F492746
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1300 | 563 | 1205 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_1150385|Ga0436361_1150385_43601_44944 |
| Length | 447 |
| Sequence | VHEDGFFTRRRSAPPLQWNPLFPTRAGAFHLKGGLAQSKDRMNLLSSLFDGFLTWANQGLLDFSVWQIVAYTLITTHITIAAVTIFLHRAQAHRALDLGPIPSHFFRFWLWIGTGMVTKEWVAIHRKHHAKCETEEDPHSPQTRGLSKVMKEGAELYRAESRNQETLAKYSHGVPDDWVERNVYSRYSWQGVGLMLILNLALFGALGATVWAVQMVWIPFFAAGVVNGVGHFWGYRNFEAPDASTNISPWGIIIGGEELHNNHHTYPTSAKFSVKKGEFDIGWVYIRALEAIGWAKVRKTAPKLQTGDIRDADKQTLDAVISNRYEVMASYGRRLQAACAAELSRLKAEGAQQTARFKQFKLAQRWLHRDHDRIPAEVHGELAHARAASPVLDMLVVMREELRQLWTRTNVSAEQLVADLQAWCLRAEASGIAELRNFSLALRTARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 6 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 7 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 8 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 9 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 10 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 11 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 12 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 13 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 14 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 15 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 16 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 17 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 18 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 19 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 20 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 21 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 22 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 23 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 24 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 25 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 26 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 27 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 28 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 29 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 30 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 31 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 32 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 33 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 34 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 35 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 36 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 37 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 38 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 39 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 40 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 41 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 42 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 43 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 44 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 45 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 46 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 47 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 48 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 49 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 50 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 51 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 52 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 53 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 54 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 55 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 56 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 57 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 58 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 59 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 60 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 61 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 62 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 63 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 64 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 65 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 66 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 67 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 68 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 69 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 70 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 71 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 72 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 73 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 74 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 75 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 76 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 77 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 78 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 79 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 80 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 81 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 82 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 83 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 84 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 85 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 86 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 87 | 2941479691 | |||
| 88 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 89 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 90 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 91 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 92 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 93 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 94 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 95 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 96 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 97 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 98 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 99 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 100 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 101 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 102 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 103 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 104 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 105 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 106 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 107 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 108 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 109 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 110 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 111 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 112 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 113 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 114 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 115 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 116 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 117 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 118 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 119 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 120 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 121 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 122 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 123 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 124 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 125 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 126 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 127 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 128 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 129 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 130 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 131 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 132 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 133 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 134 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 135 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 136 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 137 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 143 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 145 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 146 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 147 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 148 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 156 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 162 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 163 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 166 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 168 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 170 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 172 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 173 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 174 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 176 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 177 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 178 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 179 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 180 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 181 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 182 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 183 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 184 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 185 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 186 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 187 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 188 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 189 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 190 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 191 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 192 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 193 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 194 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 195 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 196 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 198 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 199 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 200 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 201 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 203 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 204 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 215 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 216 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 227 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 231 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 232 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 233 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 235 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 236 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 237 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 239 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 240 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 241 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 250 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 251 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 252 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 255 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 256 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 257 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 259 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 261 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 267 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 322 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 325 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 331 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 332 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 333 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 334 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 335 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 336 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 337 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 338 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 339 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 340 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 341 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 342 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 343 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 344 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 345 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 346 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 347 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 348 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 349 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 350 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 351 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 352 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 353 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 354 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 355 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 356 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 357 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 358 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 359 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 360 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 361 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 362 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 363 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 364 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 365 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 367 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 368 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 373 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 374 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 375 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 376 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 377 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 378 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 379 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 380 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 382 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 383 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 384 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 385 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 386 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 387 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 388 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 389 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 390 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 391 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 392 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 393 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 394 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 395 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 396 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 397 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 398 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 399 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 400 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 401 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 402 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 403 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 404 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 405 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 406 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 407 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 408 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 409 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 410 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 411 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 412 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 413 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 414 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 415 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 416 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 417 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 418 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 419 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 420 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 421 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 422 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 423 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 424 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 425 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 426 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 427 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 428 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 429 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 469 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 471 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 472 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 473 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 475 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 476 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 477 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 478 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 479 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 480 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 481 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 482 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 483 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 484 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 485 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 486 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 487 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 488 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 489 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 490 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 509 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 510 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 513 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 516 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 517 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 518 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 519 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 520 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 521 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 522 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 525 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 526 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 527 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 528 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 529 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 530 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 531 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 533 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 534 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 535 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 536 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 537 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 538 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 539 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 541 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 542 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 543 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 544 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 545 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 546 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 547 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 548 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 549 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 550 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 551 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 552 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.85 |
| Metatranscriptomes | 2.85 |
| Isolates | 7.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27 |
| Nodule | 0.77 |
| Rhizoplane | 2.62 |
| Rhizosphere | 57.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000133 | 3300001915 | Bacteria | 20423 |
| 2 | JGI24740J21852_10000527 | 3300001979 | Bacteria | 16316 |
| 3 | JGI24740J21852_10000561 | 3300001979 | Bacteria | 15954 |
| 4 | JGI25155J39150_1000053 | 3300002704 | Bacteria | 74449 |
| 5 | JGI25156J39149_1000045 | 3300002705 | Bacteria | 104173 |
| 6 | JGI25156J39149_1003461 | 3300002705 | Bacteria | 5164 |
| 7 | JGI25156J39149_1009053 | 3300002705 | Bacteria | 2450 |
| 8 | JGI25154J39366_1000064 | 3300002738 | Bacteria | 104148 |
| 9 | JGI25154J39366_1001471 | 3300002738 | Bacteria | 8319 |
| 10 | JGI25154J39366_1003432 | 3300002738 | Bacteria | 3331 |
| 11 | JGI25154J39366_1003510 | 3300002738 | Bacteria | 3256 |
| 12 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 13 | JGI25157J39369_1000063 | 3300002741 | Bacteria | 104173 |
| 14 | JGI25150J39212_1003417 | 3300002774 | Bacteria | 3715 |
| 15 | JGI25150J39212_1005429 | 3300002774 | Bacteria | 2722 |
| 16 | JGI25159J45721_1000581 | 3300002987 | Bacteria | 16452 |
| 17 | JGI25159J45721_1002137 | 3300002987 | Bacteria | 7723 |
| 18 | Ga0006778J45830_1016434 | 3300003162 | Bacteria | 1374 |
| 19 | JGI25151J46595_10001460 | 3300003187 | Bacteria | 16029 |
| 20 | JGI25151J46595_10016821 | 3300003187 | Bacteria | 3190 |
| 21 | Ga0006770J48903_1020431 | 3300003305 | Bacteria | 1340 |
| 22 | Ga0006777J48905_1028280 | 3300003308 | Bacteria | 1474 |
| 23 | rootH1_10006215 | 3300003316 | Bacteria | 6813 |
| 24 | rootL2_10000982 | 3300003322 | Bacteria | 15080 |
| 25 | JGI25160J50197_1000517 | 3300003354 | Bacteria | 22675 |
| 26 | JGI25161J50226_1000081 | 3300003374 | Bacteria | 78703 |
| 27 | JGI25161J50226_1001581 | 3300003374 | Bacteria | 6656 |
| 28 | Ga0006562J51391_1011363 | 3300003578 | Bacteria | 6660 |
| 29 | Ga0006562J51391_1011704 | 3300003578 | Bacteria | 1384 |
| 30 | Ga0055539_1000313 | 3300003752 | Bacteria | 25199 |
| 31 | Ga0055539_1005393 | 3300003752 | Bacteria | 1664 |
| 32 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 33 | Ga0055532_1000008 | 3300003758 | Bacteria | 404753 |
| 34 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 35 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 36 | Ga0055525_1000169 | 3300003759 | Bacteria | 83336 |
| 37 | Ga0055527_1000617 | 3300003760 | Bacteria | 11304 |
| 38 | Ga0055535_1000006 | 3300003761 | Bacteria | 404753 |
| 39 | Ga0055535_1000087 | 3300003761 | Bacteria | 102655 |
| 40 | Ga0055535_1000142 | 3300003761 | Bacteria | 75104 |
| 41 | Ga0055542_1000022 | 3300003762 | Bacteria | 302315 |
| 42 | Ga0055542_1002372 | 3300003762 | Bacteria | 6378 |
| 43 | Ga0055529_1000025 | 3300003763 | Bacteria | 304757 |
| 44 | Ga0055529_1000030 | 3300003763 | Bacteria | 272455 |
| 45 | Ga0055529_1000139 | 3300003763 | Bacteria | 102943 |
| 46 | Ga0055526_1001236 | 3300003771 | Bacteria | 18319 |
