_63739_64128 | 129 |
| 1134 | 3300046694 | Ga0495649_0066186 | Ga0495649_0066186_311_700 | 129 |
| 1135 | 3300046794 | Ga0495589_0317863 | Ga0495589_0317863_284_673 | 129 |
| 1136 | 3300046809 | Ga0495600_0108075 | Ga0495600_0108075_818_1207 | 129 |
| 1137 | 3300046810 | Ga0495660_0256013 | Ga0495660_0256013_155_544 | 129 |
| 1138 | 3300047317 | Ga0495604_0590296 | Ga0495604_0590296_298_687 | 129 |
| 1139 | 3300047322 | Ga0495680_1103152 | Ga0495680_1103152_29_439 | 129 |
| 1140 | 3300047443 | Ga0495687_000233 | Ga0495687_000233_61896_62285 | 129 |
| 1141 | 3300047443 | Ga0495687_098283 | Ga0495687_098283_672_1061 | 129 |
| 1142 | 3300047447 | Ga0495685_050912 | Ga0495685_050912_482_871 | 129 |
| 1143 | 3300047469 | Ga0495673_0025163 | Ga0495673_0025163_33_422 | 129 |
| 1144 | 3300047470 | Ga0495681_0032669 | Ga0495681_0032669_799_1188 | 129 |
| 1145 | 3300047472 | Ga0495686_0000133 | Ga0495686_0000133_1571_1960 | 129 |
| 1146 | 3300047472 | Ga0495686_0002422 | Ga0495686_0002422_10199_10588 | 129 |
| 1147 | 3300047472 | Ga0495686_0010199 | Ga0495686_0010199_836_1225 | 129 |
| 1148 | 3300047472 | Ga0495686_0244332 | Ga0495686_0244332_227_616 | 129 |
| 1149 | 3300047472 | Ga0495686_0390316 | Ga0495686_0390316_189_578 | 129 |
| 1150 | 3300047472 | Ga0495686_0417035 | Ga0495686_0417035_225_614 | 129 |
| 1151 | 3300047673 | Ga0495593_0572900 | Ga0495593_0572900_168_557 | 129 |
| 1152 | 3300048089 | Ga0495614_0023016 | Ga0495614_0023016_644_1033 | 129 |
| 1153 | 3300048903 | Ga0496100_0514498 | Ga0496100_0514498_29_418 | 129 |
| 1154 | 3300048905 | Ga0496102_0094764 | Ga0496102_0094764_1741_2130 | 129 |
| 1155 | 3300048906 | Ga0496103_0207758 | Ga0496103_0207758_307_696 | 129 |
| 1156 | 3300048907 | Ga0496104_0513882 | Ga0496104_0513882_374_763 | 129 |
| 1157 | 3300048916 | Ga0496113_0105034 | Ga0496113_0105034_1246_1635 | 129 |
| 1158 | 3300048917 | Ga0496114_0091395 | Ga0496114_0091395_1887_2276 | 129 |
| 1159 | 3300048918 | Ga0496115_0738107 | Ga0496115_0738107_20_409 | 129 |
| 1160 | 3300048919 | Ga0496116_0000029 | Ga0496116_0000029_73352_73741 | 129 |
| 1161 | 3300048919 | Ga0496116_0005535 | Ga0496116_0005535_5637_6026 | 129 |
| 1162 | 3300048920 | Ga0496117_0000007 | Ga0496117_0000007_71730_72119 | 129 |
| 1163 | 3300048920 | Ga0496117_0001863 | Ga0496117_0001863_13649_14038 | 129 |
| 1164 | 3300048921 | Ga0496118_0022242 | Ga0496118_0022242_3781_4170 | 129 |
| 1165 | 3300048921 | Ga0496118_0025644 | Ga0496118_0025644_1106_1495 | 129 |
| 1166 | 3300048922 | Ga0496119_0000007 | Ga0496119_0000007_71797_72186 | 129 |
| 1167 | 3300048925 | Ga0496122_0000862 | Ga0496122_0000862_26015_26404 | 129 |
| 1168 | 3300048925 | Ga0496122_0006922 | Ga0496122_0006922_2761_3150 | 129 |
| 1169 | 3300048925 | Ga0496122_0025542 | Ga0496122_0025542_3127_3516 | 129 |
| 1170 | 3300048926 | Ga0496123_0013292 | Ga0496123_0013292_2973_3362 | 129 |
| 1171 | 3300048926 | Ga0496123_0015001 | Ga0496123_0015001_3439_3828 | 129 |
| 1172 | 3300048926 | Ga0496123_0058126 | Ga0496123_0058126_1913_2302 | 129 |
| 1173 | 3300048926 | Ga0496123_0211468 | Ga0496123_0211468_327_716 | 129 |
| 1174 | 3300048927 | Ga0496124_0013719 | Ga0496124_0013719_938_1327 | 129 |
| 1175 | 3300048927 | Ga0496124_0039503 | Ga0496124_0039503_1719_2108 | 129 |
| 1176 | 3300048927 | Ga0496124_0438807 | Ga0496124_0438807_121_510 | 129 |
| 1177 | 3300048928 | Ga0496125_0048493 | Ga0496125_0048493_402_791 | 129 |
| 1178 | 3300048928 | Ga0496125_0056896 | Ga0496125_0056896_1327_1716 | 129 |
| 1179 | 3300048928 | Ga0496125_0179552 | Ga0496125_0179552_838_1227 | 129 |
| 1180 | 3300048928 | Ga0496125_0758204 | Ga0496125_0758204_69_458 | 129 |
| 1181 | 3300048929 | Ga0496126_0002974 | Ga0496126_0002974_21176_21565 | 129 |
| 1182 | 3300049127 | Ga0501306_002387 | Ga0501306_002387_1071_1460 | 129 |
| 1183 | 3300049127 | Ga0501306_029242 | Ga0501306_029242_11_400 | 129 |
| 1184 | 3300049127 | Ga0501306_088956 | Ga0501306_088956_76_465 | 129 |
| 1185 | 3300049129 | Ga0501309_079192 | Ga0501309_079192_40_429 | 129 |
| 1186 | 3300049130 | Ga0501310_006583 | Ga0501310_006583_177_566 | 129 |
| 1187 | 3300049130 | Ga0501310_044778 | Ga0501310_044778_172_561 | 129 |
| 1188 | 3300049130 | Ga0501310_048367 | Ga0501310_048367_155_544 | 129 |
| 1189 | 3300049132 | Ga0501343_016908 | Ga0501343_016908_82_471 | 129 |
| 1190 | 3300049161 | Ga0501305_006266 | Ga0501305_006266_197_586 | 129 |
| 1191 | 3300049161 | Ga0501305_013964 | Ga0501305_013964_80_469 | 129 |
| 1192 | 3300049162 | Ga0501307_003414 | Ga0501307_003414_1047_1436 | 129 |
| 1193 | 3300049162 | Ga0501307_005780 | Ga0501307_005780_342_731 | 129 |
| 1194 | 3300049459 | Ga0495678_012530 | Ga0495678_012530_2003_2392 | 129 |
| 1195 | 3300049460 | Ga0495682_0007766 | Ga0495682_0007766_2165_2554 | 129 |
| 1196 | 3300049527 | Ga0501311_013259 | Ga0501311_013259_216_605 | 129 |
| 1197 | 3300049528 | Ga0501312_007913 | Ga0501312_007913_804_1193 | 129 |
| 1198 | 3300049531 | Ga0501315_004584 | Ga0501315_004584_866_1255 | 129 |
| 1199 | 3300049531 | Ga0501315_009200 | Ga0501315_009200_260_649 | 129 |
| 1200 | 3300049531 | Ga0501315_020543 | Ga0501315_020543_393_782 | 129 |
| 1201 | 3300049531 | Ga0501315_089576 | Ga0501315_089576_62_451 | 129 |
| 1202 | 3300049532 | Ga0501316_001608 | Ga0501316_001608_1463_1852 | 129 |
| 1203 | 3300049532 | Ga0501316_027774 | Ga0501316_027774_53_442 | 129 |
| 1204 | 3300049532 | Ga0501316_042567 | Ga0501316_042567_143_532 | 129 |
| 1205 | 3300049533 | Ga0501317_036702 | Ga0501317_036702_177_566 | 129 |
| 1206 | 3300049535 | Ga0501319_001107 | Ga0501319_001107_12_401 | 129 |
| 1207 | 3300049536 | Ga0501320_004699 | Ga0501320_004699_528_917 | 129 |
| 1208 | 3300049536 | Ga0501320_013307 | Ga0501320_013307_342_731 | 129 |
| 1209 | 3300049536 | Ga0501320_050179 | Ga0501320_050179_98_487 | 129 |
| 1210 | 3300049537 | Ga0501321_000590 | Ga0501321_000590_1132_1521 | 129 |
| 1211 | 3300049537 | Ga0501321_008543 | Ga0501321_008543_407_796 | 129 |
| 1212 | 3300049537 | Ga0501321_066804 | Ga0501321_066804_63_452 | 129 |
| 1213 | 3300049539 | Ga0501323_015373 | Ga0501323_015373_116_505 | 129 |
| 1214 | 3300049539 | Ga0501323_020427 | Ga0501323_020427_177_566 | 129 |
| 1215 | 3300049540 | Ga0501324_014502 | Ga0501324_014502_308_697 | 129 |
| 1216 | 3300049541 | Ga0501325_013523 | Ga0501325_013523_178_567 | 129 |
| 1217 | 3300049543 | Ga0501327_01292 | Ga0501327_01292_334_723 | 129 |
| 1218 | 3300049544 | Ga0501328_11067 | Ga0501328_11067_42_431 | 129 |
| 1219 | 3300049545 | Ga0501329_13237 | Ga0501329_13237_21_410 | 129 |
| 1220 | 3300049546 | Ga0501330_001422 | Ga0501330_001422_316_705 | 129 |
| 1221 | 3300049546 | Ga0501330_006234 | Ga0501330_006234_313_702 | 129 |
| 1222 | 3300049549 | Ga0501333_009569 | Ga0501333_009569_223_615 | 129 |
| 1223 | 3300049550 | Ga0501334_01349 | Ga0501334_01349_334_723 | 129 |
| 1224 | 3300049551 | Ga0501335_000742 | Ga0501335_000742_952_1341 | 129 |
| 1225 | 3300049551 | Ga0501335_001452 | Ga0501335_001452_904_1293 | 129 |
| 1226 | 3300049551 | Ga0501335_008567 | Ga0501335_008567_302_691 | 129 |
| 1227 | 3300049551 | Ga0501335_014867 | Ga0501335_014867_230_619 | 129 |
| 1228 | 3300049551 | Ga0501335_020269 | Ga0501335_020269_57_446 | 129 |
| 1229 | 3300049551 | Ga0501335_035351 | Ga0501335_035351_14_403 | 129 |
| 1230 | 3300049552 | Ga0501336_009708 | Ga0501336_009708_177_566 | 129 |
| 1231 | 3300049552 | Ga0501336_009945 | Ga0501336_009945_177_566 | 129 |
| 1232 | 3300049553 | Ga0501337_001289 | Ga0501337_001289_509_898 | 129 |
| 1233 | 3300049553 | Ga0501337_003436 | Ga0501337_003436_208_597 | 129 |
| 1234 | 3300049556 | Ga0501340_001429 | Ga0501340_001429_659_1048 | 129 |
| 1235 | 3300049556 | Ga0501340_006416 | Ga0501340_006416_193_582 | 129 |
| 1236 | 3300049570 | Ga0501033_0131892 | Ga0501033_0131892_1337_1726 | 129 |
| 1237 | 3300049661 | Ga0501217_014128 | Ga0501217_014128_486_875 | 129 |
| 1238 | 3300049669 | Ga0501235_139173 | Ga0501235_139173_196_585 | 129 |
| 1239 | 3300049671 | Ga0501238_001674 | Ga0501238_001674_1940_2329 | 129 |
| 1240 | 3300049681 | Ga0501251_000697 | Ga0501251_000697_2470_2859 | 129 |
| 1241 | 3300049758 | Ga0501241_000002 | Ga0501241_000002_87190_87579 | 129 |
| 1242 | 3300049760 | Ga0501263_016694 | Ga0501263_016694_10_399 | 129 |
| 1243 | 3300049766 | Ga0501269_000004 | Ga0501269_000004_33313_33702 | 129 |
| 1244 | 3300049766 | Ga0501269_015808 | Ga0501269_015808_349_738 | 129 |
| 1245 | 3300049776 | Ga0501280_027081 | Ga0501280_027081_140_529 | 129 |
| 1246 | 3300050493 | nmdc:mga0k408_150668_c1 | nmdc:mga0k408_150668_c1_467_856 | 129 |
| 1247 | 3300050493 | nmdc:mga0k408_22365_c1 | nmdc:mga0k408_22365_c1_2468_2857 | 129 |
| 1248 | 3300050493 | nmdc:mga0k408_349_c2 | nmdc:mga0k408_349_c2_544_933 | 129 |
| 1249 | 3300050493 | nmdc:mga0k408_452852_c1 | nmdc:mga0k408_452852_c1_304_693 | 129 |
| 1250 | 3300050496 | nmdc:mga07m45_530437_c1 | nmdc:mga07m45_530437_c1_177_566 | 129 |
| 1251 | 3300050511 | nmdc:mga08y16_946750_c1 | nmdc:mga08y16_946750_c1_133_543 | 129 |
| 1252 | 3300053090 | Ga0500646_0064896 | Ga0500646_0064896_611_1021 | 129 |
| 1253 | 3300053093 | Ga0500651_0000078 | Ga0500651_0000078_16010_16399 | 129 |
| 1254 | 3300053098 | Ga0500650_0464662 | Ga0500650_0464662_60_449 | 129 |
| 1255 | 3300053122 | Ga0500608_000214 | Ga0500608_000214_21224_21613 | 129 |
| 1256 | 3300053122 | Ga0500608_087806 | Ga0500608_087806_83_472 | 129 |
| 1257 | 3300053125 | Ga0500618_000057 | Ga0500618_000057_4333_4722 | 129 |
| 1258 | 3300053130 | Ga0500642_0057580 | Ga0500642_0057580_915_1304 | 129 |
| 1259 | 3300053131 | Ga0500652_245013 | Ga0500652_245013_60_449 | 129 |
| 1260 | 3300053136 | Ga0500559_0173989 | Ga0500559_0173989_359_748 | 129 |
| 1261 | 3300053137 | Ga0500561_0057890 | Ga0500561_0057890_612_1001 | 129 |
| 1262 | 3300053138 | Ga0500564_099097 | Ga0500564_099097_266_655 | 129 |
| 1263 | 3300053139 | Ga0500568_0122186 | Ga0500568_0122186_273_662 | 129 |
| 1264 | 3300053140 | Ga0500573_0377679 | Ga0500573_0377679_28_417 | 129 |
| 1265 | 3300053143 | Ga0500579_261869 | Ga0500579_261869_59_448 | 129 |
| 1266 | 3300053146 | Ga0500588_0421235 | Ga0500588_0421235_23_412 | 129 |
| 1267 | 3300053153 | Ga0500616_0068519 | Ga0500616_0068519_1256_1645 | 129 |
| 1268 | 3300053157 | Ga0500624_000412 | Ga0500624_000412_1321_1710 | 129 |
| 1269 | 3300053161 | Ga0500634_0195996 | Ga0500634_0195996_452_841 | 129 |
| 1270 | 3300053730 | Ga0500645_045549 | Ga0500645_045549_265_654 | 129 |
| 1271 | 3300059478 | Ga0587093_002351 | Ga0587093_002351_524_913 | 129 |
| 1272 | 3300059478 | Ga0587093_005525 | Ga0587093_005525_553_945 | 129 |
| 1273 | 3300059478 | Ga0587093_008088 | Ga0587093_008088_43_486 | 129 |
| 1274 | 3300059490 | Ga0587066_001010 | Ga0587066_001010_1926_2315 | 129 |
| 1275 | 3300059491 | Ga0587070_012110 | Ga0587070_012110_168_557 | 129 |
| 1276 | 3300059491 | Ga0587070_077901 | Ga0587070_077901_146_574 | 129 |
| 1277 | 3300059492 | Ga0587073_0004228 | Ga0587073_0004228_783_1175 | 129 |
| 1278 | 3300059492 | Ga0587073_0136105 | Ga0587073_0136105_99_488 | 129 |
| 1279 | 3300059493 | Ga0587077_000755 | Ga0587077_000755_525_953 | 129 |
| 1280 | 3300059493 | Ga0587077_004049 | Ga0587077_004049_341_733 | 129 |
| 1281 | 3300059503 | Ga0587080_032855 | Ga0587080_032855_430_822 | 129 |
| 1282 | 3300059503 | Ga0587080_052037 | Ga0587080_052037_309_698 | 129 |
| 1283 | 3300059505 | Ga0587083_0007032 | Ga0587083_0007032_553_942 | 129 |
| 1284 | 3300059505 | Ga0587083_0009203 | Ga0587083_0009203_755_1147 | 129 |
| 1285 | 3300059505 | Ga0587083_0010186 | Ga0587083_0010186_263_652 | 129 |
| 1286 | 3300059505 | Ga0587083_0067751 | Ga0587083_0067751_51_440 | 129 |
| 1287 | 3300059507 | Ga0587086_069553 | Ga0587086_069553_144_533 | 129 |
| 1288 | 3300059508 | Ga0587088_002584 | Ga0587088_002584_633_1022 | 129 |
| 1289 | 3300059509 | Ga0587089_041766 | Ga0587089_041766_261_689 | 129 |
| 1290 | 3300059509 | Ga0587089_100535 | Ga0587089_100535_18_428 | 129 |
| 1291 | 3300059510 | Ga0587090_035231 | Ga0587090_035231_128_517 | 129 |
| 1292 | 3300059511 | Ga0587091_007866 | Ga0587091_007866_1021_1410 | 129 |
| 1293 | 3300059511 | Ga0587091_071736 | Ga0587091_071736_165_554 | 129 |
| 1294 | 3300059512 | Ga0587092_004572 | Ga0587092_004572_836_1225 | 129 |
| 1295 | 3300059512 | Ga0587092_005398 | Ga0587092_005398_667_1056 | 129 |
| 1296 | 3300059512 | Ga0587092_034923 | Ga0587092_034923_362_790 | 129 |
| 1297 | 3300059513 | Ga0587094_013211 | Ga0587094_013211_646_1035 | 129 |
| 1298 | 3300059513 | Ga0587094_027056 | Ga0587094_027056_126_515 | 129 |
| 1299 | 3300059514 | Ga0587095_006475 | Ga0587095_006475_131_520 | 129 |
| 1300 | 3300059605 | Ga0587106_000803 | Ga0587106_000803_2024_2413 | 129 |
| 1301 | 3300059624 | Ga0587109_069356 | Ga0587109_069356_32_424 | 129 |
| 1302 | 3300059627 | Ga0587117_033747 | Ga0587117_033747_72_461 | 129 |
| 1303 | 3300059639 | Ga0587062_029117 | Ga0587062_029117_128_517 | 129 |
| 1304 | 3300059640 | Ga0587067_011887 | Ga0587067_011887_103_492 | 129 |
| 1305 | 3300059640 | Ga0587067_026246 | Ga0587067_026246_396_788 | 129 |
| 1306 | 3300059641 | Ga0587068_030243 | Ga0587068_030243_519_908 | 129 |
| 1307 | 3300059641 | Ga0587068_042434 | Ga0587068_042434_144_554 | 129 |
| 1308 | 3300059642 | Ga0587069_010109 | Ga0587069_010109_780_1169 | 129 |
| 1309 | 3300059645 | Ga0587076_001180 | Ga0587076_001180_1437_1826 | 129 |
| 1310 | 3300059645 | Ga0587076_007250 | Ga0587076_007250_31_420 | 129 |
| 1311 | 3300059645 | Ga0587076_018545 | Ga0587076_018545_552_944 | 129 |
| 1312 | 3300059645 | Ga0587076_031564 | Ga0587076_031564_459_869 | 129 |
| 1313 | 3300059645 | Ga0587076_067595 | Ga0587076_067595_40_468 | 129 |
| 1314 | 3300059647 | Ga0587079_096182 | Ga0587079_096182_272_661 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9519 | 16 | 115 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9466 | 16 | 107 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9368 | 16 | 107 |
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9338 | 16 | 115 |
| 4v48-assembly1.cif.gz_BK | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9222 | 17 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q23155_77_208_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8709 | 17 | 129 | 3.30.420.80 |
| af_Q9VEN6_71_200_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.87 | 17 | 129 | 3.30.420.80 |
| af_P9WH65_1_139_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8588 | 1 | 129 | 3.30.420.80 |
| af_P9WH65_1_139_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8527 | 1 | 129 | 3.30.420.80 |
| 4ujzP00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8469 | 18 | 128 | 3.30.420.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0RPL5-F1-model_v4 | 30S ribosomal protein S11 | 0.9597 | 20 | 108 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3D0RPL5-F1-model_v4 | 30S ribosomal protein S11 | 0.9492 | 20 | 108 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-H1DBZ7-F1-model_v4 | deleted | 0.9301 | 33 | 110 |
|
| AF-A0A6J1V4G7-F1-model_v4 | 28S ribosomal protein S11, mitochondrial | 0.9226 | 17 | 122 |
GO:0003735
GO:0005763 GO:0006412 |
| AF-A0A6P1B509-F1-model_v4 | deleted | 0.9206 | 39 | 113 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar