F492902

General Info

Members Datasets Scaffolds Average Seq Length
1314 592 1200 128

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0637847|Ga0453684_0637847_661_1065
Length 125
Sequence MGTPTKRPGPTRPSKKEGKGVAQGLACIQATFNNTIVTITDPTGNVVTWASAGSVGFKGSRKSTPFAAQMIAQGMKEVKVFVKGPGAGREAAIRSLQAAGLEITAIKDVTPIPHNGCRPRKRRRV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
5 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
6 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
7 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
8 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
9 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
10 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
11 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
12 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
13 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
14 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
15 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
16 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
17 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
18 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
19 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
20 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
21 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
22 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
23 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
24 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
25 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
26 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
27 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
28 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
29 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
30 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
31 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
32 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
33 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
34 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
35 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
36 2738541283 Pedobacter sp. OK701 Isolate Unclassified
37 2738541284 Pedobacter sp. YR016 Isolate Unclassified
38 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
39 2738541302 Pedobacter sp. CF074 Isolate Unclassified
40 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
41 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
42 2738543023 Pedobacter sp. OK628 Isolate Unclassified
43 2739367651 Pedobacter sp. OK291 Isolate Unclassified
44 2739367656 Pedobacter sp. CF523 Isolate Unclassified
45 2739367663 Pedobacter sp. YR510 Isolate Unclassified
46 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
47 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
48 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
49 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
50 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
51 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
52 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
53 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
54 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
55 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
56 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
57 2818991437 Pedobacter terrae 518 Isolate Unclassified
58 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
59 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
60 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
61 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
62 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
63 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
64 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
65 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
66 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
67 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
68 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
69 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
70 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
71 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
72 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
73 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
74 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
75 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
76 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
77 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
78 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
79 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
80 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
81 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
82 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
83 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
84 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
85 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
86 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
87 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
88 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
89 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
90 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
91 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
92 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
93 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
94 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
95 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
96 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
97 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
98 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
99 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
100 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
101 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
102 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
103 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
104 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
105 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
106 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
107 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
108 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
109 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
110 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
111 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
112 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
113 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
114 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
115 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
116 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
117 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
118 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
119 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
120 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
121 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
122 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
123 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
124 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
125 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
126 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
127 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
128 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
129 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
130 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
131 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
132 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
133 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
134 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
137 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
139 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
140 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
141 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
142 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
143 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
144 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
145 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
146 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
147 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
148 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
149 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
150 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
151 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
152 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
156 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
157 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
158 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
159 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
160 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
161 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
162 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
163 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
164 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
165 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
166 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
167 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
168 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
169 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
170 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
171 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
172 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
173 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
174 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
175 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
176 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
177 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
178 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
179 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
180 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
181 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
182 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
183 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
184 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
186 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
187 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
188 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
190 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
191 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
192 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
193 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
194 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
195 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
196 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
197 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
198 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
199 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
200 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
201 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
202 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
203 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
204 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
205 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
206 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
207 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
208 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
209 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
210 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
211 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
212 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
213 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
214 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
215 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
216 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
217 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
218 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
219 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
220 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
221 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
222 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
223 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
224 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
225 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
226 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
229 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
233 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
234 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
236 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
237 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
239 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
240 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
241 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
242 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
244 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
245 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
248 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
249 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
294 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
295 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
300 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
303 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
304 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
305 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
306 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
307 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
308 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
309 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
310 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
311 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
312 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
313 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
314 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
315 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
316 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
317 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
318 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
319 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
320 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
321 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
322 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
323 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
324 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
325 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
326 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
327 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
328 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
329 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
330 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
331 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
332 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
333 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
334 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
335 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
336 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
337 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
338 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
339 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
340 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
341 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
342 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
344 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
345 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
351 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
352 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
353 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
354 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
355 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
356 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
357 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
358 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
359 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
360 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
361 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
362 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
363 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
364 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
365 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
366 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
367 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
368 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
369 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
370 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
371 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
372 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
373 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
374 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
375 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
376 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
377 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
378 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
379 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
380 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
381 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
382 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
383 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
384 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
385 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
386 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
387 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
388 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
389 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
390 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
391 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
392 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
393 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
394 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
395 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
396 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
397 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
398 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
399 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
400 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
401 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
402 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
403 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
404 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
405 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
406 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
407 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
408 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
409 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
410 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
411 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
412 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
413 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
414 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
415 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
416 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
417 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
418 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
419 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
420 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
421 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
422 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
423 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
424 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
425 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
426 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
427 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
428 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
429 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
430 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
431 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
432 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
433 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
434 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
437 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
438 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
439 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
440 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
441 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
442 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
443 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
444 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
445 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
446 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
447 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
448 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
449 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
450 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
451 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
452 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
453 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
454 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
455 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
456 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
457 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
458 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
459 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
460 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
461 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
475 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
476 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
506 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
508 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
516 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
517 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
518 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
519 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
520 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
521 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
522 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
523 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
524 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
525 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
526 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
527 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
528 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
529 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
530 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
531 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
532 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
533 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
535 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
536 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
537 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
538 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
539 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
540 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
541 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
542 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
543 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
544 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
545 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
546 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
547 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
548 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
549 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
550 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
551 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
552 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
553 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
554 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
555 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
556 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
557 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
558 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
559 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
560 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
561 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
562 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
563 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
588 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
589 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
590 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
591 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
592 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.66
Metatranscriptomes 16.67
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 4.87
Nodule 0.53
Rhizoplane 2.44
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 8.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_24813 2124908027 Bacteria 958
2 SwRhRL2b_contig_156102 2162886007 Bacteria 1577
3 SwRhRL2b_contig_1853401 2162886007 Bacteria 2479
4 SwRhRL2b_contig_2489919 2162886007 Bacteria 1072
5 SwRhRL2b_contig_3583939 2162886007 Bacteria 2057
6 MRS1b_contig_1810326 2162886011 Bacteria 979
7 2214800779 2209111006 Bacteria 2080
8 JGI24741J21665_1003251 3300001915 Bacteria 3929
9 JGI24740J21852_10008913 3300001979 Bacteria 3965
10 JGI24740J21852_10033543 3300001979 Bacteria 1628
11 JGI24737J22298_10001860 3300001990 Bacteria 7545
12 JGI24735J21928_10000003 3300002067 Bacteria 385983
13 JGI24735J21928_10005021 3300002067 Bacteria 4405
14 JGI24744J21845_10001128 3300002077 Bacteria 5201
15 JGI25162J39368_1000039 3300002737 Bacteria 175976
16 JGI25162J39368_1001202 3300002737 Bacteria 15113
17 JGI25164J39214_1001166 3300002772 Bacteria 7290
18 JGI25152J39213_1000006 3300002773 Bacteria 158516
19 JGI25150J39212_1000005 3300002774 Bacteria 311800
20 JGI25151J46595_10000004 3300003187 Bacteria 494006
21 JGI25165J46597_1000678 3300003214 Bacteria 27401
22 JGI25153J46596_10000004 3300003215 Bacteria 494006
23 Ga0006758J48902_1029451 3300003300 Bacteria 891
24 rootH1_10024556 3300003316 Bacteria 3314
25 rootH1_10160693 3300003316 Bacteria 1292
26 rootH2_10056635 3300003320 Bacteria 7076
27 rootL2_10101710 3300003322 Bacteria 4114
28 rootH1_10045781 3300003323 Bacteria 11513
29 rootH1_10193341 3300003323 Bacteria 1500
30 Ga0007409J51694_1063312 3300003575 Bacteria 2513
31 Ga0006562J51391_1003423 3300003578 Bacteria 13910
32 Ga0006562J51391_1007655 3300003578 Bacteria 3240
33 Ga0055536_1000004 3300003781 Bacteria 411108
34 Ga0055530_10000817 3300003791 Bacteria 25836
35 Ga0058863_10111335 3300004799 Bacteria 3480
36 Ga0058861_10176091 3300004800 Bacteria 3494
37 Ga0058860_10114316 3300004801 Bacteria 13584
38 Ga0058860_10142251 3300004801 Bacteria 2938
39 Ga0058862_10102512 3300004803 Bacteria 4102
40 Ga0065717_1001968 3300005276 Bacteria 4650
41 Ga0065716_1002480 3300005277 Bacteria 1749
42 Ga0065714_10002624 3300005288 Bacteria 24311
43 Ga0065714_10005956 3300005288 Bacteria 4227
44 Ga0065714_10009786 3300005288 Bacteria 2823
45 Ga0065714_10013697 3300005288 Bacteria 1653
46 Ga0065714_10022334 3300005288 Bacteria 1051
47 Ga0065714_10045584 3300005288 Bacteria 720
48 Ga0065714_10047236 3300005288 Bacteria 915
49 Ga0065714_10079789 3300005288 Bacteria 2486
50 Ga0065714_10102584 3300005288 Bacteria 1620
51 Ga0065714_10160851 3300005288 Bacteria 1052
52 Ga0065714_10163029 3300005288 Bacteria 1034
53 Ga0065714_10250665 3300005288 Bacteria 775
54 Ga0065704_10000307 3300005289 Bacteria 35767
55 Ga0065704_10004597 3300005289 Bacteria 3633
56 Ga0065704_10073035 3300005289 Bacteria 7653
57 Ga0065704_10078273 3300005289 Bacteria 4471
58 Ga0065704_10082398 3300005289 Bacteria 3606
59 Ga0065704_10096211 3300005289 Bacteria 2436
60 Ga0065704_10102101 3300005289 Bacteria 2215
61 Ga0065704_10177771 3300005289 Bacteria 1220
62 Ga0065704_10269193 3300005289 Bacteria 947
63 Ga0065704_10346795 3300005289 Bacteria 810
64 Ga0065704_10399407 3300005289 Bacteria 753
65 Ga0065704_10458670 3300005289 Bacteria 699
66 Ga0065715_10036832 3300005293 Bacteria 2618
67 Ga0065715_10521621 3300005293 Bacteria 763
68 Ga0065715_10569858 3300005293 Bacteria 699
69 Ga0065715_10866960 3300005293 Bacteria 584
70 Ga0065715_10927087 3300005293 Bacteria 561
71 Ga0070658_10000153 3300005327 Bacteria 60625
72 Ga0070658_10120312 3300005327 Bacteria 2181
73 Ga0070658_10244897 3300005327 Bacteria 1520
74 Ga0070676_10000312 3300005328 Bacteria 21945
75 Ga0070683_100018688 3300005329 Bacteria 6143
76 Ga0070683_100032136 3300005329 Bacteria 4777
77 Ga0070690_100580742 3300005330 Bacteria 848
78 Ga0070670_100135400 3300005331 Bacteria 2129
79 Ga0070680_100005676 3300005336 Bacteria 9464
80 Ga0070682_100000768 3300005337 Bacteria 18980
81 Ga0068868_100104416 3300005338 Bacteria 2296
82 Ga0068868_100118877 3300005338 Bacteria 2154
83 Ga0070660_100043744 3300005339 Bacteria 3423
84 Ga0070660_100057675 3300005339 Bacteria 3009
85 Ga0070691_10252658 3300005341 Bacteria 946
86 Ga0070668_100276810 3300005347 Bacteria 1400
87 Ga0070669_100349495 3300005353 Bacteria 1200
88 Ga0070671_100045958 3300005355 Bacteria 3631
89 Ga0070671_101121230 3300005355 Bacteria 691
90 Ga0070674_100123468 3300005356 Bacteria 1920
91 Ga0070673_100043212 3300005364 Bacteria 3480
92 Ga0070659_100000375 3300005366 Bacteria 33764
93 Ga0070659_101692991 3300005366 Bacteria 566
94 Ga0070667_101647679 3300005367 Bacteria 603
95 Ga0070678_100032095 3300005456 Bacteria 3631
96 Ga0070678_100234064 3300005456 Bacteria 1533
97 Ga0070662_100000074 3300005457 Bacteria 54943
98 Ga0070662_100794941 3300005457 Bacteria 804
99 Ga0070681_10002985 3300005458 Bacteria 15692
100 Ga0068867_100010877 3300005459 Bacteria 6418
101 Ga0068867_100970210 3300005459 Bacteria 769
102 Ga0074259_10883899 3300005507 Bacteria 545
103 Ga0070679_100006255 3300005530 Bacteria 11090
104 Ga0070679_100727393 3300005530 Bacteria 935
105 Ga0070684_100006351 3300005535 Bacteria 9136
106 Ga0070684_100723154 3300005535 Bacteria 929
107 Ga0068853_100150954 3300005539 Bacteria 2092
108 Ga0068853_100167326 3300005539 Bacteria 1987
109 Ga0070693_101517646 3300005547 Bacteria 524
110 Ga0070665_100000372 3300005548 Bacteria 66748
111 Ga0070704_101084299 3300005549 Bacteria 727
112 Ga0068855_100000360 3300005563 Bacteria 56448
113 Ga0068855_100012268 3300005563 Bacteria 10356
114 Ga0068855_100025831 3300005563 Bacteria 7023
115 Ga0068855_100061070 3300005563 Bacteria 4405
116 Ga0068855_100071470 3300005563 Bacteria 4035
117 Ga0068855_100279474 3300005563 Bacteria 1854
118 Ga0068855_100524481 3300005563 Bacteria 1285
119 Ga0068855_100671044 3300005563 Bacteria 1112
120 Ga0068855_100814966 3300005563 Bacteria 991
121 Ga0068855_100859569 3300005563 Bacteria 961
122 Ga0068855_102101977 3300005563 Bacteria 569
123 Ga0068857_100489716 3300005577 Bacteria 1153
124 Ga0068854_100266832 3300005578 Bacteria 1373
125 Ga0068854_100936506 3300005578 Bacteria 763
126 Ga0068856_100016148 3300005614 Bacteria 7219
127 Ga0068856_100058008 3300005614 Bacteria 3823
128 Ga0068856_100147792 3300005614 Bacteria 2358
129 Ga0068856_100153582 3300005614 Bacteria 2312
130 Ga0068856_100340133 3300005614 Bacteria 1519
131 Ga0068856_100423074 3300005614 Bacteria 1352
132 Ga0068856_100667106 3300005614 Bacteria 1060
133 Ga0068852_100010466 3300005616 Bacteria 6935
134 Ga0068852_100268045 3300005616 Bacteria 1642
135 Ga0068852_100411938 3300005616 Bacteria 1332
136 Ga0068852_100462537 3300005616 Bacteria 1258
137 Ga0068852_101512163 3300005616 Bacteria 694
138 Ga0068859_102399722 3300005617 Bacteria 581
139 Ga0068859_102708143 3300005617 Bacteria 545
140 Ga0068866_10152156 3300005718 Bacteria 1341
141 Ga0068863_100897056 3300005841 Bacteria 887
142 Ga0068863_101631036 3300005841 Unclassified 654
143 Ga0068863_101913908 3300005841 Bacteria 603
144 Ga0068860_100562306 3300005843 Bacteria 1143
145 Ga0070716_100062251 3300006173 Bacteria 2163
146 Ga0075362_10012264 3300006177 Bacteria 3401
147 Ga0075369_10350950 3300006186 Bacteria 692
148 Ga0075366_10089546 3300006195 Bacteria 1843
149 Ga0075366_10252599 3300006195 Bacteria 1076
150 Ga0097621_100007799 3300006237 Bacteria 7678
151 Ga0097621_100200943 3300006237 Bacteria 1730
152 Ga0075370_10177105 3300006353 Bacteria 1254
153 Ga0068871_100000141 3300006358 Bacteria 46656
154 Ga0068871_100350639 3300006358 Bacteria 1305
155 Ga0068865_100000917 3300006881 Bacteria 16715
156 Ga0097620_102399396 3300006931 Bacteria 581
157 Ga0097620_102707874 3300006931 Bacteria 545
158 Ga0099824_1003374 3300006942 Bacteria 23361
159 Ga0079104_1000280 3300006946 Bacteria 65859
160 Ga0099826_10000125 3300006948 Bacteria 34471
161 Ga0105251_10038077 3300009011 Bacteria 2357
162 Ga0105251_10057935 3300009011 Bacteria 1830
163 Ga0105251_10498151 3300009011 Bacteria 569
164 Ga0105244_10000027 3300009036 Bacteria 207569
165 Ga0105244_10000160 3300009036 Bacteria 69914
166 Ga0105244_10015827 3300009036 Bacteria 4315
167 Ga0105240_10000082 3300009093 Bacteria 195184
168 Ga0105240_10073384 3300009093 Bacteria 4225
169 Ga0105240_10204993 3300009093 Bacteria 2309
170 Ga0105240_10432476 3300009093 Bacteria 1476
171 Ga0105240_10481262 3300009093 Bacteria 1384
172 Ga0105240_10924097 3300009093 Bacteria 937
173 Ga0105240_10971270 3300009093 Bacteria 910
174 Ga0105240_11222634 3300009093 Bacteria 795
175 Ga0111539_11039008 3300009094 Bacteria 952
176 Ga0105245_10144700 3300009098 Bacteria 2242
177 Ga0105245_10812450 3300009098 Bacteria 973
178 Ga0105245_11624337 3300009098 Bacteria 698
179 Ga0105243_10000009 3300009148 Bacteria 354419
180 Ga0105243_10003612 3300009148 Bacteria 12456
181 Ga0105243_10014278 3300009148 Bacteria 6010
182 Ga0105241_10111599 3300009174 Bacteria 2189
183 Ga0105241_10177460 3300009174 Bacteria 1764
184 Ga0105241_10191865 3300009174 Bacteria 1701
185 Ga0105241_10555896 3300009174 Bacteria 1031
186 Ga0105241_11121315 3300009174 Bacteria 742
187 Ga0105241_11613001 3300009174 Bacteria 628
188 Ga0105242_10053982 3300009176 Bacteria 3283
189 Ga0105242_10227333 3300009176 Bacteria 1670
190 Ga0105242_10279101 3300009176 Bacteria 1517
191 Ga0105242_10692446 3300009176 Bacteria 996
192 Ga0105242_10847467 3300009176 Bacteria 909
193 Ga0105237_10000794 3300009545 Bacteria 43200
194 Ga0105237_10002553 3300009545 Bacteria 22488
195 Ga0105237_10006510 3300009545 Bacteria 12935
196 Ga0105237_10015313 3300009545 Bacteria 7986
197 Ga0105237_10015662 3300009545 Bacteria 7882
198 Ga0105237_10047854 3300009545 Bacteria 4300
199 Ga0105237_10071252 3300009545 Bacteria 3471
200 Ga0105237_10083942 3300009545 Bacteria 3175
201 Ga0105237_10185132 3300009545 Bacteria 2083
202 Ga0105237_11452365 3300009545 Bacteria 692
203 Ga0105238_10017754 3300009551 Bacteria 7234
204 Ga0105238_10194984 3300009551 Bacteria 2001
205 Ga0105249_10092720 3300009553 Bacteria 2828
206 Ga0105249_10192006 3300009553 Bacteria 1994
207 Ga0130086_1024805 3300009829 Bacteria 618
208 Ga0130085_1035330 3300009850 Bacteria 618
209 Ga0105239_10000011 3300010375 Bacteria 337500
210 Ga0105239_10005378 3300010375 Bacteria 15038
211 Ga0105239_10015682 3300010375 Bacteria 8387
212 Ga0105239_10248837 3300010375 Bacteria 1996
213 Ga0105239_10262733 3300010375 Bacteria 1940
214 Ga0105239_10429598 3300010375 Bacteria 1497
215 Ga0105239_12090703 3300010375 Bacteria 658
216 Ga0157327_1007676 3300012512 Bacteria 946
217 Ga0157373_10000006 3300013100 Bacteria 261768
218 Ga0157373_10001033 3300013100 Bacteria 21448
219 Ga0157373_10001369 3300013100 Bacteria 18710
220 Ga0157373_10002831 3300013100 Bacteria 13113
221 Ga0157373_10009996 3300013100 Bacteria 6992
222 Ga0157373_10028999 3300013100 Bacteria 3989
223 Ga0157373_10059430 3300013100 Bacteria 2709
224 Ga0157373_11166423 3300013100 Bacteria 580
225 Ga0157371_10000041 3300013102 Bacteria 203957
226 Ga0157371_10000091 3300013102 Bacteria 144664
227 Ga0157371_10001553 3300013102 Bacteria 23609
228 Ga0157371_10001678 3300013102 Bacteria 22612
229 Ga0157371_10013476 3300013102 Bacteria 6207
230 Ga0157371_10021684 3300013102 Bacteria 4713
231 Ga0157371_10033811 3300013102 Bacteria 3672
232 Ga0157370_10012207 3300013104 Bacteria 8929
233 Ga0157370_10014051 3300013104 Bacteria 8215
234 Ga0157370_10019740 3300013104 Bacteria 6747
235 Ga0157370_10041216 3300013104 Bacteria 4457
236 Ga0157370_10042074 3300013104 Bacteria 4404
237 Ga0157370_10073063 3300013104 Bacteria 3236
238 Ga0157370_10106885 3300013104 Bacteria 2618
239 Ga0157370_10327925 3300013104 Bacteria 1412
240 Ga0157370_10553788 3300013104 Bacteria 1054
241 Ga0157370_10693077 3300013104 Bacteria 930
242 Ga0157370_10856639 3300013104 Bacteria 826
243 Ga0157370_11487469 3300013104 Bacteria 609
244 Ga0157369_10000016 3300013105 Bacteria 257827
245 Ga0157369_10000613 3300013105 Bacteria 46357
246 Ga0157369_10008868 3300013105 Bacteria 11520
247 Ga0157369_10010007 3300013105 Bacteria 10831
248 Ga0157369_10030357 3300013105 Bacteria 5962
249 Ga0157369_10080886 3300013105 Bacteria 3478
250 Ga0157369_10408180 3300013105 Bacteria 1409
251 Ga0157369_11507817 3300013105 Bacteria 684
252 Ga0157374_10030641 3300013296 Bacteria 4886
253 Ga0157374_10077301 3300013296 Bacteria 3150
254 Ga0157374_10104516 3300013296 Bacteria 2719
255 Ga0157374_10208307 3300013296 Bacteria 1916
256 Ga0157374_10210459 3300013296 Bacteria 1906
257 Ga0157374_10371931 3300013296 Bacteria 1423
258 Ga0157374_10454107 3300013296 Bacteria 1283
259 Ga0157374_10986484 3300013296 Bacteria 861
260 Ga0157374_11416639 3300013296 Bacteria 718
261 Ga0157374_11420827 3300013296 Bacteria 717
262 Ga0157378_10008303 3300013297 Bacteria 9048
263 Ga0157378_10060889 3300013297 Bacteria 3368
264 Ga0157378_10378236 3300013297 Bacteria 1390
265 Ga0163162_10003331 3300013306 Bacteria 15374
266 Ga0163162_10033491 3300013306 Bacteria 5107
267 Ga0163162_10047580 3300013306 Bacteria 4298
268 Ga0163162_10068714 3300013306 Bacteria 3595
269 Ga0163162_10106514 3300013306 Bacteria 2899
270 Ga0163162_10278112 3300013306 Bacteria 1806
271 Ga0163162_11176876 3300013306 Bacteria 870
272 Ga0163162_11396126 3300013306 Bacteria 797
273 Ga0157372_10000030 3300013307 Bacteria 179925
274 Ga0157372_10000332 3300013307 Bacteria 51907
275 Ga0157372_10003430 3300013307 Bacteria 17111
276 Ga0157372_10011651 3300013307 Bacteria 9360
277 Ga0157372_10037880 3300013307 Bacteria 5321
278 Ga0157372_10129288 3300013307 Bacteria 2905
279 Ga0157372_10157361 3300013307 Bacteria 2625
280 Ga0157372_10903284 3300013307 Bacteria 1025
281 Ga0157375_10099030 3300013308 Bacteria 2993
282 Ga0157375_10904988 3300013308 Bacteria 1026
283 Ga0157375_11032639 3300013308 Bacteria 960
284 Ga0157375_11275906 3300013308 Bacteria 863
285 Ga0157375_11403714 3300013308 Bacteria 823
286 Ga0157375_11429406 3300013308 Bacteria 815
287 Ga0157375_11618320 3300013308 Bacteria 766
288 Ga0157375_13212846 3300013308 Bacteria 545
289 Ga0163163_10980641 3300014325 Bacteria 908
290 Ga0163163_11138066 3300014325 Bacteria 843
291 Ga0163163_11580757 3300014325 Bacteria 717
292 Ga0163163_12203559 3300014325 Bacteria 610
293 Ga0157380_10000051 3300014326 Bacteria 68466
294 Ga0157380_10946651 3300014326 Bacteria 891
295 Ga0182008_10000003 3300014497 Bacteria 456880
296 Ga0182008_10000034 3300014497 Bacteria 138235
297 Ga0182008_10001770 3300014497 Bacteria 14147
298 Ga0182008_10003643 3300014497 Bacteria 9192
299 Ga0182008_10111138 3300014497 Bacteria 1358
300 Ga0182008_10345321 3300014497 Bacteria 788
301 Ga0182008_10716442 3300014497 Bacteria 573
302 Ga0157377_10009989 3300014745 Bacteria 4682
303 Ga0157379_11114424 3300014968 Bacteria 756
304 Ga0157376_10125737 3300014969 Bacteria 2280
305 Ga0157376_10271219 3300014969 Bacteria 1594
306 Ga0182006_1000001 3300015261 Bacteria 1091090
307 Ga0182006_1000103 3300015261 Bacteria 93638
308 Ga0182006_1006389 3300015261 Bacteria 5486
309 Ga0182006_1008481 3300015261 Bacteria 4656
310 Ga0182006_1009290 3300015261 Bacteria 4412
311 Ga0182006_1062134 3300015261 Bacteria 1406
312 Ga0182006_1068748 3300015261 Bacteria 1318
313 Ga0182007_10000002 3300015262 Bacteria 564661
314 Ga0182007_10005771 3300015262 Bacteria 5382
315 Ga0182007_10015899 3300015262 Bacteria 2792
316 Ga0183373_1004 3300015682 Bacteria 537398
317 Ga0163161_10000039 3300017792 Bacteria 148130
318 Ga0163161_10000207 3300017792 Bacteria 53913
319 Ga0163161_10009312 3300017792 Bacteria 6794
320 Ga0163161_10039425 3300017792 Bacteria 3391
321 Ga0163161_10054256 3300017792 Bacteria 2908
322 Ga0163161_10097976 3300017792 Bacteria 2178
323 Ga0163161_10125798 3300017792 Bacteria 1930
324 Ga0163161_10317631 3300017792 Bacteria 1230
325 Ga0163161_10554453 3300017792 Bacteria 942
326 Ga0163161_10628450 3300017792 Bacteria 888
327 Ga0163161_10709095 3300017792 Bacteria 838
328 Ga0163161_10739282 3300017792 Bacteria 822
329 Ga0163161_11250984 3300017792 Bacteria 643
330 Ga0197907_10757494 3300020069 Bacteria 1550
331 Ga0197907_11138220 3300020069 Bacteria 1021
332 Ga0206356_10991038 3300020070 Bacteria 2728
333 Ga0206356_11209637 3300020070 Bacteria 1368
334 Ga0206356_11535795 3300020070 Bacteria 1012
335 Ga0206349_1692805 3300020075 Bacteria 840
336 Ga0206351_10267476 3300020077 Bacteria 15418
337 Ga0206351_10387294 3300020077 Bacteria 4610
338 Ga0206351_10512829 3300020077 Bacteria 15076
339 Ga0206351_10991482 3300020077 Bacteria 3143
340 Ga0206352_10226992 3300020078 Bacteria 1800
341 Ga0206352_10382572 3300020078 Bacteria 889
342 Ga0206352_10622029 3300020078 Bacteria 2482
343 Ga0206352_10835038 3300020078 Bacteria 2111
344 Ga0206350_10018304 3300020080 Bacteria 4056
345 Ga0206350_11221028 3300020080 Bacteria 1722
346 Ga0206354_10248047 3300020081 Bacteria 1770
347 Ga0206354_10263498 3300020081 Bacteria 1624
348 Ga0206354_11507030 3300020081 Bacteria 837
349 Ga0206353_10159245 3300020082 Bacteria 898
350 Ga0206353_10736142 3300020082 Bacteria 1941
351 Ga0154015_1024308 3300020610 Bacteria 3636
352 Ga0154015_1037437 3300020610 Bacteria 13281
353 Ga0154015_1309672 3300020610 Bacteria 3231
354 Ga0213872_10051000 3300021361 Bacteria 1878
355 Ga0224712_10004189 3300022467 Bacteria 3860
356 Ga0224712_10045345 3300022467 Bacteria 1682
357 Ga0224712_10082607 3300022467 Bacteria 1329
358 Ga0209563_127189 3300025230 Bacteria 575
359 Ga0207427_100025 3300025231 Bacteria 433726
360 Ga0209437_100010 3300025233 Bacteria 838447
361 Ga0209437_100135 3300025233 Bacteria 176455
362 Ga0207425_1000008 3300025245 Bacteria 618024
363 Ga0209026_1000610 3300025250 Bacteria 22917
364 Ga0209026_1004574 3300025250 Bacteria 4059
365 Ga0209148_1033295 3300025254 Bacteria 753
366 Ga0209148_1037006 3300025254 Bacteria 694
367 Ga0209129_1000040 3300025258 Bacteria 313043
368 Ga0209129_1049492 3300025258 Bacteria 645
369 Ga0209233_1000017 3300025261 Bacteria 898076
370 Ga0209233_1032971 3300025261 Bacteria 1192
371 Ga0209675_1000200 3300025291 Bacteria 63684
372 Ga0209676_1000009 3300025292 Bacteria 981719
373 Ga0209025_1000020 3300025294 Bacteria 618024
374 Ga0209758_1000022 3300025297 Bacteria 618024
375 Ga0209050_1000048 3300025298 Bacteria 371553
376 Ga0207655_1000016 3300025728 Bacteria 551476
377 Ga0207655_1000038 3300025728 Bacteria 348340
378 Ga0207655_1062533 3300025728 Bacteria 1431
379 Ga0207713_1057298 3300025735 Bacteria 1507
380 Ga0207642_10051496 3300025899 Bacteria 1863
381 Ga0207642_10122961 3300025899 Bacteria 1342
382 Ga0207647_10000303 3300025904 Bacteria 40536
383 Ga0207647_10032931 3300025904 Bacteria 3324
384 Ga0207647_10036461 3300025904 Bacteria 3124
385 Ga0207645_10000035 3300025907 Bacteria 89345
386 Ga0207705_10000108 3300025909 Bacteria 93501
387 Ga0207705_10328136 3300025909 Bacteria 1176
388 Ga0207654_10023808 3300025911 Bacteria 3286
389 Ga0207654_10124200 3300025911 Bacteria 1625
390 Ga0207654_10648325 3300025911 Bacteria 756
391 Ga0207654_10982565 3300025911 Bacteria 614
392 Ga0207707_10032972 3300025912 Bacteria 4534
393 Ga0207695_10000053 3300025913 Bacteria 396740
394 Ga0207695_10039657 3300025913 Bacteria 5060
395 Ga0207695_10062421 3300025913 Bacteria 3847
396 Ga0207695_10080728 3300025913 Bacteria 3293
397 Ga0207695_10085252 3300025913 Bacteria 3188
398 Ga0207695_10288044 3300025913 Bacteria 1535
399 Ga0207671_10005849 3300025914 Bacteria 11173
400 Ga0207671_10011776 3300025914 Bacteria 7082
401 Ga0207671_10013363 3300025914 Bacteria 6541
402 Ga0207671_10018120 3300025914 Bacteria 5410
403 Ga0207671_10020602 3300025914 Bacteria 5016
404 Ga0207671_10034795 3300025914 Bacteria 3742
405 Ga0207671_10072375 3300025914 Bacteria 2573
406 Ga0207671_10722220 3300025914 Bacteria 792
407 Ga0207671_10847229 3300025914 Bacteria 724
408 Ga0207660_10360566 3300025917 Bacteria 1166
409 Ga0207657_10055251 3300025919 Bacteria 3431
410 Ga0207657_10111319 3300025919 Bacteria 2261
411 Ga0207657_10231799 3300025919 Bacteria 1476
412 Ga0207657_10398871 3300025919 Bacteria 1082
413 Ga0207649_10253338 3300025920 Bacteria 1269
414 Ga0207652_10002419 3300025921 Bacteria 15754
415 Ga0207652_10095693 3300025921 Bacteria 2616
416 Ga0207652_11552987 3300025921 Bacteria 566
417 Ga0207681_10486661 3300025923 Bacteria 1008
418 Ga0207694_10009649 3300025924 Bacteria 7276
419 Ga0207694_10042226 3300025924 Bacteria 3517
420 Ga0207650_10136672 3300025925 Bacteria 1923
421 Ga0207687_10126670 3300025927 Bacteria 1918
422 Ga0207687_11130250 3300025927 Bacteria 673
423 Ga0207664_10602438 3300025929 Bacteria 987
424 Ga0207644_11375596 3300025931 Bacteria 593
425 Ga0207690_10000936 3300025932 Bacteria 18684
426 Ga0207690_10069096 3300025932 Bacteria 2429
427 Ga0207706_10019009 3300025933 Bacteria 6180
428 Ga0207706_10854126 3300025933 Bacteria 771
429 Ga0207686_10059526 3300025934 Bacteria 2414
430 Ga0207686_10187305 3300025934 Bacteria 1472
431 Ga0207709_10000026 3300025935 Bacteria 354467
432 Ga0207709_10000084 3300025935 Bacteria 161002
433 Ga0207709_10020248 3300025935 Bacteria 3750
434 Ga0207709_11582225 3300025935 Bacteria 544
435 Ga0207704_10000036 3300025938 Bacteria 94574
436 Ga0207665_10034201 3300025939 Bacteria 3373
437 Ga0207691_10186142 3300025940 Bacteria 1812
438 Ga0207691_10275349 3300025940 Bacteria 1449
439 Ga0207689_10558361 3300025942 Bacteria 962
440 Ga0207661_10013292 3300025944 Bacteria 6012
441 Ga0207661_10014621 3300025944 Bacteria 5756
442 Ga0207667_10000430 3300025949 Bacteria 56466
443 Ga0207667_10022849 3300025949 Bacteria 6898
444 Ga0207667_10023666 3300025949 Bacteria 6761
445 Ga0207667_10041900 3300025949 Bacteria 4869
446 Ga0207667_10093127 3300025949 Bacteria 3112
447 Ga0207667_10242746 3300025949 Bacteria 1843
448 Ga0207667_10265903 3300025949 Bacteria 1753
449 Ga0207651_10009416 3300025960 Bacteria 5347
450 Ga0207712_10542484 3300025961 Bacteria 999
451 Ga0207668_10020698 3300025972 Bacteria 4186
452 Ga0207668_11671342 3300025972 Bacteria 575
453 Ga0207640_10192986 3300025981 Bacteria 1537
454 Ga0207640_10666795 3300025981 Bacteria 888
455 Ga0207640_10912444 3300025981 Bacteria 768
456 Ga0207658_10494531 3300025986 Bacteria 1089
457 Ga0207658_10975083 3300025986 Bacteria 773
458 Ga0207677_11055425 3300026023 Bacteria 739
459 Ga0207639_10167234 3300026041 Bacteria 1859
460 Ga0207639_10380458 3300026041 Bacteria 1267
461 Ga0207639_10546031 3300026041 Bacteria 1063
462 Ga0207639_11132541 3300026041 Bacteria 734
463 Ga0207702_10010443 3300026078 Bacteria 7766
464 Ga0207702_10068465 3300026078 Bacteria 3050
465 Ga0207702_10069982 3300026078 Bacteria 3017
466 Ga0207702_10311424 3300026078 Bacteria 1497
467 Ga0207702_10318830 3300026078 Bacteria 1480
468 Ga0207702_10322206 3300026078 Bacteria 1472
469 Ga0207702_10370041 3300026078 Bacteria 1376
470 Ga0207702_10567715 3300026078 Bacteria 1111
471 Ga0207702_12422588 3300026078 Bacteria 512
472 Ga0207648_10000333 3300026089 Bacteria 51656
473 Ga0207648_11039269 3300026089 Bacteria 768
474 Ga0207676_11854756 3300026095 Bacteria 602
475 Ga0207674_10641092 3300026116 Bacteria 1026
476 Ga0207674_10812864 3300026116 Bacteria 902
477 Ga0207674_11110581 3300026116 Bacteria 760
478 Ga0207683_10003418 3300026121 Bacteria 13828
479 Ga0207683_10918146 3300026121 Bacteria 813
480 Ga0207698_10013453 3300026142 Bacteria 5399
481 Ga0207698_10137832 3300026142 Bacteria 2096
482 Ga0207698_10150675 3300026142 Bacteria 2018
483 Ga0207698_10337062 3300026142 Bacteria 1419
484 Ga0207698_10485173 3300026142 Bacteria 1200
485 Ga0209281_1000337 3300027111 Bacteria 79938
486 Ga0209489_111364 3300027361 Bacteria 9138
487 Ga0209995_1079267 3300027471 Bacteria 564
488 Ga0209968_1001995 3300027526 Bacteria 3102
489 Ga0209968_1042388 3300027526 Bacteria 780
490 Ga0209999_1008578 3300027543 Bacteria 1845
491 Ga0210002_1004025 3300027617 Bacteria 2181
492 Ga0209282_1014100 3300027666 Bacteria 5087
493 Ga0268266_10000658 3300028379 Bacteria 46741
494 Ga0268264_10861207 3300028381 Bacteria 908
495 Ga0265337_1069686 3300028556 Bacteria 968
496 Ga0265337_1133038 3300028556 Bacteria 674
497 Ga0265326_10159196 3300028558 Bacteria 645
498 Ga0265334_10025950 3300028573 Bacteria 2369
499 Ga0265334_10102722 3300028573 Bacteria 1033
500 Ga0265318_10048406 3300028577 Bacteria 1601
501 Ga0265323_10000040 3300028653 Bacteria 70373
502 Ga0265336_10018763 3300028666 Bacteria 2237
503 Ga0307517_10012583 3300028786 Bacteria 11593
504 Ga0307517_10233819 3300028786 Bacteria 1099
505 Ga0307517_10295128 3300028786 Bacteria 913
506 Ga0307515_10179470 3300028794 Bacteria 2074
507 Ga0307515_10302211 3300028794 Bacteria 1284
508 Ga0307515_10339301 3300028794 Bacteria 1156
509 Ga0307515_10669408 3300028794 Bacteria 651
510 Ga0265338_10001162 3300028800 Bacteria 43495
511 Ga0265338_10007954 3300028800 Bacteria 12991
512 Ga0265338_10570954 3300028800 Bacteria 790
513 Ga0316177_1073605 3300030731 Bacteria 20644
514 Ga0316176_1042405 3300030732 Bacteria 10258
515 Ga0314311_1036826 3300030733 Bacteria 876
516 Ga0316183_1033300 3300030742 Bacteria 31987
517 Ga0316181_1007760 3300030744 Bacteria 1229
518 Ga0316181_1034557 3300030744 Bacteria 9867
519 Ga0316182_1143329 3300030745 Bacteria 2798
520 Ga0316182_1415427 3300030745 Bacteria 3110
521 Ga0265330_10109929 3300031235 Bacteria 1178
522 Ga0265339_10431907 3300031249 Bacteria 613
523 Ga0265327_10000370 3300031251 Bacteria 84921
524 Ga0265327_10075375 3300031251 Bacteria 1678
525 Ga0265327_10134823 3300031251 Bacteria 1159
526 Ga0265316_10000486 3300031344 Bacteria 45040
527 Ga0265316_10004585 3300031344 Bacteria 13715
528 Ga0265316_10065971 3300031344 Bacteria 2802
529 Ga0265316_10363451 3300031344 Bacteria 1046
530 Ga0307509_10114085 3300031507 Bacteria 2698
531 Ga0307408_100003785 3300031548 Bacteria 10304
532 Ga0307408_100003845 3300031548 Bacteria 10216
533 Ga0307408_100005144 3300031548 Bacteria 8770
534 Ga0307408_100015317 3300031548 Bacteria 5105
535 Ga0307408_100966780 3300031548 Bacteria 783
536 Ga0316575_10072812 3300031665 Bacteria 1382
537 Ga0316579_10126698 3300031691 Bacteria 1229
538 Ga0316579_10303502 3300031691 Bacteria 772
539 Ga0316579_10397442 3300031691 Bacteria 666
540 Ga0265342_10069939 3300031712 Bacteria 2049
541 Ga0265342_10106285 3300031712 Bacteria 1593
542 Ga0265342_10165993 3300031712 Bacteria 1218
543 Ga0265342_10234540 3300031712 Bacteria 984
544 Ga0316576_10017698 3300031727 Bacteria 4849
545 Ga0316576_10018128 3300031727 Bacteria 4799
546 Ga0316576_10021761 3300031727 Bacteria 4440
547 Ga0316576_10027616 3300031727 Bacteria 3992
548 Ga0316576_10039513 3300031727 Bacteria 3387
549 Ga0316576_10044468 3300031727 Bacteria 3208
550 Ga0316576_10060515 3300031727 Bacteria 2774
551 Ga0316576_10106177 3300031727 Bacteria 2102
552 Ga0316576_10141263 3300031727 Bacteria 1813
553 Ga0316576_10208640 3300031727 Bacteria 1471
554 Ga0316576_10452242 3300031727 Bacteria 948
555 Ga0316576_10620299 3300031727 Bacteria 788
556 Ga0316578_10023848 3300031728 Bacteria 3427
557 Ga0316578_10042897 3300031728 Bacteria 2625
558 Ga0316578_10081543 3300031728 Bacteria 1925
559 Ga0316578_10312557 3300031728 Bacteria 939
560 Ga0316578_10334512 3300031728 Bacteria 902
561 Ga0307405_10000005 3300031731 Bacteria 376536
562 Ga0307405_10000006 3300031731 Bacteria 361477
563 Ga0307405_10080775 3300031731 Bacteria 2123
564 Ga0307405_10217445 3300031731 Bacteria 1400
565 Ga0316577_10039011 3300031733 Bacteria 2658
566 Ga0316577_10251991 3300031733 Bacteria 999
567 Ga0307413_10001014 3300031824 Bacteria 10155
568 Ga0307413_10001307 3300031824 Bacteria 9311
569 Ga0307413_10464591 3300031824 Bacteria 1008
570 Ga0307413_10685145 3300031824 Bacteria 850
571 Ga0307410_10000034 3300031852 Bacteria 48449
572 Ga0307410_10428957 3300031852 Bacteria 1074
573 Ga0307406_10000004 3300031901 Bacteria 179772
574 Ga0307407_10000003 3300031903 Bacteria 271723
575 Ga0307407_10000196 3300031903 Bacteria 18233
576 Ga0307412_10002079 3300031911 Bacteria 11112
577 Ga0307412_10003796 3300031911 Bacteria 8399
578 Ga0307412_10012909 3300031911 Bacteria 4881
579 Ga0307412_10014189 3300031911 Bacteria 4692
580 Ga0307412_10014929 3300031911 Bacteria 4592
581 Ga0307412_10041647 3300031911 Bacteria 2978
582 Ga0307412_10248062 3300031911 Bacteria 1381
583 Ga0307412_10465219 3300031911 Bacteria 1045
584 Ga0307412_10932103 3300031911 Bacteria 763
585 Ga0307409_100068515 3300031995 Bacteria 2807
586 Ga0307416_100000002 3300032002 Bacteria 509907
587 Ga0307416_100000006 3300032002 Bacteria 466074
588 Ga0307416_100079899 3300032002 Bacteria 2758
589 Ga0307414_10000011 3300032004 Bacteria 338253
590 Ga0307414_10000030 3300032004 Bacteria 187373
591 Ga0307414_10000527 3300032004 Bacteria 19931
592 Ga0307414_10000673 3300032004 Bacteria 17502
593 Ga0307414_10005329 3300032004 Bacteria 7075
594 Ga0307414_10005856 3300032004 Bacteria 6798
595 Ga0307414_10008647 3300032004 Bacteria 5791
596 Ga0307414_10009488 3300032004 Bacteria 5593
597 Ga0307414_10012166 3300032004 Bacteria 5077
598 Ga0307414_10019816 3300032004 Bacteria 4178
599 Ga0307414_10043096 3300032004 Bacteria 3071
600 Ga0307414_10065136 3300032004 Bacteria 2598
601 Ga0307414_10082843 3300032004 Bacteria 2353
602 Ga0307414_10085579 3300032004 Bacteria 2323
603 Ga0307414_10087301 3300032004 Bacteria 2304
604 Ga0307414_10125747 3300032004 Bacteria 1980
605 Ga0307414_10126650 3300032004 Bacteria 1974
606 Ga0307414_10198743 3300032004 Bacteria 1629
607 Ga0307414_10457857 3300032004 Bacteria 1120
608 Ga0307414_10606466 3300032004 Bacteria 982
609 Ga0307414_10904314 3300032004 Bacteria 809
610 Ga0307414_11331723 3300032004 Bacteria 666
611 Ga0307414_11349251 3300032004 Bacteria 662
612 Ga0307411_10000004 3300032005 Bacteria 460327
613 Ga0307411_10001861 3300032005 Bacteria 8973
614 Ga0307411_10055855 3300032005 Bacteria 2599
615 Ga0307411_10892300 3300032005 Bacteria 789
616 Ga0307411_11077058 3300032005 Bacteria 723
617 Ga0307411_11551145 3300032005 Bacteria 610
618 Ga0316583_10220733 3300032133 Bacteria 657
619 Ga0316585_10003939 3300032137 Bacteria 4109
620 Ga0316585_10053022 3300032137 Bacteria 1304
621 Ga0316585_10072804 3300032137 Bacteria 1116
622 Ga0316585_10175678 3300032137 Bacteria 708
623 Ga0316580_10075571 3300032139 Bacteria 1031
624 Ga0316580_10095681 3300032139 Bacteria 909
625 Ga0316580_10138765 3300032139 Bacteria 746
626 Ga0316593_10000201 3300032168 Bacteria 9314
627 Ga0316593_10003117 3300032168 Bacteria 4063
628 Ga0316593_10003954 3300032168 Bacteria 3746
629 Ga0316593_10006093 3300032168 Bacteria 3234
630 Ga0316593_10040978 3300032168 Bacteria 1540
631 Ga0316593_10066960 3300032168 Bacteria 1237
632 Ga0316593_10094169 3300032168 Bacteria 1057
633 Ga0316593_10119539 3300032168 Bacteria 945
634 Ga0316593_10157582 3300032168 Bacteria 828
635 Ga0316593_10162772 3300032168 Bacteria 815
636 Ga0316593_10193787 3300032168 Bacteria 750
637 Ga0307507_10000034 3300033179 Bacteria 188697
638 Ga0307510_10003892 3300033180 Bacteria 17498
639 Ga0307510_10030428 3300033180 Bacteria 6119
640 Ga0316592_1000331 3300033524 Bacteria 6138
641 Ga0316592_1000945 3300033524 Bacteria 4451
642 Ga0316592_1001036 3300033524 Bacteria 4325
643 Ga0316592_1014787 3300033524 Bacteria 1621
644 Ga0316592_1015296 3300033524 Bacteria 1597
645 Ga0316592_1015321 3300033524 Bacteria 1596
646 Ga0316592_1080804 3300033524 Bacteria 739
647 Ga0316586_1009678 3300033527 Bacteria 1447
648 Ga0316588_1001461 3300033528 Bacteria 3879
649 Ga0316588_1047427 3300033528 Bacteria 1037
650 Ga0316588_1049774 3300033528 Bacteria 1015
651 Ga0316588_1062965 3300033528 Bacteria 906
652 Ga0316587_1009264 3300033529 Bacteria 1559
653 Ga0316596_1000052 3300033541 Bacteria 12700
654 Ga0316596_1000348 3300033541 Bacteria 7561
655 Ga0316596_1000575 3300033541 Bacteria 6430
656 Ga0316596_1003747 3300033541 Bacteria 3360
657 Ga0316596_1003898 3300033541 Bacteria 3305
658 Ga0316596_1006680 3300033541 Bacteria 2693
659 Ga0316596_1019521 3300033541 Bacteria 1720
660 Ga0316596_1021732 3300033541 Bacteria 1637
661 Ga0316596_1031647 3300033541 Bacteria 1375
662 Ga0316596_1032001 3300033541 Bacteria 1368
663 Ga0316596_1049625 3300033541 Bacteria 1109
664 Ga0316596_1052248 3300033541 Bacteria 1083
665 Ga0316596_1106897 3300033541 Bacteria 758
666 Ga0316596_1119275 3300033541 Bacteria 717
667 Ga0316596_1143532 3300033541 Bacteria 654
668 Ga0316596_1154244 3300033541 Bacteria 631
669 Ga0373955_0376856 3300035172 Bacteria 861
670 Ga0316574_0027184 3300035398 Bacteria 3445
671 Ga0316574_0047218 3300035398 Bacteria 2672
672 Ga0316574_0056124 3300035398 Bacteria 2463
673 Ga0316574_0056810 3300035398 Unclassified 2449
674 Ga0316574_0068566 3300035398 Bacteria 2237
675 Ga0316574_0165017 3300035398 Bacteria 1426
676 Ga0316574_0246045 3300035398 Bacteria 1143
677 Ga0316574_0481877 3300035398 Bacteria 775
678 Ga0316574_0850595 3300035398 Bacteria 554
679 Ga0373937_1708080 3300036401 Bacteria 576
680 Ga0316582_0014930 3300036647 Bacteria 4424
681 Ga0316582_0036309 3300036647 Bacteria 3049
682 Ga0316582_0196506 3300036647 Bacteria 1375
683 Ga0316582_0638495 3300036647 Bacteria 732
684 Ga0316584_0005378 3300036712 Bacteria 8592
685 Ga0316584_0048368 3300036712 Bacteria 3177
686 Ga0316584_0087726 3300036712 Bacteria 2329
687 Ga0316584_0277900 3300036712 Bacteria 1217
688 Ga0316584_0284516 3300036712 Bacteria 1201
689 Ga0316584_0285033 3300036712 Bacteria 1199
690 Ga0316584_0658427 3300036712 Bacteria 721
691 Ga0395899_0000034 3300037312 Bacteria 302623
692 Ga0395899_0000472 3300037312 Bacteria 45477
693 Ga0395899_0000499 3300037312 Bacteria 43572
694 Ga0395899_0000673 3300037312 Bacteria 34566
695 Ga0395900_0000346 3300037418 Bacteria 68020
696 Ga0395900_0000441 3300037418 Bacteria 59413
697 Ga0395900_0169281 3300037418 Bacteria 2225
698 Ga0395900_0208359 3300037418 Bacteria 1975
699 Ga0395900_0827767 3300037418 Bacteria 852
700 Ga0395898_0021701 3300037466 Bacteria 6509
701 Ga0395898_1478469 3300037466 Bacteria 606
702 Ga0395905_0000001 3300037471 Bacteria 2037079
703 Ga0395905_0000376 3300037471 Bacteria 63695
704 Ga0395905_0000528 3300037471 Bacteria 52404
705 Ga0395905_0127136 3300037471 Bacteria 2397
706 Ga0395901_0000351 3300038443 Bacteria 56004
707 Ga0395901_0003122 3300038443 Bacteria 16635
708 Ga0395901_0896929 3300038443 Bacteria 869
709 Ga0400483_035362 3300039062 Bacteria 41412
710 Ga0400483_183866 3300039062 Bacteria 1535
711 Ga0400489_00932 3300039093 Bacteria 9350
712 Ga0400489_18980 3300039093 Bacteria 1041
713 Ga0436361_0433548 3300039447 Bacteria 14679
714 Ga0439447_002479 3300041407 Bacteria 6716
715 Ga0439466_0014751 3300041411 Bacteria 2841
716 Ga0439465_0002928 3300041413 Bacteria 5595
717 Ga0451788_26116 3300041442 Bacteria 548
718 Ga0451789_0913588 3300041443 Bacteria 1260
719 Ga0451790_03894 3300041444 Bacteria 794
720 Ga0451790_15122 3300041444 Bacteria 1162
721 Ga0451790_24363 3300041444 Bacteria 866
722 Ga0451790_25357 3300041444 Bacteria 751
723 Ga0451790_36804 3300041444 Bacteria 515
724 Ga0451792_07354 3300041445 Bacteria 562
725 Ga0451794_08398 3300041446 Bacteria 628
726 Ga0451794_24707 3300041446 Bacteria 871
727 Ga0451794_25189 3300041446 Bacteria 750
728 Ga0451794_39000 3300041446 Bacteria 623
729 Ga0451791_0489072 3300041451 Bacteria 1708
730 Ga0451791_1291585 3300041451 Bacteria 838
731 Ga0451793_0486272 3300041452 Bacteria 869
732 Ga0451795_0972033 3300041456 Bacteria 563
733 Ga0451798_0268261 3300041458 Bacteria 541
734 Ga0451802_1884876 3300041460 Bacteria 1066
735 Ga0451804_0735281 3300041463 Bacteria 857
736 Ga0451804_1059666 3300041463 Bacteria 1135
737 Ga0451807_0242729 3300041486 Bacteria 897
738 Ga0451807_1458215 3300041486 Bacteria 932
739 Ga0451837_0551105 3300041494 Bacteria 627
740 Ga0451844_23593 3300041500 Bacteria 631
741 Ga0451849_1177343 3300041505 Bacteria 865
742 Ga0451851_0089935 3300041507 Bacteria 1105
743 Ga0451843_1098053 3300041509 Bacteria 612
744 Ga0451843_1638388 3300041509 Bacteria 1120
745 Ga0451855_0333792 3300041511 Bacteria 882
746 Ga0451855_0440306 3300041511 Bacteria 509
747 Ga0451855_0497909 3300041511 Bacteria 3019
748 Ga0452271_37402 3300041916 Bacteria 829
749 Ga0452271_80664 3300041916 Bacteria 637
750 Ga0439445_0000090 3300042004 Bacteria 14230
751 Ga0439445_0036329 3300042004 Bacteria 1296
752 Ga0439448_0001990 3300042005 Bacteria 5465
753 Ga0439432_122979 3300042006 Bacteria 768
754 Ga0439457_024112 3300042014 Bacteria 1346
755 Ga0450901_005819 3300042533 Bacteria 1267
756 Ga0451577_0000092 3300042876 Bacteria 198898
757 Ga0451577_0000690 3300042876 Bacteria 52905
758 Ga0451577_0005144 3300042876 Bacteria 13458
759 Ga0451577_0023389 3300042876 Bacteria 5637
760 Ga0451577_0024955 3300042876 Bacteria 5429
761 Ga0451577_0025303 3300042876 Bacteria 5388
762 Ga0451577_0028546 3300042876 Bacteria 5045
763 Ga0451577_0047949 3300042876 Bacteria 3818
764 Ga0451577_0066417 3300042876 Bacteria 3217
765 Ga0451577_0091067 3300042876 Bacteria 2722
766 Ga0451577_0107299 3300042876 Bacteria 2496
767 Ga0451577_0300325 3300042876 Bacteria 1455
768 Ga0451577_0360457 3300042876 Bacteria 1319
769 Ga0451577_0389652 3300042876 Bacteria 1264
770 Ga0451577_0487687 3300042876 Bacteria 1119
771 Ga0451577_0551316 3300042876 Bacteria 1047
772 Ga0451577_0801834 3300042876 Bacteria 850
773 Ga0451577_1658807 3300042876 Bacteria 563
774 Ga0451577_1721338 3300042876 Bacteria 551
775 Ga0453683_0000066 3300044673 Bacteria 164788
776 Ga0453683_0000522 3300044673 Bacteria 43145
777 Ga0453683_0006727 3300044673 Bacteria 7859
778 Ga0453683_0010256 3300044673 Bacteria 6213
779 Ga0453683_0118753 3300044673 Bacteria 1664
780 Ga0453683_0139064 3300044673 Bacteria 1532
781 Ga0453683_0162196 3300044673 Bacteria 1414
782 Ga0453683_0214162 3300044673 Bacteria 1224
783 Ga0453683_0215687 3300044673 Bacteria 1219
784 Ga0453683_0215753 3300044673 Bacteria 1219
785 Ga0453683_0216051 3300044673 Bacteria 1218
786 Ga0453683_0278281 3300044673 Bacteria 1068
787 Ga0453683_0318967 3300044673 Bacteria 996
788 Ga0453683_0621848 3300044673 Bacteria 705
789 Ga0466966_0001476 3300044684 Bacteria 15131
790 Ga0466961_0182800 3300044693 Bacteria 1301
791 Ga0466961_0863931 3300044693 Bacteria 539
792 Ga0453684_0000440 3300044712 Bacteria 169397
793 Ga0453684_0000506 3300044712 Bacteria 152143
794 Ga0453684_0001121 3300044712 Bacteria 83919
795 Ga0453684_0001382 3300044712 Bacteria 70292
796 Ga0453684_0001549 3300044712 Bacteria 64220
797 Ga0453684_0004131 3300044712 Bacteria 31439
798 Ga0453684_0004169 3300044712 Bacteria 31186
799 Ga0453684_0004492 3300044712 Bacteria 29332
800 Ga0453684_0009769 3300044712 Bacteria 16659
801 Ga0453684_0012437 3300044712 Bacteria 14033
802 Ga0453684_0035092 3300044712 Bacteria 6941
803 Ga0453684_0049674 3300044712 Bacteria 5527
804 Ga0453684_0064505 3300044712 Bacteria 4678
805 Ga0453684_0076172 3300044712 Bacteria 4212
806 Ga0453684_0104626 3300044712 Bacteria 3455
807 Ga0453684_0133450 3300044712 Bacteria 2976
808 Ga0453684_0143337 3300044712 Bacteria 2849
809 Ga0453684_0145941 3300044712 Bacteria 2819
810 Ga0453684_0182883 3300044712 Bacteria 2459
811 Ga0453684_0213872 3300044712 Bacteria 2238
812 Ga0453684_0267728 3300044712 Bacteria 1954
813 Ga0453684_0385184 3300044712 Bacteria 1573
814 Ga0453684_0417493 3300044712 Bacteria 1499
815 Ga0453684_0532547 3300044712 Bacteria 1296
816 Ga0453684_0577897 3300044712 Bacteria 1234
817 Ga0453684_0637847 3300044712 Bacteria 1164
818 Ga0453684_0811243 3300044712 Bacteria 1008
819 Ga0453684_1058534 3300044712 Bacteria 859
820 Ga0453684_1398372 3300044712 Bacteria 726
821 Ga0453684_1490826 3300044712 Bacteria 698
822 Ga0453684_1491245 3300044712 Bacteria 698
823 Ga0466959_0124272 3300045049 Bacteria 1832
824 Ga0451576_0000003 3300045051 Bacteria 1550573
825 Ga0451576_0000113 3300045051 Bacteria 208644
826 Ga0451576_0000204 3300045051 Bacteria 149459
827 Ga0451576_0000783 3300045051 Bacteria 62485
828 Ga0451576_0003652 3300045051 Bacteria 20883
829 Ga0451576_0011102 3300045051 Bacteria 10274
830 Ga0451576_0013908 3300045051 Bacteria 8986
831 Ga0451576_0022652 3300045051 Bacteria 6807
832 Ga0451576_0047948 3300045051 Bacteria 4490
833 Ga0451576_0083654 3300045051 Bacteria 3319
834 Ga0451576_0088919 3300045051 Bacteria 3212
835 Ga0451576_0143234 3300045051 Bacteria 2492
836 Ga0451576_0277421 3300045051 Bacteria 1753
837 Ga0451576_0291923 3300045051 Bacteria 1705
838 Ga0451576_0438926 3300045051 Bacteria 1370
839 Ga0451576_0937455 3300045051 Bacteria 908
840 Ga0451576_0995907 3300045051 Bacteria 878
841 Ga0451576_1846002 3300045051 Bacteria 624
842 Ga0451576_2409690 3300045051 Bacteria 538
843 Ga0466958_0007843 3300045836 Bacteria 5897
844 Ga0495627_000022 3300046453 Bacteria 254672
845 Ga0495627_002474 3300046453 Bacteria 8853
846 Ga0495627_051473 3300046453 Bacteria 1237
847 Ga0495592_0123750 3300046454 Bacteria 1817
848 Ga0495590_0000627 3300046457 Bacteria 16440
849 Ga0495638_0616280 3300046460 Bacteria 531
850 Ga0495651_0082640 3300046462 Bacteria 2423
851 Ga0495650_0000023 3300046471 Bacteria 527763
852 Ga0495650_0122333 3300046471 Bacteria 957
853 Ga0495662_0053308 3300046476 Bacteria 1953
854 Ga0495585_0000476 3300046492 Bacteria 38316
855 Ga0495585_0001907 3300046492 Bacteria 15677
856 Ga0495585_0079477 3300046492 Bacteria 1779
857 Ga0495607_0068813 3300046501 Bacteria 1984
858 Ga0495607_0109464 3300046501 Bacteria 1467
859 Ga0495583_0045267 3300046506 Bacteria 2036
860 Ga0495606_0003554 3300046507 Bacteria 16456
861 Ga0495606_0011558 3300046507 Bacteria 7186
862 Ga0495606_0042764 3300046507 Bacteria 3027
863 Ga0495606_0131694 3300046507 Bacteria 1486
864 Ga0495606_0157197 3300046507 Bacteria 1329
865 Ga0495606_0284996 3300046507 Bacteria 901
866 Ga0495606_0608547 3300046507 Bacteria 535
867 Ga0495610_0000005 3300046512 Bacteria 924111
868 Ga0495610_0020639 3300046512 Bacteria 3652
869 Ga0495610_0033472 3300046512 Bacteria 2656
870 Ga0495610_0155940 3300046512 Bacteria 969
871 Ga0495610_0402938 3300046512 Bacteria 504
872 Ga0495616_0022430 3300046513 Bacteria 3410
873 Ga0495616_0073426 3300046513 Bacteria 1650
874 Ga0495616_0244907 3300046513 Bacteria 772
875 Ga0495628_1034669 3300046516 Bacteria 564
876 Ga0495631_0002385 3300046518 Bacteria 10650
877 Ga0495631_0061979 3300046518 Bacteria 1621
878 Ga0495632_0004162 3300046519 Bacteria 9918
879 Ga0495632_0110742 3300046519 Bacteria 1289
880 Ga0495632_0520565 3300046519 Bacteria 512
881 Ga0495637_0066720 3300046520 Bacteria 1462
882 Ga0495643_0000294 3300046522 Bacteria 70329
883 Ga0495643_0024720 3300046522 Bacteria 3405
884 Ga0495644_0017124 3300046523 Bacteria 2772
885 Ga0495648_0017616 3300046524 Bacteria 5097
886 Ga0495648_0098997 3300046524 Bacteria 1614
887 Ga0495648_0387851 3300046524 Bacteria 628
888 Ga0495663_0000053 3300046525 Bacteria 53554
889 Ga0495663_0019140 3300046525 Bacteria 1956
890 Ga0495663_0081759 3300046525 Bacteria 1041
891 Ga0495642_0031330 3300046528 Bacteria 2132
892 Ga0495652_0033059 3300046529 Bacteria 4519
893 Ga0495654_0000003 3300046530 Bacteria 863485
894 Ga0495654_0070029 3300046530 Bacteria 1664
895 Ga0495587_0586209 3300046536 Bacteria 614
896 Ga0495609_0000003 3300046538 Bacteria 711547
897 Ga0495609_0004523 3300046538 Bacteria 7572
898 Ga0495609_0006730 3300046538 Bacteria 5828
899 Ga0495609_0014049 3300046538 Bacteria 3771
900 Ga0495597_0206106 3300046542 Bacteria 786
901 Ga0495633_0000072 3300046558 Bacteria 131197
902 Ga0495633_0003150 3300046558 Bacteria 11168
903 Ga0495633_0016150 3300046558 Bacteria 3858
904 Ga0495633_0020940 3300046558 Bacteria 3278
905 Ga0495633_0501692 3300046558 Bacteria 547
906 Ga0495668_0000165 3300046616 Bacteria 98016
907 Ga0495668_0069683 3300046616 Bacteria 1934
908 Ga0495634_0138088 3300046642 Bacteria 1549
909 Ga0495634_0610215 3300046642 Bacteria 633
910 Ga0495611_0042182 3300046648 Bacteria 2037
911 Ga0495625_0000096 3300046660 Bacteria 142609
912 Ga0495625_0000308 3300046660 Bacteria 74661
913 Ga0495625_0001933 3300046660 Bacteria 23424
914 Ga0495625_0106019 3300046660 Bacteria 1925
915 Ga0495625_0171535 3300046660 Bacteria 1448
916 Ga0495625_0217728 3300046660 Bacteria 1252
917 Ga0495625_0225335 3300046660 Bacteria 1226
918 Ga0495625_0465596 3300046660 Bacteria 778
919 Ga0495661_0103742 3300046665 Bacteria 1595
920 Ga0495661_0133006 3300046665 Bacteria 1361
921 Ga0495588_0076305 3300046674 Bacteria 1747
922 Ga0495658_0058588 3300046683 Bacteria 2203
923 Ga0495658_0333467 3300046683 Bacteria 963
924 Ga0495669_0043303 3300046684 Bacteria 2004
925 Ga0495613_0400814 3300046689 Bacteria 936
926 Ga0495670_0127741 3300046691 Bacteria 1324
927 Ga0495671_0036148 3300046692 Bacteria 2504
928 Ga0495671_0476054 3300046692 Bacteria 596
929 Ga0495649_0000105 3300046694 Bacteria 74750
930 Ga0495649_0066186 3300046694 Bacteria 1939
931 Ga0495589_0317863 3300046794 Bacteria 720
932 Ga0495600_0108075 3300046809 Bacteria 1812
933 Ga0495660_0216941 3300046810 Bacteria 904
934 Ga0495660_0256013 3300046810 Bacteria 810
935 Ga0495604_0590296 3300047317 Bacteria 713
936 Ga0495680_1103152 3300047322 Bacteria 501
937 Ga0495687_000233 3300047443 Bacteria 77056
938 Ga0495687_098283 3300047443 Bacteria 1104
939 Ga0495685_050912 3300047447 Bacteria 1405
940 Ga0495673_0025163 3300047469 Bacteria 2862
941 Ga0495681_0032669 3300047470 Bacteria 2617
942 Ga0495686_0000133 3300047472 Bacteria 151597
943 Ga0495686_0002422 3300047472 Bacteria 17639
944 Ga0495686_0010199 3300047472 Bacteria 6696
945 Ga0495686_0244332 3300047472 Bacteria 1011
946 Ga0495686_0390316 3300047472 Bacteria 749
947 Ga0495686_0417035 3300047472 Bacteria 718
948 Ga0495593_0572900 3300047673 Bacteria 567
949 Ga0495614_0023016 3300048089 Bacteria 2687
950 Ga0496100_0514498 3300048903 Bacteria 923
951 Ga0496102_0094764 3300048905 Bacteria 2766
952 Ga0496103_0207758 3300048906 Bacteria 1259
953 Ga0496104_0513882 3300048907 Bacteria 1109
954 Ga0496110_0286115 3300048913 Bacteria 1501
955 Ga0496113_0105034 3300048916 Bacteria 2193
956 Ga0496114_0091395 3300048917 Bacteria 2585
957 Ga0496115_0022950 3300048918 Bacteria 4839
958 Ga0496115_0738107 3300048918 Bacteria 771
959 Ga0496116_0000024 3300048919 Bacteria 471420
960 Ga0496116_0000029 3300048919 Bacteria 422187
961 Ga0496116_0005535 3300048919 Bacteria 11653
962 Ga0496117_0000007 3300048920 Bacteria 720505
963 Ga0496117_0001863 3300048920 Bacteria 28457
964 Ga0496117_0170046 3300048920 Bacteria 1266
965 Ga0496118_0022242 3300048921 Bacteria 5551
966 Ga0496118_0025644 3300048921 Bacteria 5047
967 Ga0496119_0000007 3300048922 Bacteria 475920
968 Ga0496119_0261209 3300048922 Bacteria 869
969 Ga0496121_0183138 3300048924 Bacteria 1509
970 Ga0496121_0473852 3300048924 Bacteria 801
971 Ga0496122_0000862 3300048925 Bacteria 57049
972 Ga0496122_0006922 3300048925 Bacteria 12808
973 Ga0496122_0025542 3300048925 Bacteria 5126
974 Ga0496123_0013292 3300048926 Bacteria 6932
975 Ga0496123_0015001 3300048926 Bacteria 6383
976 Ga0496123_0058126 3300048926 Bacteria 2511
977 Ga0496123_0211468 3300048926 Bacteria 985
978 Ga0496124_0013719 3300048927 Bacteria 7890
979 Ga0496124_0039503 3300048927 Bacteria 4091
980 Ga0496124_0438807 3300048927 Bacteria 894
981 Ga0496124_0894352 3300048927 Bacteria 539
982 Ga0496125_0000018 3300048928 Bacteria 482390
983 Ga0496125_0000031 3300048928 Bacteria 365156
984 Ga0496125_0048493 3300048928 Bacteria 3541
985 Ga0496125_0056896 3300048928 Bacteria 3172
986 Ga0496125_0179552 3300048928 Bacteria 1412
987 Ga0496125_0758204 3300048928 Bacteria 507
988 Ga0496126_0002974 3300048929 Bacteria 21999
989 Ga0496126_0645820 3300048929 Bacteria 828
990 Ga0501306_002387 3300049127 Bacteria 1919
991 Ga0501306_029242 3300049127 Bacteria 811
992 Ga0501306_088956 3300049127 Bacteria 541
993 Ga0501309_079192 3300049129 Bacteria 549
994 Ga0501310_000149 3300049130 Bacteria 6887
995 Ga0501310_006583 3300049130 Bacteria 1222
996 Ga0501310_033025 3300049130 Bacteria 694
997 Ga0501310_044778 3300049130 Bacteria 626
998 Ga0501310_048367 3300049130 Bacteria 609
999 Ga0501343_016908 3300049132 Bacteria 628
1000 Ga0501305_006266 3300049161 Bacteria 1471
1001 Ga0501305_013964 3300049161 Bacteria 1118
1002 Ga0501307_001686 3300049162 Bacteria 1924
1003 Ga0501307_003414 3300049162 Bacteria 1556
1004 Ga0501307_005780 3300049162 Bacteria 1315
1005 Ga0501307_022615 3300049162 Bacteria 828
1006 Ga0495678_012530 3300049459 Bacteria 4016
1007 Ga0495682_0007766 3300049460 Bacteria 4250
1008 Ga0501311_000988 3300049527 Bacteria 2306
1009 Ga0501311_013259 3300049527 Bacteria 1038
1010 Ga0501312_002704 3300049528 Bacteria 1938
1011 Ga0501312_007913 3300049528 Bacteria 1367
1012 Ga0501313_037565 3300049529 Bacteria 644
1013 Ga0501314_000001 3300049530 Bacteria 13837
1014 Ga0501315_004584 3300049531 Bacteria 1454
1015 Ga0501315_009200 3300049531 Bacteria 1164
1016 Ga0501315_020543 3300049531 Bacteria 887
1017 Ga0501315_089576 3300049531 Bacteria 532
1018 Ga0501316_001608 3300049532 Bacteria 1957
1019 Ga0501316_001710 3300049532 Bacteria 1925
1020 Ga0501316_027774 3300049532 Bacteria 745
1021 Ga0501316_042567 3300049532 Bacteria 637
1022 Ga0501317_005939 3300049533 Bacteria 1326
1023 Ga0501317_036702 3300049533 Bacteria 733
1024 Ga0501319_000002 3300049535 Bacteria 13675
1025 Ga0501319_001107 3300049535 Bacteria 1493
1026 Ga0501320_000034 3300049536 Bacteria 6599
1027 Ga0501320_000628 3300049536 Bacteria 2173
1028 Ga0501320_004699 3300049536 Bacteria 1215
1029 Ga0501320_013307 3300049536 Bacteria 877
1030 Ga0501320_050179 3300049536 Bacteria 567
1031 Ga0501321_000590 3300049537 Bacteria 2423
1032 Ga0501321_003707 3300049537 Bacteria 1418
1033 Ga0501321_008543 3300049537 Bacteria 1089
1034 Ga0501321_066804 3300049537 Bacteria 553
1035 Ga0501322_000883 3300049538 Bacteria 1552
1036 Ga0501323_000002 3300049539 Bacteria 14311
1037 Ga0501323_001313 3300049539 Bacteria 2167
1038 Ga0501323_015373 3300049539 Bacteria 966
1039 Ga0501323_020427 3300049539 Bacteria 869
1040 Ga0501323_026262 3300049539 Bacteria 797
1041 Ga0501324_000002 3300049540 Bacteria 14212
1042 Ga0501324_010331 3300049540 Bacteria 849
1043 Ga0501324_014502 3300049540 Bacteria 756
1044 Ga0501324_038845 3300049540 Bacteria 539
1045 Ga0501325_000056 3300049541 Bacteria 3420
1046 Ga0501325_013523 3300049541 Bacteria 783
1047 Ga0501326_00020 3300049542 Bacteria 5374
1048 Ga0501326_09971 3300049542 Bacteria 566
1049 Ga0501327_01292 3300049543 Bacteria 1180
1050 Ga0501328_00037 3300049544 Bacteria 2833
1051 Ga0501328_11067 3300049544 Bacteria 516
1052 Ga0501329_01391 3300049545 Bacteria 1051
1053 Ga0501329_13237 3300049545 Bacteria 542
1054 Ga0501330_001422 3300049546 Bacteria 1236
1055 Ga0501330_001661 3300049546 Bacteria 1186
1056 Ga0501330_006234 3300049546 Bacteria 777
1057 Ga0501331_00092 3300049547 Bacteria 2734
1058 Ga0501333_009569 3300049549 Bacteria 682
1059 Ga0501334_01349 3300049550 Bacteria 1342
1060 Ga0501334_03288 3300049550 Bacteria 997
1061 Ga0501335_000742 3300049551 Bacteria 2246
1062 Ga0501335_001452 3300049551 Bacteria 1822
1063 Ga0501335_008567 3300049551 Bacteria 963
1064 Ga0501335_014867 3300049551 Bacteria 790
1065 Ga0501335_020269 3300049551 Bacteria 707
1066 Ga0501335_035351 3300049551 Bacteria 576
1067 Ga0501336_009708 3300049552 Bacteria 762
1068 Ga0501336_009945 3300049552 Bacteria 756
1069 Ga0501337_000031 3300049553 Bacteria 5086
1070 Ga0501337_001289 3300049553 Bacteria 1414
1071 Ga0501337_003436 3300049553 Bacteria 1006
1072 Ga0501338_00373 3300049554 Bacteria 1952
1073 Ga0501340_001429 3300049556 Bacteria 1289
1074 Ga0501340_006416 3300049556 Bacteria 790
1075 Ga0501031_0026756 3300049568 Bacteria 3760
1076 Ga0501032_0007271 3300049569 Bacteria 8100
1077 Ga0501032_0048968 3300049569 Bacteria 2852
1078 Ga0501032_0396137 3300049569 Bacteria 887
1079 Ga0501033_0000011 3300049570 Bacteria 259130
1080 Ga0501033_0131892 3300049570 Bacteria 1810
1081 Ga0501034_0001265 3300049571 Bacteria 34324
1082 Ga0501034_0390568 3300049571 Bacteria 1315
1083 Ga0501036_0019659 3300049572 Bacteria 5670
1084 Ga0501036_0166298 3300049572 Bacteria 1859
1085 Ga0501037_0013217 3300049573 Bacteria 6084
1086 Ga0501038_0002395 3300049574 Bacteria 17463
1087 Ga0501038_0075723 3300049574 Bacteria 2844
1088 Ga0501039_0023075 3300049575 Bacteria 4773
1089 Ga0501040_0522141 3300049576 Bacteria 856
1090 Ga0501043_0024223 3300049579 Bacteria 4762
1091 Ga0501043_0881339 3300049579 Bacteria 643
1092 Ga0501047_0406992 3300049581 Bacteria 1193
1093 Ga0501048_0268643 3300049582 Bacteria 1212
1094 Ga0501198_001947 3300049649 Bacteria 2740
1095 Ga0501217_014128 3300049661 Bacteria 1800
1096 Ga0501223_025877 3300049663 Bacteria 1142
1097 Ga0501224_004359 3300049664 Bacteria 2011
1098 Ga0501235_139173 3300049669 Bacteria 620
1099 Ga0501238_000015 3300049671 Bacteria 31964
1100 Ga0501238_001674 3300049671 Bacteria 2579
1101 Ga0501249_004157 3300049679 Bacteria 2931
1102 Ga0501249_016566 3300049679 Bacteria 1584
1103 Ga0501249_022408 3300049679 Bacteria 1382
1104 Ga0501251_000697 3300049681 Bacteria 3019
1105 Ga0501252_060643 3300049682 Bacteria 591
1106 Ga0501255_024276 3300049684 Bacteria 806
1107 Ga0501225_0310649 3300049705 Bacteria 536
1108 Ga0501241_000002 3300049758 Bacteria 194532
1109 Ga0501241_001391 3300049758 Bacteria 4970
1110 Ga0501241_003188 3300049758 Bacteria 3112
1111 Ga0501263_016694 3300049760 Bacteria 958
1112 Ga0501266_000002 3300049763 Bacteria 459947
1113 Ga0501269_000004 3300049766 Bacteria 91854
1114 Ga0501269_015808 3300049766 Bacteria 928
1115 Ga0501280_000239 3300049776 Bacteria 13899
1116 Ga0501280_027081 3300049776 Bacteria 881
1117 Ga0501282_022136 3300049778 Bacteria 701
1118 Ga0501035_0004622 3300049822 Bacteria 13050
1119 Ga0501035_0018430 3300049822 Bacteria 6432
1120 Ga0501044_0023913 3300049823 Bacteria 6493
1121 Ga0501045_0000053 3300049824 Bacteria 51403
1122 Ga0501204_002065 3300049850 Bacteria 2022
1123 nmdc:mga0k408_150668_c1 3300050493 Bacteria 965
1124 nmdc:mga0k408_22365_c1 3300050493 Bacteria 3560
1125 nmdc:mga0k408_349_c2 3300050493 Bacteria 1877
1126 nmdc:mga0k408_452852_c1 3300050493 Bacteria 762
1127 nmdc:mga07m45_530437_c1 3300050496 Bacteria 681
1128 nmdc:mga08y16_946750_c1 3300050511 Bacteria 844
1129 Ga0500578_0670910 3300053086 Bacteria 561
1130 Ga0500646_0004786 3300053090 Bacteria 3426
1131 Ga0500646_0064896 3300053090 Bacteria 1083
1132 Ga0500651_0000078 3300053093 Bacteria 62741
1133 Ga0500641_0000168 3300053096 Bacteria 24462
1134 Ga0500641_0005947 3300053096 Bacteria 4321
1135 Ga0500650_0464662 3300053098 Bacteria 541
1136 Ga0500594_0227933 3300053118 Bacteria 617
1137 Ga0500608_000214 3300053122 Bacteria 23145
1138 Ga0500608_087806 3300053122 Bacteria 1458
1139 Ga0500618_000057 3300053125 Bacteria 98383
1140 Ga0500642_0057580 3300053130 Bacteria 1734
1141 Ga0500652_245013 3300053131 Bacteria 712
1142 Ga0500658_0000002 3300053134 Bacteria 548440
1143 Ga0500559_0077755 3300053136 Bacteria 1504
1144 Ga0500559_0173989 3300053136 Bacteria 1013
1145 Ga0500561_0057890 3300053137 Bacteria 1077
1146 Ga0500564_099097 3300053138 Bacteria 1290
1147 Ga0500568_0122186 3300053139 Bacteria 970
1148 Ga0500573_0377679 3300053140 Bacteria 679
1149 Ga0500579_261869 3300053143 Bacteria 548
1150 Ga0500588_0421235 3300053146 Bacteria 509
1151 Ga0500589_068495 3300053147 Bacteria 1611
1152 Ga0500616_0068519 3300053153 Bacteria 1817
1153 Ga0500624_000412 3300053157 Bacteria 13199
1154 Ga0500634_0195996 3300053161 Bacteria 892
1155 Ga0500584_196186 3300053726 Bacteria 681
1156 Ga0500645_045549 3300053730 Bacteria 1289
1157 Ga0587093_002351 3300059478 Bacteria 1745
1158 Ga0587093_005525 3300059478 Bacteria 1339
1159 Ga0587093_008088 3300059478 Bacteria 1189
1160 Ga0587066_001010 3300059490 Bacteria 2663
1161 Ga0587070_012110 3300059491 Bacteria 1304
1162 Ga0587070_077901 3300059491 Bacteria 721
1163 Ga0587073_0004228 3300059492 Bacteria 2042
1164 Ga0587073_0136105 3300059492 Bacteria 680
1165 Ga0587077_000755 3300059493 Bacteria 3065
1166 Ga0587077_004049 3300059493 Bacteria 1896
1167 Ga0587080_032855 3300059503 Bacteria 912
1168 Ga0587080_052037 3300059503 Bacteria 776
1169 Ga0587083_0007032 3300059505 Bacteria 1704
1170 Ga0587083_0009203 3300059505 Bacteria 1569
1171 Ga0587083_0010186 3300059505 Bacteria 1518
1172 Ga0587083_0067751 3300059505 Bacteria 821
1173 Ga0587086_069553 3300059507 Bacteria 602
1174 Ga0587088_002584 3300059508 Bacteria 2082
1175 Ga0587089_041766 3300059509 Bacteria 712
1176 Ga0587089_100535 3300059509 Bacteria 524
1177 Ga0587090_035231 3300059510 Bacteria 856
1178 Ga0587091_007866 3300059511 Bacteria 1553
1179 Ga0587091_071736 3300059511 Bacteria 759
1180 Ga0587092_004572 3300059512 Bacteria 1659
1181 Ga0587092_005398 3300059512 Bacteria 1574
1182 Ga0587092_034923 3300059512 Bacteria 850
1183 Ga0587094_013211 3300059513 Bacteria 1113
1184 Ga0587094_027056 3300059513 Bacteria 868
1185 Ga0587095_006475 3300059514 Bacteria 911
1186 Ga0587106_000803 3300059605 Bacteria 2469
1187 Ga0587109_069356 3300059624 Bacteria 759
1188 Ga0587117_033747 3300059627 Bacteria 784
1189 Ga0587062_029117 3300059639 Bacteria 835
1190 Ga0587067_011887 3300059640 Bacteria 1350
1191 Ga0587067_026246 3300059640 Bacteria 1042
1192 Ga0587068_030243 3300059641 Bacteria 935
1193 Ga0587068_042434 3300059641 Bacteria 827
1194 Ga0587069_010109 3300059642 Bacteria 1233
1195 Ga0587076_001180 3300059645 Bacteria 2578
1196 Ga0587076_007250 3300059645 Bacteria 1508
1197 Ga0587076_018545 3300059645 Bacteria 1122
1198 Ga0587076_031564 3300059645 Bacteria 942
1199 Ga0587076_067595 3300059645 Bacteria 735
1200 Ga0587079_096182 3300059647 Bacteria 700

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049671 Ga0501238_000015 Ga0501238_000015_679_1056 114
2 3300042876 Ga0451577_0091067 Ga0451577_0091067_1461_1865 117
3 3300044712 Ga0453684_0637847 Ga0453684_0637847_661_1065 117
4 3300049568 Ga0501031_0026756 Ga0501031_0026756_1683_2090 118
5 3300049569 Ga0501032_0007271 Ga0501032_0007271_3378_3785 118
6 3300049569 Ga0501032_0048968 Ga0501032_0048968_1729_2136 118
7 3300049570 Ga0501033_0000011 Ga0501033_0000011_49596_50003 118
8 3300049571 Ga0501034_0001265 Ga0501034_0001265_4766_5173 118
9 3300049572 Ga0501036_0019659 Ga0501036_0019659_3310_3717 118
10 3300049573 Ga0501037_0013217 Ga0501037_0013217_790_1197 118
11 3300049574 Ga0501038_0002395 Ga0501038_0002395_4161_4568 118
12 3300049574 Ga0501038_0075723 Ga0501038_0075723_1626_2033 118
13 3300049575 Ga0501039_0023075 Ga0501039_0023075_1763_2170 118
14 3300049579 Ga0501043_0024223 Ga0501043_0024223_1107_1514 118
15 3300049581 Ga0501047_0406992 Ga0501047_0406992_672_1079 118
16 3300049582 Ga0501048_0268643 Ga0501048_0268643_629_1036 118
17 3300049822 Ga0501035_0004622 Ga0501035_0004622_6264_6671 118
18 3300049823 Ga0501044_0023913 Ga0501044_0023913_4760_5167 118
19 3300049824 Ga0501045_0000053 Ga0501045_0000053_4898_5305 118
20 3300005616 Ga0068852_100268045 Ga0068852_1002680454 119
21 3300026142 Ga0207698_10137832 Ga0207698_101378324 119
22 3300005367 Ga0070667_101647679 Ga0070667_1016476792 120
23 3300005617 Ga0068859_102708143 Ga0068859_1027081432 120
24 3300006931 Ga0097620_102707874 Ga0097620_1027078742 120
25 3300014326 Ga0157380_10946651 Ga0157380_109466512 120
26 3300025986 Ga0207658_10975083 Ga0207658_109750832 120
27 3300045051 Ga0451576_0000003 Ga0451576_0000003_967546_967971 120
28 3300049569 Ga0501032_0396137 Ga0501032_0396137_161_571 120
29 3300042876 Ga0451577_0360457 Ga0451577_0360457_546_950 121
30 3300028577 Ga0265318_10048406 Ga0265318_100484062 122
31 3300042876 Ga0451577_0000690 Ga0451577_0000690_5011_5421 122
32 3300005355 Ga0070671_101121230 Ga0070671_1011212301 123
33 3300013306 Ga0163162_11396126 Ga0163162_113961262 123
34 3300014325 Ga0163163_10980641 Ga0163163_109806411 123
35 3300035172 Ga0373955_0376856 Ga0373955_0376856_338_751 123
36 3300036401 Ga0373937_1708080 Ga0373937_1708080_12_425 123
37 3300037471 Ga0395905_0000001 Ga0395905_0000001_263169_263579 123
38 iso_pu_bacteria 2513020052 2513232387 123
39 iso_pu_bacteria 2519899754 2520879552 123
40 iso_pu_bacteria 2643221600 2644009213 123
41 iso_pu_bacteria 2643221667 2644373950 123
42 iso_pu_bacteria 2643221716 2644643918 123
43 iso_pu_bacteria 2643221725 2644681813 123
44 iso_pu_bacteria 2738541279 2738733048 123
45 iso_pu_bacteria 2738541285 2738765586 123
46 iso_pu_bacteria 2738543007 2739214629 123
47 iso_pu_bacteria 2739367857 2740002856 123
48 iso_pu_bacteria 2739367858 2740007673 123
49 iso_pu_bacteria 2802428842 2802655278 123
50 iso_pu_bacteria 2816332280 2817413529 123
51 iso_pu_bacteria 2857613821 2857617068 123
52 iso_pu_bacteria 2857618242 2857619737 123
53 iso_pu_bacteria 2881247448 2881247594 123
54 iso_pu_bacteria 2881359912 2881364121 123
55 iso_pu_bacteria 2903895155 2903898680 123
56 iso_pu_bacteria 2904419702 2904422380 123
57 iso_pu_bacteria 2904555929 2904558514 123
58 iso_pu_bacteria 2919191525 2919194240 123
59 iso_pu_bacteria 2919509842 2919511845 123
60 iso_pu_bacteria 2919683626 2919684596 123
61 iso_pu_bacteria 2929150217 2929150585 123
62 iso_pu_bacteria 2958458903 2958461982 123
63 iso_pu_bacteria 2958512119 2958514517 123
64 iso_pu_bacteria 2965320100 2965321941 123
65 iso_pu_bacteria 2977268062 2977272057 123
66 iso_pu_bacteria 8036736890 8036739246 123
67 iso_pu_bacteria 8054307821 8054311448 123
68 iso_pu_bacteria 8055419101 8055423564 123
69 iso_pu_bacteria 8055592153 8055595082 123
70 iso_pu_bacteria 8056440228 8056443499 123
71 3300009098 Ga0105245_10144700 Ga0105245_101447002 124
72 3300025927 Ga0207687_10126670 Ga0207687_101266704 124
73 3300025931 Ga0207644_11375596 Ga0207644_113755962 125
74 iso_pu_bacteria 2511231000 2511231097 125
75 iso_pu_bacteria 2523533629 2524006248 125
76 iso_pu_bacteria 2582581278 2585143598 125
77 iso_pu_bacteria 2582581281 2585156561 125
78 iso_pu_bacteria 2582581282 2585160788 125
79 iso_pu_bacteria 2582581873 2585427001 125
80 iso_pu_bacteria 2585427687 2586210041 125
81 iso_pu_bacteria 2585428045 2587679988 125
82 iso_pu_bacteria 2585428060 2587748646 125
83 iso_pu_bacteria 2585428061 2587753444 125
84 iso_pu_bacteria 2585428095 2587864971 125
85 iso_pu_bacteria 2585428115 2587945325 125
86 iso_pu_bacteria 2585428182 2588211504 125
87 iso_pu_bacteria 2585428183 2588215886 125
88 iso_pu_bacteria 2585428184 2588219308 125
89 iso_pu_bacteria 2585428185 2588224786 125
90 iso_pu_bacteria 2585428187 2588234621 125
91 iso_pu_bacteria 2588253712 2588447581 125
92 iso_pu_bacteria 2588254255 2590603208 125
93 iso_pu_bacteria 2588254257 2590610229 125
94 iso_pu_bacteria 2599185184 2599479370 125
95 iso_pu_bacteria 2721755487 2722726189 125
96 iso_pu_bacteria 2728369107 2729200742 125
97 iso_pu_bacteria 2738541273 2738698364 125
98 iso_pu_bacteria 2738541283 2738755664 125
99 iso_pu_bacteria 2738541284 2738762119 125
100 iso_pu_bacteria 2738541302 2738854414 125
101 iso_pu_bacteria 2738543014 2739252690 125
102 iso_pu_bacteria 2738543023 2739301901 125
103 iso_pu_bacteria 2739367651 2739587966 125
104 iso_pu_bacteria 2739367656 2739614383 125
105 iso_pu_bacteria 2739367663 2739646685 125
106 iso_pu_bacteria 2739367874 2740060442 125
107 iso_pu_bacteria 2751185877 2753674221 125
108 iso_pu_bacteria 2765235839 2765575692 125
109 iso_pu_bacteria 2772190705 2772605797 125
110 iso_pu_bacteria 2775506739 2775674325 125
111 iso_pu_bacteria 2775506987 2776615255 125
112 iso_pu_bacteria 2816332188 2816875539 125
113 iso_pu_bacteria 2818991437 2819545841 125
114 iso_pu_bacteria 2842083920 2842086269 125
115 iso_pu_bacteria 2842722452 2842724266 125
116 iso_pu_bacteria 2842903701 2842908283 125
117 iso_pu_bacteria 2842909656 2842913600 125
118 iso_pu_bacteria 2849281842 2849282587 125
119 iso_pu_bacteria 2852623160 2852625381 125
120 iso_pu_bacteria 2852627209 2852629125 125
121 iso_pu_bacteria 2857627736 2857631664 125
122 iso_pu_bacteria 2871720351 2871723618 125
123 iso_pu_bacteria 2884933994 2884934392 125
124 iso_pu_bacteria 2887375801 2887379696 125
125 iso_pu_bacteria 2889290771 2889293804 125
126 iso_pu_bacteria 2890737413 2890740650 125
127 iso_pu_bacteria 2896317667 2896320825 125
128 iso_pu_bacteria 2902048731 2902051176 125
129 iso_pu_bacteria 2904445276 2904449081 125
130 iso_pu_bacteria 2904780799 2904782800 125
131 iso_pu_bacteria 2905999023 2906001161 125
132 iso_pu_bacteria 2906799679 2906800153 125
133 iso_pu_bacteria 2919097161 2919097940 125
134 iso_pu_bacteria 2919177583 2919180411 125
135 iso_pu_bacteria 2919186247 2919189083 125
136 iso_pu_bacteria 2919399522 2919403179 125
137 iso_pu_bacteria 2919437846 2919438030 125
138 iso_pu_bacteria 2928078545 2928082321 125
139 iso_pu_bacteria 2928147474 2928149100 125
140 iso_pu_bacteria 2932082852 2932085033 125
141 iso_pu_bacteria 2939664404 2939666762 125
142 iso_pu_bacteria 2945924605 2945924786 125
143 iso_pu_bacteria 2945997725 2945998911 125
144 iso_pu_bacteria 2946019816 2946024099 125
145 iso_pu_bacteria 2954016120 2954021354 125
146 iso_pu_bacteria 2977232053 2977235866 125
147 iso_pu_bacteria 2977243572 2977247739 125
148 iso_pu_bacteria 2984572630 2984574464 125
149 iso_pu_bacteria 2984606641 2984607913 125
150 iso_pu_bacteria 2993372514 2993375088 125
151 iso_pu_bacteria 2993480792 2993481951 125
152 iso_pu_bacteria 3003233435 3003234779 125
153 iso_pu_bacteria 8055588893 8055591273 125
154 2162886007 SwRhRL2b_contig_1853401 SwRhRL2b_0345.00003120 126
155 3300003300 Ga0006758J48902_1029451 Ga0006758J48902_10294512 126
156 3300005289 Ga0065704_10004597 Ga0065704_100045972 126
157 3300005341 Ga0070691_10252658 Ga0070691_102526582 126
158 3300028794 Ga0307515_10302211 Ga0307515_103022112 126
159 3300031548 Ga0307408_100003845 Ga0307408_1000038452 126
160 3300032005 Ga0307411_10001861 Ga0307411_100018613 126
161 3300033541 Ga0316596_1000052 Ga0316596_100005224 126
162 3300035398 Ga0316574_0047218 Ga0316574_0047218_1705_2094 126
163 3300036712 Ga0316584_0277900 Ga0316584_0277900_732_1121 126
164 3300042876 Ga0451577_0300325 Ga0451577_0300325_49_432 126
165 3300044712 Ga0453684_0009769 Ga0453684_0009769_10036_10419 126
166 3300048913 Ga0496110_0286115 Ga0496110_0286115_581_967 126
167 3300049130 Ga0501310_033025 Ga0501310_033025_204_590 126
168 3300049162 Ga0501307_001686 Ga0501307_001686_100_486 126
169 3300049162 Ga0501307_022615 Ga0501307_022615_162_551 126
170 3300049527 Ga0501311_000988 Ga0501311_000988_1108_1494 126
171 3300049528 Ga0501312_002704 Ga0501312_002704_1455_1841 126
172 3300049529 Ga0501313_037565 Ga0501313_037565_103_492 126
173 3300049532 Ga0501316_001710 Ga0501316_001710_242_631 126
174 3300049536 Ga0501320_000628 Ga0501320_000628_666_1052 126
175 3300049539 Ga0501323_001313 Ga0501323_001313_1188_1574 126
176 3300049540 Ga0501324_010331 Ga0501324_010331_223_612 126
177 3300049540 Ga0501324_038845 Ga0501324_038845_49_435 126
178 3300049542 Ga0501326_09971 Ga0501326_09971_81_467 126
179 3300049550 Ga0501334_03288 Ga0501334_03288_174_560 126
180 3300049649 Ga0501198_001947 Ga0501198_001947_1619_2005 126
181 3300049663 Ga0501223_025877 Ga0501223_025877_531_917 126
182 3300049679 Ga0501249_016566 Ga0501249_016566_608_997 126
183 3300049705 Ga0501225_0310649 Ga0501225_0310649_106_495 126
184 3300049758 Ga0501241_001391 Ga0501241_001391_1635_2024 126
185 3300049850 Ga0501204_002065 Ga0501204_002065_1035_1421 126
186 iso_pu_bacteria 2833640130 2833640602 126
187 2162886007 SwRhRL2b_contig_2489919 SwRhRL2b_0572.00005130 127
188 2162886011 MRS1b_contig_1810326 MRS1b_0199.00000980 127
189 2209111006 2214800779 2213830272 127
190 3300003575 Ga0007409J51694_1063312 Ga0007409J51694_10633122 127
191 3300003578 Ga0006562J51391_1003423 Ga0006562J51391_100342324 127
192 3300004801 Ga0058860_10114316 Ga0058860_101143164 127
193 3300005276 Ga0065717_1001968 Ga0065717_10019685 127
194 3300005277 Ga0065716_1002480 Ga0065716_10024801 127
195 3300005288 Ga0065714_10045584 Ga0065714_100455842 127
196 3300005288 Ga0065714_10047236 Ga0065714_100472362 127
197 3300005288 Ga0065714_10163029 Ga0065714_101630292 127
198 3300005288 Ga0065714_10250665 Ga0065714_102506652 127
199 3300005289 Ga0065704_10082398 Ga0065704_100823981 127
200 3300005289 Ga0065704_10096211 Ga0065704_100962114 127
201 3300005289 Ga0065704_10102101 Ga0065704_101021014 127
202 3300005293 Ga0065715_10036832 Ga0065715_100368323 127
203 3300005293 Ga0065715_10521621 Ga0065715_105216211 127
204 3300005293 Ga0065715_10569858 Ga0065715_105698582 127
205 3300005331 Ga0070670_100135400 Ga0070670_1001354002 127
206 3300005456 Ga0070678_100234064 Ga0070678_1002340643 127
207 3300005459 Ga0068867_100970210 Ga0068867_1009702101 127
208 3300005507 Ga0074259_10883899 Ga0074259_108838991 127
209 3300005547 Ga0070693_101517646 Ga0070693_1015176461 127
210 3300005616 Ga0068852_100411938 Ga0068852_1004119382 127
211 3300005841 Ga0068863_100897056 Ga0068863_1008970562 127
212 3300006173 Ga0070716_100062251 Ga0070716_1000622513 127
213 3300006177 Ga0075362_10012264 Ga0075362_100122644 127
214 3300006237 Ga0097621_100200943 Ga0097621_1002009431 127
215 3300006358 Ga0068871_100350639 Ga0068871_1003506391 127
216 3300006942 Ga0099824_1003374 Ga0099824_100337419 127
217 3300006946 Ga0079104_1000280 Ga0079104_100028028 127
218 3300006948 Ga0099826_10000125 Ga0099826_100001259 127
219 3300009011 Ga0105251_10038077 Ga0105251_100380773 127
220 3300009036 Ga0105244_10000027 Ga0105244_10000027184 127
221 3300009176 Ga0105242_10053982 Ga0105242_100539822 127
222 3300009553 Ga0105249_10192006 Ga0105249_101920062 127
223 3300012512 Ga0157327_1007676 Ga0157327_10076762 127
224 3300013100 Ga0157373_10001369 Ga0157373_100013698 127
225 3300013100 Ga0157373_11166423 Ga0157373_111664232 127
226 3300013102 Ga0157371_10001678 Ga0157371_1000167828 127
227 3300013104 Ga0157370_10073063 Ga0157370_100730632 127
228 3300013104 Ga0157370_10106885 Ga0157370_101068853 127
229 3300013104 Ga0157370_10553788 Ga0157370_105537881 127
230 3300013105 Ga0157369_10000613 Ga0157369_1000061316 127
231 3300013296 Ga0157374_10104516 Ga0157374_101045163 127
232 3300013297 Ga0157378_10378236 Ga0157378_103782364 127
233 3300013306 Ga0163162_10068714 Ga0163162_100687145 127
234 3300013308 Ga0157375_11032639 Ga0157375_110326391 127
235 3300014969 Ga0157376_10271219 Ga0157376_102712192 127
236 3300015261 Ga0182006_1009290 Ga0182006_10092904 127
237 3300015261 Ga0182006_1062134 Ga0182006_10621342 127
238 3300017792 Ga0163161_10000039 Ga0163161_1000003928 127
239 3300017792 Ga0163161_10009312 Ga0163161_100093128 127
240 3300017792 Ga0163161_10054256 Ga0163161_100542565 127
241 3300017792 Ga0163161_10317631 Ga0163161_103176312 127
242 3300020070 Ga0206356_11535795 Ga0206356_115357952 127
243 3300020077 Ga0206351_10991482 Ga0206351_109914824 127
244 3300025728 Ga0207655_1000038 Ga0207655_1000038185 127
245 3300025735 Ga0207713_1057298 Ga0207713_10572982 127
246 3300025925 Ga0207650_10136672 Ga0207650_101366723 127
247 3300025934 Ga0207686_10059526 Ga0207686_100595263 127
248 3300025939 Ga0207665_10034201 Ga0207665_100342014 127
249 3300025940 Ga0207691_10186142 Ga0207691_101861422 127
250 3300025981 Ga0207640_10666795 Ga0207640_106667952 127
251 3300025986 Ga0207658_10494531 Ga0207658_104945311 127
252 3300026041 Ga0207639_10380458 Ga0207639_103804583 127
253 3300026089 Ga0207648_11039269 Ga0207648_110392692 127
254 3300026095 Ga0207676_11854756 Ga0207676_118547561 127
255 3300026116 Ga0207674_11110581 Ga0207674_111105812 127
256 3300026121 Ga0207683_10918146 Ga0207683_109181462 127
257 3300026142 Ga0207698_10485173 Ga0207698_104851732 127
258 3300027111 Ga0209281_1000337 Ga0209281_100033739 127
259 3300027361 Ga0209489_111364 Ga0209489_1113642 127
260 3300027471 Ga0209995_1079267 Ga0209995_10792672 127
261 3300027526 Ga0209968_1001995 Ga0209968_10019951 127
262 3300027526 Ga0209968_1042388 Ga0209968_10423882 127
263 3300027543 Ga0209999_1008578 Ga0209999_10085783 127
264 3300027617 Ga0210002_1004025 Ga0210002_10040253 127
265 3300027666 Ga0209282_1014100 Ga0209282_10141004 127
266 3300028786 Ga0307517_10233819 Ga0307517_102338192 127
267 3300030744 Ga0316181_1007760 Ga0316181_10077603 127
268 3300031548 Ga0307408_100015317 Ga0307408_1000153174 127
269 3300031727 Ga0316576_10044468 Ga0316576_100444682 127
270 3300031731 Ga0307405_10000005 Ga0307405_10000005205 127
271 3300031824 Ga0307413_10001014 Ga0307413_1000101415 127
272 3300031824 Ga0307413_10001307 Ga0307413_100013072 127
273 3300031852 Ga0307410_10000034 Ga0307410_1000003413 127
274 3300031901 Ga0307406_10000004 Ga0307406_10000004131 127
275 3300031903 Ga0307407_10000196 Ga0307407_100001965 127
276 3300031911 Ga0307412_10014189 Ga0307412_100141895 127
277 3300032004 Ga0307414_10000011 Ga0307414_10000011326 127
278 3300032004 Ga0307414_10000527 Ga0307414_1000052710 127
279 3300032004 Ga0307414_10000673 Ga0307414_1000067315 127
280 3300032004 Ga0307414_10043096 Ga0307414_100430966 127
281 3300032004 Ga0307414_10125747 Ga0307414_101257474 127
282 3300032004 Ga0307414_10198743 Ga0307414_101987432 127
283 3300032005 Ga0307411_10000004 Ga0307411_1000000423 127
284 3300032168 Ga0316593_10157582 Ga0316593_101575822 127
285 3300033180 Ga0307510_10030428 Ga0307510_100304282 127
286 3300035398 Ga0316574_0056124 Ga0316574_0056124_1102_1485 127
287 3300035398 Ga0316574_0165017 Ga0316574_0165017_271_654 127
288 3300036712 Ga0316584_0285033 Ga0316584_0285033_276_668 127
289 3300041407 Ga0439447_002479 Ga0439447_002479_3656_4039 127
290 3300041411 Ga0439466_0014751 Ga0439466_0014751_2221_2604 127
291 3300041443 Ga0451789_0913588 Ga0451789_0913588_419_802 127
292 3300041444 Ga0451790_15122 Ga0451790_15122_30_413 127
293 3300041446 Ga0451794_39000 Ga0451794_39000_24_407 127
294 3300041451 Ga0451791_0489072 Ga0451791_0489072_122_505 127
295 3300041460 Ga0451802_1884876 Ga0451802_1884876_389_772 127
296 3300041463 Ga0451804_0735281 Ga0451804_0735281_345_728 127
297 3300041463 Ga0451804_1059666 Ga0451804_1059666_71_454 127
298 3300041486 Ga0451807_0242729 Ga0451807_0242729_22_405 127
299 3300041500 Ga0451844_23593 Ga0451844_23593_14_397 127
300 3300041505 Ga0451849_1177343 Ga0451849_1177343_156_539 127
301 3300041509 Ga0451843_1098053 Ga0451843_1098053_73_456 127
302 3300041509 Ga0451843_1638388 Ga0451843_1638388_378_761 127
303 3300042004 Ga0439445_0036329 Ga0439445_0036329_816_1199 127
304 3300042006 Ga0439432_122979 Ga0439432_122979_267_650 127
305 3300044673 Ga0453683_0318967 Ga0453683_0318967_343_735 127
306 3300044712 Ga0453684_1491245 Ga0453684_1491245_166_582 127
307 3300046453 Ga0495627_002474 Ga0495627_002474_1742_2125 127
308 3300046507 Ga0495606_0157197 Ga0495606_0157197_784_1167 127
309 3300046512 Ga0495610_0402938 Ga0495610_0402938_28_411 127
310 3300046522 Ga0495643_0000294 Ga0495643_0000294_53525_53908 127
311 3300046524 Ga0495648_0387851 Ga0495648_0387851_95_478 127
312 3300046660 Ga0495625_0001933 Ga0495625_0001933_15714_16097 127
313 3300046660 Ga0495625_0225335 Ga0495625_0225335_772_1155 127
314 3300046683 Ga0495658_0333467 Ga0495658_0333467_314_697 127
315 3300046689 Ga0495613_0400814 Ga0495613_0400814_452_835 127
316 3300046692 Ga0495671_0476054 Ga0495671_0476054_149_532 127
317 3300046810 Ga0495660_0216941 Ga0495660_0216941_229_612 127
318 3300048918 Ga0496115_0022950 Ga0496115_0022950_2920_3303 127
319 3300048919 Ga0496116_0000024 Ga0496116_0000024_103413_103796 127
320 3300048920 Ga0496117_0170046 Ga0496117_0170046_122_505 127
321 3300048922 Ga0496119_0261209 Ga0496119_0261209_73_456 127
322 3300048924 Ga0496121_0183138 Ga0496121_0183138_714_1097 127
323 3300048924 Ga0496121_0473852 Ga0496121_0473852_176_559 127
324 3300048927 Ga0496124_0894352 Ga0496124_0894352_12_395 127
325 3300048928 Ga0496125_0000018 Ga0496125_0000018_376398_376781 127
326 3300048928 Ga0496125_0000031 Ga0496125_0000031_35789_36172 127
327 3300048929 Ga0496126_0645820 Ga0496126_0645820_413_796 127
328 3300049130 Ga0501310_000149 Ga0501310_000149_4254_4637 127
329 3300049530 Ga0501314_000001 Ga0501314_000001_11070_11453 127
330 3300049533 Ga0501317_005939 Ga0501317_005939_190_573 127
331 3300049535 Ga0501319_000002 Ga0501319_000002_2259_2642 127
332 3300049536 Ga0501320_000034 Ga0501320_000034_3709_4092 127
333 3300049537 Ga0501321_003707 Ga0501321_003707_442_825 127
334 3300049538 Ga0501322_000883 Ga0501322_000883_757_1140 127
335 3300049539 Ga0501323_000002 Ga0501323_000002_2762_3145 127
336 3300049539 Ga0501323_026262 Ga0501323_026262_48_431 127
337 3300049540 Ga0501324_000002 Ga0501324_000002_11211_11594 127
338 3300049541 Ga0501325_000056 Ga0501325_000056_2507_2890 127
339 3300049542 Ga0501326_00020 Ga0501326_00020_771_1154 127
340 3300049544 Ga0501328_00037 Ga0501328_00037_300_683 127
341 3300049545 Ga0501329_01391 Ga0501329_01391_464_847 127
342 3300049546 Ga0501330_001661 Ga0501330_001661_381_764 127
343 3300049547 Ga0501331_00092 Ga0501331_00092_149_532 127
344 3300049553 Ga0501337_000031 Ga0501337_000031_2363_2746 127
345 3300049554 Ga0501338_00373 Ga0501338_00373_1055_1438 127
346 3300049572 Ga0501036_0166298 Ga0501036_0166298_26_409 127
347 3300049576 Ga0501040_0522141 Ga0501040_0522141_150_533 127
348 3300049579 Ga0501043_0881339 Ga0501043_0881339_17_400 127
349 3300049664 Ga0501224_004359 Ga0501224_004359_1191_1574 127
350 3300049679 Ga0501249_004157 Ga0501249_004157_2471_2854 127
351 3300049679 Ga0501249_022408 Ga0501249_022408_922_1305 127
352 3300049682 Ga0501252_060643 Ga0501252_060643_183_566 127
353 3300049684 Ga0501255_024276 Ga0501255_024276_366_749 127
354 3300049758 Ga0501241_003188 Ga0501241_003188_1848_2231 127
355 3300049763 Ga0501266_000002 Ga0501266_000002_338234_338617 127
356 3300049776 Ga0501280_000239 Ga0501280_000239_2194_2577 127
357 3300049778 Ga0501282_022136 Ga0501282_022136_199_582 127
358 3300049822 Ga0501035_0018430 Ga0501035_0018430_675_1058 127
359 3300053086 Ga0500578_0670910 Ga0500578_0670910_142_525 127
360 3300053090 Ga0500646_0004786 Ga0500646_0004786_1007_1390 127
361 3300053096 Ga0500641_0000168 Ga0500641_0000168_6364_6747 127
362 3300053096 Ga0500641_0005947 Ga0500641_0005947_1089_1472 127
363 3300053118 Ga0500594_0227933 Ga0500594_0227933_77_460 127
364 3300053134 Ga0500658_0000002 Ga0500658_0000002_202077_202460 127
365 3300053136 Ga0500559_0077755 Ga0500559_0077755_130_513 127
366 3300053147 Ga0500589_068495 Ga0500589_068495_925_1308 127
367 3300053726 Ga0500584_196186 Ga0500584_196186_129_512 127
368 3300028556 Ga0265337_1069686 Ga0265337_10696862 128
369 3300028556 Ga0265337_1133038 Ga0265337_11330382 128
370 3300028558 Ga0265326_10159196 Ga0265326_101591962 128
371 3300028573 Ga0265334_10102722 Ga0265334_101027222 128
372 3300028653 Ga0265323_10000040 Ga0265323_1000004045 128
373 3300028666 Ga0265336_10018763 Ga0265336_100187634 128
374 3300028800 Ga0265338_10001162 Ga0265338_1000116241 128
375 3300031235 Ga0265330_10109929 Ga0265330_101099292 128
376 3300031251 Ga0265327_10000370 Ga0265327_1000037055 128
377 3300031344 Ga0265316_10000486 Ga0265316_1000048623 128
378 3300031344 Ga0265316_10004585 Ga0265316_1000458515 128
379 3300031344 Ga0265316_10065971 Ga0265316_100659712 128
380 3300031344 Ga0265316_10363451 Ga0265316_103634511 128
381 3300031665 Ga0316575_10072812 Ga0316575_100728122 128
382 3300031691 Ga0316579_10126698 Ga0316579_101266983 128
383 3300031691 Ga0316579_10303502 Ga0316579_103035022 128
384 3300031691 Ga0316579_10397442 Ga0316579_103974421 128
385 3300031712 Ga0265342_10069939 Ga0265342_100699393 128
386 3300031712 Ga0265342_10106285 Ga0265342_101062853 128
387 3300031712 Ga0265342_10165993 Ga0265342_101659932 128
388 3300031712 Ga0265342_10234540 Ga0265342_102345402 128
389 3300031727 Ga0316576_10017698 Ga0316576_100176985 128
390 3300031727 Ga0316576_10018128 Ga0316576_100181285 128
391 3300031727 Ga0316576_10021761 Ga0316576_100217613 128
392 3300031727 Ga0316576_10027616 Ga0316576_100276167 128
393 3300031727 Ga0316576_10039513 Ga0316576_100395134 128
394 3300031727 Ga0316576_10060515 Ga0316576_100605152 128
395 3300031727 Ga0316576_10106177 Ga0316576_101061772 128
396 3300031727 Ga0316576_10141263 Ga0316576_101412632 128
397 3300031727 Ga0316576_10208640 Ga0316576_102086403 128
398 3300031727 Ga0316576_10620299 Ga0316576_106202992 128
399 3300031728 Ga0316578_10023848 Ga0316578_100238482 128
400 3300031728 Ga0316578_10042897 Ga0316578_100428975 128
401 3300031728 Ga0316578_10081543 Ga0316578_100815433 128
402 3300031728 Ga0316578_10312557 Ga0316578_103125572 128
403 3300031728 Ga0316578_10334512 Ga0316578_103345122 128
404 3300031733 Ga0316577_10039011 Ga0316577_100390113 128
405 3300031733 Ga0316577_10251991 Ga0316577_102519912 128
406 3300032004 Ga0307414_10019816 Ga0307414_100198164 128
407 3300032133 Ga0316583_10220733 Ga0316583_102207332 128
408 3300032137 Ga0316585_10003939 Ga0316585_100039394 128
409 3300032137 Ga0316585_10053022 Ga0316585_100530222 128
410 3300032137 Ga0316585_10072804 Ga0316585_100728042 128
411 3300032137 Ga0316585_10175678 Ga0316585_101756782 128
412 3300032139 Ga0316580_10075571 Ga0316580_100755712 128
413 3300032139 Ga0316580_10095681 Ga0316580_100956812 128
414 3300032139 Ga0316580_10138765 Ga0316580_101387651 128
415 3300032168 Ga0316593_10000201 Ga0316593_1000020120 128
416 3300032168 Ga0316593_10003117 Ga0316593_100031175 128
417 3300032168 Ga0316593_10003954 Ga0316593_100039544 128
418 3300032168 Ga0316593_10006093 Ga0316593_100060934 128
419 3300032168 Ga0316593_10040978 Ga0316593_100409785 128
420 3300032168 Ga0316593_10066960 Ga0316593_100669602 128
421 3300032168 Ga0316593_10094169 Ga0316593_100941693 128
422 3300032168 Ga0316593_10119539 Ga0316593_101195392 128
423 3300032168 Ga0316593_10162772 Ga0316593_101627722 128
424 3300032168 Ga0316593_10193787 Ga0316593_101937872 128
425 3300033524 Ga0316592_1000331 Ga0316592_10003314 128
426 3300033524 Ga0316592_1000945 Ga0316592_10009455 128
427 3300033524 Ga0316592_1001036 Ga0316592_10010365 128
428 3300033524 Ga0316592_1015296 Ga0316592_10152961 128
429 3300033524 Ga0316592_1015321 Ga0316592_10153211 128
430 3300033524 Ga0316592_1080804 Ga0316592_10808041 128
431 3300033528 Ga0316588_1001461 Ga0316588_10014614 128
432 3300033528 Ga0316588_1047427 Ga0316588_10474272 128
433 3300033528 Ga0316588_1049774 Ga0316588_10497742 128
434 3300033541 Ga0316596_1000348 Ga0316596_10003489 128
435 3300033541 Ga0316596_1000575 Ga0316596_10005759 128
436 3300033541 Ga0316596_1003747 Ga0316596_10037473 128
437 3300033541 Ga0316596_1006680 Ga0316596_10066804 128
438 3300033541 Ga0316596_1019521 Ga0316596_10195211 128
439 3300033541 Ga0316596_1021732 Ga0316596_10217322 128
440 3300033541 Ga0316596_1031647 Ga0316596_10316472 128
441 3300033541 Ga0316596_1032001 Ga0316596_10320012 128
442 3300033541 Ga0316596_1049625 Ga0316596_10496252 128
443 3300033541 Ga0316596_1052248 Ga0316596_10522483 128
444 3300033541 Ga0316596_1106897 Ga0316596_11068972 128
445 3300033541 Ga0316596_1119275 Ga0316596_11192752 128
446 3300033541 Ga0316596_1143532 Ga0316596_11435321 128
447 3300033541 Ga0316596_1154244 Ga0316596_11542441 128
448 3300035398 Ga0316574_0027184 Ga0316574_0027184_1718_2107 128
449 3300035398 Ga0316574_0056810 Ga0316574_0056810_383_772 128
450 3300035398 Ga0316574_0068566 Ga0316574_0068566_58_447 128
451 3300035398 Ga0316574_0246045 Ga0316574_0246045_379_768 128
452 3300035398 Ga0316574_0481877 Ga0316574_0481877_115_504 128
453 3300035398 Ga0316574_0850595 Ga0316574_0850595_26_415 128
454 3300036647 Ga0316582_0014930 Ga0316582_0014930_3473_3862 128
455 3300036647 Ga0316582_0036309 Ga0316582_0036309_2243_2632 128
456 3300036647 Ga0316582_0196506 Ga0316582_0196506_41_430 128
457 3300036647 Ga0316582_0638495 Ga0316582_0638495_264_653 128
458 3300036712 Ga0316584_0005378 Ga0316584_0005378_5689_6078 128
459 3300036712 Ga0316584_0048368 Ga0316584_0048368_2494_2883 128
460 3300036712 Ga0316584_0087726 Ga0316584_0087726_1346_1735 128
461 3300036712 Ga0316584_0284516 Ga0316584_0284516_407_796 128
462 3300036712 Ga0316584_0658427 Ga0316584_0658427_121_510 128
463 3300039062 Ga0400483_035362 Ga0400483_035362_12376_12765 128
464 3300039062 Ga0400483_183866 Ga0400483_183866_384_773 128
465 3300039093 Ga0400489_00932 Ga0400489_00932_5230_5619 128
466 3300039093 Ga0400489_18980 Ga0400489_18980_423_812 128
467 3300041456 Ga0451795_0972033 Ga0451795_0972033_164_553 128
468 3300041494 Ga0451837_0551105 Ga0451837_0551105_204_593 128
469 3300041511 Ga0451855_0333792 Ga0451855_0333792_168_557 128
470 3300041511 Ga0451855_0440306 Ga0451855_0440306_94_483 128
471 3300041511 Ga0451855_0497909 Ga0451855_0497909_1404_1793 128
472 3300042876 Ga0451577_0000092 Ga0451577_0000092_140543_140932 128
473 3300042876 Ga0451577_0005144 Ga0451577_0005144_5025_5414 128
474 3300042876 Ga0451577_0023389 Ga0451577_0023389_1700_2092 128
475 3300042876 Ga0451577_0024955 Ga0451577_0024955_3210_3599 128
476 3300042876 Ga0451577_0025303 Ga0451577_0025303_491_880 128
477 3300042876 Ga0451577_0028546 Ga0451577_0028546_4343_4732 128
478 3300042876 Ga0451577_0047949 Ga0451577_0047949_458_847 128
479 3300042876 Ga0451577_0066417 Ga0451577_0066417_2745_3134 128
480 3300042876 Ga0451577_0107299 Ga0451577_0107299_1432_1824 128
481 3300042876 Ga0451577_0389652 Ga0451577_0389652_404_793 128
482 3300042876 Ga0451577_0487687 Ga0451577_0487687_465_854 128
483 3300042876 Ga0451577_0551316 Ga0451577_0551316_104_493 128
484 3300042876 Ga0451577_0801834 Ga0451577_0801834_163_552 128
485 3300042876 Ga0451577_1658807 Ga0451577_1658807_32_421 128
486 3300042876 Ga0451577_1721338 Ga0451577_1721338_75_464 128
487 3300044673 Ga0453683_0000066 Ga0453683_0000066_163998_164387 128
488 3300044673 Ga0453683_0000522 Ga0453683_0000522_18699_19088 128
489 3300044673 Ga0453683_0006727 Ga0453683_0006727_1764_2153 128
490 3300044673 Ga0453683_0010256 Ga0453683_0010256_4338_4727 128
491 3300044673 Ga0453683_0118753 Ga0453683_0118753_628_1017 128
492 3300044673 Ga0453683_0139064 Ga0453683_0139064_967_1356 128
493 3300044673 Ga0453683_0162196 Ga0453683_0162196_522_911 128
494 3300044673 Ga0453683_0214162 Ga0453683_0214162_322_711 128
495 3300044673 Ga0453683_0215687 Ga0453683_0215687_770_1159 128
496 3300044673 Ga0453683_0215753 Ga0453683_0215753_51_440 128
497 3300044673 Ga0453683_0216051 Ga0453683_0216051_403_792 128
498 3300044673 Ga0453683_0278281 Ga0453683_0278281_628_1017 128
499 3300044673 Ga0453683_0621848 Ga0453683_0621848_120_509 128
500 3300044712 Ga0453684_0000440 Ga0453684_0000440_97033_97422 128
501 3300044712 Ga0453684_0000506 Ga0453684_0000506_11212_11601 128
502 3300044712 Ga0453684_0001121 Ga0453684_0001121_45677_46069 128
503 3300044712 Ga0453684_0001382 Ga0453684_0001382_11123_11512 128
504 3300044712 Ga0453684_0001549 Ga0453684_0001549_41923_42312 128
505 3300044712 Ga0453684_0004131 Ga0453684_0004131_25952_26341 128
506 3300044712 Ga0453684_0004169 Ga0453684_0004169_24991_25380 128
507 3300044712 Ga0453684_0004492 Ga0453684_0004492_3492_3881 128
508 3300044712 Ga0453684_0012437 Ga0453684_0012437_8367_8756 128
509 3300044712 Ga0453684_0035092 Ga0453684_0035092_1714_2103 128
510 3300044712 Ga0453684_0049674 Ga0453684_0049674_2157_2546 128
511 3300044712 Ga0453684_0064505 Ga0453684_0064505_1745_2134 128
512 3300044712 Ga0453684_0076172 Ga0453684_0076172_2628_3017 128
513 3300044712 Ga0453684_0104626 Ga0453684_0104626_2332_2721 128
514 3300044712 Ga0453684_0133450 Ga0453684_0133450_331_720 128
515 3300044712 Ga0453684_0143337 Ga0453684_0143337_601_990 128
516 3300044712 Ga0453684_0145941 Ga0453684_0145941_1515_1904 128
517 3300044712 Ga0453684_0182883 Ga0453684_0182883_51_440 128
518 3300044712 Ga0453684_0213872 Ga0453684_0213872_1518_1907 128
519 3300044712 Ga0453684_0267728 Ga0453684_0267728_727_1116 128
520 3300044712 Ga0453684_0385184 Ga0453684_0385184_128_517 128
521 3300044712 Ga0453684_0417493 Ga0453684_0417493_780_1169 128
522 3300044712 Ga0453684_0532547 Ga0453684_0532547_390_779 128
523 3300044712 Ga0453684_0577897 Ga0453684_0577897_108_497 128
524 3300044712 Ga0453684_0811243 Ga0453684_0811243_123_512 128
525 3300044712 Ga0453684_1058534 Ga0453684_1058534_295_684 128
526 3300044712 Ga0453684_1398372 Ga0453684_1398372_295_684 128
527 3300044712 Ga0453684_1490826 Ga0453684_1490826_127_516 128
528 3300045051 Ga0451576_0000113 Ga0451576_0000113_182120_182509 128
529 3300045051 Ga0451576_0000204 Ga0451576_0000204_140543_140932 128
530 3300045051 Ga0451576_0000783 Ga0451576_0000783_402_791 128
531 3300045051 Ga0451576_0003652 Ga0451576_0003652_4446_4835 128
532 3300045051 Ga0451576_0011102 Ga0451576_0011102_6906_7295 128
533 3300045051 Ga0451576_0013908 Ga0451576_0013908_5228_5617 128
534 3300045051 Ga0451576_0022652 Ga0451576_0022652_6185_6574 128
535 3300045051 Ga0451576_0083654 Ga0451576_0083654_403_792 128
536 3300045051 Ga0451576_0088919 Ga0451576_0088919_1426_1815 128
537 3300045051 Ga0451576_0143234 Ga0451576_0143234_189_578 128
538 3300045051 Ga0451576_0277421 Ga0451576_0277421_360_749 128
539 3300045051 Ga0451576_0291923 Ga0451576_0291923_204_596 128
540 3300045051 Ga0451576_0438926 Ga0451576_0438926_779_1168 128
541 3300045051 Ga0451576_0937455 Ga0451576_0937455_23_412 128
542 3300045051 Ga0451576_0995907 Ga0451576_0995907_366_755 128
543 3300045051 Ga0451576_1846002 Ga0451576_1846002_108_497 128
544 3300045051 Ga0451576_2409690 Ga0451576_2409690_130_519 128
545 3300049571 Ga0501034_0390568 Ga0501034_0390568_747_1136 128
546 2124908027 MRS2a_Contig_24813 MRS2a_00669080 129
547 2162886007 SwRhRL2b_contig_156102 SwRhRL2b_0800.00002340 129
548 2162886007 SwRhRL2b_contig_3583939 SwRhRL2b_0788.00003260 129
549 3300001915 JGI24741J21665_1003251 JGI24741J21665_10032514 129
550 3300001979 JGI24740J21852_10008913 JGI24740J21852_100089133 129
551 3300001979 JGI24740J21852_10033543 JGI24740J21852_100335432 129
552 3300001990 JGI24737J22298_10001860 JGI24737J22298_1000186010 129
553 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003360 129
554 3300002067 JGI24735J21928_10005021 JGI24735J21928_100050215 129
555 3300002077 JGI24744J21845_10001128 JGI24744J21845_100011284 129
556 3300002737 JGI25162J39368_1000039 JGI25162J39368_1000039104 129
557 3300002737 JGI25162J39368_1001202 JGI25162J39368_100120212 129
558 3300002772 JGI25164J39214_1001166 JGI25164J39214_10011665 129
559 3300002773 JGI25152J39213_1000006 JGI25152J39213_100000621 129
560 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005212 129
561 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004380 129
562 3300003214 JGI25165J46597_1000678 JGI25165J46597_10006786 129
563 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004380 129
564 3300003316 rootH1_10024556 rootH1_100245565 129
565 3300003316 rootH1_10160693 rootH1_101606932 129
566 3300003320 rootH2_10056635 rootH2_100566355 129
567 3300003322 rootL2_10101710 rootL2_101017107 129
568 3300003323 rootH1_10045781 rootH1_1004578110 129
569 3300003323 rootH1_10193341 rootH1_101933414 129
570 3300003578 Ga0006562J51391_1007655 Ga0006562J51391_10076554 129
571 3300003781 Ga0055536_1000004 Ga0055536_1000004121 129
572 3300003791 Ga0055530_10000817 Ga0055530_100008177 129
573 3300004799 Ga0058863_10111335 Ga0058863_101113352 129
574 3300004800 Ga0058861_10176091 Ga0058861_101760914 129
575 3300004801 Ga0058860_10142251 Ga0058860_101422512 129
576 3300004803 Ga0058862_10102512 Ga0058862_101025124 129
577 3300005288 Ga0065714_10002624 Ga0065714_1000262421 129
578 3300005288 Ga0065714_10005956 Ga0065714_100059564 129
579 3300005288 Ga0065714_10009786 Ga0065714_100097862 129
580 3300005288 Ga0065714_10013697 Ga0065714_100136972 129
581 3300005288 Ga0065714_10022334 Ga0065714_100223342 129
582 3300005288 Ga0065714_10079789 Ga0065714_100797891 129
583 3300005288 Ga0065714_10102584 Ga0065714_101025843 129
584 3300005288 Ga0065714_10160851 Ga0065714_101608512 129
585 3300005289 Ga0065704_10000307 Ga0065704_1000030730 129
586 3300005289 Ga0065704_10073035 Ga0065704_100730353 129
587 3300005289 Ga0065704_10078273 Ga0065704_100782732 129
588 3300005289 Ga0065704_10177771 Ga0065704_101777712 129
589 3300005289 Ga0065704_10269193 Ga0065704_102691931 129
590 3300005289 Ga0065704_10346795 Ga0065704_103467952 129
591 3300005289 Ga0065704_10399407 Ga0065704_103994072 129
592 3300005289 Ga0065704_10458670 Ga0065704_104586701 129
593 3300005293 Ga0065715_10866960 Ga0065715_108669601 129
594 3300005293 Ga0065715_10927087 Ga0065715_109270871 129
595 3300005327 Ga0070658_10000153 Ga0070658_1000015314 129
596 3300005327 Ga0070658_10120312 Ga0070658_101203123 129
597 3300005327 Ga0070658_10244897 Ga0070658_102448972 129
598 3300005328 Ga0070676_10000312 Ga0070676_1000031227 129
599 3300005329 Ga0070683_100018688 Ga0070683_1000186884 129
600 3300005329 Ga0070683_100032136 Ga0070683_1000321363 129
601 3300005330 Ga0070690_100580742 Ga0070690_1005807422 129
602 3300005336 Ga0070680_100005676 Ga0070680_10000567611 129
603 3300005337 Ga0070682_100000768 Ga0070682_10000076812 129
604 3300005338 Ga0068868_100104416 Ga0068868_1001044163 129
605 3300005338 Ga0068868_100118877 Ga0068868_1001188771 129
606 3300005339 Ga0070660_100043744 Ga0070660_1000437443 129
607 3300005339 Ga0070660_100057675 Ga0070660_1000576754 129
608 3300005347 Ga0070668_100276810 Ga0070668_1002768102 129
609 3300005353 Ga0070669_100349495 Ga0070669_1003494952 129
610 3300005355 Ga0070671_100045958 Ga0070671_1000459584 129
611 3300005356 Ga0070674_100123468 Ga0070674_1001234683 129
612 3300005364 Ga0070673_100043212 Ga0070673_1000432123 129
613 3300005366 Ga0070659_100000375 Ga0070659_10000037514 129
614 3300005366 Ga0070659_101692991 Ga0070659_1016929911 129
615 3300005456 Ga0070678_100032095 Ga0070678_1000320953 129
616 3300005457 Ga0070662_100000074 Ga0070662_10000007413 129
617 3300005457 Ga0070662_100794941 Ga0070662_1007949412 129
618 3300005458 Ga0070681_10002985 Ga0070681_1000298512 129
619 3300005459 Ga0068867_100010877 Ga0068867_10001087710 129
620 3300005530 Ga0070679_100006255 Ga0070679_1000062557 129
621 3300005530 Ga0070679_100727393 Ga0070679_1007273931 129
622 3300005535 Ga0070684_100006351 Ga0070684_1000063512 129
623 3300005535 Ga0070684_100723154 Ga0070684_1007231542 129
624 3300005539 Ga0068853_100150954 Ga0068853_1001509544 129
625 3300005539 Ga0068853_100167326 Ga0068853_1001673263 129
626 3300005548 Ga0070665_100000372 Ga0070665_10000037226 129
627 3300005549 Ga0070704_101084299 Ga0070704_1010842992 129
628 3300005563 Ga0068855_100000360 Ga0068855_10000036035 129
629 3300005563 Ga0068855_100012268 Ga0068855_1000122688 129
630 3300005563 Ga0068855_100025831 Ga0068855_10002583111 129
631 3300005563 Ga0068855_100061070 Ga0068855_1000610705 129
632 3300005563 Ga0068855_100071470 Ga0068855_1000714702 129
633 3300005563 Ga0068855_100279474 Ga0068855_1002794743 129
634 3300005563 Ga0068855_100524481 Ga0068855_1005244812 129
635 3300005563 Ga0068855_100671044 Ga0068855_1006710442 129
636 3300005563 Ga0068855_100814966 Ga0068855_1008149662 129
637 3300005563 Ga0068855_100859569 Ga0068855_1008595692 129
638 3300005563 Ga0068855_102101977 Ga0068855_1021019771 129
639 3300005577 Ga0068857_100489716 Ga0068857_1004897162 129
640 3300005578 Ga0068854_100266832 Ga0068854_1002668321 129
641 3300005578 Ga0068854_100936506 Ga0068854_1009365062 129
642 3300005614 Ga0068856_100016148 Ga0068856_1000161489 129
643 3300005614 Ga0068856_100058008 Ga0068856_1000580082 129
644 3300005614 Ga0068856_100147792 Ga0068856_1001477922 129
645 3300005614 Ga0068856_100153582 Ga0068856_1001535825 129
646 3300005614 Ga0068856_100340133 Ga0068856_1003401333 129
647 3300005614 Ga0068856_100423074 Ga0068856_1004230743 129
648 3300005614 Ga0068856_100667106 Ga0068856_1006671062 129
649 3300005616 Ga0068852_100010466 Ga0068852_1000104666 129
650 3300005616 Ga0068852_100462537 Ga0068852_1004625372 129
651 3300005616 Ga0068852_101512163 Ga0068852_1015121632 129
652 3300005617 Ga0068859_102399722 Ga0068859_1023997222 129
653 3300005718 Ga0068866_10152156 Ga0068866_101521562 129
654 3300005841 Ga0068863_101631036 Ga0068863_1016310361 129
655 3300005841 Ga0068863_101913908 Ga0068863_1019139081 129
656 3300005843 Ga0068860_100562306 Ga0068860_1005623062 129
657 3300006186 Ga0075369_10350950 Ga0075369_103509501 129
658 3300006195 Ga0075366_10089546 Ga0075366_100895463 129
659 3300006195 Ga0075366_10252599 Ga0075366_102525991 129
660 3300006237 Ga0097621_100007799 Ga0097621_10000779916 129
661 3300006353 Ga0075370_10177105 Ga0075370_101771052 129
662 3300006358 Ga0068871_100000141 Ga0068871_10000014112 129
663 3300006881 Ga0068865_100000917 Ga0068865_10000091716 129
664 3300006931 Ga0097620_102399396 Ga0097620_1023993962 129
665 3300009011 Ga0105251_10057935 Ga0105251_100579353 129
666 3300009011 Ga0105251_10498151 Ga0105251_104981511 129
667 3300009036 Ga0105244_10000160 Ga0105244_100001607 129
668 3300009036 Ga0105244_10015827 Ga0105244_100158276 129
669 3300009093 Ga0105240_10000082 Ga0105240_1000008212 129
670 3300009093 Ga0105240_10073384 Ga0105240_100733844 129
671 3300009093 Ga0105240_10204993 Ga0105240_102049932 129
672 3300009093 Ga0105240_10432476 Ga0105240_104324761 129
673 3300009093 Ga0105240_10481262 Ga0105240_104812622 129
674 3300009093 Ga0105240_10924097 Ga0105240_109240972 129
675 3300009093 Ga0105240_10971270 Ga0105240_109712701 129
676 3300009093 Ga0105240_11222634 Ga0105240_112226341 129
677 3300009094 Ga0111539_11039008 Ga0111539_110390082 129
678 3300009098 Ga0105245_10812450 Ga0105245_108124502 129
679 3300009098 Ga0105245_11624337 Ga0105245_116243371 129
680 3300009148 Ga0105243_10000009 Ga0105243_10000009224 129
681 3300009148 Ga0105243_10003612 Ga0105243_1000361214 129
682 3300009148 Ga0105243_10014278 Ga0105243_100142786 129
683 3300009174 Ga0105241_10111599 Ga0105241_101115995 129
684 3300009174 Ga0105241_10177460 Ga0105241_101774602 129
685 3300009174 Ga0105241_10191865 Ga0105241_101918654 129
686 3300009174 Ga0105241_10555896 Ga0105241_105558961 129
687 3300009174 Ga0105241_11121315 Ga0105241_111213151 129
688 3300009174 Ga0105241_11613001 Ga0105241_116130011 129
689 3300009176 Ga0105242_10227333 Ga0105242_102273334 129
690 3300009176 Ga0105242_10279101 Ga0105242_102791011 129
691 3300009176 Ga0105242_10692446 Ga0105242_106924462 129
692 3300009176 Ga0105242_10847467 Ga0105242_108474672 129
693 3300009545 Ga0105237_10000794 Ga0105237_100007946 129
694 3300009545 Ga0105237_10002553 Ga0105237_1000255335 129
695 3300009545 Ga0105237_10006510 Ga0105237_100065107 129
696 3300009545 Ga0105237_10015313 Ga0105237_100153136 129
697 3300009545 Ga0105237_10015662 Ga0105237_100156623 129
698 3300009545 Ga0105237_10047854 Ga0105237_100478545 129
699 3300009545 Ga0105237_10071252 Ga0105237_100712522 129
700 3300009545 Ga0105237_10083942 Ga0105237_100839422 129
701 3300009545 Ga0105237_10185132 Ga0105237_101851323 129
702 3300009545 Ga0105237_11452365 Ga0105237_114523652 129
703 3300009551 Ga0105238_10017754 Ga0105238_1001775414 129
704 3300009551 Ga0105238_10194984 Ga0105238_101949842 129
705 3300009553 Ga0105249_10092720 Ga0105249_100927202 129
706 3300009829 Ga0130086_1024805 Ga0130086_10248051 129
707 3300009850 Ga0130085_1035330 Ga0130085_10353301 129
708 3300010375 Ga0105239_10000011 Ga0105239_10000011112 129
709 3300010375 Ga0105239_10005378 Ga0105239_1000537815 129
710 3300010375 Ga0105239_10015682 Ga0105239_1001568212 129
711 3300010375 Ga0105239_10248837 Ga0105239_102488372 129
712 3300010375 Ga0105239_10262733 Ga0105239_102627334 129
713 3300010375 Ga0105239_10429598 Ga0105239_104295983 129
714 3300010375 Ga0105239_12090703 Ga0105239_120907032 129
715 3300013100 Ga0157373_10000006 Ga0157373_100000069 129
716 3300013100 Ga0157373_10001033 Ga0157373_1000103316 129
717 3300013100 Ga0157373_10002831 Ga0157373_100028319 129
718 3300013100 Ga0157373_10009996 Ga0157373_100099966 129
719 3300013100 Ga0157373_10028999 Ga0157373_100289993 129
720 3300013100 Ga0157373_10059430 Ga0157373_100594303 129
721 3300013102 Ga0157371_10000041 Ga0157371_1000004118 129
722 3300013102 Ga0157371_10000091 Ga0157371_10000091111 129
723 3300013102 Ga0157371_10001553 Ga0157371_100015532 129
724 3300013102 Ga0157371_10013476 Ga0157371_100134761 129
725 3300013102 Ga0157371_10021684 Ga0157371_100216844 129
726 3300013102 Ga0157371_10033811 Ga0157371_100338116 129
727 3300013104 Ga0157370_10012207 Ga0157370_100122076 129
728 3300013104 Ga0157370_10014051 Ga0157370_100140516 129
729 3300013104 Ga0157370_10019740 Ga0157370_100197403 129
730 3300013104 Ga0157370_10041216 Ga0157370_100412167 129
731 3300013104 Ga0157370_10042074 Ga0157370_100420741 129
732 3300013104 Ga0157370_10327925 Ga0157370_103279251 129
733 3300013104 Ga0157370_10693077 Ga0157370_106930771 129
734 3300013104 Ga0157370_10856639 Ga0157370_108566392 129
735 3300013104 Ga0157370_11487469 Ga0157370_114874691 129
736 3300013105 Ga0157369_10000016 Ga0157369_10000016222 129
737 3300013105 Ga0157369_10008868 Ga0157369_100088682 129
738 3300013105 Ga0157369_10010007 Ga0157369_100100075 129
739 3300013105 Ga0157369_10030357 Ga0157369_1003035710 129
740 3300013105 Ga0157369_10080886 Ga0157369_100808862 129
741 3300013105 Ga0157369_10408180 Ga0157369_104081803 129
742 3300013105 Ga0157369_11507817 Ga0157369_115078171 129
743 3300013296 Ga0157374_10030641 Ga0157374_1003064110 129
744 3300013296 Ga0157374_10077301 Ga0157374_100773016 129
745 3300013296 Ga0157374_10208307 Ga0157374_102083075 129
746 3300013296 Ga0157374_10210459 Ga0157374_102104595 129
747 3300013296 Ga0157374_10371931 Ga0157374_103719311 129
748 3300013296 Ga0157374_10454107 Ga0157374_104541072 129
749 3300013296 Ga0157374_10986484 Ga0157374_109864842 129
750 3300013296 Ga0157374_11416639 Ga0157374_114166392 129
751 3300013296 Ga0157374_11420827 Ga0157374_114208272 129
752 3300013297 Ga0157378_10008303 Ga0157378_1000830314 129
753 3300013297 Ga0157378_10060889 Ga0157378_100608891 129
754 3300013306 Ga0163162_10003331 Ga0163162_100033312 129
755 3300013306 Ga0163162_10033491 Ga0163162_100334915 129
756 3300013306 Ga0163162_10047580 Ga0163162_100475802 129
757 3300013306 Ga0163162_10106514 Ga0163162_101065142 129
758 3300013306 Ga0163162_10278112 Ga0163162_102781123 129
759 3300013306 Ga0163162_11176876 Ga0163162_111768762 129
760 3300013307 Ga0157372_10000030 Ga0157372_1000003011 129
761 3300013307 Ga0157372_10000332 Ga0157372_1000033211 129
762 3300013307 Ga0157372_10003430 Ga0157372_100034305 129
763 3300013307 Ga0157372_10011651 Ga0157372_1001165120 129
764 3300013307 Ga0157372_10037880 Ga0157372_100378808 129
765 3300013307 Ga0157372_10129288 Ga0157372_101292882 129
766 3300013307 Ga0157372_10157361 Ga0157372_101573612 129
767 3300013307 Ga0157372_10903284 Ga0157372_109032842 129
768 3300013308 Ga0157375_10099030 Ga0157375_100990304 129
769 3300013308 Ga0157375_10904988 Ga0157375_109049881 129
770 3300013308 Ga0157375_11275906 Ga0157375_112759062 129
771 3300013308 Ga0157375_11403714 Ga0157375_114037141 129
772 3300013308 Ga0157375_11429406 Ga0157375_114294061 129
773 3300013308 Ga0157375_11618320 Ga0157375_116183201 129
774 3300013308 Ga0157375_13212846 Ga0157375_132128462 129
775 3300014325 Ga0163163_11138066 Ga0163163_111380662 129
776 3300014325 Ga0163163_11580757 Ga0163163_115807572 129
777 3300014325 Ga0163163_12203559 Ga0163163_122035591 129
778 3300014326 Ga0157380_10000051 Ga0157380_1000005129 129
779 3300014497 Ga0182008_10000003 Ga0182008_10000003184 129
780 3300014497 Ga0182008_10000034 Ga0182008_1000003416 129
781 3300014497 Ga0182008_10001770 Ga0182008_1000177013 129
782 3300014497 Ga0182008_10003643 Ga0182008_1000364315 129
783 3300014497 Ga0182008_10111138 Ga0182008_101111382 129
784 3300014497 Ga0182008_10345321 Ga0182008_103453211 129
785 3300014497 Ga0182008_10716442 Ga0182008_107164421 129
786 3300014745 Ga0157377_10009989 Ga0157377_100099894 129
787 3300014968 Ga0157379_11114424 Ga0157379_111144241 129
788 3300014969 Ga0157376_10125737 Ga0157376_101257375 129
789 3300015261 Ga0182006_1000001 Ga0182006_1000001874 129
790 3300015261 Ga0182006_1000103 Ga0182006_100010372 129
791 3300015261 Ga0182006_1006389 Ga0182006_10063892 129
792 3300015261 Ga0182006_1008481 Ga0182006_10084815 129
793 3300015261 Ga0182006_1068748 Ga0182006_10687482 129
794 3300015262 Ga0182007_10000002 Ga0182007_10000002421 129
795 3300015262 Ga0182007_10005771 Ga0182007_100057716 129
796 3300015262 Ga0182007_10015899 Ga0182007_100158993 129
797 3300015682 Ga0183373_1004 Ga0183373_100475 129
798 3300017792 Ga0163161_10000207 Ga0163161_1000020747 129
799 3300017792 Ga0163161_10039425 Ga0163161_100394253 129
800 3300017792 Ga0163161_10097976 Ga0163161_100979761 129
801 3300017792 Ga0163161_10125798 Ga0163161_101257982 129
802 3300017792 Ga0163161_10554453 Ga0163161_105544531 129
803 3300017792 Ga0163161_10628450 Ga0163161_106284502 129
804 3300017792 Ga0163161_10709095 Ga0163161_107090952 129
805 3300017792 Ga0163161_10739282 Ga0163161_107392822 129
806 3300017792 Ga0163161_11250984 Ga0163161_112509841 129
807 3300020069 Ga0197907_10757494 Ga0197907_107574943 129
808 3300020069 Ga0197907_11138220 Ga0197907_111382202 129
809 3300020070 Ga0206356_10991038 Ga0206356_109910383 129
810 3300020070 Ga0206356_11209637 Ga0206356_112096371 129
811 3300020075 Ga0206349_1692805 Ga0206349_16928051 129
812 3300020077 Ga0206351_10267476 Ga0206351_102674764 129
813 3300020077 Ga0206351_10387294 Ga0206351_103872946 129
814 3300020077 Ga0206351_10512829 Ga0206351_105128294 129
815 3300020078 Ga0206352_10226992 Ga0206352_102269922 129
816 3300020078 Ga0206352_10382572 Ga0206352_103825722 129
817 3300020078 Ga0206352_10622029 Ga0206352_106220294 129
818 3300020078 Ga0206352_10835038 Ga0206352_108350383 129
819 3300020080 Ga0206350_10018304 Ga0206350_100183045 129
820 3300020080 Ga0206350_11221028 Ga0206350_112210282 129
821 3300020081 Ga0206354_10248047 Ga0206354_102480472 129
822 3300020081 Ga0206354_10263498 Ga0206354_102634982 129
823 3300020081 Ga0206354_11507030 Ga0206354_115070302 129
824 3300020082 Ga0206353_10159245 Ga0206353_101592452 129
825 3300020082 Ga0206353_10736142 Ga0206353_107361424 129
826 3300020610 Ga0154015_1024308 Ga0154015_10243084 129
827 3300020610 Ga0154015_1037437 Ga0154015_10374374 129
828 3300020610 Ga0154015_1309672 Ga0154015_13096722 129
829 3300021361 Ga0213872_10051000 Ga0213872_100510002 129
830 3300022467 Ga0224712_10004189 Ga0224712_100041894 129
831 3300022467 Ga0224712_10045345 Ga0224712_100453453 129
832 3300022467 Ga0224712_10082607 Ga0224712_100826072 129
833 3300025230 Ga0209563_127189 Ga0209563_1271891 129
834 3300025231 Ga0207427_100025 Ga0207427_100025314 129
835 3300025233 Ga0209437_100010 Ga0209437_100010576 129
836 3300025233 Ga0209437_100135 Ga0209437_10013576 129
837 3300025245 Ga0207425_1000008 Ga0207425_100000858 129
838 3300025250 Ga0209026_1000610 Ga0209026_100061032 129
839 3300025250 Ga0209026_1004574 Ga0209026_10045744 129
840 3300025254 Ga0209148_1033295 Ga0209148_10332951 129
841 3300025254 Ga0209148_1037006 Ga0209148_10370061 129
842 3300025258 Ga0209129_1000040 Ga0209129_1000040207 129
843 3300025258 Ga0209129_1049492 Ga0209129_10494922 129
844 3300025261 Ga0209233_1000017 Ga0209233_1000017589 129
845 3300025261 Ga0209233_1032971 Ga0209233_10329711 129
846 3300025291 Ga0209675_1000200 Ga0209675_10002004 129
847 3300025292 Ga0209676_1000009 Ga0209676_1000009432 129
848 3300025294 Ga0209025_1000020 Ga0209025_100002058 129
849 3300025297 Ga0209758_1000022 Ga0209758_100002258 129
850 3300025298 Ga0209050_1000048 Ga0209050_1000048228 129
851 3300025728 Ga0207655_1000016 Ga0207655_1000016452 129
852 3300025728 Ga0207655_1062533 Ga0207655_10625332 129
853 3300025899 Ga0207642_10051496 Ga0207642_100514961 129
854 3300025899 Ga0207642_10122961 Ga0207642_101229612 129
855 3300025904 Ga0207647_10000303 Ga0207647_1000030337 129
856 3300025904 Ga0207647_10032931 Ga0207647_100329316 129
857 3300025904 Ga0207647_10036461 Ga0207647_100364614 129
858 3300025907 Ga0207645_10000035 Ga0207645_1000003569 129
859 3300025909 Ga0207705_10000108 Ga0207705_1000010899 129
860 3300025909 Ga0207705_10328136 Ga0207705_103281362 129
861 3300025911 Ga0207654_10023808 Ga0207654_100238084 129
862 3300025911 Ga0207654_10124200 Ga0207654_101242002 129
863 3300025911 Ga0207654_10648325 Ga0207654_106483252 129
864 3300025911 Ga0207654_10982565 Ga0207654_109825651 129
865 3300025912 Ga0207707_10032972 Ga0207707_100329722 129
866 3300025913 Ga0207695_10000053 Ga0207695_10000053339 129
867 3300025913 Ga0207695_10039657 Ga0207695_100396573 129
868 3300025913 Ga0207695_10062421 Ga0207695_100624214 129
869 3300025913 Ga0207695_10080728 Ga0207695_100807285 129
870 3300025913 Ga0207695_10085252 Ga0207695_100852521 129
871 3300025913 Ga0207695_10288044 Ga0207695_102880442 129
872 3300025914 Ga0207671_10005849 Ga0207671_1000584919 129
873 3300025914 Ga0207671_10011776 Ga0207671_100117764 129
874 3300025914 Ga0207671_10013363 Ga0207671_100133633 129
875 3300025914 Ga0207671_10018120 Ga0207671_100181204 129
876 3300025914 Ga0207671_10020602 Ga0207671_100206026 129
877 3300025914 Ga0207671_10034795 Ga0207671_100347956 129
878 3300025914 Ga0207671_10072375 Ga0207671_100723753 129
879 3300025914 Ga0207671_10722220 Ga0207671_107222202 129
880 3300025914 Ga0207671_10847229 Ga0207671_108472292 129
881 3300025917 Ga0207660_10360566 Ga0207660_103605662 129
882 3300025919 Ga0207657_10055251 Ga0207657_100552514 129
883 3300025919 Ga0207657_10111319 Ga0207657_101113192 129
884 3300025919 Ga0207657_10231799 Ga0207657_102317992 129
885 3300025919 Ga0207657_10398871 Ga0207657_103988711 129
886 3300025920 Ga0207649_10253338 Ga0207649_102533382 129
887 3300025921 Ga0207652_10002419 Ga0207652_1000241912 129
888 3300025921 Ga0207652_10095693 Ga0207652_100956933 129
889 3300025921 Ga0207652_11552987 Ga0207652_115529871 129
890 3300025923 Ga0207681_10486661 Ga0207681_104866612 129
891 3300025924 Ga0207694_10009649 Ga0207694_1000964915 129
892 3300025924 Ga0207694_10042226 Ga0207694_100422265 129
893 3300025927 Ga0207687_11130250 Ga0207687_111302501 129
894 3300025929 Ga0207664_10602438 Ga0207664_106024382 129
895 3300025932 Ga0207690_10000936 Ga0207690_1000093613 129
896 3300025932 Ga0207690_10069096 Ga0207690_100690963 129
897 3300025933 Ga0207706_10019009 Ga0207706_100190098 129
898 3300025933 Ga0207706_10854126 Ga0207706_108541262 129
899 3300025934 Ga0207686_10187305 Ga0207686_101873051 129
900 3300025935 Ga0207709_10000026 Ga0207709_10000026225 129
901 3300025935 Ga0207709_10000084 Ga0207709_10000084128 129
902 3300025935 Ga0207709_10020248 Ga0207709_100202484 129
903 3300025935 Ga0207709_11582225 Ga0207709_115822251 129
904 3300025938 Ga0207704_10000036 Ga0207704_1000003661 129
905 3300025940 Ga0207691_10275349 Ga0207691_102753492 129
906 3300025942 Ga0207689_10558361 Ga0207689_105583612 129
907 3300025944 Ga0207661_10013292 Ga0207661_100132926 129
908 3300025944 Ga0207661_10014621 Ga0207661_100146218 129
909 3300025949 Ga0207667_10000430 Ga0207667_1000043035 129
910 3300025949 Ga0207667_10022849 Ga0207667_100228493 129
911 3300025949 Ga0207667_10023666 Ga0207667_100236667 129
912 3300025949 Ga0207667_10041900 Ga0207667_100419003 129
913 3300025949 Ga0207667_10093127 Ga0207667_100931273 129
914 3300025949 Ga0207667_10242746 Ga0207667_102427463 129
915 3300025949 Ga0207667_10265903 Ga0207667_102659031 129
916 3300025960 Ga0207651_10009416 Ga0207651_100094163 129
917 3300025961 Ga0207712_10542484 Ga0207712_105424841 129
918 3300025972 Ga0207668_10020698 Ga0207668_100206983 129
919 3300025972 Ga0207668_11671342 Ga0207668_116713421 129
920 3300025981 Ga0207640_10192986 Ga0207640_101929861 129
921 3300025981 Ga0207640_10912444 Ga0207640_109124441 129
922 3300026023 Ga0207677_11055425 Ga0207677_110554251 129
923 3300026041 Ga0207639_10167234 Ga0207639_101672342 129
924 3300026041 Ga0207639_10546031 Ga0207639_105460311 129
925 3300026041 Ga0207639_11132541 Ga0207639_111325411 129
926 3300026078 Ga0207702_10010443 Ga0207702_100104438 129
927 3300026078 Ga0207702_10068465 Ga0207702_100684654 129
928 3300026078 Ga0207702_10069982 Ga0207702_100699824 129
929 3300026078 Ga0207702_10311424 Ga0207702_103114242 129
930 3300026078 Ga0207702_10318830 Ga0207702_103188303 129
931 3300026078 Ga0207702_10322206 Ga0207702_103222062 129
932 3300026078 Ga0207702_10370041 Ga0207702_103700412 129
933 3300026078 Ga0207702_10567715 Ga0207702_105677151 129
934 3300026078 Ga0207702_12422588 Ga0207702_124225882 129
935 3300026089 Ga0207648_10000333 Ga0207648_1000033327 129
936 3300026116 Ga0207674_10641092 Ga0207674_106410922 129
937 3300026116 Ga0207674_10812864 Ga0207674_108128642 129
938 3300026121 Ga0207683_10003418 Ga0207683_100034189 129
939 3300026142 Ga0207698_10013453 Ga0207698_100134532 129
940 3300026142 Ga0207698_10150675 Ga0207698_101506751 129
941 3300026142 Ga0207698_10337062 Ga0207698_103370622 129
942 3300028379 Ga0268266_10000658 Ga0268266_1000065826 129
943 3300028381 Ga0268264_10861207 Ga0268264_108612072 129
944 3300028573 Ga0265334_10025950 Ga0265334_100259505 129
945 3300028786 Ga0307517_10012583 Ga0307517_100125833 129
946 3300028786 Ga0307517_10295128 Ga0307517_102951282 129
947 3300028794 Ga0307515_10179470 Ga0307515_101794703 129
948 3300028794 Ga0307515_10339301 Ga0307515_103393011 129
949 3300028794 Ga0307515_10669408 Ga0307515_106694081 129
950 3300028800 Ga0265338_10007954 Ga0265338_1000795421 129
951 3300028800 Ga0265338_10570954 Ga0265338_105709542 129
952 3300030731 Ga0316177_1073605 Ga0316177_107360514 129
953 3300030732 Ga0316176_1042405 Ga0316176_10424055 129
954 3300030733 Ga0314311_1036826 Ga0314311_10368261 129
955 3300030742 Ga0316183_1033300 Ga0316183_103330020 129
956 3300030744 Ga0316181_1034557 Ga0316181_103455711 129
957 3300030745 Ga0316182_1143329 Ga0316182_11433292 129
958 3300030745 Ga0316182_1415427 Ga0316182_14154274 129
959 3300031249 Ga0265339_10431907 Ga0265339_104319071 129
960 3300031251 Ga0265327_10075375 Ga0265327_100753753 129
961 3300031251 Ga0265327_10134823 Ga0265327_101348232 129
962 3300031507 Ga0307509_10114085 Ga0307509_101140853 129
963 3300031548 Ga0307408_100003785 Ga0307408_10000378515 129
964 3300031548 Ga0307408_100005144 Ga0307408_1000051442 129
965 3300031548 Ga0307408_100966780 Ga0307408_1009667802 129
966 3300031727 Ga0316576_10452242 Ga0316576_104522422 129
967 3300031731 Ga0307405_10000006 Ga0307405_1000000672 129
968 3300031731 Ga0307405_10080775 Ga0307405_100807751 129
969 3300031731 Ga0307405_10217445 Ga0307405_102174452 129
970 3300031824 Ga0307413_10464591 Ga0307413_104645912 129
971 3300031824 Ga0307413_10685145 Ga0307413_106851452 129
972 3300031852 Ga0307410_10428957 Ga0307410_104289572 129
973 3300031903 Ga0307407_10000003 Ga0307407_10000003176 129
974 3300031911 Ga0307412_10002079 Ga0307412_1000207910 129
975 3300031911 Ga0307412_10003796 Ga0307412_100037965 129
976 3300031911 Ga0307412_10012909 Ga0307412_100129098 129
977 3300031911 Ga0307412_10014929 Ga0307412_100149292 129
978 3300031911 Ga0307412_10041647 Ga0307412_100416475 129
979 3300031911 Ga0307412_10248062 Ga0307412_102480622 129
980 3300031911 Ga0307412_10465219 Ga0307412_104652192 129
981 3300031911 Ga0307412_10932103 Ga0307412_109321032 129
982 3300031995 Ga0307409_100068515 Ga0307409_1000685152 129
983 3300032002 Ga0307416_100000002 Ga0307416_100000002420 129
984 3300032002 Ga0307416_100000006 Ga0307416_10000000671 129
985 3300032002 Ga0307416_100079899 Ga0307416_1000798995 129
986 3300032004 Ga0307414_10000030 Ga0307414_1000003015 129
987 3300032004 Ga0307414_10005329 Ga0307414_1000532910 129
988 3300032004 Ga0307414_10005856 Ga0307414_100058564 129
989 3300032004 Ga0307414_10008647 Ga0307414_100086477 129
990 3300032004 Ga0307414_10009488 Ga0307414_100094882 129
991 3300032004 Ga0307414_10012166 Ga0307414_100121662 129
992 3300032004 Ga0307414_10065136 Ga0307414_100651362 129
993 3300032004 Ga0307414_10082843 Ga0307414_100828435 129
994 3300032004 Ga0307414_10085579 Ga0307414_100855791 129
995 3300032004 Ga0307414_10087301 Ga0307414_100873013 129
996 3300032004 Ga0307414_10126650 Ga0307414_101266503 129
997 3300032004 Ga0307414_10457857 Ga0307414_104578572 129
998 3300032004 Ga0307414_10606466 Ga0307414_106064661 129
999 3300032004 Ga0307414_10904314 Ga0307414_109043142 129
1000 3300032004 Ga0307414_11331723 Ga0307414_113317232 129
1001 3300032004 Ga0307414_11349251 Ga0307414_113492512 129
1002 3300032005 Ga0307411_10055855 Ga0307411_100558554 129
1003 3300032005 Ga0307411_10892300 Ga0307411_108923002 129
1004 3300032005 Ga0307411_11077058 Ga0307411_110770582 129
1005 3300032005 Ga0307411_11551145 Ga0307411_115511451 129
1006 3300033179 Ga0307507_10000034 Ga0307507_10000034125 129
1007 3300033180 Ga0307510_10003892 Ga0307510_1000389211 129
1008 3300033524 Ga0316592_1014787 Ga0316592_10147873 129
1009 3300033527 Ga0316586_1009678 Ga0316586_10096783 129
1010 3300033528 Ga0316588_1062965 Ga0316588_10629652 129
1011 3300033529 Ga0316587_1009264 Ga0316587_10092642 129
1012 3300033541 Ga0316596_1003898 Ga0316596_10038984 129
1013 3300037312 Ga0395899_0000034 Ga0395899_0000034_32158_32547 129
1014 3300037312 Ga0395899_0000472 Ga0395899_0000472_39274_39663 129
1015 3300037312 Ga0395899_0000499 Ga0395899_0000499_39076_39465 129
1016 3300037312 Ga0395899_0000673 Ga0395899_0000673_13758_14177 129
1017 3300037418 Ga0395900_0000346 Ga0395900_0000346_42591_42980 129
1018 3300037418 Ga0395900_0000441 Ga0395900_0000441_755_1144 129
1019 3300037418 Ga0395900_0169281 Ga0395900_0169281_1578_1997 129
1020 3300037418 Ga0395900_0208359 Ga0395900_0208359_701_1129 129
1021 3300037418 Ga0395900_0827767 Ga0395900_0827767_181_570 129
1022 3300037466 Ga0395898_0021701 Ga0395898_0021701_1491_1880 129
1023 3300037466 Ga0395898_1478469 Ga0395898_1478469_74_463 129
1024 3300037471 Ga0395905_0000376 Ga0395905_0000376_21231_21644 129
1025 3300037471 Ga0395905_0000528 Ga0395905_0000528_25024_25413 129
1026 3300037471 Ga0395905_0127136 Ga0395905_0127136_1964_2353 129
1027 3300038443 Ga0395901_0000351 Ga0395901_0000351_24525_24914 129
1028 3300038443 Ga0395901_0003122 Ga0395901_0003122_2081_2497 129
1029 3300038443 Ga0395901_0896929 Ga0395901_0896929_129_518 129
1030 3300039447 Ga0436361_0433548 Ga0436361_0433548_6729_7118 129
1031 3300041413 Ga0439465_0002928 Ga0439465_0002928_1814_2203 129
1032 3300041442 Ga0451788_26116 Ga0451788_26116_75_464 129
1033 3300041444 Ga0451790_03894 Ga0451790_03894_226_615 129
1034 3300041444 Ga0451790_24363 Ga0451790_24363_102_491 129
1035 3300041444 Ga0451790_25357 Ga0451790_25357_70_459 129
1036 3300041444 Ga0451790_36804 Ga0451790_36804_24_413 129
1037 3300041445 Ga0451792_07354 Ga0451792_07354_64_453 129
1038 3300041446 Ga0451794_08398 Ga0451794_08398_46_435 129
1039 3300041446 Ga0451794_24707 Ga0451794_24707_380_769 129
1040 3300041446 Ga0451794_25189 Ga0451794_25189_90_479 129
1041 3300041451 Ga0451791_1291585 Ga0451791_1291585_343_732 129
1042 3300041452 Ga0451793_0486272 Ga0451793_0486272_376_765 129
1043 3300041458 Ga0451798_0268261 Ga0451798_0268261_35_424 129
1044 3300041486 Ga0451807_1458215 Ga0451807_1458215_100_489 129
1045 3300041507 Ga0451851_0089935 Ga0451851_0089935_471_860 129
1046 3300041916 Ga0452271_37402 Ga0452271_37402_292_681 129
1047 3300041916 Ga0452271_80664 Ga0452271_80664_76_465 129
1048 3300042004 Ga0439445_0000090 Ga0439445_0000090_13170_13559 129
1049 3300042005 Ga0439448_0001990 Ga0439448_0001990_909_1298 129
1050 3300042014 Ga0439457_024112 Ga0439457_024112_500_889 129
1051 3300042533 Ga0450901_005819 Ga0450901_005819_688_1077 129
1052 3300044684 Ga0466966_0001476 Ga0466966_0001476_12696_13085 129
1053 3300044693 Ga0466961_0182800 Ga0466961_0182800_746_1135 129
1054 3300044693 Ga0466961_0863931 Ga0466961_0863931_133_525 129
1055 3300045049 Ga0466959_0124272 Ga0466959_0124272_299_691 129
1056 3300045051 Ga0451576_0047948 Ga0451576_0047948_3139_3531 129
1057 3300045836 Ga0466958_0007843 Ga0466958_0007843_2400_2789 129
1058 3300046453 Ga0495627_000022 Ga0495627_000022_198007_198396 129
1059 3300046453 Ga0495627_051473 Ga0495627_051473_762_1151 129
1060 3300046454 Ga0495592_0123750 Ga0495592_0123750_1312_1701 129
1061 3300046457 Ga0495590_0000627 Ga0495590_0000627_10045_10434 129
1062 3300046460 Ga0495638_0616280 Ga0495638_0616280_16_405 129
1063 3300046462 Ga0495651_0082640 Ga0495651_0082640_822_1211 129
1064 3300046471 Ga0495650_0000023 Ga0495650_0000023_61364_61753 129
1065 3300046471 Ga0495650_0122333 Ga0495650_0122333_383_772 129
1066 3300046476 Ga0495662_0053308 Ga0495662_0053308_695_1105 129
1067 3300046492 Ga0495585_0000476 Ga0495585_0000476_36411_36800 129
1068 3300046492 Ga0495585_0001907 Ga0495585_0001907_12871_13260 129
1069 3300046492 Ga0495585_0079477 Ga0495585_0079477_837_1226 129
1070 3300046501 Ga0495607_0068813 Ga0495607_0068813_1486_1875 129
1071 3300046501 Ga0495607_0109464 Ga0495607_0109464_1001_1390 129
1072 3300046506 Ga0495583_0045267 Ga0495583_0045267_839_1228 129
1073 3300046507 Ga0495606_0003554 Ga0495606_0003554_5349_5738 129
1074 3300046507 Ga0495606_0011558 Ga0495606_0011558_2442_2831 129
1075 3300046507 Ga0495606_0042764 Ga0495606_0042764_2076_2465 129
1076 3300046507 Ga0495606_0131694 Ga0495606_0131694_234_623 129
1077 3300046507 Ga0495606_0284996 Ga0495606_0284996_123_512 129
1078 3300046507 Ga0495606_0608547 Ga0495606_0608547_134_523 129
1079 3300046512 Ga0495610_0000005 Ga0495610_0000005_188160_188549 129
1080 3300046512 Ga0495610_0020639 Ga0495610_0020639_175_564 129
1081 3300046512 Ga0495610_0033472 Ga0495610_0033472_760_1149 129
1082 3300046512 Ga0495610_0155940 Ga0495610_0155940_405_794 129
1083 3300046513 Ga0495616_0022430 Ga0495616_0022430_298_687 129
1084 3300046513 Ga0495616_0073426 Ga0495616_0073426_980_1369 129
1085 3300046513 Ga0495616_0244907 Ga0495616_0244907_56_445 129
1086 3300046516 Ga0495628_1034669 Ga0495628_1034669_53_442 129
1087 3300046518 Ga0495631_0002385 Ga0495631_0002385_4865_5254 129
1088 3300046518 Ga0495631_0061979 Ga0495631_0061979_643_1032 129
1089 3300046519 Ga0495632_0004162 Ga0495632_0004162_6458_6847 129
1090 3300046519 Ga0495632_0110742 Ga0495632_0110742_370_759 129
1091 3300046519 Ga0495632_0520565 Ga0495632_0520565_42_431 129
1092 3300046520 Ga0495637_0066720 Ga0495637_0066720_282_671 129
1093 3300046522 Ga0495643_0024720 Ga0495643_0024720_1693_2082 129
1094 3300046523 Ga0495644_0017124 Ga0495644_0017124_1180_1569 129
1095 3300046524 Ga0495648_0017616 Ga0495648_0017616_4007_4396 129
1096 3300046524 Ga0495648_0098997 Ga0495648_0098997_1059_1448 129
1097 3300046525 Ga0495663_0000053 Ga0495663_0000053_50262_50651 129
1098 3300046525 Ga0495663_0019140 Ga0495663_0019140_1364_1753 129
1099 3300046525 Ga0495663_0081759 Ga0495663_0081759_634_1023 129
1100 3300046528 Ga0495642_0031330 Ga0495642_0031330_886_1275 129
1101 3300046529 Ga0495652_0033059 Ga0495652_0033059_4072_4461 129
1102 3300046530 Ga0495654_0000003 Ga0495654_0000003_695997_696386 129
1103 3300046530 Ga0495654_0070029 Ga0495654_0070029_1242_1631 129
1104 3300046536 Ga0495587_0586209 Ga0495587_0586209_141_530 129
1105 3300046538 Ga0495609_0000003 Ga0495609_0000003_682385_682774 129
1106 3300046538 Ga0495609_0004523 Ga0495609_0004523_2867_3256 129
1107 3300046538 Ga0495609_0006730 Ga0495609_0006730_964_1353 129
1108 3300046538 Ga0495609_0014049 Ga0495609_0014049_1399_1788 129
1109 3300046542 Ga0495597_0206106 Ga0495597_0206106_138_527 129
1110 3300046558 Ga0495633_0000072 Ga0495633_0000072_84380_84769 129
1111 3300046558 Ga0495633_0003150 Ga0495633_0003150_1711_2100 129
1112 3300046558 Ga0495633_0016150 Ga0495633_0016150_2697_3086 129
1113 3300046558 Ga0495633_0020940 Ga0495633_0020940_1317_1706 129
1114 3300046558 Ga0495633_0501692 Ga0495633_0501692_42_431 129
1115 3300046616 Ga0495668_0000165 Ga0495668_0000165_4584_4973 129
1116 3300046616 Ga0495668_0069683 Ga0495668_0069683_535_924 129
1117 3300046642 Ga0495634_0138088 Ga0495634_0138088_278_688 129
1118 3300046642 Ga0495634_0610215 Ga0495634_0610215_16_405 129
1119 3300046648 Ga0495611_0042182 Ga0495611_0042182_183_572 129
1120 3300046660 Ga0495625_0000096 Ga0495625_0000096_82247_82636 129
1121 3300046660 Ga0495625_0000308 Ga0495625_0000308_10624_11013 129
1122 3300046660 Ga0495625_0106019 Ga0495625_0106019_1009_1398 129
1123 3300046660 Ga0495625_0171535 Ga0495625_0171535_541_930 129
1124 3300046660 Ga0495625_0217728 Ga0495625_0217728_572_961 129
1125 3300046660 Ga0495625_0465596 Ga0495625_0465596_67_456 129
1126 3300046665 Ga0495661_0103742 Ga0495661_0103742_135_524 129
1127 3300046665 Ga0495661_0133006 Ga0495661_0133006_155_544 129
1128 3300046674 Ga0495588_0076305 Ga0495588_0076305_1348_1737 129
1129 3300046683 Ga0495658_0058588 Ga0495658_0058588_564_953 129
1130 3300046684 Ga0495669_0043303 Ga0495669_0043303_875_1264 129
1131 3300046691 Ga0495670_0127741 Ga0495670_0127741_246_635 129
1132 3300046692 Ga0495671_0036148 Ga0495671_0036148_957_1346 129
1133 3300046694 Ga0495649_0000105 Ga0495649_0000105_63739_64128 129
1134 3300046694 Ga0495649_0066186 Ga0495649_0066186_311_700 129
1135 3300046794 Ga0495589_0317863 Ga0495589_0317863_284_673 129
1136 3300046809 Ga0495600_0108075 Ga0495600_0108075_818_1207 129
1137 3300046810 Ga0495660_0256013 Ga0495660_0256013_155_544 129
1138 3300047317 Ga0495604_0590296 Ga0495604_0590296_298_687 129
1139 3300047322 Ga0495680_1103152 Ga0495680_1103152_29_439 129
1140 3300047443 Ga0495687_000233 Ga0495687_000233_61896_62285 129
1141 3300047443 Ga0495687_098283 Ga0495687_098283_672_1061 129
1142 3300047447 Ga0495685_050912 Ga0495685_050912_482_871 129
1143 3300047469 Ga0495673_0025163 Ga0495673_0025163_33_422 129
1144 3300047470 Ga0495681_0032669 Ga0495681_0032669_799_1188 129
1145 3300047472 Ga0495686_0000133 Ga0495686_0000133_1571_1960 129
1146 3300047472 Ga0495686_0002422 Ga0495686_0002422_10199_10588 129
1147 3300047472 Ga0495686_0010199 Ga0495686_0010199_836_1225 129
1148 3300047472 Ga0495686_0244332 Ga0495686_0244332_227_616 129
1149 3300047472 Ga0495686_0390316 Ga0495686_0390316_189_578 129
1150 3300047472 Ga0495686_0417035 Ga0495686_0417035_225_614 129
1151 3300047673 Ga0495593_0572900 Ga0495593_0572900_168_557 129
1152 3300048089 Ga0495614_0023016 Ga0495614_0023016_644_1033 129
1153 3300048903 Ga0496100_0514498 Ga0496100_0514498_29_418 129
1154 3300048905 Ga0496102_0094764 Ga0496102_0094764_1741_2130 129
1155 3300048906 Ga0496103_0207758 Ga0496103_0207758_307_696 129
1156 3300048907 Ga0496104_0513882 Ga0496104_0513882_374_763 129
1157 3300048916 Ga0496113_0105034 Ga0496113_0105034_1246_1635 129
1158 3300048917 Ga0496114_0091395 Ga0496114_0091395_1887_2276 129
1159 3300048918 Ga0496115_0738107 Ga0496115_0738107_20_409 129
1160 3300048919 Ga0496116_0000029 Ga0496116_0000029_73352_73741 129
1161 3300048919 Ga0496116_0005535 Ga0496116_0005535_5637_6026 129
1162 3300048920 Ga0496117_0000007 Ga0496117_0000007_71730_72119 129
1163 3300048920 Ga0496117_0001863 Ga0496117_0001863_13649_14038 129
1164 3300048921 Ga0496118_0022242 Ga0496118_0022242_3781_4170 129
1165 3300048921 Ga0496118_0025644 Ga0496118_0025644_1106_1495 129
1166 3300048922 Ga0496119_0000007 Ga0496119_0000007_71797_72186 129
1167 3300048925 Ga0496122_0000862 Ga0496122_0000862_26015_26404 129
1168 3300048925 Ga0496122_0006922 Ga0496122_0006922_2761_3150 129
1169 3300048925 Ga0496122_0025542 Ga0496122_0025542_3127_3516 129
1170 3300048926 Ga0496123_0013292 Ga0496123_0013292_2973_3362 129
1171 3300048926 Ga0496123_0015001 Ga0496123_0015001_3439_3828 129
1172 3300048926 Ga0496123_0058126 Ga0496123_0058126_1913_2302 129
1173 3300048926 Ga0496123_0211468 Ga0496123_0211468_327_716 129
1174 3300048927 Ga0496124_0013719 Ga0496124_0013719_938_1327 129
1175 3300048927 Ga0496124_0039503 Ga0496124_0039503_1719_2108 129
1176 3300048927 Ga0496124_0438807 Ga0496124_0438807_121_510 129
1177 3300048928 Ga0496125_0048493 Ga0496125_0048493_402_791 129
1178 3300048928 Ga0496125_0056896 Ga0496125_0056896_1327_1716 129
1179 3300048928 Ga0496125_0179552 Ga0496125_0179552_838_1227 129
1180 3300048928 Ga0496125_0758204 Ga0496125_0758204_69_458 129
1181 3300048929 Ga0496126_0002974 Ga0496126_0002974_21176_21565 129
1182 3300049127 Ga0501306_002387 Ga0501306_002387_1071_1460 129
1183 3300049127 Ga0501306_029242 Ga0501306_029242_11_400 129
1184 3300049127 Ga0501306_088956 Ga0501306_088956_76_465 129
1185 3300049129 Ga0501309_079192 Ga0501309_079192_40_429 129
1186 3300049130 Ga0501310_006583 Ga0501310_006583_177_566 129
1187 3300049130 Ga0501310_044778 Ga0501310_044778_172_561 129
1188 3300049130 Ga0501310_048367 Ga0501310_048367_155_544 129
1189 3300049132 Ga0501343_016908 Ga0501343_016908_82_471 129
1190 3300049161 Ga0501305_006266 Ga0501305_006266_197_586 129
1191 3300049161 Ga0501305_013964 Ga0501305_013964_80_469 129
1192 3300049162 Ga0501307_003414 Ga0501307_003414_1047_1436 129
1193 3300049162 Ga0501307_005780 Ga0501307_005780_342_731 129
1194 3300049459 Ga0495678_012530 Ga0495678_012530_2003_2392 129
1195 3300049460 Ga0495682_0007766 Ga0495682_0007766_2165_2554 129
1196 3300049527 Ga0501311_013259 Ga0501311_013259_216_605 129
1197 3300049528 Ga0501312_007913 Ga0501312_007913_804_1193 129
1198 3300049531 Ga0501315_004584 Ga0501315_004584_866_1255 129
1199 3300049531 Ga0501315_009200 Ga0501315_009200_260_649 129
1200 3300049531 Ga0501315_020543 Ga0501315_020543_393_782 129
1201 3300049531 Ga0501315_089576 Ga0501315_089576_62_451 129
1202 3300049532 Ga0501316_001608 Ga0501316_001608_1463_1852 129
1203 3300049532 Ga0501316_027774 Ga0501316_027774_53_442 129
1204 3300049532 Ga0501316_042567 Ga0501316_042567_143_532 129
1205 3300049533 Ga0501317_036702 Ga0501317_036702_177_566 129
1206 3300049535 Ga0501319_001107 Ga0501319_001107_12_401 129
1207 3300049536 Ga0501320_004699 Ga0501320_004699_528_917 129
1208 3300049536 Ga0501320_013307 Ga0501320_013307_342_731 129
1209 3300049536 Ga0501320_050179 Ga0501320_050179_98_487 129
1210 3300049537 Ga0501321_000590 Ga0501321_000590_1132_1521 129
1211 3300049537 Ga0501321_008543 Ga0501321_008543_407_796 129
1212 3300049537 Ga0501321_066804 Ga0501321_066804_63_452 129
1213 3300049539 Ga0501323_015373 Ga0501323_015373_116_505 129
1214 3300049539 Ga0501323_020427 Ga0501323_020427_177_566 129
1215 3300049540 Ga0501324_014502 Ga0501324_014502_308_697 129
1216 3300049541 Ga0501325_013523 Ga0501325_013523_178_567 129
1217 3300049543 Ga0501327_01292 Ga0501327_01292_334_723 129
1218 3300049544 Ga0501328_11067 Ga0501328_11067_42_431 129
1219 3300049545 Ga0501329_13237 Ga0501329_13237_21_410 129
1220 3300049546 Ga0501330_001422 Ga0501330_001422_316_705 129
1221 3300049546 Ga0501330_006234 Ga0501330_006234_313_702 129
1222 3300049549 Ga0501333_009569 Ga0501333_009569_223_615 129
1223 3300049550 Ga0501334_01349 Ga0501334_01349_334_723 129
1224 3300049551 Ga0501335_000742 Ga0501335_000742_952_1341 129
1225 3300049551 Ga0501335_001452 Ga0501335_001452_904_1293 129
1226 3300049551 Ga0501335_008567 Ga0501335_008567_302_691 129
1227 3300049551 Ga0501335_014867 Ga0501335_014867_230_619 129
1228 3300049551 Ga0501335_020269 Ga0501335_020269_57_446 129
1229 3300049551 Ga0501335_035351 Ga0501335_035351_14_403 129
1230 3300049552 Ga0501336_009708 Ga0501336_009708_177_566 129
1231 3300049552 Ga0501336_009945 Ga0501336_009945_177_566 129
1232 3300049553 Ga0501337_001289 Ga0501337_001289_509_898 129
1233 3300049553 Ga0501337_003436 Ga0501337_003436_208_597 129
1234 3300049556 Ga0501340_001429 Ga0501340_001429_659_1048 129
1235 3300049556 Ga0501340_006416 Ga0501340_006416_193_582 129
1236 3300049570 Ga0501033_0131892 Ga0501033_0131892_1337_1726 129
1237 3300049661 Ga0501217_014128 Ga0501217_014128_486_875 129
1238 3300049669 Ga0501235_139173 Ga0501235_139173_196_585 129
1239 3300049671 Ga0501238_001674 Ga0501238_001674_1940_2329 129
1240 3300049681 Ga0501251_000697 Ga0501251_000697_2470_2859 129
1241 3300049758 Ga0501241_000002 Ga0501241_000002_87190_87579 129
1242 3300049760 Ga0501263_016694 Ga0501263_016694_10_399 129
1243 3300049766 Ga0501269_000004 Ga0501269_000004_33313_33702 129
1244 3300049766 Ga0501269_015808 Ga0501269_015808_349_738 129
1245 3300049776 Ga0501280_027081 Ga0501280_027081_140_529 129
1246 3300050493 nmdc:mga0k408_150668_c1 nmdc:mga0k408_150668_c1_467_856 129
1247 3300050493 nmdc:mga0k408_22365_c1 nmdc:mga0k408_22365_c1_2468_2857 129
1248 3300050493 nmdc:mga0k408_349_c2 nmdc:mga0k408_349_c2_544_933 129
1249 3300050493 nmdc:mga0k408_452852_c1 nmdc:mga0k408_452852_c1_304_693 129
1250 3300050496 nmdc:mga07m45_530437_c1 nmdc:mga07m45_530437_c1_177_566 129
1251 3300050511 nmdc:mga08y16_946750_c1 nmdc:mga08y16_946750_c1_133_543 129
1252 3300053090 Ga0500646_0064896 Ga0500646_0064896_611_1021 129
1253 3300053093 Ga0500651_0000078 Ga0500651_0000078_16010_16399 129
1254 3300053098 Ga0500650_0464662 Ga0500650_0464662_60_449 129
1255 3300053122 Ga0500608_000214 Ga0500608_000214_21224_21613 129
1256 3300053122 Ga0500608_087806 Ga0500608_087806_83_472 129
1257 3300053125 Ga0500618_000057 Ga0500618_000057_4333_4722 129
1258 3300053130 Ga0500642_0057580 Ga0500642_0057580_915_1304 129
1259 3300053131 Ga0500652_245013 Ga0500652_245013_60_449 129
1260 3300053136 Ga0500559_0173989 Ga0500559_0173989_359_748 129
1261 3300053137 Ga0500561_0057890 Ga0500561_0057890_612_1001 129
1262 3300053138 Ga0500564_099097 Ga0500564_099097_266_655 129
1263 3300053139 Ga0500568_0122186 Ga0500568_0122186_273_662 129
1264 3300053140 Ga0500573_0377679 Ga0500573_0377679_28_417 129
1265 3300053143 Ga0500579_261869 Ga0500579_261869_59_448 129
1266 3300053146 Ga0500588_0421235 Ga0500588_0421235_23_412 129
1267 3300053153 Ga0500616_0068519 Ga0500616_0068519_1256_1645 129
1268 3300053157 Ga0500624_000412 Ga0500624_000412_1321_1710 129
1269 3300053161 Ga0500634_0195996 Ga0500634_0195996_452_841 129
1270 3300053730 Ga0500645_045549 Ga0500645_045549_265_654 129
1271 3300059478 Ga0587093_002351 Ga0587093_002351_524_913 129
1272 3300059478 Ga0587093_005525 Ga0587093_005525_553_945 129
1273 3300059478 Ga0587093_008088 Ga0587093_008088_43_486 129
1274 3300059490 Ga0587066_001010 Ga0587066_001010_1926_2315 129
1275 3300059491 Ga0587070_012110 Ga0587070_012110_168_557 129
1276 3300059491 Ga0587070_077901 Ga0587070_077901_146_574 129
1277 3300059492 Ga0587073_0004228 Ga0587073_0004228_783_1175 129
1278 3300059492 Ga0587073_0136105 Ga0587073_0136105_99_488 129
1279 3300059493 Ga0587077_000755 Ga0587077_000755_525_953 129
1280 3300059493 Ga0587077_004049 Ga0587077_004049_341_733 129
1281 3300059503 Ga0587080_032855 Ga0587080_032855_430_822 129
1282 3300059503 Ga0587080_052037 Ga0587080_052037_309_698 129
1283 3300059505 Ga0587083_0007032 Ga0587083_0007032_553_942 129
1284 3300059505 Ga0587083_0009203 Ga0587083_0009203_755_1147 129
1285 3300059505 Ga0587083_0010186 Ga0587083_0010186_263_652 129
1286 3300059505 Ga0587083_0067751 Ga0587083_0067751_51_440 129
1287 3300059507 Ga0587086_069553 Ga0587086_069553_144_533 129
1288 3300059508 Ga0587088_002584 Ga0587088_002584_633_1022 129
1289 3300059509 Ga0587089_041766 Ga0587089_041766_261_689 129
1290 3300059509 Ga0587089_100535 Ga0587089_100535_18_428 129
1291 3300059510 Ga0587090_035231 Ga0587090_035231_128_517 129
1292 3300059511 Ga0587091_007866 Ga0587091_007866_1021_1410 129
1293 3300059511 Ga0587091_071736 Ga0587091_071736_165_554 129
1294 3300059512 Ga0587092_004572 Ga0587092_004572_836_1225 129
1295 3300059512 Ga0587092_005398 Ga0587092_005398_667_1056 129
1296 3300059512 Ga0587092_034923 Ga0587092_034923_362_790 129
1297 3300059513 Ga0587094_013211 Ga0587094_013211_646_1035 129
1298 3300059513 Ga0587094_027056 Ga0587094_027056_126_515 129
1299 3300059514 Ga0587095_006475 Ga0587095_006475_131_520 129
1300 3300059605 Ga0587106_000803 Ga0587106_000803_2024_2413 129
1301 3300059624 Ga0587109_069356 Ga0587109_069356_32_424 129
1302 3300059627 Ga0587117_033747 Ga0587117_033747_72_461 129
1303 3300059639 Ga0587062_029117 Ga0587062_029117_128_517 129
1304 3300059640 Ga0587067_011887 Ga0587067_011887_103_492 129
1305 3300059640 Ga0587067_026246 Ga0587067_026246_396_788 129
1306 3300059641 Ga0587068_030243 Ga0587068_030243_519_908 129
1307 3300059641 Ga0587068_042434 Ga0587068_042434_144_554 129
1308 3300059642 Ga0587069_010109 Ga0587069_010109_780_1169 129
1309 3300059645 Ga0587076_001180 Ga0587076_001180_1437_1826 129
1310 3300059645 Ga0587076_007250 Ga0587076_007250_31_420 129
1311 3300059645 Ga0587076_018545 Ga0587076_018545_552_944 129
1312 3300059645 Ga0587076_031564 Ga0587076_031564_459_869 129
1313 3300059645 Ga0587076_067595 Ga0587076_067595_40_468 129
1314 3300059647 Ga0587079_096182 Ga0587079_096182_272_661 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00411

Ribosomal_S11

Ribosomal protein S11

24

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9519 16 115
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9466 16 107
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9368 16 107
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9338 16 115
4v48-assembly1.cif.gz_BK real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9222 17 113
ID Description Score Start End Superfamily
af_Q23155_77_208_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8709 17 129 3.30.420.80
af_Q9VEN6_71_200_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.87 17 129 3.30.420.80
af_P9WH65_1_139_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8588 1 129 3.30.420.80
af_P9WH65_1_139_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8527 1 129 3.30.420.80
4ujzP00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8469 18 128 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9597 20 108 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9492 20 108 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-H1DBZ7-F1-model_v4 deleted 0.9301 33 110
AF-A0A6J1V4G7-F1-model_v4 28S ribosomal protein S11, mitochondrial 0.9226 17 122 GO:0003735
GO:0005763
GO:0006412
AF-A0A6P1B509-F1-model_v4 deleted 0.9206 39 113

Feature Viewer

pLDDT pTM Quality
84.03 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map