| 47 | Ga0055526_1017809 | 3300003771 | Bacteria | 2690 |
| 48 | Ga0055537_1000430 | 3300003773 | Bacteria | 27230 |
| 49 | Ga0055537_1002108 | 3300003773 | Bacteria | 6986 |
| 50 | Ga0055537_1004361 | 3300003773 | Bacteria | 4060 |
| 51 | Ga0055537_1006949 | 3300003773 | Bacteria | 2796 |
| 52 | Ga0055524_1000013 | 3300003775 | Bacteria | 259850 |
| 53 | Ga0055524_1000114 | 3300003775 | Bacteria | 94476 |
| 54 | Ga0055524_1001778 | 3300003775 | Bacteria | 11841 |
| 55 | Ga0055524_1005899 | 3300003775 | Bacteria | 5397 |
| 56 | Ga0055536_1011706 | 3300003781 | Bacteria | 3330 |
| 57 | Ga0055534_1000963 | 3300003784 | Bacteria | 12782 |
| 58 | Ga0055534_1000972 | 3300003784 | Bacteria | 12709 |
| 59 | Ga0055528_1000405 | 3300003790 | Bacteria | 34965 |
| 60 | Ga0055528_1002010 | 3300003790 | Bacteria | 11406 |
| 61 | Ga0055528_1014951 | 3300003790 | Bacteria | 2832 |
| 62 | Ga0055530_10000317 | 3300003791 | Bacteria | 43667 |
| 63 | Ga0055530_10001043 | 3300003791 | Bacteria | 22076 |
| 64 | Ga0055530_10004544 | 3300003791 | Bacteria | 7088 |
| 65 | Ga0055530_10004603 | 3300003791 | Bacteria | 7027 |
| 66 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 67 | Ga0055540_1000153 | 3300003792 | Bacteria | 68176 |
| 68 | Ga0055540_1003508 | 3300003792 | Bacteria | 7551 |
| 69 | Ga0055540_1003949 | 3300003792 | Bacteria | 6924 |
| 70 | Ga0055540_1019060 | 3300003792 | Bacteria | 1860 |
| 71 | Ga0055531_10000314 | 3300003794 | Bacteria | 47668 |
| 72 | Ga0055531_10000493 | 3300003794 | Bacteria | 36200 |
| 73 | Ga0055531_10002088 | 3300003794 | Bacteria | 13726 |
| 74 | Ga0055531_10002737 | 3300003794 | Bacteria | 11585 |
| 75 | Ga0055531_10007375 | 3300003794 | Bacteria | 6022 |
| 76 | Ga0055531_10015669 | 3300003794 | Bacteria | 3321 |
| 77 | Ga0055541_1000789 | 3300003841 | Bacteria | 7895 |
| 78 | Ga0055543_1000291 | 3300004625 | Bacteria | 36133 |
| 79 | Ga0055543_1005397 | 3300004625 | Bacteria | 3271 |
| 80 | Ga0055543_1007792 | 3300004625 | Bacteria | 2439 |
| 81 | Ga0058858_1433317 | 3300004785 | Bacteria | 1439 |
| 82 | Ga0058859_10135176 | 3300004798 | Bacteria | 1348 |
| 83 | Ga0065165_1000197 | 3300005262 | Bacteria | 104294 |
| 84 | Ga0065165_1000239 | 3300005262 | Bacteria | 94061 |
| 85 | Ga0065165_1005595 | 3300005262 | Bacteria | 6968 |
| 86 | Ga0065165_1005742 | 3300005262 | Bacteria | 6822 |
| 87 | Ga0065165_1007565 | 3300005262 | Bacteria | 5300 |
| 88 | Ga0065704_10079392 | 3300005289 | Bacteria | 4177 |
| 89 | Ga0065704_10135769 | 3300005289 | Bacteria | 1573 |
| 90 | Ga0065707_10084601 | 3300005295 | Bacteria | 6997 |
| 91 | Ga0070658_10042765 | 3300005327 | Bacteria | 3660 |
| 92 | Ga0070658_10082456 | 3300005327 | Bacteria | 2642 |
| 93 | Ga0070658_10150734 | 3300005327 | Bacteria | 1947 |
| 94 | Ga0070676_10001955 | 3300005328 | Bacteria | 10482 |
| 95 | Ga0070676_10039117 | 3300005328 | Bacteria | 2741 |
| 96 | Ga0070676_10162578 | 3300005328 | Bacteria | 1438 |
| 97 | Ga0070683_100081114 | 3300005329 | Bacteria | 3037 |
| 98 | Ga0070683_100093253 | 3300005329 | Bacteria | 2829 |
| 99 | Ga0070670_100000939 | 3300005331 | Bacteria | 22858 |
| 100 | Ga0070670_100023500 | 3300005331 | Bacteria | 5306 |
| 101 | Ga0070670_100043384 | 3300005331 | Bacteria | 3865 |
| 102 | Ga0070670_100184444 | 3300005331 | Bacteria | 1812 |
| 103 | Ga0070677_10002616 | 3300005333 | Bacteria | 5764 |
| 104 | Ga0070677_10005224 | 3300005333 | Bacteria | 4272 |
| 105 | Ga0070677_10035481 | 3300005333 | Bacteria | 1934 |
| 106 | Ga0068869_100002798 | 3300005334 | Bacteria | 10571 |
| 107 | Ga0070666_10111468 | 3300005335 | Bacteria | 1892 |
| 108 | Ga0070666_10218578 | 3300005335 | Bacteria | 1343 |
| 109 | Ga0070680_100012342 | 3300005336 | Bacteria | 6635 |
| 110 | Ga0070682_100167209 | 3300005337 | Bacteria | 1525 |
| 111 | Ga0068868_100004119 | 3300005338 | Bacteria | 10161 |
| 112 | Ga0068868_100045277 | 3300005338 | Bacteria | 3442 |
| 113 | Ga0068868_100050588 | 3300005338 | Bacteria | 3264 |
| 114 | Ga0068868_100076693 | 3300005338 | Bacteria | 2673 |
| 115 | Ga0070689_100008358 | 3300005340 | Bacteria | 7290 |
| 116 | Ga0070661_100000002 | 3300005344 | Bacteria | 265686 |
| 117 | Ga0070661_100012486 | 3300005344 | Bacteria | 5941 |
| 118 | Ga0070668_100140829 | 3300005347 | Bacteria | 1943 |
| 119 | Ga0070669_100066138 | 3300005353 | Bacteria | 2664 |
| 120 | Ga0070675_100003660 | 3300005354 | Bacteria | 11691 |
| 121 | Ga0070675_100003790 | 3300005354 | Bacteria | 11481 |
| 122 | Ga0070675_100026036 | 3300005354 | Bacteria | 4691 |
| 123 | Ga0070675_100031337 | 3300005354 | Bacteria | 4298 |
| 124 | Ga0070675_100124465 | 3300005354 | Bacteria | 2193 |
| 125 | Ga0070675_100271986 | 3300005354 | Bacteria | 1487 |
| 126 | Ga0070671_100002857 | 3300005355 | Bacteria | 13429 |
| 127 | Ga0070671_100017900 | 3300005355 | Bacteria | 5746 |
| 128 | Ga0070671_100035058 | 3300005355 | Bacteria | 4156 |
| 129 | Ga0070671_100042594 | 3300005355 | Bacteria | 3774 |
| 130 | Ga0070671_100043352 | 3300005355 | Bacteria | 3738 |
| 131 | Ga0070671_100064946 | 3300005355 | Bacteria | 3040 |
| 132 | Ga0070671_100106280 | 3300005355 | Bacteria | 2356 |
| 133 | Ga0070671_100118012 | 3300005355 | Bacteria | 2231 |
| 134 | Ga0070671_100146539 | 3300005355 | Bacteria | 1993 |
| 135 | Ga0070674_100004270 | 3300005356 | Bacteria | 8131 |
| 136 | Ga0070674_100156771 | 3300005356 | Bacteria | 1723 |
| 137 | Ga0070673_100002423 | 3300005364 | Bacteria | 11361 |
| 138 | Ga0070673_100021355 | 3300005364 | Bacteria | 4692 |
| 139 | Ga0070673_100044183 | 3300005364 | Bacteria | 3449 |
| 140 | Ga0070673_100103569 | 3300005364 | Bacteria | 2349 |
| 141 | Ga0070688_100006265 | 3300005365 | Bacteria | 6344 |
| 142 | Ga0070659_100003171 | 3300005366 | Bacteria | 11710 |
| 143 | Ga0070667_100001132 | 3300005367 | Bacteria | 24302 |
| 144 | Ga0070667_100002718 | 3300005367 | Bacteria | 15313 |
| 145 | Ga0070667_100081311 | 3300005367 | Bacteria | 2772 |
| 146 | Ga0070667_100081411 | 3300005367 | Bacteria | 2771 |
| 147 | Ga0070667_100122000 | 3300005367 | Bacteria | 2267 |
| 148 | Ga0070663_100000007 | 3300005455 | Bacteria | 202632 |
| 149 | Ga0070663_100021379 | 3300005455 | Bacteria | 4303 |
| 150 | Ga0070663_100022223 | 3300005455 | Bacteria | 4237 |
| 151 | Ga0070663_100209582 | 3300005455 | Bacteria | 1525 |
| 152 | Ga0070678_100014813 | 3300005456 | Bacteria | 4932 |
| 153 | Ga0070678_100017957 | 3300005456 | Bacteria | 4572 |
| 154 | Ga0070678_100037399 | 3300005456 | Bacteria | 3408 |
| 155 | Ga0070678_100231595 | 3300005456 | Bacteria | 1540 |
| 156 | Ga0070662_100004327 | 3300005457 | Bacteria | 8967 |
| 157 | Ga0070662_100009659 | 3300005457 | Bacteria | 6311 |
| 158 | Ga0070662_100015254 | 3300005457 | Bacteria | 5143 |
| 159 | Ga0070662_100016597 | 3300005457 | Bacteria | 4947 |
| 160 | Ga0070681_10019572 | 3300005458 | Bacteria | 6777 |
| 161 | Ga0070681_10182314 | 3300005458 | Bacteria | 2021 |
| 162 | Ga0068867_100000086 | 3300005459 | Bacteria | 58298 |
| 163 | Ga0068867_100003769 | 3300005459 | Bacteria | 10673 |
| 164 | Ga0068867_100003928 | 3300005459 | Bacteria | 10466 |
| 165 | Ga0068867_100005351 | 3300005459 | Bacteria | 9070 |
| 166 | Ga0070707_100175277 | 3300005468 | Bacteria | 2090 |
| 167 | Ga0070698_100084064 | 3300005471 | Bacteria | 3172 |
| 168 | Ga0070679_100023124 | 3300005530 | Bacteria | 6081 |
| 169 | Ga0070679_100179178 | 3300005530 | Bacteria | 2092 |
| 170 | Ga0070672_100001075 | 3300005543 | Bacteria | 16635 |
| 171 | Ga0070672_100079457 | 3300005543 | Bacteria | 2626 |
| 172 | Ga0070672_100135687 | 3300005543 | Bacteria | 2026 |
| 173 | Ga0070672_100183285 | 3300005543 | Bacteria | 1745 |
| 174 | Ga0070686_100182932 | 3300005544 | Bacteria | 1490 |
| 175 | Ga0070665_100099545 | 3300005548 | Bacteria | 2911 |
| 176 | Ga0070665_100108615 | 3300005548 | Bacteria | 2777 |
| 177 | Ga0070665_100112005 | 3300005548 | Bacteria | 2731 |
| 178 | Ga0068855_100041043 | 3300005563 | Bacteria | 5487 |
| 179 | Ga0068855_100221152 | 3300005563 | Bacteria | 2123 |
| 180 | Ga0070664_100000001 | 3300005564 | Bacteria | 551832 |
| 181 | Ga0070664_100004542 | 3300005564 | Bacteria | 11136 |
| 182 | Ga0070664_100096677 | 3300005564 | Bacteria | 2563 |
| 183 | Ga0068857_100007953 | 3300005577 | Bacteria | 9152 |
| 184 | Ga0068857_100029445 | 3300005577 | Bacteria | 4845 |
| 185 | Ga0068857_100127847 | 3300005577 | Bacteria | 2290 |
| 186 | Ga0068857_100164713 | 3300005577 | Bacteria | 2013 |
| 187 | Ga0068854_100000009 | 3300005578 | Bacteria | 181432 |
| 188 | Ga0068854_100067299 | 3300005578 | Bacteria | 2609 |
| 189 | Ga0068854_100203468 | 3300005578 | Bacteria | 1558 |
| 190 | Ga0068856_100000007 | 3300005614 | Bacteria | 213669 |
| 191 | Ga0068856_100008259 | 3300005614 | Bacteria | 10149 |
| 192 | Ga0070702_100123102 | 3300005615 | Bacteria | 1626 |
| 193 | Ga0068852_100080615 | 3300005616 | Bacteria | 2886 |
| 194 | Ga0068852_100126184 | 3300005616 | Bacteria | 2350 |
| 195 | Ga0068852_100148792 | 3300005616 | Bacteria | 2175 |
| 196 | Ga0068859_100060955 | 3300005617 | Bacteria | 3801 |
| 197 | Ga0068859_100092966 | 3300005617 | Bacteria | 3068 |
| 198 | Ga0068864_100001313 | 3300005618 | Bacteria | 20690 |
| 199 | Ga0068864_100013771 | 3300005618 | Bacteria | 6706 |
| 200 | Ga0068864_100203793 | 3300005618 | Bacteria | 1818 |
| 201 | Ga0068864_100220720 | 3300005618 | Bacteria | 1749 |
| 202 | Ga0068866_10041851 | 3300005718 | Bacteria | 2276 |
| 203 | Ga0068861_100004782 | 3300005719 | Bacteria | 9099 |
| 204 | Ga0068861_100016063 | 3300005719 | Bacteria | 5287 |
| 205 | Ga0068861_100034130 | 3300005719 | Bacteria | 3760 |
| 206 | Ga0068861_100046860 | 3300005719 | Bacteria | 3261 |
| 207 | Ga0068861_100069495 | 3300005719 | Bacteria | 2725 |
| 208 | Ga0068851_10104349 | 3300005834 | Bacteria | 1507 |
| 209 | Ga0068851_10110720 | 3300005834 | Bacteria | 1465 |
| 210 | Ga0068870_10102541 | 3300005840 | Bacteria | 1620 |
| 211 | Ga0068863_100019781 | 3300005841 | Bacteria | 6439 |
| 212 | Ga0068858_100017353 | 3300005842 | Bacteria | 6752 |
| 213 | Ga0068858_100031050 | 3300005842 | Bacteria | 4961 |
| 214 | Ga0068858_100050526 | 3300005842 | Bacteria | 3848 |
| 215 | Ga0068860_100000685 | 3300005843 | Bacteria | 39158 |
| 216 | Ga0068860_100014044 | 3300005843 | Bacteria | 7856 |
| 217 | Ga0068860_100022963 | 3300005843 | Bacteria | 6032 |
| 218 | Ga0068860_100063757 | 3300005843 | Bacteria | 3500 |
| 219 | Ga0068860_100099993 | 3300005843 | Bacteria | 2766 |
| 220 | Ga0068862_100011753 | 3300005844 | Bacteria | 7225 |
| 221 | Ga0068862_100022287 | 3300005844 | Bacteria | 5297 |
| 222 | Ga0075365_10000227 | 3300006038 | Bacteria | 19112 |
| 223 | Ga0075365_10002710 | 3300006038 | Bacteria | 8823 |
| 224 | Ga0075365_10003284 | 3300006038 | Bacteria | 8295 |
| 225 | Ga0075368_10014400 | 3300006042 | Bacteria | 2921 |
| 226 | Ga0075368_10019630 | 3300006042 | Bacteria | 2552 |
| 227 | Ga0075368_10024443 | 3300006042 | Bacteria | 2315 |
| 228 | Ga0075368_10053543 | 3300006042 | Bacteria | 1607 |
| 229 | Ga0075363_100004105 | 3300006048 | Bacteria | 6315 |
| 230 | Ga0075363_100010719 | 3300006048 | Bacteria | 4366 |
| 231 | Ga0075363_100035250 | 3300006048 | Bacteria | 2617 |
| 232 | Ga0075363_100037680 | 3300006048 | Bacteria | 2540 |
| 233 | Ga0075363_100067436 | 3300006048 | Bacteria | 1939 |
| 234 | Ga0075364_10001197 | 3300006051 | Bacteria | 13931 |
| 235 | Ga0075364_10003065 | 3300006051 | Bacteria | 9441 |
| 236 | Ga0075364_10007708 | 3300006051 | Bacteria | 6406 |
| 237 | Ga0075364_10014953 | 3300006051 | Bacteria | 4803 |
| 238 | Ga0075364_10015326 | 3300006051 | Bacteria | 4752 |
| 239 | Ga0075364_10018465 | 3300006051 | Bacteria | 4365 |
| 240 | Ga0075364_10018914 | 3300006051 | Bacteria | 4320 |
| 241 | Ga0075364_10026882 | 3300006051 | Bacteria | 3674 |
| 242 | Ga0075364_10045003 | 3300006051 | Bacteria | 2872 |
| 243 | Ga0075432_10034745 | 3300006058 | Bacteria | 1751 |
| 244 | Ga0075362_10017189 | 3300006177 | Bacteria | 2976 |
| 245 | Ga0075362_10027844 | 3300006177 | Bacteria | 2422 |
| 246 | Ga0075362_10083585 | 3300006177 | Bacteria | 1474 |
| 247 | Ga0075367_10001265 | 3300006178 | Bacteria | 10666 |
| 248 | Ga0075367_10004232 | 3300006178 | Bacteria | 6970 |
| 249 | Ga0075367_10037548 | 3300006178 | Bacteria | 2816 |
| 250 | Ga0075367_10037556 | 3300006178 | Bacteria | 2815 |
| 251 | Ga0075367_10059536 | 3300006178 | Bacteria | 2274 |
| 252 | Ga0075369_10000060 | 3300006186 | Bacteria | 28160 |
| 253 | Ga0075369_10025008 | 3300006186 | Bacteria | 2479 |
| 254 | Ga0075427_10000023 | 3300006194 | Bacteria | 10265 |
| 255 | Ga0075366_10001613 | 3300006195 | Bacteria | 11295 |
| 256 | Ga0075366_10016779 | 3300006195 | Bacteria | 4209 |
| 257 | Ga0075366_10017339 | 3300006195 | Bacteria | 4144 |
| 258 | Ga0075366_10022200 | 3300006195 | Bacteria | 3691 |
| 259 | Ga0075366_10022341 | 3300006195 | Bacteria | 3679 |
| 260 | Ga0075366_10022612 | 3300006195 | Bacteria | 3660 |
| 261 | Ga0075366_10023366 | 3300006195 | Bacteria | 3601 |
| 262 | Ga0075366_10023387 | 3300006195 | Bacteria | 3599 |
| 263 | Ga0075366_10033534 | 3300006195 | Bacteria | 3025 |
| 264 | Ga0075366_10039026 | 3300006195 | Bacteria | 2805 |
| 265 | Ga0075366_10053078 | 3300006195 | Bacteria | 2408 |
| 266 | Ga0075366_10058191 | 3300006195 | Bacteria | 2296 |
| 267 | Ga0075366_10079412 | 3300006195 | Bacteria | 1959 |
| 268 | Ga0075366_10089780 | 3300006195 | Bacteria | 1840 |
| 269 | Ga0075366_10093416 | 3300006195 | Bacteria | 1803 |
| 270 | Ga0075366_10101873 | 3300006195 | Bacteria | 1723 |
| 271 | Ga0075366_10120475 | 3300006195 | Bacteria | 1581 |
| 272 | Ga0097621_100073888 | 3300006237 | Bacteria | 2823 |
| 273 | Ga0097621_100091912 | 3300006237 | Bacteria | 2541 |
| 274 | Ga0097621_100179383 | 3300006237 | Bacteria | 1829 |
| 275 | Ga0075370_10000066 | 3300006353 | Bacteria | 31728 |
| 276 | Ga0075370_10000742 | 3300006353 | Bacteria | 13009 |
| 277 | Ga0075370_10002946 | 3300006353 | Bacteria | 7999 |
| 278 | Ga0075370_10005250 | 3300006353 | Bacteria | 6413 |
| 279 | Ga0075370_10006000 | 3300006353 | Bacteria | 6085 |
| 280 | Ga0075370_10010506 | 3300006353 | Bacteria | 4841 |
| 281 | Ga0075370_10011147 | 3300006353 | Bacteria | 4716 |
| 282 | Ga0075370_10014707 | 3300006353 | Bacteria | 4179 |
| 283 | Ga0075370_10028371 | 3300006353 | Bacteria | 3111 |
| 284 | Ga0075370_10029346 | 3300006353 | Bacteria | 3064 |
| 285 | Ga0075370_10032406 | 3300006353 | Bacteria | 2922 |
| 286 | Ga0075370_10036327 | 3300006353 | Bacteria | 2767 |
| 287 | Ga0075370_10042707 | 3300006353 | Bacteria | 2561 |
| 288 | Ga0075370_10067354 | 3300006353 | Bacteria | 2044 |
| 289 | Ga0075370_10067965 | 3300006353 | Bacteria | 2034 |
| 290 | Ga0075370_10088870 | 3300006353 | Bacteria | 1781 |
| 291 | Ga0075370_10114709 | 3300006353 | Bacteria | 1566 |
| 292 | Ga0068871_100022463 | 3300006358 | Bacteria | 4864 |
| 293 | Ga0068871_100078882 | 3300006358 | Bacteria | 2723 |
| 294 | Ga0068871_100090123 | 3300006358 | Bacteria | 2553 |
| 295 | Ga0068871_100138221 | 3300006358 | Bacteria | 2070 |
| 296 | Ga0068871_100180783 | 3300006358 | Bacteria | 1812 |
| 297 | Ga0075430_100083106 | 3300006846 | Bacteria | 2683 |
| 298 | Ga0068865_100017504 | 3300006881 | Bacteria | 4610 |
| 299 | Ga0068865_100020853 | 3300006881 | Bacteria | 4256 |
| 300 | Ga0097620_100060960 | 3300006931 | Bacteria | 3801 |
| 301 | Ga0097620_100092964 | 3300006931 | Bacteria | 3068 |
| 302 | Ga0079104_1000309 | 3300006946 | Bacteria | 61858 |
| 303 | Ga0099826_10005550 | 3300006948 | Bacteria | 9061 |
| 304 | Ga0105240_10005483 | 3300009093 | Bacteria | 18913 |
| 305 | Ga0105240_10034284 | 3300009093 | Bacteria | 6549 |
| 306 | Ga0105240_10203342 | 3300009093 | Bacteria | 2320 |
| 307 | Ga0105245_10026446 | 3300009098 | Bacteria | 5107 |
| 308 | Ga0114129_10162038 | 3300009147 | Bacteria | 3054 |
| 309 | Ga0105243_10009596 | 3300009148 | Bacteria | 7369 |
| 310 | Ga0105243_10010351 | 3300009148 | Bacteria | 7083 |
| 311 | Ga0105243_10020161 | 3300009148 | Bacteria | 5054 |
| 312 | Ga0105243_10067283 | 3300009148 | Bacteria | 2883 |
| 313 | Ga0105243_10100833 | 3300009148 | Bacteria | 2396 |
| 314 | Ga0105243_10119114 | 3300009148 | Bacteria | 2223 |
| 315 | Ga0105242_10000485 | 3300009176 | Bacteria | 31627 |
| 316 | Ga0105248_10022249 | 3300009177 | Bacteria | 7028 |
| 317 | Ga0105248_10031969 | 3300009177 | Bacteria | 5880 |
| 318 | Ga0105248_10072326 | 3300009177 | Bacteria | 3875 |
| 319 | Ga0105248_10408599 | 3300009177 | Bacteria | 1529 |
| 320 | Ga0105237_10168614 | 3300009545 | Bacteria | 2189 |
| 321 | Ga0105237_10174704 | 3300009545 | Bacteria | 2148 |
| 322 | Ga0105237_10179425 | 3300009545 | Bacteria | 2118 |
| 323 | Ga0105237_10295006 | 3300009545 | Bacteria | 1624 |
| 324 | Ga0105238_10017534 | 3300009551 | Bacteria | 7280 |
| 325 | Ga0105238_10026760 | 3300009551 | Bacteria | 5879 |
| 326 | Ga0105238_10044057 | 3300009551 | Bacteria | 4513 |
| 327 | Ga0105238_10055566 | 3300009551 | Bacteria | 3974 |
| 328 | Ga0105238_10128869 | 3300009551 | Bacteria | 2509 |
| 329 | Ga0105238_10139751 | 3300009551 | Bacteria | 2399 |
| 330 | Ga0105249_10007528 | 3300009553 | Bacteria | 9500 |
| 331 | Ga0105249_10177425 | 3300009553 | Bacteria | 2070 |
| 332 | Ga0105239_10027775 | 3300010375 | Bacteria | 6227 |
| 333 | Ga0105239_10052753 | 3300010375 | Bacteria | 4460 |
| 334 | Ga0105239_10182747 | 3300010375 | Bacteria | 2346 |
| 335 | Ga0105239_10528229 | 3300010375 | Bacteria | 1343 |
| 336 | Ga0157319_1000043 | 3300012497 | Bacteria | 22525 |
| 337 | Ga0157347_1000854 | 3300012502 | Bacteria | 2185 |
| 338 | Ga0157373_10035384 | 3300013100 | Bacteria | 3586 |
| 339 | Ga0157373_10067144 | 3300013100 | Bacteria | 2536 |
| 340 | Ga0157373_10085739 | 3300013100 | Bacteria | 2220 |
| 341 | Ga0157373_10123000 | 3300013100 | Bacteria | 1824 |
| 342 | Ga0157371_10001209 | 3300013102 | Bacteria | 27527 |
| 343 | Ga0157371_10047817 | 3300013102 | Bacteria | 3041 |
| 344 | Ga0157371_10124955 | 3300013102 | Bacteria | 1829 |
| 345 | Ga0157370_10001652 | 3300013104 | Bacteria | 27514 |
| 346 | Ga0157370_10007697 | 3300013104 | Bacteria | 11689 |
| 347 | Ga0157370_10014694 | 3300013104 | Bacteria | 7997 |
| 348 | Ga0157370_10185047 | 3300013104 | Bacteria | 1934 |
| 349 | Ga0157369_10011577 | 3300013105 | Bacteria | 10013 |
| 350 | Ga0157369_10077210 | 3300013105 | Bacteria | 3569 |
| 351 | Ga0157374_10058382 | 3300013296 | Bacteria | 3605 |
| 352 | Ga0157374_10093522 | 3300013296 | Bacteria | 2871 |
| 353 | Ga0157374_10108482 | 3300013296 | Bacteria | 2668 |
| 354 | Ga0157374_10118782 | 3300013296 | Bacteria | 2550 |
| 355 | Ga0157378_10006194 | 3300013297 | Bacteria | 10468 |
| 356 | Ga0157378_10081014 | 3300013297 | Bacteria | 2933 |
| 357 | Ga0157378_10139820 | 3300013297 | Bacteria | 2248 |
| 358 | Ga0163162_10029946 | 3300013306 | Bacteria | 5390 |
| 359 | Ga0163162_10040965 | 3300013306 | Bacteria | 4633 |
| 360 | Ga0157372_10005299 | 3300013307 | Bacteria | 13694 |
| 361 | Ga0157372_10132393 | 3300013307 | Bacteria | 2870 |
| 362 | Ga0157372_10209179 | 3300013307 | Bacteria | 2261 |
| 363 | Ga0157372_10403426 | 3300013307 | Bacteria | 1593 |
| 364 | Ga0157375_10008692 | 3300013308 | Bacteria | 8901 |
| 365 | Ga0157375_10014347 | 3300013308 | Bacteria | 7064 |
| 366 | Ga0157375_10032391 | 3300013308 | Bacteria | 4958 |
| 367 | Ga0157375_10084511 | 3300013308 | Bacteria | 3223 |
| 368 | Ga0157375_10296945 | 3300013308 | Bacteria | 1779 |
| 369 | Ga0157380_10012147 | 3300014326 | Bacteria | 6236 |
| 370 | Ga0157380_10028626 | 3300014326 | Bacteria | 4250 |
| 371 | Ga0182008_10000215 | 3300014497 | Bacteria | 45361 |
| 372 | Ga0182008_10010204 | 3300014497 | Bacteria | 5033 |
| 373 | Ga0182008_10043605 | 3300014497 | Bacteria | 2233 |
| 374 | Ga0182008_10073062 | 3300014497 | Bacteria | 1688 |
| 375 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 376 | Ga0157377_10006032 | 3300014745 | Bacteria | 5747 |
| 377 | Ga0157379_10007916 | 3300014968 | Bacteria | 9212 |
| 378 | Ga0157379_10010131 | 3300014968 | Bacteria | 8217 |
| 379 | Ga0157376_10004863 | 3300014969 | Bacteria | 9364 |
| 380 | Ga0157376_10014331 | 3300014969 | Bacteria | 5947 |
| 381 | Ga0157376_10018648 | 3300014969 | Bacteria | 5326 |
| 382 | Ga0157376_10122695 | 3300014969 | Bacteria | 2306 |
| 383 | Ga0182006_1008804 | 3300015261 | Bacteria | 4563 |
| 384 | Ga0182006_1026968 | 3300015261 | Bacteria | 2348 |
| 385 | Ga0182007_10003586 | 3300015262 | Bacteria | 7293 |
| 386 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 387 | Ga0163161_10000849 | 3300017792 | Bacteria | 23834 |
| 388 | Ga0163161_10034546 | 3300017792 | Bacteria | 3617 |
| 389 | Ga0163161_10066787 | 3300017792 | Bacteria | 2626 |
| 390 | Ga0163161_10094501 | 3300017792 | Bacteria | 2216 |
| 391 | Ga0197907_11214976 | 3300020069 | Bacteria | 2690 |
| 392 | Ga0206355_1356493 | 3300020076 | Bacteria | 3466 |
| 393 | Ga0206351_10095075 | 3300020077 | Bacteria | 12925 |
| 394 | Ga0206351_10216415 | 3300020077 | Bacteria | 1622 |
| 395 | Ga0154015_1017848 | 3300020610 | Bacteria | 29859 |
| 396 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 397 | Ga0213872_10000042 | 3300021361 | Bacteria | 118474 |
| 398 | Ga0213872_10000129 | 3300021361 | Bacteria | 69032 |
| 399 | Ga0213872_10000351 | 3300021361 | Bacteria | 38881 |
| 400 | Ga0213872_10000411 | 3300021361 | Bacteria | 35059 |
| 401 | Ga0213872_10009020 | 3300021361 | Bacteria | 4794 |
| 402 | Ga0213872_10010720 | 3300021361 | Bacteria | 4354 |
| 403 | Ga0213872_10012213 | 3300021361 | Bacteria | 4048 |
| 404 | Ga0213872_10026271 | 3300021361 | Bacteria | 2675 |
| 405 | Ga0224712_10034991 | 3300022467 | Bacteria | 1851 |
| 406 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 407 | Ga0209784_100014 | 3300025224 | Bacteria | 496182 |
| 408 | Ga0209784_100365 | 3300025224 | Bacteria | 21497 |
| 409 | Ga0209566_100011 | 3300025225 | Bacteria | 496182 |
| 410 | Ga0209566_100955 | 3300025225 | Bacteria | 13033 |
| 411 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 412 | Ga0209674_100032 | 3300025226 | Bacteria | 426888 |
| 413 | Ga0209674_100184 | 3300025226 | Bacteria | 68529 |
| 414 | Ga0209672_100094 | 3300025228 | Bacteria | 113800 |
| 415 | Ga0209672_100517 | 3300025228 | Bacteria | 21267 |
| 416 | Ga0209672_100689 | 3300025228 | Bacteria | 16922 |
| 417 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 418 | Ga0209147_100794 | 3300025229 | Bacteria | 15311 |
| 419 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 420 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 421 | Ga0209563_100029 | 3300025230 | Bacteria | 496182 |
| 422 | Ga0209563_102706 | 3300025230 | Bacteria | 3897 |
| 423 | Ga0207427_100361 | 3300025231 | Bacteria | 28311 |
| 424 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 425 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 426 | Ga0209258_100044 | 3300025242 | Bacteria | 376336 |
| 427 | Ga0209258_100525 | 3300025242 | Bacteria | 36665 |
| 428 | Ga0207425_1000980 | 3300025245 | Bacteria | 13435 |
| 429 | Ga0207425_1002133 | 3300025245 | Bacteria | 7264 |
| 430 | Ga0207425_1003726 | 3300025245 | Bacteria | 4779 |
| 431 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 432 | Ga0209646_1000035 | 3300025246 | Bacteria | 363209 |
| 433 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 434 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 435 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 436 | Ga0209026_1007281 | 3300025250 | Bacteria | 2524 |
| 437 | Ga0209677_100065 | 3300025253 | Bacteria | 151037 |
| 438 | Ga0209677_100068 | 3300025253 | Bacteria | 146135 |
| 439 | Ga0209677_100760 | 3300025253 | Bacteria | 16357 |
| 440 | Ga0209677_102322 | 3300025253 | Bacteria | 7314 |
| 441 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 442 | Ga0209148_1000293 | 3300025254 | Bacteria | 74776 |
| 443 | Ga0209759_1000019 | 3300025256 | Bacteria | 357908 |
| 444 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 445 | Ga0209759_1000970 | 3300025256 | Bacteria | 19907 |
| 446 | Ga0209759_1007504 | 3300025256 | Bacteria | 3500 |
| 447 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 448 | Ga0209129_1000043 | 3300025258 | Bacteria | 298978 |
| 449 | Ga0209129_1015583 | 3300025258 | Bacteria | 1560 |
| 450 | Ga0209565_1000043 | 3300025263 | Bacteria | 235332 |
| 451 | Ga0209565_1000046 | 3300025263 | Bacteria | 226073 |
| 452 | Ga0209565_1001386 | 3300025263 | Bacteria | 10846 |
| 453 | Ga0209565_1007343 | 3300025263 | Bacteria | 2982 |
| 454 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 455 | Ga0209455_1000048 | 3300025272 | Bacteria | 376260 |
| 456 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 457 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 458 | Ga0209673_1000615 | 3300025273 | Bacteria | 54497 |
| 459 | Ga0209673_1002626 | 3300025273 | Bacteria | 12066 |
| 460 | Ga0209673_1004714 | 3300025273 | Bacteria | 7183 |
| 461 | Ga0209673_1040023 | 3300025273 | Bacteria | 1345 |
| 462 | Ga0209130_1000110 | 3300025284 | Bacteria | 133258 |
| 463 | Ga0209130_1000569 | 3300025284 | Bacteria | 36292 |
| 464 | Ga0209130_1001087 | 3300025284 | Bacteria | 20298 |
| 465 | Ga0209130_1001597 | 3300025284 | Bacteria | 14166 |
| 466 | Ga0209130_1002030 | 3300025284 | Bacteria | 11020 |
| 467 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 468 | Ga0209675_1000170 | 3300025291 | Bacteria | 78095 |
| 469 | Ga0209675_1003361 | 3300025291 | Bacteria | 7649 |
| 470 | Ga0209675_1005411 | 3300025291 | Bacteria | 5352 |
| 471 | Ga0209675_1007213 | 3300025291 | Bacteria | 4304 |
| 472 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 473 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 474 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 475 | Ga0209676_1000194 | 3300025292 | Bacteria | 136666 |
| 476 | Ga0209676_1001380 | 3300025292 | Bacteria | 23674 |
| 477 | Ga0209676_1001840 | 3300025292 | Bacteria | 17529 |
| 478 | Ga0209676_1005823 | 3300025292 | Bacteria | 6303 |
| 479 | Ga0209025_1000057 | 3300025294 | Bacteria | 314601 |
| 480 | Ga0209025_1000272 | 3300025294 | Bacteria | 120328 |
| 481 | Ga0209025_1000289 | 3300025294 | Bacteria | 113555 |
| 482 | Ga0209025_1006727 | 3300025294 | Bacteria | 8820 |
| 483 | Ga0209025_1007832 | 3300025294 | Bacteria | 7848 |
| 484 | Ga0209025_1009058 | 3300025294 | Bacteria | 7019 |
| 485 | Ga0209025_1023858 | 3300025294 | Bacteria | 3180 |
| 486 | Ga0209025_1042040 | 3300025294 | Bacteria | 1948 |
| 487 | Ga0209025_1042382 | 3300025294 | Bacteria | 1934 |
| 488 | Ga0209025_1046041 | 3300025294 | Bacteria | 1800 |
| 489 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 490 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 491 | Ga0209564_1000183 | 3300025295 | Bacteria | 150409 |
| 492 | Ga0209564_1000198 | 3300025295 | Bacteria | 138511 |
| 493 | Ga0209564_1001847 | 3300025295 | Bacteria | 19277 |
| 494 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 495 | Ga0209758_1000093 | 3300025297 | Bacteria | 241169 |
| 496 | Ga0209758_1000204 | 3300025297 | Bacteria | 131754 |
| 497 | Ga0209758_1017887 | 3300025297 | Bacteria | 3503 |
| 498 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 499 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 500 | Ga0209050_1000122 | 3300025298 | Bacteria | 195305 |
| 501 | Ga0209050_1000145 | 3300025298 | Bacteria | 168151 |
| 502 | Ga0209050_1000895 | 3300025298 | Bacteria | 39508 |
| 503 | Ga0209050_1001124 | 3300025298 | Bacteria | 32325 |
| 504 | Ga0209050_1004630 | 3300025298 | Bacteria | 9176 |
| 505 | Ga0209050_1011786 | 3300025298 | Bacteria | 4098 |
| 506 | Ga0209050_1016557 | 3300025298 | Bacteria | 3006 |
| 507 | Ga0209050_1025076 | 3300025298 | Bacteria | 2039 |
| 508 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 509 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 510 | Ga0209256_1000098 | 3300025299 | Bacteria | 204152 |
| 511 | Ga0209256_1000140 | 3300025299 | Bacteria | 152770 |
| 512 | Ga0209256_1001268 | 3300025299 | Bacteria | 27564 |
| 513 | Ga0209256_1007013 | 3300025299 | Bacteria | 5721 |
| 514 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 515 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 516 | Ga0207426_1000117 | 3300025302 | Bacteria | 224652 |
| 517 | Ga0207426_1001160 | 3300025302 | Bacteria | 23658 |
| 518 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 519 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 520 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 521 | Ga0209051_1000168 | 3300025303 | Bacteria | 119312 |
| 522 | Ga0209051_1000173 | 3300025303 | Bacteria | 117170 |
| 523 | Ga0209051_1000179 | 3300025303 | Bacteria | 114055 |
| 524 | Ga0209051_1000488 | 3300025303 | Bacteria | 51079 |
| 525 | Ga0209051_1000814 | 3300025303 | Bacteria | 32349 |
| 526 | Ga0209051_1001925 | 3300025303 | Bacteria | 16051 |
| 527 | Ga0209051_1004966 | 3300025303 | Bacteria | 7950 |
| 528 | Ga0209051_1024867 | 3300025303 | Bacteria | 2452 |
| 529 | Ga0209051_1037497 | 3300025303 | Bacteria | 1776 |
| 530 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 531 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 532 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 533 | Ga0209257_1000084 | 3300025304 | Bacteria | 291502 |
| 534 | Ga0209257_1000096 | 3300025304 | Bacteria | 259390 |
| 535 | Ga0209257_1000412 | 3300025304 | Bacteria | 82996 |
| 536 | Ga0209257_1003994 | 3300025304 | Bacteria | 11908 |
| 537 | Ga0209257_1004271 | 3300025304 | Bacteria | 11259 |
| 538 | Ga0207697_10013305 | 3300025315 | Bacteria | 3434 |
| 539 | Ga0207697_10061246 | 3300025315 | Bacteria | 1565 |
| 540 | Ga0207655_1003001 | 3300025728 | Bacteria | 12929 |
| 541 | Ga0207682_10003157 | 3300025893 | Bacteria | 7219 |
| 542 | Ga0207682_10006644 | 3300025893 | Bacteria | 4648 |
| 543 | Ga0207682_10039210 | 3300025893 | Bacteria | 1925 |
| 544 | Ga0207642_10011507 | 3300025899 | Bacteria | 3160 |
| 545 | Ga0207642_10060567 | 3300025899 | Bacteria | 1756 |
| 546 | Ga0207688_10024697 | 3300025901 | Bacteria | 3297 |
| 547 | Ga0207688_10041033 | 3300025901 | Bacteria | 2573 |
| 548 | Ga0207688_10076797 | 3300025901 | Bacteria | 1903 |
| 549 | Ga0207680_10004287 | 3300025903 | Bacteria | 6759 |
| 550 | Ga0207680_10126225 | 3300025903 | Bacteria | 1680 |
| 551 | Ga0207680_10128342 | 3300025903 | Bacteria | 1668 |
| 552 | Ga0207645_10042100 | 3300025907 | Bacteria | 2923 |
| 553 | Ga0207645_10068933 | 3300025907 | Bacteria | 2262 |
| 554 | Ga0207705_10071062 | 3300025909 | Bacteria | 2523 |
| 555 | Ga0207684_10001414 | 3300025910 | Bacteria | 25976 |
| 556 | Ga0207707_10068594 | 3300025912 | Bacteria | 3090 |
| 557 | Ga0207695_10001669 | 3300025913 | Bacteria | 35740 |
| 558 | Ga0207695_10010175 | 3300025913 | Bacteria | 11536 |
| 559 | Ga0207695_10029800 | 3300025913 | Bacteria | 6021 |
| 560 | Ga0207671_10033303 | 3300025914 | Bacteria | 3833 |
| 561 | Ga0207660_10014917 | 3300025917 | Bacteria | 5122 |
| 562 | Ga0207662_10002597 | 3300025918 | Bacteria | 9105 |
| 563 | Ga0207657_10045327 | 3300025919 | Bacteria | 3861 |
| 564 | Ga0207657_10088149 | 3300025919 | Bacteria | 2594 |
| 565 | Ga0207649_10000231 | 3300025920 | Bacteria | 45424 |
| 566 | Ga0207649_10093288 | 3300025920 | Bacteria | 1975 |
| 567 | Ga0207649_10112984 | 3300025920 | Bacteria | 1818 |
| 568 | Ga0207652_10025150 | 3300025921 | Bacteria | 4947 |
| 569 | Ga0207681_10008770 | 3300025923 | Bacteria | 6176 |
| 570 | Ga0207694_10019947 | 3300025924 | Bacteria | 5071 |
| 571 | Ga0207650_10001837 | 3300025925 | Bacteria | 14987 |
| 572 | Ga0207650_10006719 | 3300025925 | Bacteria | 7843 |
| 573 | Ga0207650_10021604 | 3300025925 | Bacteria | 4547 |
| 574 | Ga0207650_10130941 | 3300025925 | Bacteria | 1963 |
| 575 | Ga0207650_10186671 | 3300025925 | Bacteria | 1655 |
| 576 | Ga0207659_10001154 | 3300025926 | Bacteria | 15740 |
| 577 | Ga0207659_10001657 | 3300025926 | Bacteria | 13216 |
| 578 | Ga0207659_10003471 | 3300025926 | Bacteria | 9455 |
| 579 | Ga0207687_10166300 | 3300025927 | Bacteria | 1697 |
| 580 | Ga0207644_10003202 | 3300025931 | Bacteria | 10543 |
| 581 | Ga0207644_10032324 | 3300025931 | Bacteria | 3650 |
| 582 | Ga0207644_10047145 | 3300025931 | Bacteria | 3073 |
| 583 | Ga0207644_10050485 | 3300025931 | Bacteria | 2982 |
| 584 | Ga0207644_10062850 | 3300025931 | Bacteria | 2694 |
| 585 | Ga0207644_10065110 | 3300025931 | Bacteria | 2650 |
| 586 | Ga0207644_10129635 | 3300025931 | Bacteria | 1929 |
| 587 | Ga0207690_10004058 | 3300025932 | Bacteria | 8649 |
| 588 | Ga0207690_10077284 | 3300025932 | Bacteria | 2313 |
| 589 | Ga0207706_10000499 | 3300025933 | Bacteria | 41776 |
| 590 | Ga0207709_10000130 | 3300025935 | Bacteria | 110843 |
| 591 | Ga0207709_10001694 | 3300025935 | Bacteria | 14834 |
| 592 | Ga0207709_10002721 | 3300025935 | Bacteria | 10914 |
| 593 | Ga0207709_10005799 | 3300025935 | Bacteria | 6981 |
| 594 | Ga0207709_10067926 | 3300025935 | Bacteria | 2251 |
| 595 | Ga0207669_10003780 | 3300025937 | Bacteria | 6581 |
| 596 | Ga0207704_10063492 | 3300025938 | Bacteria | 2302 |
| 597 | Ga0207691_10000511 | 3300025940 | Bacteria | 38559 |
| 598 | Ga0207691_10005462 | 3300025940 | Bacteria | 12271 |
| 599 | Ga0207691_10024751 | 3300025940 | Bacteria | 5643 |
| 600 | Ga0207691_10034076 | 3300025940 | Bacteria | 4739 |
| 601 | Ga0207691_10035416 | 3300025940 | Bacteria | 4633 |
| 602 | Ga0207691_10129050 | 3300025940 | Bacteria | 2234 |
| 603 | Ga0207691_10142036 | 3300025940 | Bacteria | 2115 |
| 604 | Ga0207711_10011343 | 3300025941 | Bacteria | 7402 |
| 605 | Ga0207711_10020600 | 3300025941 | Bacteria | 5503 |
| 606 | Ga0207711_10179547 | 3300025941 | Bacteria | 1924 |
| 607 | Ga0207711_10212709 | 3300025941 | Bacteria | 1766 |
| 608 | Ga0207689_10003209 | 3300025942 | Bacteria | 14974 |
| 609 | Ga0207689_10022772 | 3300025942 | Bacteria | 5263 |
| 610 | Ga0207689_10100290 | 3300025942 | Bacteria | 2379 |
| 611 | Ga0207689_10120235 | 3300025942 | Bacteria | 2161 |
| 612 | Ga0207661_10052592 | 3300025944 | Bacteria | 3254 |
| 613 | Ga0207679_10000003 | 3300025945 | Bacteria | 597553 |
| 614 | Ga0207679_10006049 | 3300025945 | Bacteria | 7628 |
| 615 | Ga0207679_10090162 | 3300025945 | Bacteria | 2369 |
| 616 | Ga0207679_10222625 | 3300025945 | Bacteria | 1588 |
| 617 | Ga0207667_10046059 | 3300025949 | Bacteria | 4618 |
| 618 | Ga0207667_10084418 | 3300025949 | Bacteria | 3287 |
| 619 | Ga0207667_10114793 | 3300025949 | Bacteria | 2775 |
| 620 | Ga0207667_10339975 | 3300025949 | Bacteria | 1532 |
| 621 | Ga0207651_10016902 | 3300025960 | Bacteria | 4292 |
| 622 | Ga0207651_10018036 | 3300025960 | Bacteria | 4188 |
| 623 | Ga0207651_10027991 | 3300025960 | Bacteria | 3548 |
| 624 | Ga0207651_10087447 | 3300025960 | Bacteria | 2268 |
| 625 | Ga0207712_10009755 | 3300025961 | Bacteria | 6084 |
| 626 | Ga0207712_10198231 | 3300025961 | Bacteria | 1590 |
| 627 | Ga0207640_10000204 | 3300025981 | Bacteria | 42427 |
| 628 | Ga0207640_10042398 | 3300025981 | Bacteria | 2901 |
| 629 | Ga0207640_10179312 | 3300025981 | Bacteria | 1587 |
| 630 | Ga0207658_10001749 | 3300025986 | Bacteria | 16347 |
| 631 | Ga0207658_10013291 | 3300025986 | Bacteria | 5622 |
| 632 | Ga0207658_10033908 | 3300025986 | Bacteria | 3644 |
| 633 | Ga0207658_10074735 | 3300025986 | Bacteria | 2576 |
| 634 | Ga0207658_10111847 | 3300025986 | Bacteria | 2160 |
| 635 | Ga0207658_10237765 | 3300025986 | Bacteria | 1541 |
| 636 | Ga0207677_10001579 | 3300026023 | Bacteria | 12065 |
| 637 | Ga0207677_10067151 | 3300026023 | Bacteria | 2511 |
| 638 | Ga0207677_10090461 | 3300026023 | Bacteria | 2224 |
| 639 | Ga0207677_10094849 | 3300026023 | Bacteria | 2179 |
| 640 | Ga0207677_10163452 | 3300026023 | Bacteria | 1732 |
| 641 | Ga0207703_10005816 | 3300026035 | Bacteria | 9879 |
| 642 | Ga0207703_10007010 | 3300026035 | Bacteria | 8968 |
| 643 | Ga0207703_10063397 | 3300026035 | Bacteria | 3030 |
| 644 | Ga0207639_10003459 | 3300026041 | Bacteria | 10625 |
| 645 | Ga0207639_10061438 | 3300026041 | Bacteria | 2902 |
| 646 | Ga0207678_10000002 | 3300026067 | Bacteria | 371723 |
| 647 | Ga0207678_10001741 | 3300026067 | Bacteria | 19919 |
| 648 | Ga0207678_10042038 | 3300026067 | Bacteria | 3961 |
| 649 | Ga0207678_10097384 | 3300026067 | Bacteria | 2514 |
| 650 | Ga0207708_10019691 | 3300026075 | Bacteria | 5089 |
| 651 | Ga0207708_10022978 | 3300026075 | Bacteria | 4710 |
| 652 | Ga0207702_10000080 | 3300026078 | Bacteria | 108289 |
| 653 | Ga0207702_10001261 | 3300026078 | Bacteria | 25509 |
| 654 | Ga0207702_10005418 | 3300026078 | Bacteria | 11168 |
| 655 | Ga0207641_10005241 | 3300026088 | Bacteria | 11086 |
| 656 | Ga0207641_10229931 | 3300026088 | Bacteria | 1723 |
| 657 | Ga0207648_10000053 | 3300026089 | Bacteria | 107516 |
| 658 | Ga0207648_10003753 | 3300026089 | Bacteria | 15873 |
| 659 | Ga0207648_10012937 | 3300026089 | Bacteria | 7793 |
| 660 | Ga0207648_10013431 | 3300026089 | Bacteria | 7621 |
| 661 | Ga0207648_10071700 | 3300026089 | Bacteria | 3019 |
| 662 | Ga0207648_10212645 | 3300026089 | Bacteria | 1717 |
| 663 | Ga0207676_10007553 | 3300026095 | Bacteria | 7713 |
| 664 | Ga0207676_10016812 | 3300026095 | Bacteria | 5297 |
| 665 | Ga0207676_10107975 | 3300026095 | Bacteria | 2322 |
| 666 | Ga0207676_10187259 | 3300026095 | Bacteria | 1818 |
| 667 | Ga0207676_10305798 | 3300026095 | Bacteria | 1453 |
| 668 | Ga0207674_10004793 | 3300026116 | Bacteria | 16214 |
| 669 | Ga0207674_10012238 | 3300026116 | Bacteria | 9598 |
| 670 | Ga0207674_10052728 | 3300026116 | Bacteria | 4147 |
| 671 | Ga0207675_100002925 | 3300026118 | Bacteria | 16801 |
| 672 | Ga0207675_100004928 | 3300026118 | Bacteria | 12863 |
| 673 | Ga0207675_100026001 | 3300026118 | Bacteria | 5448 |
| 674 | Ga0207675_100038504 | 3300026118 | Bacteria | 4463 |
| 675 | Ga0207675_100084556 | 3300026118 | Bacteria | 2977 |
| 676 | Ga0207675_100133907 | 3300026118 | Bacteria | 2350 |
| 677 | Ga0207683_10006050 | 3300026121 | Bacteria | 10361 |
| 678 | Ga0207683_10008024 | 3300026121 | Bacteria | 9029 |
| 679 | Ga0207683_10080738 | 3300026121 | Bacteria | 2885 |
| 680 | Ga0207683_10160742 | 3300026121 | Bacteria | 2030 |
| 681 | Ga0207683_10270416 | 3300026121 | Bacteria | 1552 |
| 682 | Ga0207683_10373506 | 3300026121 | Bacteria | 1310 |
| 683 | Ga0207698_10038535 | 3300026142 | Bacteria | 3532 |
| 684 | Ga0207698_10057783 | 3300026142 | Bacteria | 3003 |
| 685 | Ga0207698_10272726 | 3300026142 | Bacteria | 1560 |
| 686 | Ga0209281_1000103 | 3300027111 | Bacteria | 221425 |
| 687 | Ga0209973_1000593 | 3300027252 | Bacteria | 2825 |
| 688 | Ga0209983_1010176 | 3300027665 | Bacteria | 1921 |
| 689 | Ga0209282_1002486 | 3300027666 | Bacteria | 10675 |
| 690 | Ga0209813_10011416 | 3300027866 | Bacteria | 2321 |
| 691 | Ga0209974_10001308 | 3300027876 | Bacteria | 8953 |
| 692 | Ga0209974_10015055 | 3300027876 | Bacteria | 2568 |
| 693 | Ga0268266_10014299 | 3300028379 | Bacteria | 6825 |
| 694 | Ga0268266_10343695 | 3300028379 | Bacteria | 1401 |
| 695 | Ga0268265_10007752 | 3300028380 | Bacteria | 7247 |
| 696 | Ga0268265_10016123 | 3300028380 | Bacteria | 5128 |
| 697 | Ga0268265_10103334 | 3300028380 | Bacteria | 2307 |
| 698 | Ga0268264_10005622 | 3300028381 | Bacteria | 10618 |
| 699 | Ga0268264_10011457 | 3300028381 | Bacteria | 7321 |
| 700 | Ga0268264_10063241 | 3300028381 | Bacteria | 3110 |
| 701 | Ga0268264_10315708 | 3300028381 | Bacteria | 1476 |
| 702 | Ga0265336_10000053 | 3300028666 | Bacteria | 113034 |
| 703 | Ga0307517_10001511 | 3300028786 | Bacteria | 38826 |
| 704 | Ga0307517_10126743 | 3300028786 | Bacteria | 1859 |
| 705 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 706 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 707 | Ga0307515_10000708 | 3300028794 | Bacteria | 76903 |
| 708 | Ga0307515_10002191 | 3300028794 | Bacteria | 42879 |
| 709 | Ga0307515_10002971 | 3300028794 | Bacteria | 35983 |
| 710 | Ga0307515_10012418 | 3300028794 | Bacteria | 16020 |
| 711 | Ga0307515_10013083 | 3300028794 | Bacteria | 15535 |
| 712 | Ga0307515_10041442 | 3300028794 | Bacteria | 7239 |
| 713 | Ga0307515_10048737 | 3300028794 | Bacteria | 6397 |
| 714 | Ga0307515_10071988 | 3300028794 | Bacteria | 4675 |
| 715 | Ga0307515_10086241 | 3300028794 | Bacteria | 4005 |
| 716 | Ga0307515_10090189 | 3300028794 | Bacteria | 3848 |
| 717 | Ga0307515_10121393 | 3300028794 | Bacteria | 2956 |
| 718 | Ga0307515_10131234 | 3300028794 | Bacteria | 2757 |
| 719 | Ga0265324_10000132 | 3300029957 | Bacteria | 58866 |
| 720 | Ga0307512_10106359 | 3300030522 | Bacteria | 1872 |
| 721 | Ga0314311_1040207 | 3300030733 | Bacteria | 5569 |
| 722 | Ga0316178_1118432 | 3300030735 | Bacteria | 5947 |
| 723 | Ga0316183_1082423 | 3300030742 | Bacteria | 3684 |
| 724 | Ga0316181_1082156 | 3300030744 | Bacteria | 5198 |
| 725 | Ga0316182_1083649 | 3300030745 | Bacteria | 2333 |
| 726 | Ga0316182_1306370 | 3300030745 | Bacteria | 1638 |
| 727 | Ga0265332_10000020 | 3300031238 | Bacteria | 219119 |
| 728 | Ga0265328_10018418 | 3300031239 | Bacteria | 2694 |
| 729 | Ga0265331_10004933 | 3300031250 | Bacteria | 8200 |
| 730 | Ga0265331_10011350 | 3300031250 | Bacteria | 4883 |
| 731 | Ga0265331_10038086 | 3300031250 | Bacteria | 2352 |
| 732 | Ga0265327_10000144 | 3300031251 | Bacteria | 156779 |
| 733 | Ga0265327_10005627 | 3300031251 | Bacteria | 10374 |
| 734 | Ga0265327_10073363 | 3300031251 | Bacteria | 1707 |
| 735 | Ga0265316_10000005 | 3300031344 | Bacteria | 304442 |
| 736 | Ga0307513_10000020 | 3300031456 | Bacteria | 228745 |
| 737 | Ga0307513_10000129 | 3300031456 | Bacteria | 106759 |
| 738 | Ga0307513_10032452 | 3300031456 | Bacteria | 5888 |
| 739 | Ga0307513_10037752 | 3300031456 | Bacteria | 5372 |
| 740 | Ga0307513_10056487 | 3300031456 | Bacteria | 4190 |
| 741 | Ga0307513_10057757 | 3300031456 | Bacteria | 4130 |
| 742 | Ga0307513_10157651 | 3300031456 | Bacteria | 2167 |
| 743 | Ga0307509_10003552 | 3300031507 | Bacteria | 23484 |
| 744 | Ga0307509_10004884 | 3300031507 | Bacteria | 19006 |
| 745 | Ga0307509_10011369 | 3300031507 | Bacteria | 10786 |
| 746 | Ga0307509_10030410 | 3300031507 | Bacteria | 5974 |
| 747 | Ga0307509_10049375 | 3300031507 | Bacteria | 4511 |
| 748 | Ga0307408_100000086 | 3300031548 | Bacteria | 101944 |
| 749 | Ga0307408_100003486 | 3300031548 | Bacteria | 10733 |
| 750 | Ga0307408_100049153 | 3300031548 | Bacteria | 3028 |
| 751 | Ga0307408_100088756 | 3300031548 | Bacteria | 2329 |
| 752 | Ga0307508_10000169 | 3300031616 | Bacteria | 78769 |
| 753 | Ga0307508_10002731 | 3300031616 | Bacteria | 18438 |
| 754 | Ga0307508_10214365 | 3300031616 | Bacteria | 1525 |
| 755 | Ga0307514_10000920 | 3300031649 | Bacteria | 44996 |
| 756 | Ga0307514_10014677 | 3300031649 | Bacteria | 6481 |
| 757 | Ga0316579_10002053 | 3300031691 | Bacteria | 7543 |
| 758 | Ga0265314_10001065 | 3300031711 | Bacteria | 31865 |
| 759 | Ga0265342_10081970 | 3300031712 | Bacteria | 1862 |
| 760 | Ga0316576_10008990 | 3300031727 | Bacteria | 6419 |
| 761 | Ga0316576_10113349 | 3300031727 | Bacteria | 2033 |
| 762 | Ga0316578_10024622 | 3300031728 | Bacteria | 3377 |
| 763 | Ga0316578_10038197 | 3300031728 | Bacteria | 2768 |
| 764 | Ga0307516_10000311 | 3300031730 | Bacteria | 63197 |
| 765 | Ga0307516_10000678 | 3300031730 | Bacteria | 46164 |
| 766 | Ga0307516_10004343 | 3300031730 | Bacteria | 17529 |
| 767 | Ga0307516_10008972 | 3300031730 | Bacteria | 11204 |
| 768 | Ga0307516_10009522 | 3300031730 | Bacteria | 10822 |
| 769 | Ga0307516_10045613 | 3300031730 | Bacteria | 4328 |
| 770 | Ga0307516_10081745 | 3300031730 | Bacteria | 3073 |
| 771 | Ga0307405_10021785 | 3300031731 | Bacteria | 3609 |
| 772 | Ga0307405_10038766 | 3300031731 | Bacteria | 2875 |
| 773 | Ga0307413_10013379 | 3300031824 | Bacteria | 4123 |
| 774 | Ga0307413_10088722 | 3300031824 | Bacteria | 2007 |
| 775 | Ga0307413_10097706 | 3300031824 | Bacteria | 1931 |
| 776 | Ga0307410_10032495 | 3300031852 | Bacteria | 3359 |
| 777 | Ga0307406_10002476 | 3300031901 | Bacteria | 10069 |
| 778 | Ga0307406_10004722 | 3300031901 | Bacteria | 7423 |
| 779 | Ga0307406_10010926 | 3300031901 | Bacteria | 5135 |
| 780 | Ga0307412_10006540 | 3300031911 | Bacteria | 6596 |
| 781 | Ga0307412_10045274 | 3300031911 | Bacteria | 2875 |
| 782 | Ga0307412_10056567 | 3300031911 | Bacteria | 2614 |
| 783 | Ga0307412_10181360 | 3300031911 | Bacteria | 1584 |
| 784 | Ga0307409_100000189 | 3300031995 | Bacteria | 24166 |
| 785 | Ga0307409_100006670 | 3300031995 | Bacteria | 6819 |
| 786 | Ga0307416_100001876 | 3300032002 | Bacteria | 11723 |
| 787 | Ga0307411_10130385 | 3300032005 | Bacteria | 1836 |
| 788 | Ga0307411_10131372 | 3300032005 | Bacteria | 1830 |
| 789 | Ga0307415_100019230 | 3300032126 | Bacteria | 4143 |
| 790 | Ga0307415_100027523 | 3300032126 | Bacteria | 3603 |
| 791 | Ga0316593_10028412 | 3300032168 | Bacteria | 1802 |
| 792 | Ga0316593_10033310 | 3300032168 | Bacteria | 1686 |
| 793 | Ga0307507_10018253 | 3300033179 | Bacteria | 7989 |
| 794 | Ga0307507_10021035 | 3300033179 | Bacteria | 7282 |
| 795 | Ga0307510_10068525 | 3300033180 | Bacteria | 3559 |
| 796 | Ga0316592_1005500 | 3300033524 | Bacteria | 2408 |
| 797 | Ga0316592_1024929 | 3300033524 | Bacteria | 1288 |
| 798 | Ga0316588_1001260 | 3300033528 | Bacteria | 4080 |
| 799 | Ga0316588_1005901 | 3300033528 | Bacteria | 2419 |
| 800 | Ga0316587_1010530 | 3300033529 | Bacteria | 1481 |
| 801 | Ga0316596_1021026 | 3300033541 | Bacteria | 1662 |
| 802 | Ga0373923_0077768 | 3300035111 | Bacteria | 1435 |
| 803 | Ga0373939_0000004 | 3300035114 | Bacteria | 106519 |
| 804 | Ga0373960_0006404 | 3300035121 | Bacteria | 2761 |
| 805 | Ga0373931_0000140 | 3300035691 | Bacteria | 32698 |
| 806 | Ga0373931_0002251 | 3300035691 | Bacteria | 8526 |
| 807 | Ga0373931_0014186 | 3300035691 | Bacteria | 3891 |
| 808 | Ga0373931_0016238 | 3300035691 | Bacteria | 3662 |
| 809 | Ga0373927_0201911 | 3300035695 | Bacteria | 1305 |
| 810 | Ga0373937_0100521 | 3300036401 | Bacteria | 2684 |
| 811 | Ga0316582_0034544 | 3300036647 | Bacteria | 3115 |
| 812 | Ga0316584_0006067 | 3300036712 | Bacteria | 8166 |
| 813 | Ga0316584_0074349 | 3300036712 | Bacteria | 2547 |
| 814 | Ga0373925_0034529 | 3300037068 | Bacteria | 3728 |
| 815 | Ga0373925_0128586 | 3300037068 | Bacteria | 1973 |
| 816 | Ga0395899_0005350 | 3300037312 | Bacteria | 9972 |
| 817 | Ga0395899_0006712 | 3300037312 | Bacteria | 8914 |
| 818 | Ga0395899_0102242 | 3300037312 | Bacteria | 2068 |
| 819 | Ga0395900_0000131 | 3300037418 | Bacteria | 125554 |
| 820 | Ga0395900_0005063 | 3300037418 | Bacteria | 13830 |
| 821 | Ga0395900_0005396 | 3300037418 | Bacteria | 13392 |
| 822 | Ga0395900_0018610 | 3300037418 | Bacteria | 7083 |
| 823 | Ga0395900_0021753 | 3300037418 | Bacteria | 6557 |
| 824 | Ga0395900_0119412 | 3300037418 | Bacteria | 2706 |
| 825 | Ga0395898_0001532 | 3300037466 | Bacteria | 31823 |
| 826 | Ga0395898_0006253 | 3300037466 | Bacteria | 12742 |
| 827 | Ga0395898_0011606 | 3300037466 | Bacteria | 9144 |
| 828 | Ga0395905_0000777 | 3300037471 | Bacteria | 41933 |
| 829 | Ga0395905_0001157 | 3300037471 | Bacteria | 33035 |
| 830 | Ga0395905_0001668 | 3300037471 | Bacteria | 26186 |
| 831 | Ga0395905_0017710 | 3300037471 | Bacteria | 6763 |
| 832 | Ga0395905_0026275 | 3300037471 | Bacteria | 5490 |
| 833 | Ga0395905_0034757 | 3300037471 | Bacteria | 4733 |
| 834 | Ga0395905_0040407 | 3300037471 | Bacteria | 4375 |
| 835 | Ga0395905_0042849 | 3300037471 | Bacteria | 4246 |
| 836 | Ga0395905_0078207 | 3300037471 | Bacteria | 3099 |
| 837 | Ga0395905_0105542 | 3300037471 | Bacteria | 2645 |
| 838 | Ga0395905_0113532 | 3300037471 | Bacteria | 2545 |
| 839 | Ga0395905_0116952 | 3300037471 | Bacteria | 2505 |
| 840 | Ga0395905_0176135 | 3300037471 | Bacteria | 2008 |
| 841 | Ga0395905_0187142 | 3300037471 | Bacteria | 1943 |
| 842 | Ga0395905_0309042 | 3300037471 | Bacteria | 1469 |
| 843 | Ga0395901_0007241 | 3300038443 | Bacteria | 11191 |
| 844 | Ga0395901_0022743 | 3300038443 | Bacteria | 6428 |
| 845 | Ga0395901_0043010 | 3300038443 | Bacteria | 4685 |
| 846 | Ga0395901_0099214 | 3300038443 | Bacteria | 3054 |
| 847 | Ga0395901_0183218 | 3300038443 | Bacteria | 2196 |
| 848 | Ga0395901_0236332 | 3300038443 | Bacteria | 1907 |
| 849 | Ga0395901_0311371 | 3300038443 | Bacteria | 1630 |
| 850 | Ga0400485_21670 | 3300038735 | Bacteria | 2148 |
| 851 | Ga0436365_0350119 | 3300039437 | Bacteria | 7336 |
| 852 | Ga0436365_0760616 | 3300039437 | Bacteria | 2085 |
| 853 | Ga0436361_0255861 | 3300039447 | Bacteria | 53221 |
| 854 | Ga0436361_0338967 | 3300039447 | Bacteria | 4771 |
| 855 | Ga0436361_0355769 | 3300039447 | Bacteria | 5025 |
| 856 | Ga0436361_0362312 | 3300039447 | Bacteria | 55943 |
| 857 | Ga0436361_0393109 | 3300039447 | Bacteria | 4769 |
| 858 | Ga0436361_0616441 | 3300039447 | Bacteria | 29495 |
| 859 | Ga0436361_0709657 | 3300039447 | Bacteria | 1884 |
| 860 | Ga0436361_0916159 | 3300039447 | Bacteria | 49060 |
| 861 | Ga0436361_1150385 | 3300039447 | Bacteria | 105721 |
| 862 | Ga0439436_0000635 | 3300041404 | Bacteria | 9346 |
| 863 | Ga0439439_0000329 | 3300041406 | Bacteria | 7680 |
| 864 | Ga0439466_0004216 | 3300041411 | Bacteria | 5551 |
| 865 | Ga0439465_0000176 | 3300041413 | Bacteria | 16369 |
| 866 | Ga0439465_0016982 | 3300041413 | Bacteria | 2271 |
| 867 | Ga0451793_1605648 | 3300041452 | Bacteria | 2400 |
| 868 | Ga0451793_1651023 | 3300041452 | Bacteria | 1896 |
| 869 | Ga0451795_0983196 | 3300041456 | Bacteria | 1723 |
| 870 | Ga0451798_0142848 | 3300041458 | Bacteria | 2634 |
| 871 | Ga0451800_0241174 | 3300041459 | Bacteria | 2019 |
| 872 | Ga0451802_0447858 | 3300041460 | Bacteria | 2093 |
| 873 | Ga0451841_0619619 | 3300041498 | Bacteria | 1950 |
| 874 | Ga0451853_0383239 | 3300041512 | Bacteria | 2822 |
| 875 | Ga0451853_1507922 | 3300041512 | Bacteria | 3161 |
| 876 | Ga0451853_2429987 | 3300041512 | Bacteria | 1493 |
| 877 | Ga0439431_0009855 | 3300041997 | Bacteria | 2162 |
| 878 | Ga0439445_0000181 | 3300042004 | Bacteria | 11274 |
| 879 | Ga0439445_0009295 | 3300042004 | Bacteria | 2315 |
| 880 | Ga0439449_0000632 | 3300042007 | Bacteria | 13206 |
| 881 | Ga0439449_0000947 | 3300042007 | Bacteria | 11364 |
| 882 | Ga0439449_0001266 | 3300042007 | Bacteria | 9907 |
| 883 | Ga0439462_0001510 | 3300042015 | Bacteria | 5204 |
| 884 | Ga0450911_000725 | 3300042115 | Bacteria | 9579 |
| 885 | Ga0450923_001000 | 3300042125 | Bacteria | 3522 |
| 886 | Ga0450899_001250 | 3300042135 | Bacteria | 2880 |
| 887 | Ga0439446_0036617 | 3300042156 | Bacteria | 1434 |
| 888 | Ga0450909_009165 | 3300042185 | Bacteria | 1444 |
| 889 | Ga0439434_0000543 | 3300042435 | Bacteria | 10785 |
| 890 | Ga0439434_0003310 | 3300042435 | Bacteria | 4734 |
| 891 | Ga0439434_0035836 | 3300042435 | Bacteria | 1517 |
| 892 | Ga0439434_0051958 | 3300042435 | Bacteria | 1272 |
| 893 | Ga0450918_002647 | 3300042531 | Bacteria | 3371 |
| 894 | Ga0450918_003930 | 3300042531 | Bacteria | 2730 |
| 895 | Ga0451577_0000152 | 3300042876 | Bacteria | 153284 |
| 896 | Ga0451577_0004023 | 3300042876 | Bacteria | 15811 |
| 897 | Ga0451577_0018493 | 3300042876 | Bacteria | 6419 |
| 898 | Ga0451577_0030135 | 3300042876 | Bacteria | 4903 |
| 899 | Ga0451577_0041881 | 3300042876 | Bacteria | 4109 |
| 900 | Ga0466969_0001257 | 3300044656 | Bacteria | 13672 |
| 901 | Ga0466969_0001560 | 3300044656 | Bacteria | 12303 |
| 902 | Ga0466969_0005210 | 3300044656 | Bacteria | 6918 |
| 903 | Ga0466969_0012595 | 3300044656 | Bacteria | 4457 |
| 904 | Ga0466969_0057686 | 3300044656 | Bacteria | 1892 |
| 905 | Ga0466969_0076686 | 3300044656 | Bacteria | 1600 |
| 906 | Ga0466973_0035278 | 3300044659 | Bacteria | 4754 |
| 907 | Ga0466965_0008100 | 3300044683 | Bacteria | 4855 |
| 908 | Ga0466965_0018908 | 3300044683 | Bacteria | 3306 |
| 909 | Ga0466965_0097482 | 3300044683 | Bacteria | 1501 |
| 910 | Ga0466966_0000687 | 3300044684 | Bacteria | 21520 |
| 911 | Ga0466966_0001625 | 3300044684 | Bacteria | 14480 |
| 912 | Ga0466966_0002631 | 3300044684 | Bacteria | 11760 |
| 913 | Ga0466966_0080940 | 3300044684 | Bacteria | 2022 |
| 914 | Ga0466961_0001458 | 3300044693 | Bacteria | 14699 |
| 915 | Ga0466961_0002291 | 3300044693 | Bacteria | 11891 |
| 916 | Ga0466961_0007342 | 3300044693 | Bacteria | 7013 |
| 917 | Ga0466963_0002704 | 3300044694 | Bacteria | 9994 |
| 918 | Ga0466963_0014486 | 3300044694 | Bacteria | 4862 |
| 919 | Ga0466964_0001639 | 3300044706 | Bacteria | 7729 |
| 920 | Ga0466964_0002848 | 3300044706 | Bacteria | 6238 |
| 921 | Ga0466964_0053627 | 3300044706 | Bacteria | 1660 |
| 922 | Ga0453684_0000122 | 3300044712 | Bacteria | 340529 |
| 923 | Ga0453684_0197635 | 3300044712 | Bacteria | 2347 |
| 924 | Ga0466971_0003452 | 3300044719 | Bacteria | 6749 |
| 925 | Ga0466971_0005142 | 3300044719 | Bacteria | 5665 |
| 926 | Ga0466968_0006689 | 3300044735 | Bacteria | 4355 |
| 927 | Ga0466970_0005511 | 3300044765 | Bacteria | 6284 |
| 928 | Ga0466970_0005981 | 3300044765 | Bacteria | 6061 |
| 929 | Ga0466957_0012381 | 3300044842 | Bacteria | 4938 |
| 930 | Ga0466957_0020799 | 3300044842 | Bacteria | 3860 |
| 931 | Ga0466957_0087085 | 3300044842 | Bacteria | 1952 |
| 932 | Ga0466960_0060962 | 3300044901 | Bacteria | 1850 |
| 933 | Ga0466959_0000287 | 3300045049 | Bacteria | 30550 |
| 934 | Ga0466959_0023408 | 3300045049 | Bacteria | 4570 |
| 935 | Ga0466959_0057239 | 3300045049 | Bacteria | 2842 |
| 936 | Ga0451576_0001995 | 3300045051 | Bacteria | 32320 |
| 937 | Ga0451576_0006156 | 3300045051 | Bacteria | 14777 |
| 938 | Ga0451576_0051233 | 3300045051 | Bacteria | 4328 |
| 939 | Ga0451576_0058191 | 3300045051 | Bacteria | 4040 |
| 940 | Ga0451576_0137794 | 3300045051 | Bacteria | 2545 |
| 941 | Ga0451576_0297220 | 3300045051 | Bacteria | 1688 |
| 942 | Ga0466958_0008673 | 3300045836 | Bacteria | 5644 |
| 943 | Ga0466958_0011505 | 3300045836 | Bacteria | 4983 |
| 944 | Ga0466958_0063425 | 3300045836 | Bacteria | 2253 |
| 945 | Ga0466967_0029006 | 3300045976 | Bacteria | 4626 |
| 946 | Ga0495627_029101 | 3300046453 | Bacteria | 1759 |
| 947 | Ga0495592_0000250 | 3300046454 | Bacteria | 46017 |
| 948 | Ga0495629_0000047 | 3300046459 | Bacteria | 109814 |
| 949 | Ga0495638_0010294 | 3300046460 | Bacteria | 6503 |
| 950 | Ga0495650_0020417 | 3300046471 | Bacteria | 3231 |
| 951 | Ga0495650_0054156 | 3300046471 | Bacteria | 1639 |
| 952 | Ga0495580_0003727 | 3300046472 | Bacteria | 12906 |
| 953 | Ga0495580_0025643 | 3300046472 | Bacteria | 4308 |
| 954 | Ga0495582_0003250 | 3300046473 | Bacteria | 9125 |
| 955 | Ga0495639_0037468 | 3300046475 | Bacteria | 2174 |
| 956 | Ga0495594_0024776 | 3300046499 | Bacteria | 3224 |
| 957 | Ga0495606_0002998 | 3300046507 | Bacteria | 18539 |
| 958 | Ga0495610_0026730 | 3300046512 | Bacteria | 3077 |
| 959 | Ga0495616_0030690 | 3300046513 | Bacteria | 2821 |
| 960 | Ga0495620_0019601 | 3300046515 | Bacteria | 3322 |
| 961 | Ga0495620_0042573 | 3300046515 | Bacteria | 1983 |
| 962 | Ga0495628_0165170 | 3300046516 | Bacteria | 1681 |
| 963 | Ga0495632_0005520 | 3300046519 | Bacteria | 8342 |
| 964 | Ga0495632_0116303 | 3300046519 | Bacteria | 1252 |
| 965 | Ga0495637_0003930 | 3300046520 | Bacteria | 7787 |
| 966 | Ga0495648_0057728 | 3300046524 | Bacteria | 2325 |
| 967 | Ga0495666_0013084 | 3300046526 | Bacteria | 4135 |
| 968 | Ga0495654_0000313 | 3300046530 | Bacteria | 42607 |
| 969 | Ga0495640_0154113 | 3300046533 | Bacteria | 1475 |
| 970 | Ga0495587_0019463 | 3300046536 | Bacteria | 4200 |
| 971 | Ga0495621_0042373 | 3300046539 | Bacteria | 1602 |
| 972 | Ga0495597_0059772 | 3300046542 | Bacteria | 1663 |
| 973 | Ga0495656_0000087 | 3300046615 | Bacteria | 40520 |
| 974 | Ga0495634_0008231 | 3300046642 | Bacteria | 7777 |
| 975 | Ga0495625_0001451 | 3300046660 | Bacteria | 28777 |
| 976 | Ga0495625_0004137 | 3300046660 | Bacteria | 13846 |
| 977 | Ga0495625_0004296 | 3300046660 | Bacteria | 13552 |
| 978 | Ga0495661_0000622 | 3300046665 | Bacteria | 36082 |
| 979 | Ga0495658_0002569 | 3300046683 | Bacteria | 9129 |
| 980 | Ga0495658_0041870 | 3300046683 | Bacteria | 2555 |
| 981 | Ga0495670_0097686 | 3300046691 | Bacteria | 1509 |
| 982 | Ga0495649_0001463 | 3300046694 | Bacteria | 17755 |
| 983 | Ga0495649_0004909 | 3300046694 | Bacteria | 8623 |
| 984 | Ga0495600_0027348 | 3300046809 | Bacteria | 3685 |
| 985 | Ga0495660_0149470 | 3300046810 | Bacteria | 1155 |
| 986 | Ga0495604_0010562 | 3300047317 | Bacteria | 7320 |
| 987 | Ga0495676_0003280 | 3300047321 | Bacteria | 14621 |
| 988 | Ga0495687_000700 | 3300047443 | Bacteria | 37469 |
| 989 | Ga0495687_012571 | 3300047443 | Bacteria | 4466 |
| 990 | Ga0495675_0005883 | 3300047444 | Bacteria | 7494 |
| 991 | Ga0495686_0003614 | 3300047472 | Bacteria | 13266 |
| 992 | Ga0495602_0003834 | 3300048088 | Bacteria | 15645 |
| 993 | Ga0495626_0000003 | 3300048091 | Bacteria | 427774 |
| 994 | Ga0495626_0022313 | 3300048091 | Bacteria | 3128 |
| 995 | Ga0496100_0018438 | 3300048903 | Bacteria | 4139 |
| 996 | Ga0496101_0005305 | 3300048904 | Bacteria | 8210 |
| 997 | Ga0496101_0212307 | 3300048904 | Bacteria | 1500 |
| 998 | Ga0496102_0008930 | 3300048905 | Bacteria | 8600 |
| 999 | Ga0496102_0010550 | 3300048905 | Bacteria | 7955 |
| 1000 | Ga0496102_0015155 | 3300048905 | Bacteria | 6712 |
| 1001 | Ga0496102_0047897 | 3300048905 | Bacteria | 3886 |
| 1002 | Ga0496105_0003188 | 3300048908 | Bacteria | 12077 |
| 1003 | Ga0496105_0030017 | 3300048908 | Bacteria | 4453 |
| 1004 | Ga0496105_0134301 | 3300048908 | Bacteria | 2039 |
| 1005 | Ga0496106_0005942 | 3300048909 | Bacteria | 9016 |
| 1006 | Ga0496108_0105917 | 3300048911 | Bacteria | 2401 |
| 1007 | Ga0496109_0063912 | 3300048912 | Bacteria | 3367 |
| 1008 | Ga0496109_0118393 | 3300048912 | Bacteria | 2466 |
| 1009 | Ga0496109_0168704 | 3300048912 | Bacteria | 2053 |
| 1010 | Ga0496110_0040628 | 3300048913 | Bacteria | 4054 |
| 1011 | Ga0496110_0125528 | 3300048913 | Bacteria | 2315 |
| 1012 | Ga0496112_0008823 | 3300048915 | Bacteria | 9048 |
| 1013 | Ga0496112_0029309 | 3300048915 | Bacteria | 5322 |
| 1014 | Ga0496112_0260384 | 3300048915 | Bacteria | 1684 |
| 1015 | Ga0496113_0221609 | 3300048916 | Bacteria | 1507 |
| 1016 | Ga0496114_0038012 | 3300048917 | Bacteria | 3982 |
| 1017 | Ga0496114_0231527 | 3300048917 | Bacteria | 1623 |
| 1018 | Ga0496116_0009604 | 3300048919 | Bacteria | 8232 |
| 1019 | Ga0496116_0015236 | 3300048919 | Bacteria | 6088 |
| 1020 | Ga0496116_0042395 | 3300048919 | Bacteria | 3111 |
| 1021 | Ga0496117_0033970 | 3300048920 | Bacteria | 3850 |
| 1022 | Ga0496118_0006180 | 3300048921 | Bacteria | 13271 |
| 1023 | Ga0496118_0108075 | 3300048921 | Bacteria | 1855 |
| 1024 | Ga0496119_0018064 | 3300048922 | Bacteria | 5269 |
| 1025 | Ga0496120_0017510 | 3300048923 | Bacteria | 4642 |
| 1026 | Ga0496121_0000012 | 3300048924 | Bacteria | 653131 |
| 1027 | Ga0496121_0000568 | 3300048924 | Bacteria | 69617 |
| 1028 | Ga0496121_0014158 | 3300048924 | Bacteria | 8495 |
| 1029 | Ga0496121_0076519 | 3300048924 | Bacteria | 2668 |
| 1030 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 1031 | Ga0496122_0000329 | 3300048925 | Bacteria | 103316 |
| 1032 | Ga0496123_0000045 | 3300048926 | Bacteria | 249294 |
| 1033 | Ga0496123_0000260 | 3300048926 | Bacteria | 106988 |
| 1034 | Ga0496124_0000036 | 3300048927 | Bacteria | 318032 |
| 1035 | Ga0496124_0000086 | 3300048927 | Bacteria | 202844 |
| 1036 | Ga0496124_0025394 | 3300048927 | Bacteria | 5366 |
| 1037 | Ga0496124_0032613 | 3300048927 | Bacteria | 4596 |
| 1038 | Ga0496124_0051122 | 3300048927 | Bacteria | 3517 |
| 1039 | Ga0496125_0000105 | 3300048928 | Bacteria | 200717 |
| 1040 | Ga0496125_0002103 | 3300048928 | Bacteria | 26737 |
| 1041 | Ga0496125_0006290 | 3300048928 | Bacteria | 12893 |
| 1042 | Ga0496125_0012141 | 3300048928 | Bacteria | 8569 |
| 1043 | Ga0496125_0042518 | 3300048928 | Bacteria | 3868 |
| 1044 | Ga0496125_0056695 | 3300048928 | Bacteria | 3179 |
| 1045 | Ga0496125_0076766 | 3300048928 | Bacteria | 2578 |
| 1046 | Ga0496126_0123311 | 3300048929 | Bacteria | 2245 |
| 1047 | Ga0496126_0248983 | 3300048929 | Bacteria | 1481 |
| 1048 | Ga0501310_004561 | 3300049130 | Bacteria | 1395 |
| 1049 | Ga0501323_004115 | 3300049539 | Bacteria | 1521 |
| 1050 | Ga0501031_0005466 | 3300049568 | Bacteria | 8267 |
| 1051 | Ga0501032_0004732 | 3300049569 | Bacteria | 10217 |
| 1052 | Ga0501033_0150483 | 3300049570 | Bacteria | 1679 |
| 1053 | Ga0501034_0005422 | 3300049571 | Bacteria | 13943 |
| 1054 | Ga0501034_0018726 | 3300049571 | Bacteria | 7095 |
| 1055 | Ga0501034_0020618 | 3300049571 | Bacteria | 6733 |
| 1056 | Ga0501034_0086590 | 3300049571 | Bacteria | 3133 |
| 1057 | Ga0501036_0002318 | 3300049572 | Bacteria | 14880 |
| 1058 | Ga0501036_0085956 | 3300049572 | Bacteria | 2659 |
| 1059 | Ga0501037_0054613 | 3300049573 | Bacteria | 2921 |
| 1060 | Ga0501038_0003581 | 3300049574 | Bacteria | 14451 |
| 1061 | Ga0501039_0260047 | 3300049575 | Bacteria | 1364 |
| 1062 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 1063 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 1064 | Ga0501046_0016051 | 3300049580 | Bacteria | 6279 |
| 1065 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 1066 | Ga0501047_0018196 | 3300049581 | Bacteria | 6734 |
| 1067 | Ga0501047_0035507 | 3300049581 | Bacteria | 4816 |
| 1068 | Ga0501047_0110172 | 3300049581 | Bacteria | 2636 |
| 1069 | Ga0501048_0009085 | 3300049582 | Bacteria | 7480 |
| 1070 | Ga0501070_0003847 | 3300049586 | Bacteria | 12948 |
| 1071 | Ga0501072_0059851 | 3300049588 | Bacteria | 3003 |
| 1072 | Ga0501073_0029410 | 3300049589 | Bacteria | 3927 |
| 1073 | Ga0501073_0032823 | 3300049589 | Bacteria | 3700 |
| 1074 | Ga0501074_0134826 | 3300049590 | Bacteria | 1766 |
| 1075 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 1076 | Ga0501225_0001352 | 3300049705 | Bacteria | 7631 |
| 1077 | Ga0501080_0007098 | 3300049742 | Bacteria | 10115 |
| 1078 | Ga0501083_0025700 | 3300049744 | Bacteria | 4076 |
| 1079 | Ga0501266_003344 | 3300049763 | Bacteria | 1995 |
| 1080 | Ga0501035_0001682 | 3300049822 | Bacteria | 22366 |
| 1081 | Ga0501035_0006696 | 3300049822 | Bacteria | 10768 |
| 1082 | Ga0501044_0007167 | 3300049823 | Bacteria | 12264 |
| 1083 | Ga0501044_0014188 | 3300049823 | Bacteria | 8605 |
| 1084 | Ga0501044_0032540 | 3300049823 | Bacteria | 5481 |
| 1085 | Ga0501044_0111779 | 3300049823 | Bacteria | 2739 |
| 1086 | Ga0501044_0170750 | 3300049823 | Bacteria | 2146 |
| 1087 | Ga0501045_0001048 | 3300049824 | Bacteria | 18195 |
| 1088 | nmdc:mga03n38_11656_c1 | 3300050490 | Bacteria | 3284 |
| 1089 | nmdc:mga03n38_12124_c1 | 3300050490 | Bacteria | 3234 |
| 1090 | nmdc:mga03n38_61_c1 | 3300050490 | Bacteria | 22538 |
| 1091 | nmdc:mga00v17_12094_c1 | 3300050491 | Bacteria | 4755 |
| 1092 | nmdc:mga00v17_14156_c1 | 3300050491 | Bacteria | 4446 |
| 1093 | nmdc:mga00v17_146_c1 | 3300050491 | Bacteria | 40788 |
| 1094 | nmdc:mga00v17_2128_c1 | 3300050491 | Bacteria | 10183 |
| 1095 | nmdc:mga00v17_22012_c1 | 3300050491 | Bacteria | 3674 |
| 1096 | nmdc:mga00v17_505_c1 | 3300050491 | Bacteria | 21902 |
| 1097 | nmdc:mga00v17_6135_c1 | 3300050491 | Bacteria | 6367 |
| 1098 | nmdc:mga0yw44_176989_c1 | 3300050492 | Bacteria | 1403 |
| 1099 | nmdc:mga0yw44_275_c1 | 3300050492 | Bacteria | 17637 |
| 1100 | nmdc:mga0yw44_57_c1 | 3300050492 | Bacteria | 40136 |
| 1101 | nmdc:mga0k408_10272_c1 | 3300050493 | Bacteria | 5060 |
| 1102 | nmdc:mga0k408_122783_c1 | 3300050493 | Bacteria | 1539 |
| 1103 | nmdc:mga0k408_12700_c1 | 3300050493 | Bacteria | 4605 |
| 1104 | nmdc:mga0k408_134_c1 | 3300050493 | Bacteria | 27880 |
| 1105 | nmdc:mga0k408_14316_c1 | 3300050493 | Bacteria | 4368 |
| 1106 | nmdc:mga0k408_143498_c1 | 3300050493 | Bacteria | 1421 |
| 1107 | nmdc:mga0k408_15212_c1 | 3300050493 | Bacteria | 4251 |
| 1108 | nmdc:mga0k408_18434_c1 | 3300050493 | Bacteria | 3897 |
| 1109 | nmdc:mga0k408_196527_c1 | 3300050493 | Bacteria | 1204 |
| 1110 | nmdc:mga0k408_1969_c1 | 3300050493 | Bacteria | 11007 |
| 1111 | nmdc:mga0k408_20201_c1 | 3300050493 | Bacteria | 3729 |
| 1112 | nmdc:mga0k408_22699_c1 | 3300050493 | Bacteria | 3535 |
| 1113 | nmdc:mga0k408_25606_c1 | 3300050493 | Bacteria | 3342 |
| 1114 | nmdc:mga0k408_28295_c1 | 3300050493 | Bacteria | 3186 |
| 1115 | nmdc:mga0k408_2894_c1 | 3300050493 | Bacteria | 9099 |
| 1116 | nmdc:mga0k408_52536_c1 | 3300050493 | Bacteria | 2362 |
| 1117 | nmdc:mga0k408_533_c1 | 3300050493 | Bacteria | 20949 |
| 1118 | nmdc:mga0k408_62846_c1 | 3300050493 | Bacteria | 2159 |
| 1119 | nmdc:mga0k408_84073_c1 | 3300050493 | Bacteria | 1867 |
| 1120 | nmdc:mga0k408_951_c2 | 3300050493 | Bacteria | 6329 |
| 1121 | nmdc:mga06z11_105_c1 | 3300050494 | Bacteria | 34898 |
| 1122 | nmdc:mga06z11_22303_c1 | 3300050494 | Bacteria | 2955 |
| 1123 | nmdc:mga06z11_6455_c1 | 3300050494 | Bacteria | 4774 |
| 1124 | nmdc:mga07m45_11093_c1 | 3300050496 | Bacteria | 4726 |
| 1125 | nmdc:mga07m45_121182_c1 | 3300050496 | Bacteria | 1511 |
| 1126 | nmdc:mga07m45_13425_c1 | 3300050496 | Bacteria | 4347 |
| 1127 | nmdc:mga07m45_142405_c1 | 3300050496 | Bacteria | 1389 |
| 1128 | nmdc:mga07m45_142667_c1 | 3300050496 | Bacteria | 1387 |
| 1129 | nmdc:mga07m45_1573_c1 | 3300050496 | Bacteria | 10505 |
| 1130 | nmdc:mga07m45_18036_c1 | 3300050496 | Bacteria | 3802 |
| 1131 | nmdc:mga07m45_212767_c1 | 3300050496 | Bacteria | 1125 |
| 1132 | nmdc:mga07m45_25532_c1 | 3300050496 | Bacteria | 3241 |
| 1133 | nmdc:mga07m45_3649_c1 | 3300050496 | Bacteria | 7434 |
| 1134 | nmdc:mga07m45_4460_c1 | 3300050496 | Bacteria | 6850 |
| 1135 | nmdc:mga07m45_45953_c1 | 3300050496 | Bacteria | 2452 |
| 1136 | nmdc:mga07m45_5487_c1 | 3300050496 | Bacteria | 6318 |
| 1137 | nmdc:mga07m45_66_c1 | 3300050496 | Bacteria | 40757 |
| 1138 | nmdc:mga07m45_75_c1 | 3300050496 | Bacteria | 29787 |
| 1139 | nmdc:mga07m45_810_c1 | 3300050496 | Bacteria | 13476 |
| 1140 | nmdc:mga07m45_9440_c1 | 3300050496 | Bacteria | 5064 |
| 1141 | nmdc:mga07m45_969_c1 | 3300050496 | Bacteria | 12632 |
| 1142 | nmdc:mga08y16_312129_c1 | 3300050511 | Bacteria | 1619 |
| 1143 | nmdc:mga0n895_165330_c1 | 3300050512 | Bacteria | 2244 |
| 1144 | nmdc:mga0sz30_118_c1 | 3300050516 | Bacteria | 29758 |
| 1145 | nmdc:mga0sz30_12949_c1 | 3300050516 | Bacteria | 3256 |
| 1146 | nmdc:mga0sz30_13505_c1 | 3300050516 | Bacteria | 3199 |
| 1147 | nmdc:mga0sz30_34430_c1 | 3300050516 | Bacteria | 2108 |
| 1148 | Ga0500610_0029223 | 3300053079 | Bacteria | 2783 |
| 1149 | Ga0500635_0000083 | 3300053080 | Bacteria | 61980 |
| 1150 | Ga0500578_0000058 | 3300053086 | Bacteria | 119650 |
| 1151 | Ga0500644_0001410 | 3300053088 | Bacteria | 6389 |
| 1152 | Ga0500651_0000125 | 3300053093 | Bacteria | 47146 |
| 1153 | Ga0500651_0042015 | 3300053093 | Bacteria | 2881 |
| 1154 | Ga0500562_013588 | 3300053108 | Bacteria | 2081 |
| 1155 | Ga0500571_006911 | 3300053110 | Bacteria | 6150 |
| 1156 | Ga0500593_000810 | 3300053117 | Bacteria | 11698 |
| 1157 | Ga0500593_001579 | 3300053117 | Bacteria | 8194 |
| 1158 | Ga0500594_0000346 | 3300053118 | Bacteria | 10412 |
| 1159 | Ga0500594_0000938 | 3300053118 | Bacteria | 6261 |
| 1160 | Ga0500607_008170 | 3300053121 | Bacteria | 6383 |
| 1161 | Ga0500608_020890 | 3300053122 | Bacteria | 3018 |
| 1162 | Ga0500628_000906 | 3300053129 | Bacteria | 5229 |
| 1163 | Ga0500642_0000990 | 3300053130 | Bacteria | 8165 |
| 1164 | Ga0500652_000300 | 3300053131 | Bacteria | 17910 |
| 1165 | Ga0500658_0002003 | 3300053134 | Bacteria | 7959 |
| 1166 | Ga0500658_0002237 | 3300053134 | Bacteria | 7509 |
| 1167 | Ga0500658_0005042 | 3300053134 | Bacteria | 4914 |
| 1168 | Ga0500658_0021081 | 3300053134 | Bacteria | 2465 |
| 1169 | Ga0500559_0000076 | 3300053136 | Bacteria | 76510 |
| 1170 | Ga0500559_0034570 | 3300053136 | Bacteria | 2180 |
| 1171 | Ga0500568_0004400 | 3300053139 | Bacteria | 7534 |
| 1172 | Ga0500568_0010776 | 3300053139 | Bacteria | 4265 |
| 1173 | Ga0500568_0028309 | 3300053139 | Bacteria | 2336 |
| 1174 | Ga0500577_0013682 | 3300053142 | Bacteria | 2485 |
| 1175 | Ga0500616_0020378 | 3300053153 | Bacteria | 3725 |
| 1176 | Ga0500619_000040 | 3300053154 | Bacteria | 40525 |
| 1177 | Ga0500622_0000094 | 3300053156 | Bacteria | 91975 |
| 1178 | Ga0500622_0001530 | 3300053156 | Bacteria | 18329 |
| 1179 | Ga0500622_0001780 | 3300053156 | Bacteria | 16470 |
| 1180 | Ga0500622_0054734 | 3300053156 | Bacteria | 2045 |
| 1181 | Ga0500634_0099122 | 3300053161 | Bacteria | 1462 |
| 1182 | Ga0500570_034372 | 3300053724 | Bacteria | 2709 |
| 1183 | Ga0500645_003945 | 3300053730 | Bacteria | 5843 |
| 1184 | Ga0500645_007534 | 3300053730 | Bacteria | 3780 |
| 1185 | Ga0500587_000079 | 3300053739 | Bacteria | 8123 |
| 1186 | Ga0500587_004174 | 3300053739 | Bacteria | 1995 |
| 1187 | Ga0500661_002024 | 3300055283 | Bacteria | 3826 |
| 1188 | Ga0590071_010060 | 3300059421 | Bacteria | 2214 |
| 1189 | Ga0587084_001004 | 3300059477 | Bacteria | 2522 |
| 1190 | Ga0587084_009376 | 3300059477 | Bacteria | 1263 |
| 1191 | Ga0587070_013470 | 3300059491 | Bacteria | 1262 |
| 1192 | Ga0587085_009626 | 3300059506 | Bacteria | 1263 |
| 1193 | Ga0587088_001114 | 3300059508 | Bacteria | 2664 |
| 1194 | Ga0587088_002489 | 3300059508 | Bacteria | 2105 |
| 1195 | Ga0587091_011847 | 3300059511 | Bacteria | 1369 |
| 1196 | Ga0587101_001771 | 3300059623 | Bacteria | 1933 |
| 1197 | Ga0587128_002004 | 3300059630 | Bacteria | 2049 |
| 1198 | Ga0587128_008413 | 3300059630 | Bacteria | 1333 |
| 1199 | Ga0587068_012091 | 3300059641 | Bacteria | 1313 |
| 1200 | Ga0587072_000066 | 3300059643 | Bacteria | 7689 |
| 1201 | Ga0587078_006703 | 3300059646 | Bacteria | 1256 |
| 1202 | Ga0587104_000185 | 3300059650 | Bacteria | 2218 |
| 1203 | Ga0466962_0002972 | 3300061719 | Bacteria | 8086 |
| 1204 | Ga0466962_0003937 | 3300061719 | Bacteria | 7106 |
| 1205 | Ga0466962_0029546 | 3300061719 | Bacteria | 2624 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046524 | Ga0495648_0057728 | Ga0495648_0057728_1256_2248 | 323 |
| 2 | 3300037471 | Ga0395905_0309042 | Ga0395905_0309042_434_1447 | 326 |
| 3 | iso_pu_bacteria | 2857537821 | 2857539084 | 330 |
| 4 | 3300048903 | Ga0496100_0018438 | Ga0496100_0018438_11_1051 | 336 |
| 5 | 3300038443 | Ga0395901_0236332 | Ga0395901_0236332_11_1060 | 341 |
| 6 | 3300050496 | nmdc:mga07m45_121182_c1 | nmdc:mga07m45_121182_c1_36_1085 | 341 |
| 7 | 3300025901 | Ga0207688_10076797 | Ga0207688_100767972 | 342 |
| 8 | 3300006042 | Ga0075368_10024443 | Ga0075368_100244432 | 345 |
| 9 | 3300006048 | Ga0075363_100035250 | Ga0075363_1000352501 | 345 |
| 10 | 3300006178 | Ga0075367_10037548 | Ga0075367_100375482 | 345 |
| 11 | 3300027866 | Ga0209813_10011416 | Ga0209813_100114161 | 345 |
| 12 | 3300050490 | nmdc:mga03n38_12124_c1 | nmdc:mga03n38_12124_c1_916_2148 | 345 |
| 13 | 3300050494 | nmdc:mga06z11_22303_c1 | nmdc:mga06z11_22303_c1_408_1640 | 345 |
| 14 | 3300042135 | Ga0450899_001250 | Ga0450899_001250_1576_2796 | 348 |
| 15 | 3300013307 | Ga0157372_10403426 | Ga0157372_104034262 | 351 |
| 16 | 3300050496 | nmdc:mga07m45_212767_c1 | nmdc:mga07m45_212767_c1_21_1109 | 351 |
| 17 | 3300049130 | Ga0501310_004561 | Ga0501310_004561_31_1227 | 355 |
| 18 | 3300046460 | Ga0495638_0010294 | Ga0495638_0010294_1145_2239 | 356 |
| 19 | 3300049575 | Ga0501039_0260047 | Ga0501039_0260047_26_1234 | 357 |
| 20 | 3300046539 | Ga0495621_0042373 | Ga0495621_0042373_30_1214 | 358 |
| 21 | 3300049568 | Ga0501031_0005466 | Ga0501031_0005466_1175_2383 | 359 |
| 22 | 3300049569 | Ga0501032_0004732 | Ga0501032_0004732_8203_9411 | 359 |
| 23 | 3300049571 | Ga0501034_0018726 | Ga0501034_0018726_385_1593 | 359 |
| 24 | 3300049572 | Ga0501036_0002318 | Ga0501036_0002318_767_1975 | 359 |
| 25 | 3300049573 | Ga0501037_0054613 | Ga0501037_0054613_1484_2692 | 359 |
| 26 | 3300049574 | Ga0501038_0003581 | Ga0501038_0003581_12109_13317 | 359 |
| 27 | 3300049581 | Ga0501047_0018196 | Ga0501047_0018196_4871_6079 | 359 |
| 28 | 3300049589 | Ga0501073_0032823 | Ga0501073_0032823_926_2134 | 359 |
| 29 | 3300049742 | Ga0501080_0007098 | Ga0501080_0007098_675_1883 | 359 |
| 30 | 3300049822 | Ga0501035_0001682 | Ga0501035_0001682_779_1987 | 359 |
| 31 | 3300049823 | Ga0501044_0170750 | Ga0501044_0170750_790_1998 | 359 |
| 32 | 3300049570 | Ga0501033_0150483 | Ga0501033_0150483_102_1310 | 360 |
| 33 | 3300005564 | Ga0070664_100004542 | Ga0070664_1000045424 | 361 |
| 34 | 3300005577 | Ga0068857_100164713 | Ga0068857_1001647131 | 361 |
| 35 | 3300049581 | Ga0501047_0110172 | Ga0501047_0110172_1511_2626 | 361 |
| 36 | 3300038735 | Ga0400485_21670 | Ga0400485_21670_25_1173 | 363 |
| 37 | iso_pu_bacteria | 2858950400 | 2858956091 | 363 |
| 38 | 3300044656 | Ga0466969_0001257 | Ga0466969_0001257_7593_8708 | 364 |
| 39 | 3300044659 | Ga0466973_0035278 | Ga0466973_0035278_2788_3903 | 364 |
| 40 | 3300044683 | Ga0466965_0008100 | Ga0466965_0008100_430_1545 | 364 |
| 41 | 3300044694 | Ga0466963_0002704 | Ga0466963_0002704_1979_3094 | 364 |
| 42 | 3300044719 | Ga0466971_0003452 | Ga0466971_0003452_5134_6249 | 364 |
| 43 | 3300044842 | Ga0466957_0012381 | Ga0466957_0012381_706_1821 | 364 |
| 44 | 3300045836 | Ga0466958_0008673 | Ga0466958_0008673_270_1385 | 364 |
| 45 | 3300025245 | Ga0207425_1000980 | Ga0207425_10009806 | 366 |
| 46 | 3300025258 | Ga0209129_1000043 | Ga0209129_1000043184 | 366 |
| 47 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014291 | 366 |
| 48 | 3300025297 | Ga0209758_1000093 | Ga0209758_100009334 | 366 |
| 49 | 3300031824 | Ga0307413_10097706 | Ga0307413_100977062 | 366 |
| 50 | 3300042156 | Ga0439446_0036617 | Ga0439446_0036617_48_1268 | 366 |
| 51 | 3300028794 | Ga0307515_10012418 | Ga0307515_100124181 | 367 |
| 52 | 3300046810 | Ga0495660_0149470 | Ga0495660_0149470_14_1141 | 367 |
| 53 | 3300050493 | nmdc:mga0k408_143498_c1 | nmdc:mga0k408_143498_c1_14_1141 | 367 |
| 54 | 3300053136 | Ga0500559_0034570 | Ga0500559_0034570_476_1690 | 367 |
| 55 | 3300027252 | Ga0209973_1000593 | Ga0209973_10005932 | 368 |
| 56 | 3300046519 | Ga0495632_0116303 | Ga0495632_0116303_14_1156 | 369 |
| 57 | 3300049571 | Ga0501034_0005422 | Ga0501034_0005422_343_1551 | 369 |
| 58 | 3300050493 | nmdc:mga0k408_196527_c1 | nmdc:mga0k408_196527_c1_50_1192 | 369 |
| 59 | iso_pu_bacteria | 2843690924 | 2843691986 | 369 |
| 60 | 3300031727 | Ga0316576_10008990 | Ga0316576_100089902 | 370 |
| 61 | 3300031728 | Ga0316578_10024622 | Ga0316578_100246222 | 370 |
| 62 | 3300032168 | Ga0316593_10028412 | Ga0316593_100284121 | 370 |
| 63 | 3300033528 | Ga0316588_1001260 | Ga0316588_10012603 | 370 |
| 64 | 3300033529 | Ga0316587_1010530 | Ga0316587_10105301 | 370 |
| 65 | 3300033541 | Ga0316596_1021026 | Ga0316596_10210261 | 370 |
| 66 | 3300036647 | Ga0316582_0034544 | Ga0316582_0034544_606_1793 | 370 |
| 67 | 3300036712 | Ga0316584_0006067 | Ga0316584_0006067_3805_4992 | 370 |
| 68 | 3300002704 | JGI25155J39150_1000053 | JGI25155J39150_100005325 | 371 |
| 69 | 3300002705 | JGI25156J39149_1000045 | JGI25156J39149_100004544 | 371 |
| 70 | 3300002738 | JGI25154J39366_1000064 | JGI25154J39366_100006455 | 371 |
| 71 | 3300002741 | JGI25157J39369_1000063 | JGI25157J39369_100006355 | 371 |
| 72 | 3300002774 | JGI25150J39212_1003417 | JGI25150J39212_10034172 | 371 |
| 73 | 3300002774 | JGI25150J39212_1005429 | JGI25150J39212_10054292 | 371 |
| 74 | 3300002987 | JGI25159J45721_1000581 | JGI25159J45721_10005811 | 371 |
| 75 | 3300002987 | JGI25159J45721_1002137 | JGI25159J45721_10021372 | 371 |
| 76 | 3300003187 | JGI25151J46595_10016821 | JGI25151J46595_100168212 | 371 |
| 77 | 3300003354 | JGI25160J50197_1000517 | JGI25160J50197_100051713 | 371 |
| 78 | 3300003374 | JGI25161J50226_1000081 | JGI25161J50226_100008125 | 371 |
| 79 | 3300003771 | Ga0055526_1017809 | Ga0055526_10178091 | 371 |
| 80 | 3300003773 | Ga0055537_1000430 | Ga0055537_100043027 | 371 |
| 81 | 3300003773 | Ga0055537_1006949 | Ga0055537_10069491 | 371 |
| 82 | 3300003775 | Ga0055524_1000114 | Ga0055524_10001148 | 371 |
| 83 | 3300003784 | Ga0055534_1000972 | Ga0055534_10009726 | 371 |
| 84 | 3300003790 | Ga0055528_1000405 | Ga0055528_100040522 | 371 |
| 85 | 3300003791 | Ga0055530_10000317 | Ga0055530_1000031710 | 371 |
| 86 | 3300003792 | Ga0055540_1000153 | Ga0055540_100015350 | 371 |
| 87 | 3300003794 | Ga0055531_10002088 | Ga0055531_100020881 | 371 |
| 88 | 3300004625 | Ga0055543_1000291 | Ga0055543_10002917 | 371 |
| 89 | 3300005262 | Ga0065165_1005595 | Ga0065165_10055955 | 371 |
| 90 | 3300005262 | Ga0065165_1007565 | Ga0065165_10075654 | 371 |
| 91 | 3300005468 | Ga0070707_100175277 | Ga0070707_1001752771 | 371 |
| 92 | 3300006058 | Ga0075432_10034745 | Ga0075432_100347451 | 371 |
| 93 | 3300006353 | Ga0075370_10014707 | Ga0075370_100147073 | 371 |
| 94 | 3300025206 | Ga0209435_100003 | Ga0209435_100003557 | 371 |
| 95 | 3300025245 | Ga0207425_1003726 | Ga0207425_10037262 | 371 |
| 96 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008557 | 371 |
| 97 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007557 | 371 |
| 98 | 3300025256 | Ga0209759_1000019 | Ga0209759_1000019278 | 371 |
| 99 | 3300025263 | Ga0209565_1000043 | Ga0209565_1000043113 | 371 |
| 100 | 3300025263 | Ga0209565_1007343 | Ga0209565_10073432 | 371 |
| 101 | 3300025273 | Ga0209673_1000008 | Ga0209673_1000008340 | 371 |
| 102 | 3300025284 | Ga0209130_1000110 | Ga0209130_100011061 | 371 |
| 103 | 3300025284 | Ga0209130_1000569 | Ga0209130_10005692 | 371 |
| 104 | 3300025291 | Ga0209675_1000170 | Ga0209675_10001702 | 371 |
| 105 | 3300025291 | Ga0209675_1005411 | Ga0209675_10054115 | 371 |
| 106 | 3300025292 | Ga0209676_1000023 | Ga0209676_100002393 | 371 |
| 107 | 3300025292 | Ga0209676_1001380 | Ga0209676_10013808 | 371 |
| 108 | 3300025294 | Ga0209025_1006727 | Ga0209025_10067278 | 371 |
| 109 | 3300025294 | Ga0209025_1007832 | Ga0209025_10078322 | 371 |
| 110 | 3300025294 | Ga0209025_1009058 | Ga0209025_10090582 | 371 |
| 111 | 3300025295 | Ga0209564_1001847 | Ga0209564_10018472 | 371 |
| 112 | 3300025297 | Ga0209758_1017887 | Ga0209758_10178872 | 371 |
| 113 | 3300025298 | Ga0209050_1000022 | Ga0209050_100002275 | 371 |
| 114 | 3300025298 | Ga0209050_1016557 | Ga0209050_10165572 | 371 |
| 115 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011561 | 371 |
| 116 | 3300025302 | Ga0207426_1000117 | Ga0207426_1000117139 | 371 |
| 117 | 3300025302 | Ga0207426_1001160 | Ga0207426_100116020 | 371 |
| 118 | 3300025303 | Ga0209051_1000013 | Ga0209051_100001375 | 371 |
| 119 | 3300025304 | Ga0209257_1000042 | Ga0209257_1000042411 | 371 |
| 120 | 3300026041 | Ga0207639_10061438 | Ga0207639_100614381 | 371 |
| 121 | 3300031456 | Ga0307513_10000020 | Ga0307513_10000020145 | 371 |
| 122 | 3300042876 | Ga0451577_0018493 | Ga0451577_0018493_2720_3943 | 371 |
| 123 | 3300046472 | Ga0495580_0025643 | Ga0495580_0025643_2691_3902 | 371 |
| 124 | 3300046473 | Ga0495582_0003250 | Ga0495582_0003250_4260_5471 | 371 |
| 125 | 3300046499 | Ga0495594_0024776 | Ga0495594_0024776_558_1769 | 371 |
| 126 | 3300046526 | Ga0495666_0013084 | Ga0495666_0013084_1335_2546 | 371 |
| 127 | 3300046533 | Ga0495640_0154113 | Ga0495640_0154113_155_1366 | 371 |
| 128 | 3300046536 | Ga0495587_0019463 | Ga0495587_0019463_1046_2257 | 371 |
| 129 | 3300046642 | Ga0495634_0008231 | Ga0495634_0008231_82_1293 | 371 |
| 130 | 3300046809 | Ga0495600_0027348 | Ga0495600_0027348_2102_3313 | 371 |
| 131 | 3300047317 | Ga0495604_0010562 | Ga0495604_0010562_4775_5986 | 371 |
| 132 | 3300047444 | Ga0495675_0005883 | Ga0495675_0005883_5925_7136 | 371 |
| 133 | 3300048088 | Ga0495602_0003834 | Ga0495602_0003834_6832_8043 | 371 |
| 134 | 3300053088 | Ga0500644_0001410 | Ga0500644_0001410_2807_4006 | 371 |
| 135 | 3300053117 | Ga0500593_000810 | Ga0500593_000810_6628_7827 | 371 |
| 136 | 3300053730 | Ga0500645_003945 | Ga0500645_003945_3983_5182 | 371 |
| 137 | 3300031456 | Ga0307513_10000129 | Ga0307513_1000012915 | 372 |
| 138 | 3300053093 | Ga0500651_0042015 | Ga0500651_0042015_1129_2328 | 372 |
| 139 | 3300055283 | Ga0500661_002024 | Ga0500661_002024_1632_2831 | 372 |
| 140 | 3300025910 | Ga0207684_10001414 | Ga0207684_1000141410 | 373 |
| 141 | 3300046665 | Ga0495661_0000622 | Ga0495661_0000622_23107_24294 | 373 |
| 142 | 3300021361 | Ga0213872_10000129 | Ga0213872_100001299 | 374 |
| 143 | 3300039447 | Ga0436361_0355769 | Ga0436361_0355769_2976_4202 | 374 |
| 144 | 3300039447 | Ga0436361_0362312 | Ga0436361_0362312_7347_8573 | 374 |
| 145 | 3300049571 | Ga0501034_0020618 | Ga0501034_0020618_180_1340 | 374 |
| 146 | 3300003794 | Ga0055531_10000314 | Ga0055531_100003143 | 375 |
| 147 | 3300025298 | Ga0209050_1004630 | Ga0209050_10046305 | 375 |
| 148 | 3300025303 | Ga0209051_1004966 | Ga0209051_10049668 | 375 |
| 149 | 3300025304 | Ga0209257_1000017 | Ga0209257_1000017570 | 375 |
| 150 | 3300031901 | Ga0307406_10004722 | Ga0307406_100047225 | 375 |
| 151 | 3300049822 | Ga0501035_0006696 | Ga0501035_0006696_4510_5727 | 375 |
| 152 | 3300049823 | Ga0501044_0032540 | Ga0501044_0032540_2458_3675 | 375 |
| 153 | iso_pu_bacteria | 2547132103 | 2547376117 | 375 |
| 154 | iso_pu_bacteria | 2846037992 | 2846040415 | 375 |
| 155 | iso_pu_bacteria | 2998344455 | 2998346302 | 375 |
| 156 | 3300031250 | Ga0265331_10011350 | Ga0265331_100113501 | 376 |
| 157 | 3300005618 | Ga0068864_100220720 | Ga0068864_1002207201 | 377 |
| 158 | 3300025903 | Ga0207680_10126225 | Ga0207680_101262252 | 378 |
| 159 | 3300005355 | Ga0070671_100042594 | Ga0070671_1000425942 | 379 |
| 160 | 3300005459 | Ga0068867_100003928 | Ga0068867_1000039289 | 379 |
| 161 | 3300006051 | Ga0075364_10018465 | Ga0075364_100184653 | 379 |
| 162 | 3300013308 | Ga0157375_10084511 | Ga0157375_100845112 | 379 |
| 163 | 3300025926 | Ga0207659_10003471 | Ga0207659_100034718 | 379 |
| 164 | 3300025931 | Ga0207644_10062850 | Ga0207644_100628504 | 379 |
| 165 | 3300025940 | Ga0207691_10005462 | Ga0207691_1000546211 | 379 |
| 166 | 3300025942 | Ga0207689_10022772 | Ga0207689_100227724 | 379 |
| 167 | 3300025960 | Ga0207651_10027991 | Ga0207651_100279913 | 379 |
| 168 | 3300026089 | Ga0207648_10013431 | Ga0207648_100134314 | 379 |
| 169 | 3300026116 | Ga0207674_10012238 | Ga0207674_100122385 | 379 |
| 170 | 3300050493 | nmdc:mga0k408_15212_c1 | nmdc:mga0k408_15212_c1_2536_3759 | 379 |
| 171 | 3300006051 | Ga0075364_10015326 | Ga0075364_100153261 | 380 |
| 172 | 3300006195 | Ga0075366_10017339 | Ga0075366_100173392 | 380 |
| 173 | 3300006195 | Ga0075366_10079412 | Ga0075366_100794122 | 380 |
| 174 | 3300006353 | Ga0075370_10000742 | Ga0075370_100007427 | 380 |
| 175 | 3300035695 | Ga0373927_0201911 | Ga0373927_0201911_79_1263 | 380 |
| 176 | 3300037312 | Ga0395899_0102242 | Ga0395899_0102242_506_1711 | 380 |
| 177 | 3300050491 | nmdc:mga00v17_12094_c1 | nmdc:mga00v17_12094_c1_97_1281 | 380 |
| 178 | 3300050493 | nmdc:mga0k408_22699_c1 | nmdc:mga0k408_22699_c1_1796_2989 | 380 |
| 179 | 3300050496 | nmdc:mga07m45_13425_c1 | nmdc:mga07m45_13425_c1_2158_3351 | 380 |
| 180 | iso_pu_bacteria | 2839138175 | 2839142611 | 380 |
| 181 | 3300031691 | Ga0316579_10002053 | Ga0316579_100020537 | 381 |
| 182 | 3300031727 | Ga0316576_10113349 | Ga0316576_101133492 | 381 |
| 183 | 3300031728 | Ga0316578_10038197 | Ga0316578_100381971 | 381 |
| 184 | 3300032168 | Ga0316593_10033310 | Ga0316593_100333102 | 381 |
| 185 | 3300033524 | Ga0316592_1005500 | Ga0316592_10055002 | 381 |
| 186 | 3300033524 | Ga0316592_1024929 | Ga0316592_10249291 | 381 |
| 187 | 3300033528 | Ga0316588_1005901 | Ga0316588_10059014 | 381 |
| 188 | 3300036712 | Ga0316584_0074349 | Ga0316584_0074349_408_1598 | 381 |
| 189 | 3300045051 | Ga0451576_0006156 | Ga0451576_0006156_12273_13463 | 381 |
| 190 | 3300006038 | Ga0075365_10000227 | Ga0075365_1000022714 | 382 |
| 191 | 3300006048 | Ga0075363_100004105 | Ga0075363_1000041055 | 382 |
| 192 | 3300006051 | Ga0075364_10001197 | Ga0075364_1000119711 | 382 |
| 193 | 3300006178 | Ga0075367_10001265 | Ga0075367_1000126511 | 382 |
| 194 | 3300006186 | Ga0075369_10000060 | Ga0075369_100000608 | 382 |
| 195 | 3300006194 | Ga0075427_10000023 | Ga0075427_100000235 | 382 |
| 196 | 3300006353 | Ga0075370_10000066 | Ga0075370_1000006618 | 382 |
| 197 | 3300031238 | Ga0265332_10000020 | Ga0265332_1000002078 | 382 |
| 198 | 3300042007 | Ga0439449_0000947 | Ga0439449_0000947_6524_7738 | 382 |
| 199 | 3300049823 | Ga0501044_0007167 | Ga0501044_0007167_9506_10684 | 382 |
| 200 | 3300050490 | nmdc:mga03n38_61_c1 | nmdc:mga03n38_61_c1_10372_11559 | 382 |
| 201 | 3300050491 | nmdc:mga00v17_146_c1 | nmdc:mga00v17_146_c1_23887_25074 | 382 |
| 202 | 3300050491 | nmdc:mga00v17_505_c1 | nmdc:mga00v17_505_c1_13568_14755 | 382 |
| 203 | 3300050492 | nmdc:mga0yw44_57_c1 | nmdc:mga0yw44_57_c1_21601_22788 | 382 |
| 204 | 3300050494 | nmdc:mga06z11_105_c1 | nmdc:mga06z11_105_c1_24064_25251 | 382 |
| 205 | 3300050494 | nmdc:mga06z11_6455_c1 | nmdc:mga06z11_6455_c1_243_1430 | 382 |
| 206 | 3300050496 | nmdc:mga07m45_142667_c1 | nmdc:mga07m45_142667_c1_154_1341 | 382 |
| 207 | 3300050496 | nmdc:mga07m45_66_c1 | nmdc:mga07m45_66_c1_23865_25052 | 382 |
| 208 | 3300050516 | nmdc:mga0sz30_118_c1 | nmdc:mga0sz30_118_c1_15789_16976 | 382 |
| 209 | 3300005563 | Ga0068855_100041043 | Ga0068855_1000410434 | 383 |
| 210 | 3300025949 | Ga0207667_10046059 | Ga0207667_100460594 | 383 |
| 211 | 3300045049 | Ga0466959_0023408 | Ga0466959_0023408_2403_3569 | 383 |
| 212 | 3300050493 | nmdc:mga0k408_28295_c1 | nmdc:mga0k408_28295_c1_1533_2744 | 383 |
| 213 | 3300006038 | Ga0075365_10002710 | Ga0075365_100027105 | 384 |
| 214 | 3300006195 | Ga0075366_10023387 | Ga0075366_100233873 | 384 |
| 215 | 3300009176 | Ga0105242_10000485 | Ga0105242_1000048512 | 384 |
| 216 | 3300021361 | Ga0213872_10000411 | Ga0213872_100004112 | 384 |
| 217 | 3300021361 | Ga0213872_10009020 | Ga0213872_100090204 | 384 |
| 218 | 3300039447 | Ga0436361_0255861 | Ga0436361_0255861_47328_48524 | 384 |
| 219 | 3300048924 | Ga0496121_0000012 | Ga0496121_0000012_444107_445294 | 384 |
| 220 | 3300050492 | nmdc:mga0yw44_275_c1 | nmdc:mga0yw44_275_c1_8743_9930 | 384 |
| 221 | 3300050516 | nmdc:mga0sz30_34430_c1 | nmdc:mga0sz30_34430_c1_197_1384 | 384 |
| 222 | 3300059630 | Ga0587128_002004 | Ga0587128_002004_528_1736 | 384 |
| 223 | iso_pu_bacteria | 2599185292 | 2599904959 | 384 |
| 224 | iso_pu_bacteria | 2643221569 | 2643860404 | 384 |
| 225 | iso_pu_bacteria | 2643221594 | 2643981740 | 384 |
| 226 | iso_pu_bacteria | 2643221621 | 2644119860 | 384 |
| 227 | iso_pu_bacteria | 2808606395 | 2809035644 | 384 |
| 228 | iso_pu_bacteria | 2855730933 | 2855732529 | 384 |
| 229 | iso_pu_bacteria | 2855767633 | 2855769237 | 384 |
| 230 | iso_pu_bacteria | 2881927736 | 2881928119 | 384 |
| 231 | iso_pu_bacteria | 2887375801 | 2887379238 | 384 |
| 232 | iso_pu_bacteria | 2928084124 | 2928086878 | 384 |
| 233 | iso_pu_bacteria | 2941479691 | 2941483874 | 384 |
| 234 | 3300005458 | Ga0070681_10019572 | Ga0070681_100195725 | 385 |
| 235 | 3300009551 | Ga0105238_10128869 | Ga0105238_101288691 | 385 |
| 236 | 3300013100 | Ga0157373_10123000 | Ga0157373_101230001 | 385 |
| 237 | 3300013104 | Ga0157370_10007697 | Ga0157370_100076972 | 385 |
| 238 | 3300021361 | Ga0213872_10010720 | Ga0213872_100107203 | 385 |
| 239 | 3300039447 | Ga0436361_0393109 | Ga0436361_0393109_1104_2309 | 385 |
| 240 | 3300049586 | Ga0501070_0003847 | Ga0501070_0003847_1504_2700 | 385 |
| 241 | 3300049588 | Ga0501072_0059851 | Ga0501072_0059851_470_1666 | 385 |
| 242 | 3300049589 | Ga0501073_0029410 | Ga0501073_0029410_1526_2722 | 385 |
| 243 | 3300049590 | Ga0501074_0134826 | Ga0501074_0134826_108_1304 | 385 |
| 244 | 3300049744 | Ga0501083_0025700 | Ga0501083_0025700_2451_3647 | 385 |
| 245 | iso_pu_bacteria | 2857542790 | 2857546935 | 385 |
| 246 | iso_pu_bacteria | 2881412998 | 2881414871 | 385 |
| 247 | 3300006358 | Ga0068871_100090123 | Ga0068871_1000901232 | 386 |
| 248 | 3300044683 | Ga0466965_0097482 | Ga0466965_0097482_221_1435 | 386 |
| 249 | iso_pu_bacteria | 2511231002 | 2511242903 | 386 |
| 250 | 3300005328 | Ga0070676_10162578 | Ga0070676_101625781 | 387 |
| 251 | 3300005355 | Ga0070671_100106280 | Ga0070671_1001062802 | 387 |
| 252 | 3300005617 | Ga0068859_100060955 | Ga0068859_1000609553 | 387 |
| 253 | 3300006931 | Ga0097620_100060960 | Ga0097620_1000609603 | 387 |
| 254 | 3300025931 | Ga0207644_10050485 | Ga0207644_100504853 | 387 |
| 255 | 3300026095 | Ga0207676_10187259 | Ga0207676_101872592 | 387 |
| 256 | 3300048915 | Ga0496112_0008823 | Ga0496112_0008823_3101_4315 | 387 |
| 257 | 3300048915 | Ga0496112_0260384 | Ga0496112_0260384_182_1393 | 387 |
| 258 | iso_pu_bacteria | 2596583598 | 2597029785 | 387 |
| 259 | iso_pu_bacteria | 2599185178 | 2599446772 | 387 |
| 260 | iso_pu_bacteria | 2885266251 | 2885267795 | 387 |
| 261 | iso_pu_bacteria | 2900577576 | 2900577623 | 387 |
| 262 | iso_pu_bacteria | 2928058823 | 2928061791 | 387 |
| 263 | 3300003187 | JGI25151J46595_10001460 | JGI25151J46595_1000146011 | 388 |
| 264 | 3300006051 | Ga0075364_10018914 | Ga0075364_100189142 | 388 |
| 265 | 3300009551 | Ga0105238_10044057 | Ga0105238_100440572 | 388 |
| 266 | 3300025284 | Ga0209130_1001087 | Ga0209130_10010877 | 388 |
| 267 | 3300025292 | Ga0209676_1005823 | Ga0209676_10058231 | 388 |
| 268 | 3300025294 | Ga0209025_1000057 | Ga0209025_1000057204 | 388 |
| 269 | 3300025294 | Ga0209025_1023858 | Ga0209025_10238583 | 388 |
| 270 | 3300025298 | Ga0209050_1025076 | Ga0209050_10250762 | 388 |
| 271 | 3300025303 | Ga0209051_1037497 | Ga0209051_10374972 | 388 |
| 272 | 3300031239 | Ga0265328_10018418 | Ga0265328_100184183 | 388 |
| 273 | 3300031250 | Ga0265331_10004933 | Ga0265331_100049333 | 388 |
| 274 | 3300031251 | Ga0265327_10000144 | Ga0265327_1000014412 | 388 |
| 275 | 3300031548 | Ga0307408_100000086 | Ga0307408_10000008622 | 388 |
| 276 | 3300035114 | Ga0373939_0000004 | Ga0373939_0000004_5168_6379 | 388 |
| 277 | 3300035121 | Ga0373960_0006404 | Ga0373960_0006404_348_1559 | 388 |
| 278 | 3300035691 | Ga0373931_0000140 | Ga0373931_0000140_8466_9677 | 388 |
| 279 | 3300037471 | Ga0395905_0000777 | Ga0395905_0000777_36546_37757 | 388 |
| 280 | 3300045051 | Ga0451576_0058191 | Ga0451576_0058191_403_1614 | 388 |
| 281 | 3300045051 | Ga0451576_0137794 | Ga0451576_0137794_1056_2267 | 388 |
| 282 | 3300048919 | Ga0496116_0009604 | Ga0496116_0009604_3041_4249 | 388 |
| 283 | 3300048919 | Ga0496116_0015236 | Ga0496116_0015236_379_1587 | 388 |
| 284 | 3300048921 | Ga0496118_0006180 | Ga0496118_0006180_9473_10681 | 388 |
| 285 | 3300048922 | Ga0496119_0018064 | Ga0496119_0018064_2477_3685 | 388 |
| 286 | 3300048923 | Ga0496120_0017510 | Ga0496120_0017510_2854_4062 | 388 |
| 287 | 3300048924 | Ga0496121_0000568 | Ga0496121_0000568_101_1309 | 388 |
| 288 | 3300048925 | Ga0496122_0000329 | Ga0496122_0000329_43309_44517 | 388 |
| 289 | 3300048926 | Ga0496123_0000260 | Ga0496123_0000260_45411_46619 | 388 |
| 290 | 3300048927 | Ga0496124_0051122 | Ga0496124_0051122_284_1492 | 388 |
| 291 | 3300048928 | Ga0496125_0000105 | Ga0496125_0000105_14316_15524 | 388 |
| 292 | 3300048928 | Ga0496125_0042518 | Ga0496125_0042518_94_1302 | 388 |
| 293 | 3300048928 | Ga0496125_0076766 | Ga0496125_0076766_1357_2565 | 388 |
| 294 | 3300048929 | Ga0496126_0248983 | Ga0496126_0248983_207_1415 | 388 |
| 295 | 3300049823 | Ga0501044_0014188 | Ga0501044_0014188_2203_3411 | 388 |
| 296 | iso_pu_bacteria | 2643221544 | 2643745715 | 388 |
| 297 | iso_pu_bacteria | 2738541337 | 2739058606 | 388 |
| 298 | iso_pu_bacteria | 2831864461 | 2831870103 | 388 |
| 299 | 3300003374 | JGI25161J50226_1001581 | JGI25161J50226_10015817 | 389 |
| 300 | 3300003578 | Ga0006562J51391_1011363 | Ga0006562J51391_10113637 | 389 |
| 301 | 3300003578 | Ga0006562J51391_1011704 | Ga0006562J51391_10117041 | 389 |
| 302 | 3300003759 | Ga0055525_1000011 | Ga0055525_1000011425 | 389 |
| 303 | 3300003759 | Ga0055525_1000046 | Ga0055525_100004613 | 389 |
| 304 | 3300003761 | Ga0055535_1000142 | Ga0055535_100014242 | 389 |
| 305 | 3300003762 | Ga0055542_1000022 | Ga0055542_1000022189 | 389 |
| 306 | 3300003773 | Ga0055537_1002108 | Ga0055537_10021087 | 389 |
| 307 | 3300003773 | Ga0055537_1004361 | Ga0055537_10043612 | 389 |
| 308 | 3300003781 | Ga0055536_1011706 | Ga0055536_10117061 | 389 |
| 309 | 3300003784 | Ga0055534_1000963 | Ga0055534_100096313 | 389 |
| 310 | 3300003790 | Ga0055528_1002010 | Ga0055528_10020101 | 389 |
| 311 | 3300003790 | Ga0055528_1014951 | Ga0055528_10149512 | 389 |
| 312 | 3300003791 | Ga0055530_10004544 | Ga0055530_100045447 | 389 |
| 313 | 3300003791 | Ga0055530_10004603 | Ga0055530_100046037 | 389 |
| 314 | 3300003792 | Ga0055540_1003508 | Ga0055540_10035088 | 389 |
| 315 | 3300003792 | Ga0055540_1003949 | Ga0055540_10039491 | 389 |
| 316 | 3300003792 | Ga0055540_1019060 | Ga0055540_10190602 | 389 |
| 317 | 3300003794 | Ga0055531_10000493 | Ga0055531_1000049322 | 389 |
| 318 | 3300004785 | Ga0058858_1433317 | Ga0058858_14333171 | 389 |
| 319 | 3300004798 | Ga0058859_10135176 | Ga0058859_101351761 | 389 |
| 320 | 3300005289 | Ga0065704_10079392 | Ga0065704_100793922 | 389 |
| 321 | 3300005289 | Ga0065704_10135769 | Ga0065704_101357691 | 389 |
| 322 | 3300005327 | Ga0070658_10042765 | Ga0070658_100427654 | 389 |
| 323 | 3300005338 | Ga0068868_100045277 | Ga0068868_1000452773 | 389 |
| 324 | 3300005354 | Ga0070675_100271986 | Ga0070675_1002719861 | 389 |
| 325 | 3300005366 | Ga0070659_100003171 | Ga0070659_1000031712 | 389 |
| 326 | 3300005367 | Ga0070667_100081311 | Ga0070667_1000813114 | 389 |
| 327 | 3300005456 | Ga0070678_100017957 | Ga0070678_1000179575 | 389 |
| 328 | 3300005530 | Ga0070679_100179178 | Ga0070679_1001791781 | 389 |
| 329 | 3300005548 | Ga0070665_100108615 | Ga0070665_1001086154 | 389 |
| 330 | 3300005548 | Ga0070665_100112005 | Ga0070665_1001120051 | 389 |
| 331 | 3300006038 | Ga0075365_10003284 | Ga0075365_1000328410 | 389 |
| 332 | 3300006042 | Ga0075368_10014400 | Ga0075368_100144004 | 389 |
| 333 | 3300006051 | Ga0075364_10003065 | Ga0075364_100030654 | 389 |
| 334 | 3300006051 | Ga0075364_10007708 | Ga0075364_100077081 | 389 |
| 335 | 3300006051 | Ga0075364_10026882 | Ga0075364_100268823 | 389 |
| 336 | 3300006177 | Ga0075362_10027844 | Ga0075362_100278444 | 389 |
| 337 | 3300006177 | Ga0075362_10083585 | Ga0075362_100835852 | 389 |
| 338 | 3300006178 | Ga0075367_10037556 | Ga0075367_100375562 | 389 |
| 339 | 3300006195 | Ga0075366_10016779 | Ga0075366_100167795 | 389 |
| 340 | 3300006195 | Ga0075366_10022612 | Ga0075366_100226123 | 389 |
| 341 | 3300006195 | Ga0075366_10093416 | Ga0075366_100934162 | 389 |
| 342 | 3300006195 | Ga0075366_10120475 | Ga0075366_101204752 | 389 |
| 343 | 3300006353 | Ga0075370_10010506 | Ga0075370_100105065 | 389 |
| 344 | 3300006353 | Ga0075370_10028371 | Ga0075370_100283711 | 389 |
| 345 | 3300006353 | Ga0075370_10029346 | Ga0075370_100293462 | 389 |
| 346 | 3300006353 | Ga0075370_10032406 | Ga0075370_100324062 | 389 |
| 347 | 3300006353 | Ga0075370_10042707 | Ga0075370_100427072 | 389 |
| 348 | 3300006353 | Ga0075370_10067354 | Ga0075370_100673542 | 389 |
| 349 | 3300006353 | Ga0075370_10067965 | Ga0075370_100679652 | 389 |
| 350 | 3300006353 | Ga0075370_10088870 | Ga0075370_100888702 | 389 |
| 351 | 3300006846 | Ga0075430_100083106 | Ga0075430_1000831062 | 389 |
| 352 | 3300006948 | Ga0099826_10005550 | Ga0099826_100055509 | 389 |
| 353 | 3300009093 | Ga0105240_10005483 | Ga0105240_100054839 | 389 |
| 354 | 3300009148 | Ga0105243_10010351 | Ga0105243_100103517 | 389 |
| 355 | 3300009148 | Ga0105243_10020161 | Ga0105243_100201612 | 389 |
| 356 | 3300009177 | Ga0105248_10072326 | Ga0105248_100723262 | 389 |
| 357 | 3300009177 | Ga0105248_10408599 | Ga0105248_104085992 | 389 |
| 358 | 3300009545 | Ga0105237_10174704 | Ga0105237_101747042 | 389 |
| 359 | 3300009551 | Ga0105238_10017534 | Ga0105238_100175346 | 389 |
| 360 | 3300010375 | Ga0105239_10182747 | Ga0105239_101827472 | 389 |
| 361 | 3300010375 | Ga0105239_10528229 | Ga0105239_105282291 | 389 |
| 362 | 3300012502 | Ga0157347_1000854 | Ga0157347_10008542 | 389 |
| 363 | 3300013100 | Ga0157373_10067144 | Ga0157373_100671442 | 389 |
| 364 | 3300013100 | Ga0157373_10085739 | Ga0157373_100857392 | 389 |
| 365 | 3300013102 | Ga0157371_10047817 | Ga0157371_100478172 | 389 |
| 366 | 3300013104 | Ga0157370_10014694 | Ga0157370_100146948 | 389 |
| 367 | 3300013105 | Ga0157369_10011577 | Ga0157369_100115777 | 389 |
| 368 | 3300013307 | Ga0157372_10132393 | Ga0157372_101323934 | 389 |
| 369 | 3300014497 | Ga0182008_10000215 | Ga0182008_1000021537 | 389 |
| 370 | 3300014497 | Ga0182008_10010204 | Ga0182008_100102042 | 389 |
| 371 | 3300014497 | Ga0182008_10043605 | Ga0182008_100436052 | 389 |
| 372 | 3300014497 | Ga0182008_10073062 | Ga0182008_100730622 | 389 |
| 373 | 3300014969 | Ga0157376_10018648 | Ga0157376_100186482 | 389 |
| 374 | 3300015261 | Ga0182006_1008804 | Ga0182006_10088042 | 389 |
| 375 | 3300015261 | Ga0182006_1026968 | Ga0182006_10269682 | 389 |
| 376 | 3300015262 | Ga0182007_10003586 | Ga0182007_100035867 | 389 |
| 377 | 3300015683 | Ga0183362_10005 | Ga0183362_10005400 | 389 |
| 378 | 3300017792 | Ga0163161_10000849 | Ga0163161_100008492 | 389 |
| 379 | 3300017792 | Ga0163161_10066787 | Ga0163161_100667871 | 389 |
| 380 | 3300017792 | Ga0163161_10094501 | Ga0163161_100945012 | 389 |
| 381 | 3300020077 | Ga0206351_10216415 | Ga0206351_102164151 | 389 |
| 382 | 3300021361 | Ga0213872_10000003 | Ga0213872_10000003278 | 389 |
| 383 | 3300021361 | Ga0213872_10000042 | Ga0213872_1000004218 | 389 |
| 384 | 3300021361 | Ga0213872_10000351 | Ga0213872_100003519 | 389 |
| 385 | 3300021361 | Ga0213872_10026271 | Ga0213872_100262713 | 389 |
| 386 | 3300025228 | Ga0209672_100689 | Ga0209672_1006898 | 389 |
| 387 | 3300025229 | Ga0209147_100794 | Ga0209147_1007943 | 389 |
| 388 | 3300025230 | Ga0209563_100005 | Ga0209563_100005751 | 389 |
| 389 | 3300025242 | Ga0209258_100009 | Ga0209258_100009852 | 389 |
| 390 | 3300025245 | Ga0207425_1002133 | Ga0207425_10021337 | 389 |
| 391 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007852 | 389 |
| 392 | 3300025258 | Ga0209129_1000024 | Ga0209129_1000024219 | 389 |
| 393 | 3300025258 | Ga0209129_1015583 | Ga0209129_10155832 | 389 |
| 394 | 3300025263 | Ga0209565_1000046 | Ga0209565_1000046156 | 389 |
| 395 | 3300025263 | Ga0209565_1001386 | Ga0209565_10013862 | 389 |
| 396 | 3300025273 | Ga0209673_1000058 | Ga0209673_100005862 | 389 |
| 397 | 3300025273 | Ga0209673_1000615 | Ga0209673_100061547 | 389 |
| 398 | 3300025273 | Ga0209673_1002626 | Ga0209673_10026267 | 389 |
| 399 | 3300025273 | Ga0209673_1040023 | Ga0209673_10400231 | 389 |
| 400 | 3300025284 | Ga0209130_1001597 | Ga0209130_10015978 | 389 |
| 401 | 3300025284 | Ga0209130_1002030 | Ga0209130_10020306 | 389 |
| 402 | 3300025291 | Ga0209675_1000010 | Ga0209675_1000010203 | 389 |
| 403 | 3300025291 | Ga0209675_1003361 | Ga0209675_10033613 | 389 |
| 404 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028120 | 389 |
| 405 | 3300025292 | Ga0209676_1000098 | Ga0209676_1000098170 | 389 |
| 406 | 3300025292 | Ga0209676_1000194 | Ga0209676_100019413 | 389 |
| 407 | 3300025292 | Ga0209676_1001840 | Ga0209676_100184017 | 389 |
| 408 | 3300025294 | Ga0209025_1000272 | Ga0209025_10002722 | 389 |
| 409 | 3300025294 | Ga0209025_1000289 | Ga0209025_10002892 | 389 |
| 410 | 3300025294 | Ga0209025_1042040 | Ga0209025_10420402 | 389 |
| 411 | 3300025294 | Ga0209025_1042382 | Ga0209025_10423822 | 389 |
| 412 | 3300025294 | Ga0209025_1046041 | Ga0209025_10460413 | 389 |
| 413 | 3300025295 | Ga0209564_1000183 | Ga0209564_1000183119 | 389 |
| 414 | 3300025295 | Ga0209564_1000198 | Ga0209564_1000198109 | 389 |
| 415 | 3300025297 | Ga0209758_1000049 | Ga0209758_1000049138 | 389 |
| 416 | 3300025297 | Ga0209758_1000204 | Ga0209758_1000204116 | 389 |
| 417 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002123 | 389 |
| 418 | 3300025298 | Ga0209050_1000122 | Ga0209050_1000122111 | 389 |
| 419 | 3300025298 | Ga0209050_1000895 | Ga0209050_100089536 | 389 |
| 420 | 3300025299 | Ga0209256_1000098 | Ga0209256_1000098184 | 389 |
| 421 | 3300025299 | Ga0209256_1000140 | Ga0209256_1000140119 | 389 |
| 422 | 3300025302 | Ga0207426_1000038 | Ga0207426_1000038184 | 389 |
| 423 | 3300025302 | Ga0207426_1000053 | Ga0207426_1000053174 | 389 |
| 424 | 3300025303 | Ga0209051_1000015 | Ga0209051_100001549 | 389 |
| 425 | 3300025303 | Ga0209051_1000168 | Ga0209051_1000168116 | 389 |
| 426 | 3300025303 | Ga0209051_1000173 | Ga0209051_100017366 | 389 |
| 427 | 3300025303 | Ga0209051_1000179 | Ga0209051_10001794 | 389 |
| 428 | 3300025303 | Ga0209051_1000488 | Ga0209051_100048849 | 389 |
| 429 | 3300025303 | Ga0209051_1000814 | Ga0209051_100081430 | 389 |
| 430 | 3300025303 | Ga0209051_1001925 | Ga0209051_100192514 | 389 |
| 431 | 3300025304 | Ga0209257_1000002 | Ga0209257_100000232 | 389 |
| 432 | 3300025304 | Ga0209257_1000096 | Ga0209257_100009675 | 389 |
| 433 | 3300025304 | Ga0209257_1000412 | Ga0209257_100041279 | 389 |
| 434 | 3300025728 | Ga0207655_1003001 | Ga0207655_10030019 | 389 |
| 435 | 3300025909 | Ga0207705_10071062 | Ga0207705_100710622 | 389 |
| 436 | 3300025913 | Ga0207695_10029800 | Ga0207695_100298006 | 389 |
| 437 | 3300025919 | Ga0207657_10045327 | Ga0207657_100453274 | 389 |
| 438 | 3300025921 | Ga0207652_10025150 | Ga0207652_100251505 | 389 |
| 439 | 3300025924 | Ga0207694_10019947 | Ga0207694_100199472 | 389 |
| 440 | 3300025932 | Ga0207690_10004058 | Ga0207690_100040587 | 389 |
| 441 | 3300025935 | Ga0207709_10000130 | Ga0207709_10000130103 | 389 |
| 442 | 3300025935 | Ga0207709_10001694 | Ga0207709_100016946 | 389 |
| 443 | 3300025942 | Ga0207689_10100290 | Ga0207689_101002902 | 389 |
| 444 | 3300025945 | Ga0207679_10006049 | Ga0207679_100060496 | 389 |
| 445 | 3300025949 | Ga0207667_10339975 | Ga0207667_103399752 | 389 |
| 446 | 3300025981 | Ga0207640_10179312 | Ga0207640_101793121 | 389 |
| 447 | 3300025986 | Ga0207658_10111847 | Ga0207658_101118472 | 389 |
| 448 | 3300026023 | Ga0207677_10163452 | Ga0207677_101634522 | 389 |
| 449 | 3300026041 | Ga0207639_10003459 | Ga0207639_100034592 | 389 |
| 450 | 3300026089 | Ga0207648_10212645 | Ga0207648_102126451 | 389 |
| 451 | 3300026121 | Ga0207683_10006050 | Ga0207683_1000605010 | 389 |
| 452 | 3300026121 | Ga0207683_10373506 | Ga0207683_103735061 | 389 |
| 453 | 3300026142 | Ga0207698_10272726 | Ga0207698_102727262 | 389 |
| 454 | 3300027665 | Ga0209983_1010176 | Ga0209983_10101761 | 389 |
| 455 | 3300027666 | Ga0209282_1002486 | Ga0209282_10024868 | 389 |
| 456 | 3300027876 | Ga0209974_10015055 | Ga0209974_100150552 | 389 |
| 457 | 3300028379 | Ga0268266_10014299 | Ga0268266_100142996 | 389 |
| 458 | 3300028380 | Ga0268265_10016123 | Ga0268265_100161236 | 389 |
| 459 | 3300028794 | Ga0307515_10000040 | Ga0307515_10000040295 | 389 |
| 460 | 3300028794 | Ga0307515_10041442 | Ga0307515_100414422 | 389 |
| 461 | 3300028794 | Ga0307515_10090189 | Ga0307515_100901892 | 389 |
| 462 | 3300030733 | Ga0314311_1040207 | Ga0314311_10402072 | 389 |
| 463 | 3300030735 | Ga0316178_1118432 | Ga0316178_11184324 | 389 |
| 464 | 3300030742 | Ga0316183_1082423 | Ga0316183_10824232 | 389 |
| 465 | 3300030744 | Ga0316181_1082156 | Ga0316181_10821561 | 389 |
| 466 | 3300030745 | Ga0316182_1083649 | Ga0316182_10836492 | 389 |
| 467 | 3300030745 | Ga0316182_1306370 | Ga0316182_13063701 | 389 |
| 468 | 3300031250 | Ga0265331_10038086 | Ga0265331_100380861 | 389 |
| 469 | 3300031251 | Ga0265327_10005627 | Ga0265327_100056276 | 389 |
| 470 | 3300031251 | Ga0265327_10073363 | Ga0265327_100733632 | 389 |
| 471 | 3300031344 | Ga0265316_10000005 | Ga0265316_1000000592 | 389 |
| 472 | 3300031456 | Ga0307513_10032452 | Ga0307513_100324521 | 389 |
| 473 | 3300031548 | Ga0307408_100003486 | Ga0307408_1000034864 | 389 |
| 474 | 3300031548 | Ga0307408_100049153 | Ga0307408_1000491532 | 389 |
| 475 | 3300031548 | Ga0307408_100088756 | Ga0307408_1000887562 | 389 |
| 476 | 3300031649 | Ga0307514_10000920 | Ga0307514_1000092034 | 389 |
| 477 | 3300031711 | Ga0265314_10001065 | Ga0265314_1000106510 | 389 |
| 478 | 3300031712 | Ga0265342_10081970 | Ga0265342_100819701 | 389 |
| 479 | 3300031731 | Ga0307405_10038766 | Ga0307405_100387662 | 389 |
| 480 | 3300031901 | Ga0307406_10002476 | Ga0307406_100024764 | 389 |
| 481 | 3300031911 | Ga0307412_10045274 | Ga0307412_100452742 | 389 |
| 482 | 3300031911 | Ga0307412_10056567 | Ga0307412_100565674 | 389 |
| 483 | 3300032005 | Ga0307411_10130385 | Ga0307411_101303851 | 389 |
| 484 | 3300037312 | Ga0395899_0005350 | Ga0395899_0005350_8285_9499 | 389 |
| 485 | 3300037312 | Ga0395899_0006712 | Ga0395899_0006712_6263_7477 | 389 |
| 486 | 3300037418 | Ga0395900_0000131 | Ga0395900_0000131_98556_99776 | 389 |
| 487 | 3300037418 | Ga0395900_0005063 | Ga0395900_0005063_5923_7137 | 389 |
| 488 | 3300037418 | Ga0395900_0005396 | Ga0395900_0005396_464_1678 | 389 |
| 489 | 3300037418 | Ga0395900_0018610 | Ga0395900_0018610_726_1940 | 389 |
| 490 | 3300037418 | Ga0395900_0021753 | Ga0395900_0021753_1218_2429 | 389 |
| 491 | 3300037418 | Ga0395900_0119412 | Ga0395900_0119412_1300_2514 | 389 |
| 492 | 3300037466 | Ga0395898_0006253 | Ga0395898_0006253_724_1938 | 389 |
| 493 | 3300037466 | Ga0395898_0011606 | Ga0395898_0011606_3413_4627 | 389 |
| 494 | 3300037471 | Ga0395905_0001157 | Ga0395905_0001157_25197_26411 | 389 |
| 495 | 3300037471 | Ga0395905_0001668 | Ga0395905_0001668_5704_6930 | 389 |
| 496 | 3300037471 | Ga0395905_0026275 | Ga0395905_0026275_2874_4088 | 389 |
| 497 | 3300037471 | Ga0395905_0040407 | Ga0395905_0040407_452_1666 | 389 |
| 498 | 3300037471 | Ga0395905_0078207 | Ga0395905_0078207_1509_2732 | 389 |
| 499 | 3300037471 | Ga0395905_0105542 | Ga0395905_0105542_418_1632 | 389 |
| 500 | 3300037471 | Ga0395905_0116952 | Ga0395905_0116952_1097_2311 | 389 |
| 501 | 3300038443 | Ga0395901_0007241 | Ga0395901_0007241_2122_3345 | 389 |
| 502 | 3300038443 | Ga0395901_0022743 | Ga0395901_0022743_1234_2445 | 389 |
| 503 | 3300038443 | Ga0395901_0043010 | Ga0395901_0043010_1515_2729 | 389 |
| 504 | 3300038443 | Ga0395901_0099214 | Ga0395901_0099214_1211_2425 | 389 |
| 505 | 3300038443 | Ga0395901_0183218 | Ga0395901_0183218_565_1779 | 389 |
| 506 | 3300038443 | Ga0395901_0311371 | Ga0395901_0311371_83_1297 | 389 |
| 507 | 3300039447 | Ga0436361_0616441 | Ga0436361_0616441_23217_24449 | 389 |
| 508 | 3300039447 | Ga0436361_0916159 | Ga0436361_0916159_8206_9438 | 389 |
| 509 | 3300039447 | Ga0436361_1150385 | Ga0436361_1150385_43601_44944 | 389 |
| 510 | 3300041404 | Ga0439436_0000635 | Ga0439436_0000635_4130_5344 | 389 |
| 511 | 3300041406 | Ga0439439_0000329 | Ga0439439_0000329_1767_2981 | 389 |
| 512 | 3300041411 | Ga0439466_0004216 | Ga0439466_0004216_621_1835 | 389 |
| 513 | 3300041413 | Ga0439465_0000176 | Ga0439465_0000176_12201_13415 | 389 |
| 514 | 3300041413 | Ga0439465_0016982 | Ga0439465_0016982_591_1805 | 389 |
| 515 | 3300041997 | Ga0439431_0009855 | Ga0439431_0009855_423_1637 | 389 |
| 516 | 3300042004 | Ga0439445_0000181 | Ga0439445_0000181_9837_11051 | 389 |
| 517 | 3300042004 | Ga0439445_0009295 | Ga0439445_0009295_788_2002 | 389 |
| 518 | 3300042007 | Ga0439449_0000632 | Ga0439449_0000632_10574_11788 | 389 |
| 519 | 3300042007 | Ga0439449_0001266 | Ga0439449_0001266_2558_3772 | 389 |
| 520 | 3300042015 | Ga0439462_0001510 | Ga0439462_0001510_2374_3588 | 389 |
| 521 | 3300042115 | Ga0450911_000725 | Ga0450911_000725_7339_8553 | 389 |
| 522 | 3300042125 | Ga0450923_001000 | Ga0450923_001000_2160_3374 | 389 |
| 523 | 3300042185 | Ga0450909_009165 | Ga0450909_009165_84_1298 | 389 |
| 524 | 3300042435 | Ga0439434_0000543 | Ga0439434_0000543_9192_10406 | 389 |
| 525 | 3300042435 | Ga0439434_0003310 | Ga0439434_0003310_1362_2576 | 389 |
| 526 | 3300042435 | Ga0439434_0035836 | Ga0439434_0035836_283_1497 | 389 |
| 527 | 3300042531 | Ga0450918_002647 | Ga0450918_002647_198_1412 | 389 |
| 528 | 3300042876 | Ga0451577_0041881 | Ga0451577_0041881_2146_3366 | 389 |
| 529 | 3300044656 | Ga0466969_0001560 | Ga0466969_0001560_1089_2303 | 389 |
| 530 | 3300044656 | Ga0466969_0057686 | Ga0466969_0057686_490_1746 | 389 |
| 531 | 3300044693 | Ga0466961_0002291 | Ga0466961_0002291_1422_2678 | 389 |
| 532 | 3300044706 | Ga0466964_0053627 | Ga0466964_0053627_366_1622 | 389 |
| 533 | 3300044901 | Ga0466960_0060962 | Ga0466960_0060962_82_1296 | 389 |
| 534 | 3300045051 | Ga0451576_0001995 | Ga0451576_0001995_27280_28500 | 389 |
| 535 | 3300046471 | Ga0495650_0020417 | Ga0495650_0020417_1979_3199 | 389 |
| 536 | 3300046471 | Ga0495650_0054156 | Ga0495650_0054156_155_1366 | 389 |
| 537 | 3300046512 | Ga0495610_0026730 | Ga0495610_0026730_1061_2275 | 389 |
| 538 | 3300046513 | Ga0495616_0030690 | Ga0495616_0030690_1372_2586 | 389 |
| 539 | 3300046515 | Ga0495620_0019601 | Ga0495620_0019601_479_1693 | 389 |
| 540 | 3300046520 | Ga0495637_0003930 | Ga0495637_0003930_2171_3385 | 389 |
| 541 | 3300046530 | Ga0495654_0000313 | Ga0495654_0000313_35844_37058 | 389 |
| 542 | 3300046615 | Ga0495656_0000087 | Ga0495656_0000087_20076_21290 | 389 |
| 543 | 3300046660 | Ga0495625_0001451 | Ga0495625_0001451_27181_28395 | 389 |
| 544 | 3300046683 | Ga0495658_0002569 | Ga0495658_0002569_4272_5486 | 389 |
| 545 | 3300046691 | Ga0495670_0097686 | Ga0495670_0097686_95_1309 | 389 |
| 546 | 3300047321 | Ga0495676_0003280 | Ga0495676_0003280_12526_13740 | 389 |
| 547 | 3300048904 | Ga0496101_0005305 | Ga0496101_0005305_2912_4126 | 389 |
| 548 | 3300048905 | Ga0496102_0010550 | Ga0496102_0010550_5020_6234 | 389 |
| 549 | 3300048908 | Ga0496105_0003188 | Ga0496105_0003188_6703_7917 | 389 |
| 550 | 3300048913 | Ga0496110_0040628 | Ga0496110_0040628_1579_2793 | 389 |
| 551 | 3300048917 | Ga0496114_0231527 | Ga0496114_0231527_296_1510 | 389 |
| 552 | 3300048919 | Ga0496116_0042395 | Ga0496116_0042395_287_1483 | 389 |
| 553 | 3300048920 | Ga0496117_0033970 | Ga0496117_0033970_2246_3460 | 389 |
| 554 | 3300048921 | Ga0496118_0108075 | Ga0496118_0108075_118_1332 | 389 |
| 555 | 3300048924 | Ga0496121_0014158 | Ga0496121_0014158_2596_3810 | 389 |
| 556 | 3300048924 | Ga0496121_0076519 | Ga0496121_0076519_75_1292 | 389 |
| 557 | 3300048925 | Ga0496122_0000063 | Ga0496122_0000063_104312_105526 | 389 |
| 558 | 3300048926 | Ga0496123_0000045 | Ga0496123_0000045_154737_155951 | 389 |
| 559 | 3300048927 | Ga0496124_0000036 | Ga0496124_0000036_200328_201545 | 389 |
| 560 | 3300048927 | Ga0496124_0025394 | Ga0496124_0025394_1640_2854 | 389 |
| 561 | 3300048928 | Ga0496125_0002103 | Ga0496125_0002103_23689_24903 | 389 |
| 562 | 3300048928 | Ga0496125_0006290 | Ga0496125_0006290_10620_11834 | 389 |
| 563 | 3300048928 | Ga0496125_0012141 | Ga0496125_0012141_2645_3859 | 389 |
| 564 | 3300048928 | Ga0496125_0056695 | Ga0496125_0056695_964_2178 | 389 |
| 565 | 3300048929 | Ga0496126_0123311 | Ga0496126_0123311_802_2016 | 389 |
| 566 | 3300049539 | Ga0501323_004115 | Ga0501323_004115_257_1471 | 389 |
| 567 | 3300049571 | Ga0501034_0086590 | Ga0501034_0086590_1813_3027 | 389 |
| 568 | 3300049572 | Ga0501036_0085956 | Ga0501036_0085956_491_1705 | 389 |
| 569 | 3300049580 | Ga0501046_0016051 | Ga0501046_0016051_1385_2599 | 389 |
| 570 | 3300049581 | Ga0501047_0035507 | Ga0501047_0035507_1842_3056 | 389 |
| 571 | 3300049662 | Ga0501222_000008 | Ga0501222_000008_108637_109878 | 389 |
| 572 | 3300049705 | Ga0501225_0001352 | Ga0501225_0001352_3274_4488 | 389 |
| 573 | 3300049763 | Ga0501266_003344 | Ga0501266_003344_290_1504 | 389 |
| 574 | 3300049823 | Ga0501044_0111779 | Ga0501044_0111779_730_1944 | 389 |
| 575 | 3300050491 | nmdc:mga00v17_2128_c1 | nmdc:mga00v17_2128_c1_8753_9970 | 389 |
| 576 | 3300050491 | nmdc:mga00v17_22012_c1 | nmdc:mga00v17_22012_c1_234_1484 | 389 |
| 577 | 3300050491 | nmdc:mga00v17_6135_c1 | nmdc:mga00v17_6135_c1_4629_5846 | 389 |
| 578 | 3300050492 | nmdc:mga0yw44_176989_c1 | nmdc:mga0yw44_176989_c1_23_1237 | 389 |
| 579 | 3300050493 | nmdc:mga0k408_12700_c1 | nmdc:mga0k408_12700_c1_1557_2771 | 389 |
| 580 | 3300050493 | nmdc:mga0k408_18434_c1 | nmdc:mga0k408_18434_c1_2333_3547 | 389 |
| 581 | 3300050493 | nmdc:mga0k408_1969_c1 | nmdc:mga0k408_1969_c1_1884_3104 | 389 |
| 582 | 3300050493 | nmdc:mga0k408_25606_c1 | nmdc:mga0k408_25606_c1_1734_2948 | 389 |
| 583 | 3300050493 | nmdc:mga0k408_84073_c1 | nmdc:mga0k408_84073_c1_553_1767 | 389 |
| 584 | 3300050496 | nmdc:mga07m45_1573_c1 | nmdc:mga07m45_1573_c1_802_2016 | 389 |
| 585 | 3300050496 | nmdc:mga07m45_25532_c1 | nmdc:mga07m45_25532_c1_1047_2261 | 389 |
| 586 | 3300050496 | nmdc:mga07m45_3649_c1 | nmdc:mga07m45_3649_c1_5746_6960 | 389 |
| 587 | 3300050496 | nmdc:mga07m45_45953_c1 | nmdc:mga07m45_45953_c1_1169_2392 | 389 |
| 588 | 3300050496 | nmdc:mga07m45_810_c1 | nmdc:mga07m45_810_c1_1955_3169 | 389 |
| 589 | 3300050496 | nmdc:mga07m45_9440_c1 | nmdc:mga07m45_9440_c1_2486_3700 | 389 |
| 590 | 3300053079 | Ga0500610_0029223 | Ga0500610_0029223_294_1508 | 389 |
| 591 | 3300053093 | Ga0500651_0000125 | Ga0500651_0000125_20742_21956 | 389 |
| 592 | 3300053108 | Ga0500562_013588 | Ga0500562_013588_272_1486 | 389 |
| 593 | 3300053110 | Ga0500571_006911 | Ga0500571_006911_4500_5714 | 389 |
| 594 | 3300053117 | Ga0500593_001579 | Ga0500593_001579_2304_3518 | 389 |
| 595 | 3300053118 | Ga0500594_0000938 | Ga0500594_0000938_2560_3774 | 389 |
| 596 | 3300053121 | Ga0500607_008170 | Ga0500607_008170_246_1460 | 389 |
| 597 | 3300053122 | Ga0500608_020890 | Ga0500608_020890_754_1968 | 389 |
| 598 | 3300053134 | Ga0500658_0002003 | Ga0500658_0002003_4233_5447 | 389 |
| 599 | 3300053134 | Ga0500658_0002237 | Ga0500658_0002237_3783_4997 | 389 |
| 600 | 3300053139 | Ga0500568_0004400 | Ga0500568_0004400_3565_4779 | 389 |
| 601 | 3300053153 | Ga0500616_0020378 | Ga0500616_0020378_1319_2533 | 389 |
| 602 | 3300053161 | Ga0500634_0099122 | Ga0500634_0099122_98_1312 | 389 |
| 603 | 3300059477 | Ga0587084_009376 | Ga0587084_009376_36_1250 | 389 |
| 604 | 3300059491 | Ga0587070_013470 | Ga0587070_013470_13_1227 | 389 |
| 605 | 3300059506 | Ga0587085_009626 | Ga0587085_009626_13_1227 | 389 |
| 606 | 3300059508 | Ga0587088_002489 | Ga0587088_002489_215_1429 | 389 |
| 607 | 3300059511 | Ga0587091_011847 | Ga0587091_011847_141_1355 | 389 |
| 608 | 3300059623 | Ga0587101_001771 | Ga0587101_001771_683_1897 | 389 |
| 609 | 3300059630 | Ga0587128_008413 | Ga0587128_008413_36_1250 | 389 |
| 610 | 3300059641 | Ga0587068_012091 | Ga0587068_012091_15_1229 | 389 |
| 611 | 3300059646 | Ga0587078_006703 | Ga0587078_006703_13_1227 | 389 |
| 612 | 3300061719 | Ga0466962_0029546 | Ga0466962_0029546_777_2033 | 389 |
| 613 | iso_pu_bacteria | 2513020051 | 2513227666 | 389 |
| 614 | iso_pu_bacteria | 2547132374 | 2548499804 | 389 |
| 615 | iso_pu_bacteria | 2599185214 | 2599625702 | 389 |
| 616 | iso_pu_bacteria | 2599185226 | 2599673715 | 389 |
| 617 | iso_pu_bacteria | 2599185227 | 2599683385 | 389 |
| 618 | iso_pu_bacteria | 2599185229 | 2599695127 | 389 |
| 619 | iso_pu_bacteria | 2643221570 | 2643868045 | 389 |
| 620 | iso_pu_bacteria | 2643221585 | 2643936783 | 389 |
| 621 | iso_pu_bacteria | 2643221596 | 2643993950 | 389 |
| 622 | iso_pu_bacteria | 2643221609 | 2644059604 | 389 |
| 623 | iso_pu_bacteria | 2643221611 | 2644074746 | 389 |
| 624 | iso_pu_bacteria | 2643221628 | 2644162277 | 389 |
| 625 | iso_pu_bacteria | 2643221652 | 2644293656 | 389 |
| 626 | iso_pu_bacteria | 2643221656 | 2644318682 | 389 |
| 627 | iso_pu_bacteria | 2643221658 | 2644324427 | 389 |
| 628 | iso_pu_bacteria | 2643221672 | 2644396276 | 389 |
| 629 | iso_pu_bacteria | 2643221683 | 2644464748 | 389 |
| 630 | iso_pu_bacteria | 2643221717 | 2644644869 | 389 |
| 631 | iso_pu_bacteria | 2738541277 | 2738719221 | 389 |
| 632 | iso_pu_bacteria | 2738541307 | 2738880240 | 389 |
| 633 | iso_pu_bacteria | 2738543012 | 2739241134 | 389 |
| 634 | iso_pu_bacteria | 2738543013 | 2739248060 | 389 |
| 635 | iso_pu_bacteria | 2738543019 | 2739281983 | 389 |
| 636 | iso_pu_bacteria | 2816332133 | 2816471788 | 389 |
| 637 | iso_pu_bacteria | 2818991446 | 2819599724 | 389 |
| 638 | iso_pu_bacteria | 2831265667 | 2831271679 | 389 |
| 639 | iso_pu_bacteria | 2838054893 | 2838055592 | 389 |
| 640 | iso_pu_bacteria | 2842677519 | 2842681201 | 389 |
| 641 | iso_pu_bacteria | 2842718218 | 2842721490 | 389 |
| 642 | iso_pu_bacteria | 2842733646 | 2842734203 | 389 |
| 643 | iso_pu_bacteria | 2842747753 | 2842749536 | 389 |
| 644 | iso_pu_bacteria | 2881101125 | 2881102954 | 389 |
| 645 | iso_pu_bacteria | 2885192300 | 2885194753 | 389 |
| 646 | iso_pu_bacteria | 2885198086 | 2885200874 | 389 |
| 647 | iso_pu_bacteria | 2885211737 | 2885214343 | 389 |
| 648 | iso_pu_bacteria | 2894023352 | 2894024225 | 389 |
| 649 | iso_pu_bacteria | 2899924645 | 2899927643 | 389 |
| 650 | iso_pu_bacteria | 2904449895 | 2904450653 | 389 |
| 651 | iso_pu_bacteria | 2904456579 | 2904459847 | 389 |
| 652 | iso_pu_bacteria | 2904541872 | 2904549815 | 389 |
| 653 | iso_pu_bacteria | 2919462493 | 2919462819 | 389 |
| 654 | iso_pu_bacteria | 2928037797 | 2928042080 | 389 |
| 655 | iso_pu_bacteria | 2928044640 | 2928049644 | 389 |
| 656 | iso_pu_bacteria | 2928051484 | 2928051682 | 389 |
| 657 | iso_pu_bacteria | 2928064002 | 2928065627 | 389 |
| 658 | iso_pu_bacteria | 2928070936 | 2928073094 | 389 |
| 659 | iso_pu_bacteria | 2928115317 | 2928120798 | 389 |
| 660 | iso_pu_bacteria | 2929160207 | 2929161782 | 389 |
| 661 | iso_pu_bacteria | 2929520902 | 2929521370 | 389 |
| 662 | iso_pu_bacteria | 2939631187 | 2939632611 | 389 |
| 663 | iso_pu_bacteria | 2945909444 | 2945913823 | 389 |
| 664 | iso_pu_bacteria | 2945945610 | 2945949384 | 389 |
| 665 | iso_pu_bacteria | 2945972063 | 2945973429 | 389 |
| 666 | iso_pu_bacteria | 2945984333 | 2945990781 | 389 |
| 667 | iso_pu_bacteria | 2954767861 | 2954770964 | 389 |
| 668 | iso_pu_bacteria | 2974320154 | 2974322408 | 389 |
| 669 | iso_pu_bacteria | 2990710928 | 2990713596 | 389 |
| 670 | 3300002705 | JGI25156J39149_1009053 | JGI25156J39149_10090532 | 390 |
| 671 | 3300002738 | JGI25154J39366_1003432 | JGI25154J39366_10034322 | 390 |
| 672 | 3300002738 | JGI25154J39366_1003510 | JGI25154J39366_10035102 | 390 |
| 673 | 3300002741 | JGI25157J39369_1000018 | JGI25157J39369_100001867 | 390 |
| 674 | 3300003162 | Ga0006778J45830_1016434 | Ga0006778J45830_10164341 | 390 |
| 675 | 3300003305 | Ga0006770J48903_1020431 | Ga0006770J48903_10204311 | 390 |
| 676 | 3300003308 | Ga0006777J48905_1028280 | Ga0006777J48905_10282801 | 390 |
| 677 | 3300003316 | rootH1_10006215 | rootH1_100062151 | 390 |
| 678 | 3300003322 | rootL2_10000982 | rootL2_1000098211 | 390 |
| 679 | 3300003756 | Ga0055533_1000103 | Ga0055533_100010311 | 390 |
| 680 | 3300003761 | Ga0055535_1000087 | Ga0055535_100008730 | 390 |
| 681 | 3300003763 | Ga0055529_1000139 | Ga0055529_100013937 | 390 |
| 682 | 3300003771 | Ga0055526_1001236 | Ga0055526_100123616 | 390 |
| 683 | 3300003775 | Ga0055524_1000013 | Ga0055524_1000013119 | 390 |
| 684 | 3300003775 | Ga0055524_1001778 | Ga0055524_100177812 | 390 |
| 685 | 3300003775 | Ga0055524_1005899 | Ga0055524_10058993 | 390 |
| 686 | 3300003791 | Ga0055530_10001043 | Ga0055530_1000104323 | 390 |
| 687 | 3300003792 | Ga0055540_1000001 | Ga0055540_1000001129 | 390 |
| 688 | 3300003794 | Ga0055531_10002737 | Ga0055531_100027377 | 390 |
| 689 | 3300003794 | Ga0055531_10007375 | Ga0055531_100073756 | 390 |
| 690 | 3300003794 | Ga0055531_10015669 | Ga0055531_100156693 | 390 |
| 691 | 3300004625 | Ga0055543_1005397 | Ga0055543_10053975 | 390 |
| 692 | 3300004625 | Ga0055543_1007792 | Ga0055543_10077922 | 390 |
| 693 | 3300005262 | Ga0065165_1000197 | Ga0065165_100019773 | 390 |
| 694 | 3300005262 | Ga0065165_1000239 | Ga0065165_10002395 | 390 |
| 695 | 3300005262 | Ga0065165_1005742 | Ga0065165_10057426 | 390 |
| 696 | 3300005295 | Ga0065707_10084601 | Ga0065707_100846012 | 390 |
| 697 | 3300005327 | Ga0070658_10082456 | Ga0070658_100824562 | 390 |
| 698 | 3300005327 | Ga0070658_10150734 | Ga0070658_101507342 | 390 |
| 699 | 3300005328 | Ga0070676_10001955 | Ga0070676_100019558 | 390 |
| 700 | 3300005328 | Ga0070676_10039117 | Ga0070676_100391172 | 390 |
| 701 | 3300005329 | Ga0070683_100081114 | Ga0070683_1000811144 | 390 |
| 702 | 3300005329 | Ga0070683_100093253 | Ga0070683_1000932532 | 390 |
| 703 | 3300005331 | Ga0070670_100000939 | Ga0070670_10000093914 | 390 |
| 704 | 3300005331 | Ga0070670_100023500 | Ga0070670_1000235003 | 390 |
| 705 | 3300005331 | Ga0070670_100043384 | Ga0070670_1000433844 | 390 |
| 706 | 3300005331 | Ga0070670_100184444 | Ga0070670_1001844442 | 390 |
| 707 | 3300005333 | Ga0070677_10002616 | Ga0070677_100026163 | 390 |
| 708 | 3300005333 | Ga0070677_10005224 | Ga0070677_100052241 | 390 |
| 709 | 3300005333 | Ga0070677_10035481 | Ga0070677_100354812 | 390 |
| 710 | 3300005334 | Ga0068869_100002798 | Ga0068869_1000027985 | 390 |
| 711 | 3300005335 | Ga0070666_10111468 | Ga0070666_101114682 | 390 |
| 712 | 3300005335 | Ga0070666_10218578 | Ga0070666_102185781 | 390 |
| 713 | 3300005336 | Ga0070680_100012342 | Ga0070680_1000123425 | 390 |
| 714 | 3300005337 | Ga0070682_100167209 | Ga0070682_1001672091 | 390 |
| 715 | 3300005338 | Ga0068868_100004119 | Ga0068868_1000041197 | 390 |
| 716 | 3300005338 | Ga0068868_100050588 | Ga0068868_1000505884 | 390 |
| 717 | 3300005338 | Ga0068868_100076693 | Ga0068868_1000766932 | 390 |
| 718 | 3300005340 | Ga0070689_100008358 | Ga0070689_1000083585 | 390 |
| 719 | 3300005344 | Ga0070661_100012486 | Ga0070661_1000124863 | 390 |
| 720 | 3300005347 | Ga0070668_100140829 | Ga0070668_1001408292 | 390 |
| 721 | 3300005353 | Ga0070669_100066138 | Ga0070669_1000661383 | 390 |
| 722 | 3300005354 | Ga0070675_100003660 | Ga0070675_10000366012 | 390 |
| 723 | 3300005354 | Ga0070675_100003790 | Ga0070675_10000379011 | 390 |
| 724 | 3300005354 | Ga0070675_100026036 | Ga0070675_1000260364 | 390 |
| 725 | 3300005354 | Ga0070675_100031337 | Ga0070675_1000313374 | 390 |
| 726 | 3300005354 | Ga0070675_100124465 | Ga0070675_1001244652 | 390 |
| 727 | 3300005355 | Ga0070671_100002857 | Ga0070671_1000028574 | 390 |
| 728 | 3300005355 | Ga0070671_100017900 | Ga0070671_1000179003 | 390 |
| 729 | 3300005355 | Ga0070671_100035058 | Ga0070671_1000350585 | 390 |
| 730 | 3300005355 | Ga0070671_100043352 | Ga0070671_1000433524 | 390 |
| 731 | 3300005355 | Ga0070671_100064946 | Ga0070671_1000649463 | 390 |
| 732 | 3300005355 | Ga0070671_100118012 | Ga0070671_1001180122 | 390 |
| 733 | 3300005355 | Ga0070671_100146539 | Ga0070671_1001465391 | 390 |
| 734 | 3300005356 | Ga0070674_100004270 | Ga0070674_1000042706 | 390 |
| 735 | 3300005356 | Ga0070674_100156771 | Ga0070674_1001567712 | 390 |
| 736 | 3300005364 | Ga0070673_100002423 | Ga0070673_10000242311 | 390 |
| 737 | 3300005364 | Ga0070673_100021355 | Ga0070673_1000213552 | 390 |
| 738 | 3300005364 | Ga0070673_100044183 | Ga0070673_1000441833 | 390 |
| 739 | 3300005364 | Ga0070673_100103569 | Ga0070673_1001035692 | 390 |
| 740 | 3300005365 | Ga0070688_100006265 | Ga0070688_1000062655 | 390 |
| 741 | 3300005367 | Ga0070667_100001132 | Ga0070667_10000113221 | 390 |
| 742 | 3300005367 | Ga0070667_100002718 | Ga0070667_1000027183 | 390 |
| 743 | 3300005367 | Ga0070667_100081411 | Ga0070667_1000814112 | 390 |
| 744 | 3300005367 | Ga0070667_100122000 | Ga0070667_1001220003 | 390 |
| 745 | 3300005455 | Ga0070663_100021379 | Ga0070663_1000213794 | 390 |
| 746 | 3300005455 | Ga0070663_100022223 | Ga0070663_1000222234 | 390 |
| 747 | 3300005455 | Ga0070663_100209582 | Ga0070663_1002095821 | 390 |
| 748 | 3300005456 | Ga0070678_100014813 | Ga0070678_1000148132 | 390 |
| 749 | 3300005456 | Ga0070678_100037399 | Ga0070678_1000373993 | 390 |
| 750 | 3300005456 | Ga0070678_100231595 | Ga0070678_1002315951 | 390 |
| 751 | 3300005457 | Ga0070662_100004327 | Ga0070662_1000043278 | 390 |
| 752 | 3300005457 | Ga0070662_100009659 | Ga0070662_1000096594 | 390 |
| 753 | 3300005457 | Ga0070662_100015254 | Ga0070662_1000152543 | 390 |
| 754 | 3300005457 | Ga0070662_100016597 | Ga0070662_1000165972 | 390 |
| 755 | 3300005458 | Ga0070681_10182314 | Ga0070681_101823142 | 390 |
| 756 | 3300005459 | Ga0068867_100000086 | Ga0068867_10000008616 | 390 |
| 757 | 3300005459 | Ga0068867_100003769 | Ga0068867_1000037698 | 390 |
| 758 | 3300005459 | Ga0068867_100005351 | Ga0068867_1000053516 | 390 |
| 759 | 3300005471 | Ga0070698_100084064 | Ga0070698_1000840644 | 390 |
| 760 | 3300005530 | Ga0070679_100023124 | Ga0070679_1000231241 | 390 |
| 761 | 3300005543 | Ga0070672_100001075 | Ga0070672_1000010757 | 390 |
| 762 | 3300005543 | Ga0070672_100079457 | Ga0070672_1000794574 | 390 |
| 763 | 3300005543 | Ga0070672_100135687 | Ga0070672_1001356872 | 390 |
| 764 | 3300005543 | Ga0070672_100183285 | Ga0070672_1001832852 | 390 |
| 765 | 3300005544 | Ga0070686_100182932 | Ga0070686_1001829321 | 390 |
| 766 | 3300005548 | Ga0070665_100099545 | Ga0070665_1000995454 | 390 |
| 767 | 3300005563 | Ga0068855_100221152 | Ga0068855_1002211522 | 390 |
| 768 | 3300005564 | Ga0070664_100096677 | Ga0070664_1000966773 | 390 |
| 769 | 3300005577 | Ga0068857_100007953 | Ga0068857_1000079537 | 390 |
| 770 | 3300005577 | Ga0068857_100127847 | Ga0068857_1001278472 | 390 |
| 771 | 3300005578 | Ga0068854_100067299 | Ga0068854_1000672993 | 390 |
| 772 | 3300005578 | Ga0068854_100203468 | Ga0068854_1002034681 | 390 |
| 773 | 3300005614 | Ga0068856_100008259 | Ga0068856_1000082596 | 390 |
| 774 | 3300005615 | Ga0070702_100123102 | Ga0070702_1001231021 | 390 |
| 775 | 3300005616 | Ga0068852_100080615 | Ga0068852_1000806152 | 390 |
| 776 | 3300005616 | Ga0068852_100126184 | Ga0068852_1001261842 | 390 |
| 777 | 3300005616 | Ga0068852_100148792 | Ga0068852_1001487922 | 390 |
| 778 | 3300005617 | Ga0068859_100092966 | Ga0068859_1000929663 | 390 |
| 779 | 3300005618 | Ga0068864_100001313 | Ga0068864_1000013138 | 390 |
| 780 | 3300005618 | Ga0068864_100013771 | Ga0068864_1000137714 | 390 |
| 781 | 3300005618 | Ga0068864_100203793 | Ga0068864_1002037932 | 390 |
| 782 | 3300005718 | Ga0068866_10041851 | Ga0068866_100418514 | 390 |
| 783 | 3300005719 | Ga0068861_100004782 | Ga0068861_1000047828 | 390 |
| 784 | 3300005719 | Ga0068861_100016063 | Ga0068861_1000160634 | 390 |
| 785 | 3300005719 | Ga0068861_100034130 | Ga0068861_1000341302 | 390 |
| 786 | 3300005719 | Ga0068861_100046860 | Ga0068861_1000468604 | 390 |
| 787 | 3300005719 | Ga0068861_100069495 | Ga0068861_1000694953 | 390 |
| 788 | 3300005834 | Ga0068851_10104349 | Ga0068851_101043491 | 390 |
| 789 | 3300005834 | Ga0068851_10110720 | Ga0068851_101107201 | 390 |
| 790 | 3300005840 | Ga0068870_10102541 | Ga0068870_101025412 | 390 |
| 791 | 3300005841 | Ga0068863_100019781 | Ga0068863_1000197815 | 390 |
| 792 | 3300005842 | Ga0068858_100017353 | Ga0068858_1000173535 | 390 |
| 793 | 3300005842 | Ga0068858_100031050 | Ga0068858_1000310503 | 390 |
| 794 | 3300005842 | Ga0068858_100050526 | Ga0068858_1000505264 | 390 |
| 795 | 3300005843 | Ga0068860_100000685 | Ga0068860_1000006854 | 390 |
| 796 | 3300005843 | Ga0068860_100014044 | Ga0068860_1000140446 | 390 |
| 797 | 3300005843 | Ga0068860_100022963 | Ga0068860_1000229635 | 390 |
| 798 | 3300005843 | Ga0068860_100063757 | Ga0068860_1000637572 | 390 |
| 799 | 3300005843 | Ga0068860_100099993 | Ga0068860_1000999932 | 390 |
| 800 | 3300005844 | Ga0068862_100011753 | Ga0068862_1000117536 | 390 |
| 801 | 3300005844 | Ga0068862_100022287 | Ga0068862_1000222873 | 390 |
| 802 | 3300006042 | Ga0075368_10019630 | Ga0075368_100196302 | 390 |
| 803 | 3300006042 | Ga0075368_10053543 | Ga0075368_100535431 | 390 |
| 804 | 3300006048 | Ga0075363_100010719 | Ga0075363_1000107192 | 390 |
| 805 | 3300006048 | Ga0075363_100037680 | Ga0075363_1000376804 | 390 |
| 806 | 3300006048 | Ga0075363_100067436 | Ga0075363_1000674362 | 390 |
| 807 | 3300006051 | Ga0075364_10014953 | Ga0075364_100149536 | 390 |
| 808 | 3300006051 | Ga0075364_10045003 | Ga0075364_100450033 | 390 |
| 809 | 3300006177 | Ga0075362_10017189 | Ga0075362_100171891 | 390 |
| 810 | 3300006178 | Ga0075367_10004232 | Ga0075367_100042326 | 390 |
| 811 | 3300006178 | Ga0075367_10059536 | Ga0075367_100595364 | 390 |
| 812 | 3300006186 | Ga0075369_10025008 | Ga0075369_100250082 | 390 |
| 813 | 3300006195 | Ga0075366_10001613 | Ga0075366_100016136 | 390 |
| 814 | 3300006195 | Ga0075366_10022200 | Ga0075366_100222003 | 390 |
| 815 | 3300006195 | Ga0075366_10022341 | Ga0075366_100223412 | 390 |
| 816 | 3300006195 | Ga0075366_10023366 | Ga0075366_100233663 | 390 |
| 817 | 3300006195 | Ga0075366_10033534 | Ga0075366_100335342 | 390 |
| 818 | 3300006195 | Ga0075366_10039026 | Ga0075366_100390264 | 390 |
| 819 | 3300006195 | Ga0075366_10053078 | Ga0075366_100530782 | 390 |
| 820 | 3300006195 | Ga0075366_10058191 | Ga0075366_100581912 | 390 |
| 821 | 3300006195 | Ga0075366_10089780 | Ga0075366_100897802 | 390 |
| 822 | 3300006195 | Ga0075366_10101873 | Ga0075366_101018731 | 390 |
| 823 | 3300006237 | Ga0097621_100073888 | Ga0097621_1000738882 | 390 |
| 824 | 3300006237 | Ga0097621_100091912 | Ga0097621_1000919124 | 390 |
| 825 | 3300006237 | Ga0097621_100179383 | Ga0097621_1001793831 | 390 |
| 826 | 3300006353 | Ga0075370_10002946 | Ga0075370_100029462 | 390 |
| 827 | 3300006353 | Ga0075370_10005250 | Ga0075370_100052502 | 390 |
| 828 | 3300006353 | Ga0075370_10006000 | Ga0075370_100060002 | 390 |
| 829 | 3300006353 | Ga0075370_10011147 | Ga0075370_100111472 | 390 |
| 830 | 3300006353 | Ga0075370_10036327 | Ga0075370_100363271 | 390 |
| 831 | 3300006353 | Ga0075370_10114709 | Ga0075370_101147091 | 390 |
| 832 | 3300006358 | Ga0068871_100022463 | Ga0068871_1000224635 | 390 |
| 833 | 3300006358 | Ga0068871_100078882 | Ga0068871_1000788824 | 390 |
| 834 | 3300006358 | Ga0068871_100138221 | Ga0068871_1001382212 | 390 |
| 835 | 3300006358 | Ga0068871_100180783 | Ga0068871_1001807832 | 390 |
| 836 | 3300006881 | Ga0068865_100017504 | Ga0068865_1000175045 | 390 |
| 837 | 3300006881 | Ga0068865_100020853 | Ga0068865_1000208532 | 390 |
| 838 | 3300006931 | Ga0097620_100092964 | Ga0097620_1000929643 | 390 |
| 839 | 3300006946 | Ga0079104_1000309 | Ga0079104_100030950 | 390 |
| 840 | 3300009093 | Ga0105240_10034284 | Ga0105240_100342844 | 390 |
| 841 | 3300009098 | Ga0105245_10026446 | Ga0105245_100264463 | 390 |
| 842 | 3300009147 | Ga0114129_10162038 | Ga0114129_101620382 | 390 |
| 843 | 3300009148 | Ga0105243_10009596 | Ga0105243_100095962 | 390 |
| 844 | 3300009148 | Ga0105243_10067283 | Ga0105243_100672832 | 390 |
| 845 | 3300009148 | Ga0105243_10100833 | Ga0105243_101008331 | 390 |
| 846 | 3300009148 | Ga0105243_10119114 | Ga0105243_101191142 | 390 |
| 847 | 3300009177 | Ga0105248_10022249 | Ga0105248_100222496 | 390 |
| 848 | 3300009177 | Ga0105248_10031969 | Ga0105248_100319692 | 390 |
| 849 | 3300009545 | Ga0105237_10168614 | Ga0105237_101686142 | 390 |
| 850 | 3300009545 | Ga0105237_10179425 | Ga0105237_101794252 | 390 |
| 851 | 3300009545 | Ga0105237_10295006 | Ga0105237_102950062 | 390 |
| 852 | 3300009551 | Ga0105238_10026760 | Ga0105238_100267604 | 390 |
| 853 | 3300009551 | Ga0105238_10055566 | Ga0105238_100555663 | 390 |
| 854 | 3300009551 | Ga0105238_10139751 | Ga0105238_101397512 | 390 |
| 855 | 3300009553 | Ga0105249_10007528 | Ga0105249_100075282 | 390 |
| 856 | 3300009553 | Ga0105249_10177425 | Ga0105249_101774252 | 390 |
| 857 | 3300010375 | Ga0105239_10027775 | Ga0105239_100277754 | 390 |
| 858 | 3300010375 | Ga0105239_10052753 | Ga0105239_100527534 | 390 |
| 859 | 3300012497 | Ga0157319_1000043 | Ga0157319_10000435 | 390 |
| 860 | 3300013102 | Ga0157371_10124955 | Ga0157371_101249552 | 390 |
| 861 | 3300013104 | Ga0157370_10185047 | Ga0157370_101850471 | 390 |
| 862 | 3300013296 | Ga0157374_10058382 | Ga0157374_100583823 | 390 |
| 863 | 3300013296 | Ga0157374_10093522 | Ga0157374_100935222 | 390 |
| 864 | 3300013296 | Ga0157374_10108482 | Ga0157374_101084823 | 390 |
| 865 | 3300013296 | Ga0157374_10118782 | Ga0157374_101187822 | 390 |
| 866 | 3300013297 | Ga0157378_10006194 | Ga0157378_100061945 | 390 |
| 867 | 3300013297 | Ga0157378_10081014 | Ga0157378_100810142 | 390 |
| 868 | 3300013297 | Ga0157378_10139820 | Ga0157378_101398202 | 390 |
| 869 | 3300013306 | Ga0163162_10029946 | Ga0163162_100299465 | 390 |
| 870 | 3300013306 | Ga0163162_10040965 | Ga0163162_100409655 | 390 |
| 871 | 3300013307 | Ga0157372_10209179 | Ga0157372_102091793 | 390 |
| 872 | 3300013308 | Ga0157375_10008692 | Ga0157375_1000869210 | 390 |
| 873 | 3300013308 | Ga0157375_10014347 | Ga0157375_100143475 | 390 |
| 874 | 3300013308 | Ga0157375_10032391 | Ga0157375_100323915 | 390 |
| 875 | 3300013308 | Ga0157375_10296945 | Ga0157375_102969452 | 390 |
| 876 | 3300014326 | Ga0157380_10012147 | Ga0157380_100121476 | 390 |
| 877 | 3300014326 | Ga0157380_10028626 | Ga0157380_100286262 | 390 |
| 878 | 3300014745 | Ga0157377_10000038 | Ga0157377_1000003890 | 390 |
| 879 | 3300014745 | Ga0157377_10006032 | Ga0157377_100060324 | 390 |
| 880 | 3300014968 | Ga0157379_10007916 | Ga0157379_100079166 | 390 |
| 881 | 3300014968 | Ga0157379_10010131 | Ga0157379_100101316 | 390 |
| 882 | 3300014969 | Ga0157376_10004863 | Ga0157376_1000486310 | 390 |
| 883 | 3300014969 | Ga0157376_10014331 | Ga0157376_100143315 | 390 |
| 884 | 3300014969 | Ga0157376_10122695 | Ga0157376_101226952 | 390 |
| 885 | 3300017792 | Ga0163161_10034546 | Ga0163161_100345464 | 390 |
| 886 | 3300021361 | Ga0213872_10012213 | Ga0213872_100122133 | 390 |
| 887 | 3300025226 | Ga0209674_100003 | Ga0209674_100003292 | 390 |
| 888 | 3300025230 | Ga0209563_100010 | Ga0209563_10001021 | 390 |
| 889 | 3300025231 | Ga0207427_100361 | Ga0207427_1003614 | 390 |
| 890 | 3300025242 | Ga0209258_100044 | Ga0209258_10004437 | 390 |
| 891 | 3300025242 | Ga0209258_100525 | Ga0209258_10052529 | 390 |
| 892 | 3300025246 | Ga0209646_1000067 | Ga0209646_10000672 | 390 |
| 893 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033229 | 390 |
| 894 | 3300025253 | Ga0209677_100068 | Ga0209677_100068101 | 390 |
| 895 | 3300025253 | Ga0209677_100760 | Ga0209677_1007605 | 390 |
| 896 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024229 | 390 |
| 897 | 3300025256 | Ga0209759_1000970 | Ga0209759_100097011 | 390 |
| 898 | 3300025256 | Ga0209759_1007504 | Ga0209759_10075042 | 390 |
| 899 | 3300025272 | Ga0209455_1000048 | Ga0209455_100004837 | 390 |
| 900 | 3300025273 | Ga0209673_1004714 | Ga0209673_10047144 | 390 |
| 901 | 3300025291 | Ga0209675_1007213 | Ga0209675_10072135 | 390 |
| 902 | 3300025295 | Ga0209564_1000003 | Ga0209564_10000031218 | 390 |
| 903 | 3300025298 | Ga0209050_1000145 | Ga0209050_1000145138 | 390 |
| 904 | 3300025298 | Ga0209050_1001124 | Ga0209050_100112433 | 390 |
| 905 | 3300025298 | Ga0209050_1011786 | Ga0209050_10117862 | 390 |
| 906 | 3300025299 | Ga0209256_1000061 | Ga0209256_1000061121 | 390 |
| 907 | 3300025299 | Ga0209256_1001268 | Ga0209256_100126812 | 390 |
| 908 | 3300025299 | Ga0209256_1007013 | Ga0209256_10070134 | 390 |
| 909 | 3300025303 | Ga0209051_1000018 | Ga0209051_1000018323 | 390 |
| 910 | 3300025303 | Ga0209051_1024867 | Ga0209051_10248671 | 390 |
| 911 | 3300025304 | Ga0209257_1000084 | Ga0209257_100008449 | 390 |
| 912 | 3300025304 | Ga0209257_1003994 | Ga0209257_10039944 | 390 |
| 913 | 3300025304 | Ga0209257_1004271 | Ga0209257_10042715 | 390 |
| 914 | 3300025315 | Ga0207697_10013305 | Ga0207697_100133054 | 390 |
| 915 | 3300025315 | Ga0207697_10061246 | Ga0207697_100612462 | 390 |
| 916 | 3300025893 | Ga0207682_10003157 | Ga0207682_100031575 | 390 |
| 917 | 3300025893 | Ga0207682_10006644 | Ga0207682_100066443 | 390 |
| 918 | 3300025893 | Ga0207682_10039210 | Ga0207682_100392102 | 390 |
| 919 | 3300025899 | Ga0207642_10011507 | Ga0207642_100115074 | 390 |
| 920 | 3300025899 | Ga0207642_10060567 | Ga0207642_100605672 | 390 |
| 921 | 3300025901 | Ga0207688_10024697 | Ga0207688_100246974 | 390 |
| 922 | 3300025901 | Ga0207688_10041033 | Ga0207688_100410332 | 390 |
| 923 | 3300025903 | Ga0207680_10004287 | Ga0207680_100042877 | 390 |
| 924 | 3300025903 | Ga0207680_10128342 | Ga0207680_101283422 | 390 |
| 925 | 3300025907 | Ga0207645_10042100 | Ga0207645_100421003 | 390 |
| 926 | 3300025907 | Ga0207645_10068933 | Ga0207645_100689332 | 390 |
| 927 | 3300025912 | Ga0207707_10068594 | Ga0207707_100685944 | 390 |
| 928 | 3300025913 | Ga0207695_10010175 | Ga0207695_100101758 | 390 |
| 929 | 3300025914 | Ga0207671_10033303 | Ga0207671_100333033 | 390 |
| 930 | 3300025917 | Ga0207660_10014917 | Ga0207660_100149175 | 390 |
| 931 | 3300025918 | Ga0207662_10002597 | Ga0207662_100025975 | 390 |
| 932 | 3300025919 | Ga0207657_10088149 | Ga0207657_100881492 | 390 |
| 933 | 3300025920 | Ga0207649_10093288 | Ga0207649_100932882 | 390 |
| 934 | 3300025920 | Ga0207649_10112984 | Ga0207649_101129842 | 390 |
| 935 | 3300025923 | Ga0207681_10008770 | Ga0207681_100087706 | 390 |
| 936 | 3300025925 | Ga0207650_10001837 | Ga0207650_100018378 | 390 |
| 937 | 3300025925 | Ga0207650_10006719 | Ga0207650_100067198 | 390 |
| 938 | 3300025925 | Ga0207650_10021604 | Ga0207650_100216043 | 390 |
| 939 | 3300025925 | Ga0207650_10130941 | Ga0207650_101309413 | 390 |
| 940 | 3300025925 | Ga0207650_10186671 | Ga0207650_101866711 | 390 |
| 941 | 3300025926 | Ga0207659_10001154 | Ga0207659_1000115410 | 390 |
| 942 | 3300025926 | Ga0207659_10001657 | Ga0207659_100016576 | 390 |
| 943 | 3300025927 | Ga0207687_10166300 | Ga0207687_101663001 | 390 |
| 944 | 3300025931 | Ga0207644_10003202 | Ga0207644_100032024 | 390 |
| 945 | 3300025931 | Ga0207644_10032324 | Ga0207644_100323241 | 390 |
| 946 | 3300025931 | Ga0207644_10047145 | Ga0207644_100471454 | 390 |
| 947 | 3300025931 | Ga0207644_10065110 | Ga0207644_100651103 | 390 |
| 948 | 3300025931 | Ga0207644_10129635 | Ga0207644_101296352 | 390 |
| 949 | 3300025932 | Ga0207690_10077284 | Ga0207690_100772841 | 390 |
| 950 | 3300025933 | Ga0207706_10000499 | Ga0207706_100004999 | 390 |
| 951 | 3300025935 | Ga0207709_10002721 | Ga0207709_100027215 | 390 |
| 952 | 3300025935 | Ga0207709_10005799 | Ga0207709_100057992 | 390 |
| 953 | 3300025935 | Ga0207709_10067926 | Ga0207709_100679262 | 390 |
| 954 | 3300025937 | Ga0207669_10003780 | Ga0207669_100037806 | 390 |
| 955 | 3300025938 | Ga0207704_10063492 | Ga0207704_100634922 | 390 |
| 956 | 3300025940 | Ga0207691_10000511 | Ga0207691_1000051131 | 390 |
| 957 | 3300025940 | Ga0207691_10024751 | Ga0207691_100247516 | 390 |
| 958 | 3300025940 | Ga0207691_10034076 | Ga0207691_100340765 | 390 |
| 959 | 3300025940 | Ga0207691_10035416 | Ga0207691_100354162 | 390 |
| 960 | 3300025940 | Ga0207691_10129050 | Ga0207691_101290502 | 390 |
| 961 | 3300025940 | Ga0207691_10142036 | Ga0207691_101420362 | 390 |
| 962 | 3300025941 | Ga0207711_10011343 | Ga0207711_100113436 | 390 |
| 963 | 3300025941 | Ga0207711_10020600 | Ga0207711_100206005 | 390 |
| 964 | 3300025941 | Ga0207711_10179547 | Ga0207711_101795472 | 390 |
| 965 | 3300025941 | Ga0207711_10212709 | Ga0207711_102127091 | 390 |
| 966 | 3300025942 | Ga0207689_10003209 | Ga0207689_100032098 | 390 |
| 967 | 3300025942 | Ga0207689_10120235 | Ga0207689_101202352 | 390 |
| 968 | 3300025944 | Ga0207661_10052592 | Ga0207661_100525924 | 390 |
| 969 | 3300025945 | Ga0207679_10090162 | Ga0207679_100901623 | 390 |
| 970 | 3300025945 | Ga0207679_10222625 | Ga0207679_102226252 | 390 |
| 971 | 3300025949 | Ga0207667_10084418 | Ga0207667_100844183 | 390 |
| 972 | 3300025949 | Ga0207667_10114793 | Ga0207667_101147932 | 390 |
| 973 | 3300025960 | Ga0207651_10016902 | Ga0207651_100169021 | 390 |
| 974 | 3300025960 | Ga0207651_10018036 | Ga0207651_100180363 | 390 |
| 975 | 3300025960 | Ga0207651_10087447 | Ga0207651_100874472 | 390 |
| 976 | 3300025961 | Ga0207712_10009755 | Ga0207712_100097556 | 390 |
| 977 | 3300025961 | Ga0207712_10198231 | Ga0207712_101982311 | 390 |
| 978 | 3300025981 | Ga0207640_10042398 | Ga0207640_100423982 | 390 |
| 979 | 3300025986 | Ga0207658_10001749 | Ga0207658_100017495 | 390 |
| 980 | 3300025986 | Ga0207658_10013291 | Ga0207658_100132912 | 390 |
| 981 | 3300025986 | Ga0207658_10033908 | Ga0207658_100339082 | 390 |
| 982 | 3300025986 | Ga0207658_10074735 | Ga0207658_100747352 | 390 |
| 983 | 3300025986 | Ga0207658_10237765 | Ga0207658_102377651 | 390 |
| 984 | 3300026023 | Ga0207677_10001579 | Ga0207677_1000157910 | 390 |
| 985 | 3300026023 | Ga0207677_10067151 | Ga0207677_100671514 | 390 |
| 986 | 3300026023 | Ga0207677_10090461 | Ga0207677_100904612 | 390 |
| 987 | 3300026023 | Ga0207677_10094849 | Ga0207677_100948494 | 390 |
| 988 | 3300026035 | Ga0207703_10005816 | Ga0207703_100058165 | 390 |
| 989 | 3300026035 | Ga0207703_10007010 | Ga0207703_100070105 | 390 |
| 990 | 3300026035 | Ga0207703_10063397 | Ga0207703_100633972 | 390 |
| 991 | 3300026067 | Ga0207678_10001741 | Ga0207678_1000174121 | 390 |
| 992 | 3300026067 | Ga0207678_10042038 | Ga0207678_100420382 | 390 |
| 993 | 3300026067 | Ga0207678_10097384 | Ga0207678_100973842 | 390 |
| 994 | 3300026075 | Ga0207708_10019691 | Ga0207708_100196914 | 390 |
| 995 | 3300026075 | Ga0207708_10022978 | Ga0207708_100229784 | 390 |
| 996 | 3300026078 | Ga0207702_10001261 | Ga0207702_1000126115 | 390 |
| 997 | 3300026078 | Ga0207702_10005418 | Ga0207702_100054184 | 390 |
| 998 | 3300026088 | Ga0207641_10005241 | Ga0207641_1000524110 | 390 |
| 999 | 3300026088 | Ga0207641_10229931 | Ga0207641_102299312 | 390 |
| 1000 | 3300026089 | Ga0207648_10000053 | Ga0207648_1000005391 | 390 |
| 1001 | 3300026089 | Ga0207648_10003753 | Ga0207648_100037534 | 390 |
| 1002 | 3300026089 | Ga0207648_10012937 | Ga0207648_100129376 | 390 |
| 1003 | 3300026089 | Ga0207648_10071700 | Ga0207648_100717002 | 390 |
| 1004 | 3300026095 | Ga0207676_10007553 | Ga0207676_100075534 | 390 |
| 1005 | 3300026095 | Ga0207676_10016812 | Ga0207676_100168124 | 390 |
| 1006 | 3300026095 | Ga0207676_10107975 | Ga0207676_101079752 | 390 |
| 1007 | 3300026095 | Ga0207676_10305798 | Ga0207676_103057981 | 390 |
| 1008 | 3300026116 | Ga0207674_10052728 | Ga0207674_100527284 | 390 |
| 1009 | 3300026118 | Ga0207675_100002925 | Ga0207675_10000292516 | 390 |
| 1010 | 3300026118 | Ga0207675_100004928 | Ga0207675_10000492810 | 390 |
| 1011 | 3300026118 | Ga0207675_100026001 | Ga0207675_1000260012 | 390 |
| 1012 | 3300026118 | Ga0207675_100038504 | Ga0207675_1000385044 | 390 |
| 1013 | 3300026118 | Ga0207675_100084556 | Ga0207675_1000845563 | 390 |
| 1014 | 3300026118 | Ga0207675_100133907 | Ga0207675_1001339072 | 390 |
| 1015 | 3300026121 | Ga0207683_10008024 | Ga0207683_100080246 | 390 |
| 1016 | 3300026121 | Ga0207683_10080738 | Ga0207683_100807381 | 390 |
| 1017 | 3300026121 | Ga0207683_10160742 | Ga0207683_101607422 | 390 |
| 1018 | 3300026121 | Ga0207683_10270416 | Ga0207683_102704162 | 390 |
| 1019 | 3300026142 | Ga0207698_10038535 | Ga0207698_100385352 | 390 |
| 1020 | 3300026142 | Ga0207698_10057783 | Ga0207698_100577832 | 390 |
| 1021 | 3300027111 | Ga0209281_1000103 | Ga0209281_1000103179 | 390 |
| 1022 | 3300027876 | Ga0209974_10001308 | Ga0209974_100013089 | 390 |
| 1023 | 3300028379 | Ga0268266_10343695 | Ga0268266_103436951 | 390 |
| 1024 | 3300028380 | Ga0268265_10007752 | Ga0268265_100077526 | 390 |
| 1025 | 3300028380 | Ga0268265_10103334 | Ga0268265_101033342 | 390 |
| 1026 | 3300028381 | Ga0268264_10005622 | Ga0268264_100056229 | 390 |
| 1027 | 3300028381 | Ga0268264_10011457 | Ga0268264_100114572 | 390 |
| 1028 | 3300028381 | Ga0268264_10063241 | Ga0268264_100632414 | 390 |
| 1029 | 3300028381 | Ga0268264_10315708 | Ga0268264_103157082 | 390 |
| 1030 | 3300028666 | Ga0265336_10000053 | Ga0265336_10000053106 | 390 |
| 1031 | 3300028786 | Ga0307517_10001511 | Ga0307517_1000151119 | 390 |
| 1032 | 3300028786 | Ga0307517_10126743 | Ga0307517_101267431 | 390 |
| 1033 | 3300028794 | Ga0307515_10000188 | Ga0307515_1000018847 | 390 |
| 1034 | 3300028794 | Ga0307515_10000708 | Ga0307515_1000070822 | 390 |
| 1035 | 3300028794 | Ga0307515_10002191 | Ga0307515_1000219132 | 390 |
| 1036 | 3300028794 | Ga0307515_10002971 | Ga0307515_100029715 | 390 |
| 1037 | 3300028794 | Ga0307515_10013083 | Ga0307515_100130836 | 390 |
| 1038 | 3300028794 | Ga0307515_10048737 | Ga0307515_100487376 | 390 |
| 1039 | 3300028794 | Ga0307515_10071988 | Ga0307515_100719881 | 390 |
| 1040 | 3300028794 | Ga0307515_10086241 | Ga0307515_100862412 | 390 |
| 1041 | 3300028794 | Ga0307515_10121393 | Ga0307515_101213933 | 390 |
| 1042 | 3300028794 | Ga0307515_10131234 | Ga0307515_101312344 | 390 |
| 1043 | 3300029957 | Ga0265324_10000132 | Ga0265324_1000013255 | 390 |
| 1044 | 3300030522 | Ga0307512_10106359 | Ga0307512_101063591 | 390 |
| 1045 | 3300031456 | Ga0307513_10037752 | Ga0307513_100377522 | 390 |
| 1046 | 3300031456 | Ga0307513_10056487 | Ga0307513_100564872 | 390 |
| 1047 | 3300031456 | Ga0307513_10057757 | Ga0307513_100577572 | 390 |
| 1048 | 3300031456 | Ga0307513_10157651 | Ga0307513_101576514 | 390 |
| 1049 | 3300031507 | Ga0307509_10003552 | Ga0307509_1000355221 | 390 |
| 1050 | 3300031507 | Ga0307509_10004884 | Ga0307509_100048844 | 390 |
| 1051 | 3300031507 | Ga0307509_10011369 | Ga0307509_100113692 | 390 |
| 1052 | 3300031507 | Ga0307509_10030410 | Ga0307509_100304104 | 390 |
| 1053 | 3300031507 | Ga0307509_10049375 | Ga0307509_100493753 | 390 |
| 1054 | 3300031616 | Ga0307508_10000169 | Ga0307508_1000016957 | 390 |
| 1055 | 3300031616 | Ga0307508_10002731 | Ga0307508_100027312 | 390 |
| 1056 | 3300031616 | Ga0307508_10214365 | Ga0307508_102143652 | 390 |
| 1057 | 3300031649 | Ga0307514_10014677 | Ga0307514_100146776 | 390 |
| 1058 | 3300031730 | Ga0307516_10000311 | Ga0307516_1000031113 | 390 |
| 1059 | 3300031730 | Ga0307516_10000678 | Ga0307516_1000067843 | 390 |
| 1060 | 3300031730 | Ga0307516_10004343 | Ga0307516_1000434310 | 390 |
| 1061 | 3300031730 | Ga0307516_10008972 | Ga0307516_100089722 | 390 |
| 1062 | 3300031730 | Ga0307516_10009522 | Ga0307516_100095222 | 390 |
| 1063 | 3300031730 | Ga0307516_10045613 | Ga0307516_100456134 | 390 |
| 1064 | 3300031730 | Ga0307516_10081745 | Ga0307516_100817452 | 390 |
| 1065 | 3300031731 | Ga0307405_10021785 | Ga0307405_100217854 | 390 |
| 1066 | 3300031824 | Ga0307413_10013379 | Ga0307413_100133793 | 390 |
| 1067 | 3300031824 | Ga0307413_10088722 | Ga0307413_100887223 | 390 |
| 1068 | 3300031852 | Ga0307410_10032495 | Ga0307410_100324953 | 390 |
| 1069 | 3300031901 | Ga0307406_10010926 | Ga0307406_100109261 | 390 |
| 1070 | 3300031911 | Ga0307412_10006540 | Ga0307412_100065406 | 390 |
| 1071 | 3300031911 | Ga0307412_10181360 | Ga0307412_101813602 | 390 |
| 1072 | 3300031995 | Ga0307409_100000189 | Ga0307409_1000001896 | 390 |
| 1073 | 3300031995 | Ga0307409_100006670 | Ga0307409_1000066704 | 390 |
| 1074 | 3300032002 | Ga0307416_100001876 | Ga0307416_1000018767 | 390 |
| 1075 | 3300032005 | Ga0307411_10131372 | Ga0307411_101313722 | 390 |
| 1076 | 3300032126 | Ga0307415_100019230 | Ga0307415_1000192304 | 390 |
| 1077 | 3300032126 | Ga0307415_100027523 | Ga0307415_1000275234 | 390 |
| 1078 | 3300033179 | Ga0307507_10018253 | Ga0307507_100182536 | 390 |
| 1079 | 3300033179 | Ga0307507_10021035 | Ga0307507_100210354 | 390 |
| 1080 | 3300033180 | Ga0307510_10068525 | Ga0307510_100685254 | 390 |
| 1081 | 3300035111 | Ga0373923_0077768 | Ga0373923_0077768_129_1355 | 390 |
| 1082 | 3300035691 | Ga0373931_0002251 | Ga0373931_0002251_5255_6478 | 390 |
| 1083 | 3300035691 | Ga0373931_0014186 | Ga0373931_0014186_11_1216 | 390 |
| 1084 | 3300035691 | Ga0373931_0016238 | Ga0373931_0016238_1423_2643 | 390 |
| 1085 | 3300036401 | Ga0373937_0100521 | Ga0373937_0100521_914_2134 | 390 |
| 1086 | 3300037068 | Ga0373925_0034529 | Ga0373925_0034529_2207_3439 | 390 |
| 1087 | 3300037068 | Ga0373925_0128586 | Ga0373925_0128586_234_1457 | 390 |
| 1088 | 3300037466 | Ga0395898_0001532 | Ga0395898_0001532_6366_7574 | 390 |
| 1089 | 3300037471 | Ga0395905_0017710 | Ga0395905_0017710_5384_6607 | 390 |
| 1090 | 3300037471 | Ga0395905_0034757 | Ga0395905_0034757_1020_2243 | 390 |
| 1091 | 3300037471 | Ga0395905_0042849 | Ga0395905_0042849_2452_3675 | 390 |
| 1092 | 3300037471 | Ga0395905_0113532 | Ga0395905_0113532_1243_2466 | 390 |
| 1093 | 3300037471 | Ga0395905_0187142 | Ga0395905_0187142_410_1636 | 390 |
| 1094 | 3300039437 | Ga0436365_0350119 | Ga0436365_0350119_823_2043 | 390 |
| 1095 | 3300039437 | Ga0436365_0760616 | Ga0436365_0760616_136_1359 | 390 |
| 1096 | 3300039447 | Ga0436361_0338967 | Ga0436361_0338967_3315_4538 | 390 |
| 1097 | 3300039447 | Ga0436361_0709657 | Ga0436361_0709657_409_1632 | 390 |
| 1098 | 3300041452 | Ga0451793_1605648 | Ga0451793_1605648_107_1333 | 390 |
| 1099 | 3300041452 | Ga0451793_1651023 | Ga0451793_1651023_151_1374 | 390 |
| 1100 | 3300041456 | Ga0451795_0983196 | Ga0451795_0983196_136_1359 | 390 |
| 1101 | 3300041458 | Ga0451798_0142848 | Ga0451798_0142848_813_2039 | 390 |
| 1102 | 3300041459 | Ga0451800_0241174 | Ga0451800_0241174_354_1580 | 390 |
| 1103 | 3300041460 | Ga0451802_0447858 | Ga0451802_0447858_403_1626 | 390 |
| 1104 | 3300041498 | Ga0451841_0619619 | Ga0451841_0619619_672_1895 | 390 |
| 1105 | 3300041512 | Ga0451853_0383239 | Ga0451853_0383239_1244_2467 | 390 |
| 1106 | 3300041512 | Ga0451853_1507922 | Ga0451853_1507922_1335_2561 | 390 |
| 1107 | 3300041512 | Ga0451853_2429987 | Ga0451853_2429987_176_1396 | 390 |
| 1108 | 3300042435 | Ga0439434_0051958 | Ga0439434_0051958_17_1240 | 390 |
| 1109 | 3300042531 | Ga0450918_003930 | Ga0450918_003930_1487_2710 | 390 |
| 1110 | 3300042876 | Ga0451577_0000152 | Ga0451577_0000152_121727_122935 | 390 |
| 1111 | 3300042876 | Ga0451577_0004023 | Ga0451577_0004023_14235_15461 | 390 |
| 1112 | 3300042876 | Ga0451577_0030135 | Ga0451577_0030135_2711_3937 | 390 |
| 1113 | 3300044656 | Ga0466969_0005210 | Ga0466969_0005210_1680_2906 | 390 |
| 1114 | 3300044656 | Ga0466969_0012595 | Ga0466969_0012595_3011_4234 | 390 |
| 1115 | 3300044656 | Ga0466969_0076686 | Ga0466969_0076686_93_1316 | 390 |
| 1116 | 3300044683 | Ga0466965_0018908 | Ga0466965_0018908_1982_3208 | 390 |
| 1117 | 3300044684 | Ga0466966_0000687 | Ga0466966_0000687_5178_6401 | 390 |
| 1118 | 3300044684 | Ga0466966_0002631 | Ga0466966_0002631_8240_9463 | 390 |
| 1119 | 3300044684 | Ga0466966_0080940 | Ga0466966_0080940_739_1962 | 390 |
| 1120 | 3300044693 | Ga0466961_0007342 | Ga0466961_0007342_1094_2317 | 390 |
| 1121 | 3300044694 | Ga0466963_0014486 | Ga0466963_0014486_3282_4505 | 390 |
| 1122 | 3300044706 | Ga0466964_0002848 | Ga0466964_0002848_4258_5484 | 390 |
| 1123 | 3300044712 | Ga0453684_0000122 | Ga0453684_0000122_179508_180716 | 390 |
| 1124 | 3300044712 | Ga0453684_0197635 | Ga0453684_0197635_447_1673 | 390 |
| 1125 | 3300044719 | Ga0466971_0005142 | Ga0466971_0005142_1791_3017 | 390 |
| 1126 | 3300044765 | Ga0466970_0005981 | Ga0466970_0005981_1451_2674 | 390 |
| 1127 | 3300044842 | Ga0466957_0020799 | Ga0466957_0020799_378_1601 | 390 |
| 1128 | 3300045049 | Ga0466959_0000287 | Ga0466959_0000287_10959_12182 | 390 |
| 1129 | 3300045049 | Ga0466959_0057239 | Ga0466959_0057239_774_1982 | 390 |
| 1130 | 3300045051 | Ga0451576_0051233 | Ga0451576_0051233_333_1553 | 390 |
| 1131 | 3300045051 | Ga0451576_0297220 | Ga0451576_0297220_254_1462 | 390 |
| 1132 | 3300045836 | Ga0466958_0011505 | Ga0466958_0011505_2880_4106 | 390 |
| 1133 | 3300045836 | Ga0466958_0063425 | Ga0466958_0063425_183_1406 | 390 |
| 1134 | 3300046454 | Ga0495592_0000250 | Ga0495592_0000250_43900_45123 | 390 |
| 1135 | 3300046475 | Ga0495639_0037468 | Ga0495639_0037468_492_1718 | 390 |
| 1136 | 3300046507 | Ga0495606_0002998 | Ga0495606_0002998_14848_16074 | 390 |
| 1137 | 3300046515 | Ga0495620_0042573 | Ga0495620_0042573_627_1850 | 390 |
| 1138 | 3300046516 | Ga0495628_0165170 | Ga0495628_0165170_379_1599 | 390 |
| 1139 | 3300046519 | Ga0495632_0005520 | Ga0495632_0005520_4359_5582 | 390 |
| 1140 | 3300046542 | Ga0495597_0059772 | Ga0495597_0059772_212_1495 | 390 |
| 1141 | 3300046660 | Ga0495625_0004137 | Ga0495625_0004137_10020_11243 | 390 |
| 1142 | 3300046660 | Ga0495625_0004296 | Ga0495625_0004296_98_1321 | 390 |
| 1143 | 3300046683 | Ga0495658_0041870 | Ga0495658_0041870_207_1427 | 390 |
| 1144 | 3300046694 | Ga0495649_0001463 | Ga0495649_0001463_8625_9851 | 390 |
| 1145 | 3300046694 | Ga0495649_0004909 | Ga0495649_0004909_6643_7866 | 390 |
| 1146 | 3300047443 | Ga0495687_000700 | Ga0495687_000700_31868_33151 | 390 |
| 1147 | 3300047443 | Ga0495687_012571 | Ga0495687_012571_1674_2897 | 390 |
| 1148 | 3300047472 | Ga0495686_0003614 | Ga0495686_0003614_4421_5629 | 390 |
| 1149 | 3300048091 | Ga0495626_0022313 | Ga0495626_0022313_836_2059 | 390 |
| 1150 | 3300048904 | Ga0496101_0212307 | Ga0496101_0212307_109_1332 | 390 |
| 1151 | 3300048905 | Ga0496102_0008930 | Ga0496102_0008930_3418_4632 | 390 |
| 1152 | 3300048905 | Ga0496102_0015155 | Ga0496102_0015155_3720_4943 | 390 |
| 1153 | 3300048905 | Ga0496102_0047897 | Ga0496102_0047897_293_1513 | 390 |
| 1154 | 3300048908 | Ga0496105_0030017 | Ga0496105_0030017_3004_4227 | 390 |
| 1155 | 3300048908 | Ga0496105_0134301 | Ga0496105_0134301_724_1944 | 390 |
| 1156 | 3300048909 | Ga0496106_0005942 | Ga0496106_0005942_6067_7287 | 390 |
| 1157 | 3300048911 | Ga0496108_0105917 | Ga0496108_0105917_27_1250 | 390 |
| 1158 | 3300048912 | Ga0496109_0063912 | Ga0496109_0063912_2033_3253 | 390 |
| 1159 | 3300048912 | Ga0496109_0118393 | Ga0496109_0118393_1200_2423 | 390 |
| 1160 | 3300048912 | Ga0496109_0168704 | Ga0496109_0168704_630_1850 | 390 |
| 1161 | 3300048913 | Ga0496110_0125528 | Ga0496110_0125528_470_1690 | 390 |
| 1162 | 3300048915 | Ga0496112_0029309 | Ga0496112_0029309_2729_3952 | 390 |
| 1163 | 3300048916 | Ga0496113_0221609 | Ga0496113_0221609_32_1255 | 390 |
| 1164 | 3300048917 | Ga0496114_0038012 | Ga0496114_0038012_1012_2235 | 390 |
| 1165 | 3300048927 | Ga0496124_0000086 | Ga0496124_0000086_155938_157161 | 390 |
| 1166 | 3300048927 | Ga0496124_0032613 | Ga0496124_0032613_1697_2920 | 390 |
| 1167 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_104821_106044 | 390 |
| 1168 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_104904_106127 | 390 |
| 1169 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_128086_129309 | 390 |
| 1170 | 3300049582 | Ga0501048_0009085 | Ga0501048_0009085_5788_7011 | 390 |
| 1171 | 3300049824 | Ga0501045_0001048 | Ga0501045_0001048_15628_16851 | 390 |
| 1172 | 3300050490 | nmdc:mga03n38_11656_c1 | nmdc:mga03n38_11656_c1_247_1470 | 390 |
| 1173 | 3300050491 | nmdc:mga00v17_14156_c1 | nmdc:mga00v17_14156_c1_3208_4434 | 390 |
| 1174 | 3300050493 | nmdc:mga0k408_10272_c1 | nmdc:mga0k408_10272_c1_1578_2801 | 390 |
| 1175 | 3300050493 | nmdc:mga0k408_122783_c1 | nmdc:mga0k408_122783_c1_209_1438 | 390 |
| 1176 | 3300050493 | nmdc:mga0k408_134_c1 | nmdc:mga0k408_134_c1_17495_18718 | 390 |
| 1177 | 3300050493 | nmdc:mga0k408_14316_c1 | nmdc:mga0k408_14316_c1_1596_2819 | 390 |
| 1178 | 3300050493 | nmdc:mga0k408_20201_c1 | nmdc:mga0k408_20201_c1_54_1277 | 390 |
| 1179 | 3300050493 | nmdc:mga0k408_2894_c1 | nmdc:mga0k408_2894_c1_751_1974 | 390 |
| 1180 | 3300050493 | nmdc:mga0k408_52536_c1 | nmdc:mga0k408_52536_c1_434_1657 | 390 |
| 1181 | 3300050493 | nmdc:mga0k408_533_c1 | nmdc:mga0k408_533_c1_941_2164 | 390 |
| 1182 | 3300050493 | nmdc:mga0k408_62846_c1 | nmdc:mga0k408_62846_c1_807_2030 | 390 |
| 1183 | 3300050493 | nmdc:mga0k408_951_c2 | nmdc:mga0k408_951_c2_840_2063 | 390 |
| 1184 | 3300050496 | nmdc:mga07m45_11093_c1 | nmdc:mga07m45_11093_c1_2736_3959 | 390 |
| 1185 | 3300050496 | nmdc:mga07m45_142405_c1 | nmdc:mga07m45_142405_c1_32_1255 | 390 |
| 1186 | 3300050496 | nmdc:mga07m45_18036_c1 | nmdc:mga07m45_18036_c1_2326_3549 | 390 |
| 1187 | 3300050496 | nmdc:mga07m45_4460_c1 | nmdc:mga07m45_4460_c1_1465_2688 | 390 |
| 1188 | 3300050496 | nmdc:mga07m45_5487_c1 | nmdc:mga07m45_5487_c1_689_1915 | 390 |
| 1189 | 3300050496 | nmdc:mga07m45_75_c1 | nmdc:mga07m45_75_c1_1776_2999 | 390 |
| 1190 | 3300050496 | nmdc:mga07m45_969_c1 | nmdc:mga07m45_969_c1_6568_7794 | 390 |
| 1191 | 3300050511 | nmdc:mga08y16_312129_c1 | nmdc:mga08y16_312129_c1_172_1392 | 390 |
| 1192 | 3300050512 | nmdc:mga0n895_165330_c1 | nmdc:mga0n895_165330_c1_146_1366 | 390 |
| 1193 | 3300050516 | nmdc:mga0sz30_12949_c1 | nmdc:mga0sz30_12949_c1_52_1275 | 390 |
| 1194 | 3300050516 | nmdc:mga0sz30_13505_c1 | nmdc:mga0sz30_13505_c1_1385_2611 | 390 |
| 1195 | 3300053080 | Ga0500635_0000083 | Ga0500635_0000083_41675_42901 | 390 |
| 1196 | 3300053086 | Ga0500578_0000058 | Ga0500578_0000058_99762_100976 | 390 |
| 1197 | 3300053118 | Ga0500594_0000346 | Ga0500594_0000346_224_1447 | 390 |
| 1198 | 3300053129 | Ga0500628_000906 | Ga0500628_000906_280_1506 | 390 |
| 1199 | 3300053130 | Ga0500642_0000990 | Ga0500642_0000990_4682_5908 | 390 |
| 1200 | 3300053131 | Ga0500652_000300 | Ga0500652_000300_4024_5250 | 390 |
| 1201 | 3300053134 | Ga0500658_0005042 | Ga0500658_0005042_2388_3611 | 390 |
| 1202 | 3300053134 | Ga0500658_0021081 | Ga0500658_0021081_678_1901 | 390 |
| 1203 | 3300053136 | Ga0500559_0000076 | Ga0500559_0000076_10118_11341 | 390 |
| 1204 | 3300053139 | Ga0500568_0010776 | Ga0500568_0010776_186_1436 | 390 |
| 1205 | 3300053139 | Ga0500568_0028309 | Ga0500568_0028309_982_2208 | 390 |
| 1206 | 3300053142 | Ga0500577_0013682 | Ga0500577_0013682_1088_2314 | 390 |
| 1207 | 3300053154 | Ga0500619_000040 | Ga0500619_000040_3820_5043 | 390 |
| 1208 | 3300053156 | Ga0500622_0000094 | Ga0500622_0000094_51830_53056 | 390 |
| 1209 | 3300053156 | Ga0500622_0001530 | Ga0500622_0001530_10768_11991 | 390 |
| 1210 | 3300053156 | Ga0500622_0001780 | Ga0500622_0001780_7491_8714 | 390 |
| 1211 | 3300053156 | Ga0500622_0054734 | Ga0500622_0054734_547_1764 | 390 |
| 1212 | 3300053724 | Ga0500570_034372 | Ga0500570_034372_994_2220 | 390 |
| 1213 | 3300053730 | Ga0500645_007534 | Ga0500645_007534_2309_3532 | 390 |
| 1214 | 3300053739 | Ga0500587_000079 | Ga0500587_000079_3212_4435 | 390 |
| 1215 | 3300053739 | Ga0500587_004174 | Ga0500587_004174_714_1937 | 390 |
| 1216 | 3300059421 | Ga0590071_010060 | Ga0590071_010060_885_2108 | 390 |
| 1217 | 3300061719 | Ga0466962_0002972 | Ga0466962_0002972_3752_4978 | 390 |
| 1218 | iso_pu_bacteria | 2585428057 | 2587728350 | 390 |
| 1219 | iso_pu_bacteria | 2585428058 | 2587735517 | 390 |
| 1220 | iso_pu_bacteria | 2585428062 | 2587758608 | 390 |
| 1221 | iso_pu_bacteria | 2588253510 | 2588294092 | 390 |
| 1222 | iso_pu_bacteria | 2643221592 | 2643970321 | 390 |
| 1223 | iso_pu_bacteria | 2643221625 | 2644139623 | 390 |
| 1224 | iso_pu_bacteria | 2643221644 | 2644246367 | 390 |
| 1225 | iso_pu_bacteria | 2643221648 | 2644272436 | 390 |
| 1226 | iso_pu_bacteria | 2643221654 | 2644303908 | 390 |
| 1227 | 3300001915 | JGI24741J21665_1000133 | JGI24741J21665_100013312 | 391 |
| 1228 | 3300001979 | JGI24740J21852_10000527 | JGI24740J21852_100005276 | 391 |
| 1229 | 3300001979 | JGI24740J21852_10000561 | JGI24740J21852_1000056110 | 391 |
| 1230 | 3300002705 | JGI25156J39149_1003461 | JGI25156J39149_10034612 | 391 |
| 1231 | 3300002738 | JGI25154J39366_1001471 | JGI25154J39366_10014713 | 391 |
| 1232 | 3300003752 | Ga0055539_1000313 | Ga0055539_100031318 | 391 |
| 1233 | 3300003752 | Ga0055539_1005393 | Ga0055539_10053931 | 391 |
| 1234 | 3300003758 | Ga0055532_1000008 | Ga0055532_1000008118 | 391 |
| 1235 | 3300003759 | Ga0055525_1000169 | Ga0055525_100016938 | 391 |
| 1236 | 3300003760 | Ga0055527_1000617 | Ga0055527_10006179 | 391 |
| 1237 | 3300003761 | Ga0055535_1000006 | Ga0055535_1000006274 | 391 |
| 1238 | 3300003762 | Ga0055542_1002372 | Ga0055542_10023726 | 391 |
| 1239 | 3300003763 | Ga0055529_1000025 | Ga0055529_1000025274 | 391 |
| 1240 | 3300003763 | Ga0055529_1000030 | Ga0055529_1000030157 | 391 |
| 1241 | 3300003841 | Ga0055541_1000789 | Ga0055541_10007896 | 391 |
| 1242 | 3300005344 | Ga0070661_100000002 | Ga0070661_100000002138 | 391 |
| 1243 | 3300005455 | Ga0070663_100000007 | Ga0070663_100000007109 | 391 |
| 1244 | 3300005564 | Ga0070664_100000001 | Ga0070664_100000001280 | 391 |
| 1245 | 3300005577 | Ga0068857_100029445 | Ga0068857_1000294455 | 391 |
| 1246 | 3300005578 | Ga0068854_100000009 | Ga0068854_100000009183 | 391 |
| 1247 | 3300005614 | Ga0068856_100000007 | Ga0068856_100000007183 | 391 |
| 1248 | 3300009093 | Ga0105240_10203342 | Ga0105240_102033422 | 391 |
| 1249 | 3300013100 | Ga0157373_10035384 | Ga0157373_100353842 | 391 |
| 1250 | 3300013102 | Ga0157371_10001209 | Ga0157371_1000120917 | 391 |
| 1251 | 3300013104 | Ga0157370_10001652 | Ga0157370_1000165210 | 391 |
| 1252 | 3300013105 | Ga0157369_10077210 | Ga0157369_100772102 | 391 |
| 1253 | 3300013307 | Ga0157372_10005299 | Ga0157372_100052996 | 391 |
| 1254 | 3300020069 | Ga0197907_11214976 | Ga0197907_112149763 | 391 |
| 1255 | 3300020076 | Ga0206355_1356493 | Ga0206355_13564933 | 391 |
| 1256 | 3300020077 | Ga0206351_10095075 | Ga0206351_1009507512 | 391 |
| 1257 | 3300020610 | Ga0154015_1017848 | Ga0154015_101784812 | 391 |
| 1258 | 3300022467 | Ga0224712_10034991 | Ga0224712_100349913 | 391 |
| 1259 | 3300025224 | Ga0209784_100014 | Ga0209784_100014158 | 391 |
| 1260 | 3300025224 | Ga0209784_100365 | Ga0209784_10036515 | 391 |
| 1261 | 3300025225 | Ga0209566_100011 | Ga0209566_100011158 | 391 |
| 1262 | 3300025225 | Ga0209566_100955 | Ga0209566_1009558 | 391 |
| 1263 | 3300025226 | Ga0209674_100032 | Ga0209674_100032327 | 391 |
| 1264 | 3300025226 | Ga0209674_100184 | Ga0209674_1001845 | 391 |
| 1265 | 3300025228 | Ga0209672_100094 | Ga0209672_10009497 | 391 |
| 1266 | 3300025228 | Ga0209672_100517 | Ga0209672_1005179 | 391 |
| 1267 | 3300025229 | Ga0209147_100002 | Ga0209147_100002397 | 391 |
| 1268 | 3300025230 | Ga0209563_100029 | Ga0209563_100029327 | 391 |
| 1269 | 3300025230 | Ga0209563_102706 | Ga0209563_1027063 | 391 |
| 1270 | 3300025242 | Ga0209258_100002 | Ga0209258_100002397 | 391 |
| 1271 | 3300025246 | Ga0209646_1000035 | Ga0209646_1000035257 | 391 |
| 1272 | 3300025250 | Ga0209026_1007281 | Ga0209026_10072811 | 391 |
| 1273 | 3300025253 | Ga0209677_100065 | Ga0209677_100065158 | 391 |
| 1274 | 3300025253 | Ga0209677_102322 | Ga0209677_1023222 | 391 |
| 1275 | 3300025254 | Ga0209148_1000293 | Ga0209148_100029363 | 391 |
| 1276 | 3300025272 | Ga0209455_1000009 | Ga0209455_1000009276 | 391 |
| 1277 | 3300025913 | Ga0207695_10001669 | Ga0207695_1000166933 | 391 |
| 1278 | 3300025920 | Ga0207649_10000231 | Ga0207649_1000023119 | 391 |
| 1279 | 3300025945 | Ga0207679_10000003 | Ga0207679_10000003243 | 391 |
| 1280 | 3300025981 | Ga0207640_10000204 | Ga0207640_100002042 | 391 |
| 1281 | 3300026067 | Ga0207678_10000002 | Ga0207678_10000002111 | 391 |
| 1282 | 3300026078 | Ga0207702_10000080 | Ga0207702_1000008031 | 391 |
| 1283 | 3300026116 | Ga0207674_10004793 | Ga0207674_1000479316 | 391 |
| 1284 | 3300037471 | Ga0395905_0176135 | Ga0395905_0176135_725_1936 | 391 |
| 1285 | 3300044684 | Ga0466966_0001625 | Ga0466966_0001625_12061_13338 | 391 |
| 1286 | 3300044693 | Ga0466961_0001458 | Ga0466961_0001458_9350_10558 | 391 |
| 1287 | 3300044706 | Ga0466964_0001639 | Ga0466964_0001639_3380_4588 | 391 |
| 1288 | 3300044735 | Ga0466968_0006689 | Ga0466968_0006689_1600_2808 | 391 |
| 1289 | 3300044765 | Ga0466970_0005511 | Ga0466970_0005511_796_2004 | 391 |
| 1290 | 3300044842 | Ga0466957_0087085 | Ga0466957_0087085_222_1430 | 391 |
| 1291 | 3300045976 | Ga0466967_0029006 | Ga0466967_0029006_2161_3369 | 391 |
| 1292 | 3300046453 | Ga0495627_029101 | Ga0495627_029101_459_1670 | 391 |
| 1293 | 3300046459 | Ga0495629_0000047 | Ga0495629_0000047_23542_24867 | 391 |
| 1294 | 3300046472 | Ga0495580_0003727 | Ga0495580_0003727_4109_5434 | 391 |
| 1295 | 3300048091 | Ga0495626_0000003 | Ga0495626_0000003_382093_383304 | 391 |
| 1296 | 3300059477 | Ga0587084_001004 | Ga0587084_001004_287_1495 | 391 |
| 1297 | 3300059508 | Ga0587088_001114 | Ga0587088_001114_291_1499 | 391 |
| 1298 | 3300059643 | Ga0587072_000066 | Ga0587072_000066_4522_5730 | 391 |
| 1299 | 3300059650 | Ga0587104_000185 | Ga0587104_000185_285_1493 | 391 |
| 1300 | 3300061719 | Ga0466962_0003937 | Ga0466962_0003937_587_1795 | 391 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zyo-assembly1.cif.gz_A | crystal structure of human integral membrane stearoyl-coa desaturase with substrate | 0.744 | 19 | 253 |
| 4ymk-assembly2.cif.gz_D | crystal structure of stearoyl-coenzyme a desaturase 1 | 0.7301 | 23 | 256 |
| 4zyo-assembly1.cif.gz_A | crystal structure of human integral membrane stearoyl-coa desaturase with substrate | 0.6009 | 19 | 253 |
| 4ymk-assembly2.cif.gz_D | crystal structure of stearoyl-coenzyme a desaturase 1 | 0.5565 | 23 | 256 |
| 5uh7-assembly1.cif.gz_A | crystal structure of beta'mtbsi of mycobacterium tuberculosis rna polymerase | 0.3679 | 251 | 373 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XVQ6_118_225_1.20.120.20 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein | 0.6928 | 330 | 381 | 1.20.120.20 |
| af_P02651_179_332_1.20.120.20 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein | 0.3636 | 267 | 381 | 1.20.120.20 |
| af_Q9XVQ6_118_225_1.20.120.20 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein | 0.3426 | 330 | 381 | 1.20.120.20 |
| af_Q9UNL4_2_105_6.10.140.1740 | Special;Helix non-globular;Helix Hairpins; | 0.3414 | 267 | 380 | 6.10.140.1740 |
| af_I1M8I4_25_155_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.3387 | 269 | 384 | 1.20.930.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519FHA4-F1-model_v4 | deleted | 0.9965 | 2 | 184 |
|
| AF-A0A4Q3ITD2-F1-model_v4 | deleted | 0.9947 | 2 | 171 |
|
| AF-A0A5C8BC37-F1-model_v4 | deleted | 0.9942 | 11 | 246 |
|
| AF-A0A848QJM9-F1-model_v4 | deleted | 0.9939 | 1 | 255 |
|
| AF-A0A382KZD5-F1-model_v4 | Fatty acid desaturase domain-containing protein | 0.993 | 15 | 247 |
GO:0006631
GO:0016020 GO:0016717 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar