F492746

General Info

Members Datasets Scaffolds Average Seq Length
1300 563 1205 401

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1150385|Ga0436361_1150385_43601_44944
Length 447
Sequence VHEDGFFTRRRSAPPLQWNPLFPTRAGAFHLKGGLAQSKDRMNLLSSLFDGFLTWANQGLLDFSVWQIVAYTLITTHITIAAVTIFLHRAQAHRALDLGPIPSHFFRFWLWIGTGMVTKEWVAIHRKHHAKCETEEDPHSPQTRGLSKVMKEGAELYRAESRNQETLAKYSHGVPDDWVERNVYSRYSWQGVGLMLILNLALFGALGATVWAVQMVWIPFFAAGVVNGVGHFWGYRNFEAPDASTNISPWGIIIGGEELHNNHHTYPTSAKFSVKKGEFDIGWVYIRALEAIGWAKVRKTAPKLQTGDIRDADKQTLDAVISNRYEVMASYGRRLQAACAAELSRLKAEGAQQTARFKQFKLAQRWLHRDHDRIPAEVHGELAHARAASPVLDMLVVMREELRQLWTRTNVSAEQLVADLQAWCLRAEASGIAELRNFSLALRTARA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
6 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
9 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
10 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
16 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
17 2643221569 Achromobacter sp. Root565 Isolate Unclassified
18 2643221570 Acidovorax sp. Root568 Isolate Unclassified
19 2643221585 Pelomonas sp. Root662 Isolate Unclassified
20 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
21 2643221594 Achromobacter sp. Root170 Isolate Unclassified
22 2643221596 Acidovorax sp. Root70 Isolate Unclassified
23 2643221609 Acidovorax sp. Root217 Isolate Unclassified
24 2643221611 Acidovorax sp. Root219 Isolate Unclassified
25 2643221621 Achromobacter sp. Root83 Isolate Unclassified
26 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
27 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
28 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
29 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
30 2643221652 Acidovorax sp. Root402 Isolate Unclassified
31 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
32 2643221656 Pelomonas sp. Root405 Isolate Unclassified
33 2643221658 Variovorax sp. Root411 Isolate Unclassified
34 2643221672 Variovorax sp. Root434 Isolate Unclassified
35 2643221683 Variovorax sp. Root473 Isolate Unclassified
36 2643221717 Acidovorax sp. Root267 Isolate Unclassified
37 2738541277 Variovorax sp. GV051 Isolate Unclassified
38 2738541307 Variovorax sp. GV008 Isolate Unclassified
39 2738541337 Pelomonas sp. BT06 Isolate Unclassified
40 2738543012 Acidovorax sp. CF301 Isolate Unclassified
41 2738543013 Variovorax sp. BT01 Isolate Unclassified
42 2738543019 Variovorax sp. GV040 Isolate Unclassified
43 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
44 2816332133 Acidovorax radicis 2721A Isolate Unclassified
45 2818991446 Variovorax sp. 1180 Isolate Unclassified
46 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
47 2831864461 Roseateles noduli HZ7 Isolate Nodule
48 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
49 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
50 2842677519 Variovorax sp. R-72495 Isolate Unclassified
51 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
52 2842733646 Variovorax sp. R-72446 Isolate Unclassified
53 2842747753 Variovorax sp. R-72060 Isolate Unclassified
54 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
55 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
56 2855730933 Achromobacter sp. HZ28 Isolate Nodule
57 2855767633 Achromobacter sp. HZ34 Isolate Nodule
58 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
59 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
60 2858950400 Achromobacter sp. K91 Isolate Unclassified
61 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
62 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
63 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
64 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
65 2885198086 Variovorax sp. 679 Isolate Unclassified
66 2885211737 Variovorax sp. 553 Isolate Unclassified
67 2885266251 Ralstonia sp. SET104 Isolate Nodule
68 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
69 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
70 2899924645 Variovorax sp. 369 Isolate Unclassified
71 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
72 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
73 2904456579 Variovorax sp. 2002 Isolate Unclassified
74 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
75 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
76 2928037797 Variovorax sp. 1126 Isolate Unclassified
77 2928044640 Variovorax sp. 1128 Isolate Unclassified
78 2928051484 Variovorax sp. 1133 Isolate Unclassified
79 2928058823 Ralstonia sp. 1138 Isolate Unclassified
80 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
81 2928070936 Variovorax gossypii 1167 Isolate Unclassified
82 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
83 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
84 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
85 2929520902 Variovorax beijingensis 502 Isolate Unclassified
86 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
87 2941479691
88 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
89 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
90 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
91 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
92 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
93 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
94 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
95 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
96 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
97 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
98 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
99 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
100 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
101 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
102 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
103 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
104 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
105 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
106 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
107 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
108 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
109 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
110 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
111 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
112 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
113 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
114 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
115 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
116 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
117 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
118 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
119 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
120 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
121 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
122 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
123 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
124 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
125 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
126 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
127 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
128 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
129 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
130 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
131 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
132 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
133 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
134 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
135 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
136 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
137 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
138 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
139 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
140 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
141 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
142 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
143 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
144 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
145 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
146 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
147 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
148 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
149 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
150 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
151 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
152 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
153 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
154 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
155 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
156 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
157 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
158 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
159 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
160 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
161 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
162 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
163 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
164 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
165 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
166 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
167 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
168 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
169 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
170 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
171 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
172 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
173 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
174 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
175 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
176 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
177 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
178 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
179 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
180 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
181 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
182 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
183 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
184 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
185 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
186 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
187 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
188 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
189 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
190 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
191 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
192 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
193 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
194 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
195 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
196 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
197 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
198 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
199 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
200 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
201 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
202 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
203 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
204 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
205 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
206 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
207 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
208 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
209 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
210 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
211 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
212 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
213 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
214 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
215 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
216 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
217 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
218 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
219 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
220 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
221 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
222 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
223 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
224 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
225 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
226 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
227 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
228 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
229 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
230 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
231 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
232 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
233 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
234 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
235 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
236 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
237 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
239 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
240 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
241 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
248 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
250 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
251 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
252 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
255 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
256 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
260 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
263 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
265 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
268 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
322 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
325 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
326 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
331 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
332 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
333 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
334 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
335 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
336 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
337 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
338 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
339 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
340 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
341 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
342 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
343 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
344 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
345 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
346 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
347 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
348 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
349 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
350 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
351 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
352 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
353 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
354 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
355 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
356 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
357 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
358 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
359 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
360 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
361 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
362 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
363 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
364 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
365 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
367 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
368 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
373 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
374 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
375 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
376 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
377 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
378 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
379 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
380 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
382 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
383 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
384 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
385 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
386 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
387 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
388 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
389 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
390 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
391 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
392 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
393 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
394 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
395 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
396 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
397 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
398 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
399 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
400 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
401 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
402 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
403 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
404 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
405 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
406 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
407 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
408 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
409 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
410 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
411 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
412 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
413 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
414 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
415 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
416 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
417 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
418 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
419 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
420 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
421 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
422 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
423 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
424 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
425 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
426 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
427 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
428 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
429 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
430 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
431 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
432 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
433 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
434 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
435 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
436 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
437 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
438 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
439 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
440 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
441 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
442 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
443 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
444 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
445 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
446 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
447 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
448 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
449 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
450 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
451 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
452 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
453 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
454 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
455 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
456 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
457 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
458 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
459 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
460 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
461 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
462 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
463 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
464 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
465 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
466 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
467 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
468 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
469 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
470 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
471 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
472 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
473 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
474 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
475 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
476 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
477 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
478 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
479 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
480 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
481 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
482 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
483 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
484 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
485 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
486 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
487 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
488 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
489 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
490 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
505 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
506 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
507 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
508 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
509 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
510 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
511 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
512 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
513 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
516 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
517 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
518 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
519 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
520 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
521 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
522 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
523 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
524 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
525 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
526 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
527 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
528 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
529 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
530 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
531 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
532 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
533 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
534 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
535 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
536 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
537 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
538 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
539 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
540 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
541 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
542 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
543 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
544 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
545 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
546 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
547 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
548 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
549 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
550 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
551 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
552 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.85
Metatranscriptomes 2.85
Isolates 7.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27
Nodule 0.77
Rhizoplane 2.62
Rhizosphere 57.08
Stem 0
Stem Tuber 0
Unclassified 12.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000133 3300001915 Bacteria 20423
2 JGI24740J21852_10000527 3300001979 Bacteria 16316
3 JGI24740J21852_10000561 3300001979 Bacteria 15954
4 JGI25155J39150_1000053 3300002704 Bacteria 74449
5 JGI25156J39149_1000045 3300002705 Bacteria 104173
6 JGI25156J39149_1003461 3300002705 Bacteria 5164
7 JGI25156J39149_1009053 3300002705 Bacteria 2450
8 JGI25154J39366_1000064 3300002738 Bacteria 104148
9 JGI25154J39366_1001471 3300002738 Bacteria 8319
10 JGI25154J39366_1003432 3300002738 Bacteria 3331
11 JGI25154J39366_1003510 3300002738 Bacteria 3256
12 JGI25157J39369_1000018 3300002741 Bacteria 177410
13 JGI25157J39369_1000063 3300002741 Bacteria 104173
14 JGI25150J39212_1003417 3300002774 Bacteria 3715
15 JGI25150J39212_1005429 3300002774 Bacteria 2722
16 JGI25159J45721_1000581 3300002987 Bacteria 16452
17 JGI25159J45721_1002137 3300002987 Bacteria 7723
18 Ga0006778J45830_1016434 3300003162 Bacteria 1374
19 JGI25151J46595_10001460 3300003187 Bacteria 16029
20 JGI25151J46595_10016821 3300003187 Bacteria 3190
21 Ga0006770J48903_1020431 3300003305 Bacteria 1340
22 Ga0006777J48905_1028280 3300003308 Bacteria 1474
23 rootH1_10006215 3300003316 Bacteria 6813
24 rootL2_10000982 3300003322 Bacteria 15080
25 JGI25160J50197_1000517 3300003354 Bacteria 22675
26 JGI25161J50226_1000081 3300003374 Bacteria 78703
27 JGI25161J50226_1001581 3300003374 Bacteria 6656
28 Ga0006562J51391_1011363 3300003578 Bacteria 6660
29 Ga0006562J51391_1011704 3300003578 Bacteria 1384
30 Ga0055539_1000313 3300003752 Bacteria 25199
31 Ga0055539_1005393 3300003752 Bacteria 1664
32 Ga0055533_1000103 3300003756 Bacteria 107860
33 Ga0055532_1000008 3300003758 Bacteria 404753
34 Ga0055525_1000011 3300003759 Bacteria 503124
35 Ga0055525_1000046 3300003759 Bacteria 261587
36 Ga0055525_1000169 3300003759 Bacteria 83336
37 Ga0055527_1000617 3300003760 Bacteria 11304
38 Ga0055535_1000006 3300003761 Bacteria 404753
39 Ga0055535_1000087 3300003761 Bacteria 102655
40 Ga0055535_1000142 3300003761 Bacteria 75104
41 Ga0055542_1000022 3300003762 Bacteria 302315
42 Ga0055542_1002372 3300003762 Bacteria 6378
43 Ga0055529_1000025 3300003763 Bacteria 304757
44 Ga0055529_1000030 3300003763 Bacteria 272455
45 Ga0055529_1000139 3300003763 Bacteria 102943
46 Ga0055526_1001236 3300003771 Bacteria 18319
47 Ga0055526_1017809 3300003771 Bacteria 2690
48 Ga0055537_1000430 3300003773 Bacteria 27230
49 Ga0055537_1002108 3300003773 Bacteria 6986
50 Ga0055537_1004361 3300003773 Bacteria 4060
51 Ga0055537_1006949 3300003773 Bacteria 2796
52 Ga0055524_1000013 3300003775 Bacteria 259850
53 Ga0055524_1000114 3300003775 Bacteria 94476
54 Ga0055524_1001778 3300003775 Bacteria 11841
55 Ga0055524_1005899 3300003775 Bacteria 5397
56 Ga0055536_1011706 3300003781 Bacteria 3330
57 Ga0055534_1000963 3300003784 Bacteria 12782
58 Ga0055534_1000972 3300003784 Bacteria 12709
59 Ga0055528_1000405 3300003790 Bacteria 34965
60 Ga0055528_1002010 3300003790 Bacteria 11406
61 Ga0055528_1014951 3300003790 Bacteria 2832
62 Ga0055530_10000317 3300003791 Bacteria 43667
63 Ga0055530_10001043 3300003791 Bacteria 22076
64 Ga0055530_10004544 3300003791 Bacteria 7088
65 Ga0055530_10004603 3300003791 Bacteria 7027
66 Ga0055540_1000001 3300003792 Bacteria 466834
67 Ga0055540_1000153 3300003792 Bacteria 68176
68 Ga0055540_1003508 3300003792 Bacteria 7551
69 Ga0055540_1003949 3300003792 Bacteria 6924
70 Ga0055540_1019060 3300003792 Bacteria 1860
71 Ga0055531_10000314 3300003794 Bacteria 47668
72 Ga0055531_10000493 3300003794 Bacteria 36200
73 Ga0055531_10002088 3300003794 Bacteria 13726
74 Ga0055531_10002737 3300003794 Bacteria 11585
75 Ga0055531_10007375 3300003794 Bacteria 6022
76 Ga0055531_10015669 3300003794 Bacteria 3321
77 Ga0055541_1000789 3300003841 Bacteria 7895
78 Ga0055543_1000291 3300004625 Bacteria 36133
79 Ga0055543_1005397 3300004625 Bacteria 3271
80 Ga0055543_1007792 3300004625 Bacteria 2439
81 Ga0058858_1433317 3300004785 Bacteria 1439
82 Ga0058859_10135176 3300004798 Bacteria 1348
83 Ga0065165_1000197 3300005262 Bacteria 104294
84 Ga0065165_1000239 3300005262 Bacteria 94061
85 Ga0065165_1005595 3300005262 Bacteria 6968
86 Ga0065165_1005742 3300005262 Bacteria 6822
87 Ga0065165_1007565 3300005262 Bacteria 5300
88 Ga0065704_10079392 3300005289 Bacteria 4177
89 Ga0065704_10135769 3300005289 Bacteria 1573
90 Ga0065707_10084601 3300005295 Bacteria 6997
91 Ga0070658_10042765 3300005327 Bacteria 3660
92 Ga0070658_10082456 3300005327 Bacteria 2642
93 Ga0070658_10150734 3300005327 Bacteria 1947
94 Ga0070676_10001955 3300005328 Bacteria 10482
95 Ga0070676_10039117 3300005328 Bacteria 2741
96 Ga0070676_10162578 3300005328 Bacteria 1438
97 Ga0070683_100081114 3300005329 Bacteria 3037
98 Ga0070683_100093253 3300005329 Bacteria 2829
99 Ga0070670_100000939 3300005331 Bacteria 22858
100 Ga0070670_100023500 3300005331 Bacteria 5306
101 Ga0070670_100043384 3300005331 Bacteria 3865
102 Ga0070670_100184444 3300005331 Bacteria 1812
103 Ga0070677_10002616 3300005333 Bacteria 5764
104 Ga0070677_10005224 3300005333 Bacteria 4272
105 Ga0070677_10035481 3300005333 Bacteria 1934
106 Ga0068869_100002798 3300005334 Bacteria 10571
107 Ga0070666_10111468 3300005335 Bacteria 1892
108 Ga0070666_10218578 3300005335 Bacteria 1343
109 Ga0070680_100012342 3300005336 Bacteria 6635
110 Ga0070682_100167209 3300005337 Bacteria 1525
111 Ga0068868_100004119 3300005338 Bacteria 10161
112 Ga0068868_100045277 3300005338 Bacteria 3442
113 Ga0068868_100050588 3300005338 Bacteria 3264
114 Ga0068868_100076693 3300005338 Bacteria 2673
115 Ga0070689_100008358 3300005340 Bacteria 7290
116 Ga0070661_100000002 3300005344 Bacteria 265686
117 Ga0070661_100012486 3300005344 Bacteria 5941
118 Ga0070668_100140829 3300005347 Bacteria 1943
119 Ga0070669_100066138 3300005353 Bacteria 2664
120 Ga0070675_100003660 3300005354 Bacteria 11691
121 Ga0070675_100003790 3300005354 Bacteria 11481
122 Ga0070675_100026036 3300005354 Bacteria 4691
123 Ga0070675_100031337 3300005354 Bacteria 4298
124 Ga0070675_100124465 3300005354 Bacteria 2193
125 Ga0070675_100271986 3300005354 Bacteria 1487
126 Ga0070671_100002857 3300005355 Bacteria 13429
127 Ga0070671_100017900 3300005355 Bacteria 5746
128 Ga0070671_100035058 3300005355 Bacteria 4156
129 Ga0070671_100042594 3300005355 Bacteria 3774
130 Ga0070671_100043352 3300005355 Bacteria 3738
131 Ga0070671_100064946 3300005355 Bacteria 3040
132 Ga0070671_100106280 3300005355 Bacteria 2356
133 Ga0070671_100118012 3300005355 Bacteria 2231
134 Ga0070671_100146539 3300005355 Bacteria 1993
135 Ga0070674_100004270 3300005356 Bacteria 8131
136 Ga0070674_100156771 3300005356 Bacteria 1723
137 Ga0070673_100002423 3300005364 Bacteria 11361
138 Ga0070673_100021355 3300005364 Bacteria 4692
139 Ga0070673_100044183 3300005364 Bacteria 3449
140 Ga0070673_100103569 3300005364 Bacteria 2349
141 Ga0070688_100006265 3300005365 Bacteria 6344
142 Ga0070659_100003171 3300005366 Bacteria 11710
143 Ga0070667_100001132 3300005367 Bacteria 24302
144 Ga0070667_100002718 3300005367 Bacteria 15313
145 Ga0070667_100081311 3300005367 Bacteria 2772
146 Ga0070667_100081411 3300005367 Bacteria 2771
147 Ga0070667_100122000 3300005367 Bacteria 2267
148 Ga0070663_100000007 3300005455 Bacteria 202632
149 Ga0070663_100021379 3300005455 Bacteria 4303
150 Ga0070663_100022223 3300005455 Bacteria 4237
151 Ga0070663_100209582 3300005455 Bacteria 1525
152 Ga0070678_100014813 3300005456 Bacteria 4932
153 Ga0070678_100017957 3300005456 Bacteria 4572
154 Ga0070678_100037399 3300005456 Bacteria 3408
155 Ga0070678_100231595 3300005456 Bacteria 1540
156 Ga0070662_100004327 3300005457 Bacteria 8967
157 Ga0070662_100009659 3300005457 Bacteria 6311
158 Ga0070662_100015254 3300005457 Bacteria 5143
159 Ga0070662_100016597 3300005457 Bacteria 4947
160 Ga0070681_10019572 3300005458 Bacteria 6777
161 Ga0070681_10182314 3300005458 Bacteria 2021
162 Ga0068867_100000086 3300005459 Bacteria 58298
163 Ga0068867_100003769 3300005459 Bacteria 10673
164 Ga0068867_100003928 3300005459 Bacteria 10466
165 Ga0068867_100005351 3300005459 Bacteria 9070
166 Ga0070707_100175277 3300005468 Bacteria 2090
167 Ga0070698_100084064 3300005471 Bacteria 3172
168 Ga0070679_100023124 3300005530 Bacteria 6081
169 Ga0070679_100179178 3300005530 Bacteria 2092
170 Ga0070672_100001075 3300005543 Bacteria 16635
171 Ga0070672_100079457 3300005543 Bacteria 2626
172 Ga0070672_100135687 3300005543 Bacteria 2026
173 Ga0070672_100183285 3300005543 Bacteria 1745
174 Ga0070686_100182932 3300005544 Bacteria 1490
175 Ga0070665_100099545 3300005548 Bacteria 2911
176 Ga0070665_100108615 3300005548 Bacteria 2777
177 Ga0070665_100112005 3300005548 Bacteria 2731
178 Ga0068855_100041043 3300005563 Bacteria 5487
179 Ga0068855_100221152 3300005563 Bacteria 2123
180 Ga0070664_100000001 3300005564 Bacteria 551832
181 Ga0070664_100004542 3300005564 Bacteria 11136
182 Ga0070664_100096677 3300005564 Bacteria 2563
183 Ga0068857_100007953 3300005577 Bacteria 9152
184 Ga0068857_100029445 3300005577 Bacteria 4845
185 Ga0068857_100127847 3300005577 Bacteria 2290
186 Ga0068857_100164713 3300005577 Bacteria 2013
187 Ga0068854_100000009 3300005578 Bacteria 181432
188 Ga0068854_100067299 3300005578 Bacteria 2609
189 Ga0068854_100203468 3300005578 Bacteria 1558
190 Ga0068856_100000007 3300005614 Bacteria 213669
191 Ga0068856_100008259 3300005614 Bacteria 10149
192 Ga0070702_100123102 3300005615 Bacteria 1626
193 Ga0068852_100080615 3300005616 Bacteria 2886
194 Ga0068852_100126184 3300005616 Bacteria 2350
195 Ga0068852_100148792 3300005616 Bacteria 2175
196 Ga0068859_100060955 3300005617 Bacteria 3801
197 Ga0068859_100092966 3300005617 Bacteria 3068
198 Ga0068864_100001313 3300005618 Bacteria 20690
199 Ga0068864_100013771 3300005618 Bacteria 6706
200 Ga0068864_100203793 3300005618 Bacteria 1818
201 Ga0068864_100220720 3300005618 Bacteria 1749
202 Ga0068866_10041851 3300005718 Bacteria 2276
203 Ga0068861_100004782 3300005719 Bacteria 9099
204 Ga0068861_100016063 3300005719 Bacteria 5287
205 Ga0068861_100034130 3300005719 Bacteria 3760
206 Ga0068861_100046860 3300005719 Bacteria 3261
207 Ga0068861_100069495 3300005719 Bacteria 2725
208 Ga0068851_10104349 3300005834 Bacteria 1507
209 Ga0068851_10110720 3300005834 Bacteria 1465
210 Ga0068870_10102541 3300005840 Bacteria 1620
211 Ga0068863_100019781 3300005841 Bacteria 6439
212 Ga0068858_100017353 3300005842 Bacteria 6752
213 Ga0068858_100031050 3300005842 Bacteria 4961
214 Ga0068858_100050526 3300005842 Bacteria 3848
215 Ga0068860_100000685 3300005843 Bacteria 39158
216 Ga0068860_100014044 3300005843 Bacteria 7856
217 Ga0068860_100022963 3300005843 Bacteria 6032
218 Ga0068860_100063757 3300005843 Bacteria 3500
219 Ga0068860_100099993 3300005843 Bacteria 2766
220 Ga0068862_100011753 3300005844 Bacteria 7225
221 Ga0068862_100022287 3300005844 Bacteria 5297
222 Ga0075365_10000227 3300006038 Bacteria 19112
223 Ga0075365_10002710 3300006038 Bacteria 8823
224 Ga0075365_10003284 3300006038 Bacteria 8295
225 Ga0075368_10014400 3300006042 Bacteria 2921
226 Ga0075368_10019630 3300006042 Bacteria 2552
227 Ga0075368_10024443 3300006042 Bacteria 2315
228 Ga0075368_10053543 3300006042 Bacteria 1607
229 Ga0075363_100004105 3300006048 Bacteria 6315
230 Ga0075363_100010719 3300006048 Bacteria 4366
231 Ga0075363_100035250 3300006048 Bacteria 2617
232 Ga0075363_100037680 3300006048 Bacteria 2540
233 Ga0075363_100067436 3300006048 Bacteria 1939
234 Ga0075364_10001197 3300006051 Bacteria 13931
235 Ga0075364_10003065 3300006051 Bacteria 9441
236 Ga0075364_10007708 3300006051 Bacteria 6406
237 Ga0075364_10014953 3300006051 Bacteria 4803
238 Ga0075364_10015326 3300006051 Bacteria 4752
239 Ga0075364_10018465 3300006051 Bacteria 4365
240 Ga0075364_10018914 3300006051 Bacteria 4320
241 Ga0075364_10026882 3300006051 Bacteria 3674
242 Ga0075364_10045003 3300006051 Bacteria 2872
243 Ga0075432_10034745 3300006058 Bacteria 1751
244 Ga0075362_10017189 3300006177 Bacteria 2976
245 Ga0075362_10027844 3300006177 Bacteria 2422
246 Ga0075362_10083585 3300006177 Bacteria 1474
247 Ga0075367_10001265 3300006178 Bacteria 10666
248 Ga0075367_10004232 3300006178 Bacteria 6970
249 Ga0075367_10037548 3300006178 Bacteria 2816
250 Ga0075367_10037556 3300006178 Bacteria 2815
251 Ga0075367_10059536 3300006178 Bacteria 2274
252 Ga0075369_10000060 3300006186 Bacteria 28160
253 Ga0075369_10025008 3300006186 Bacteria 2479
254 Ga0075427_10000023 3300006194 Bacteria 10265
255 Ga0075366_10001613 3300006195 Bacteria 11295
256 Ga0075366_10016779 3300006195 Bacteria 4209
257 Ga0075366_10017339 3300006195 Bacteria 4144
258 Ga0075366_10022200 3300006195 Bacteria 3691
259 Ga0075366_10022341 3300006195 Bacteria 3679
260 Ga0075366_10022612 3300006195 Bacteria 3660
261 Ga0075366_10023366 3300006195 Bacteria 3601
262 Ga0075366_10023387 3300006195 Bacteria 3599
263 Ga0075366_10033534 3300006195 Bacteria 3025
264 Ga0075366_10039026 3300006195 Bacteria 2805
265 Ga0075366_10053078 3300006195 Bacteria 2408
266 Ga0075366_10058191 3300006195 Bacteria 2296
267 Ga0075366_10079412 3300006195 Bacteria 1959
268 Ga0075366_10089780 3300006195 Bacteria 1840
269 Ga0075366_10093416 3300006195 Bacteria 1803
270 Ga0075366_10101873 3300006195 Bacteria 1723
271 Ga0075366_10120475 3300006195 Bacteria 1581
272 Ga0097621_100073888 3300006237 Bacteria 2823
273 Ga0097621_100091912 3300006237 Bacteria 2541
274 Ga0097621_100179383 3300006237 Bacteria 1829
275 Ga0075370_10000066 3300006353 Bacteria 31728
276 Ga0075370_10000742 3300006353 Bacteria 13009
277 Ga0075370_10002946 3300006353 Bacteria 7999
278 Ga0075370_10005250 3300006353 Bacteria 6413
279 Ga0075370_10006000 3300006353 Bacteria 6085
280 Ga0075370_10010506 3300006353 Bacteria 4841
281 Ga0075370_10011147 3300006353 Bacteria 4716
282 Ga0075370_10014707 3300006353 Bacteria 4179
283 Ga0075370_10028371 3300006353 Bacteria 3111
284 Ga0075370_10029346 3300006353 Bacteria 3064
285 Ga0075370_10032406 3300006353 Bacteria 2922
286 Ga0075370_10036327 3300006353 Bacteria 2767
287 Ga0075370_10042707 3300006353 Bacteria 2561
288 Ga0075370_10067354 3300006353 Bacteria 2044
289 Ga0075370_10067965 3300006353 Bacteria 2034
290 Ga0075370_10088870 3300006353 Bacteria 1781
291 Ga0075370_10114709 3300006353 Bacteria 1566
292 Ga0068871_100022463 3300006358 Bacteria 4864
293 Ga0068871_100078882 3300006358 Bacteria 2723
294 Ga0068871_100090123 3300006358 Bacteria 2553
295 Ga0068871_100138221 3300006358 Bacteria 2070
296 Ga0068871_100180783 3300006358 Bacteria 1812
297 Ga0075430_100083106 3300006846 Bacteria 2683
298 Ga0068865_100017504 3300006881 Bacteria 4610
299 Ga0068865_100020853 3300006881 Bacteria 4256
300 Ga0097620_100060960 3300006931 Bacteria 3801
301 Ga0097620_100092964 3300006931 Bacteria 3068
302 Ga0079104_1000309 3300006946 Bacteria 61858
303 Ga0099826_10005550 3300006948 Bacteria 9061
304 Ga0105240_10005483 3300009093 Bacteria 18913
305 Ga0105240_10034284 3300009093 Bacteria 6549
306 Ga0105240_10203342 3300009093 Bacteria 2320
307 Ga0105245_10026446 3300009098 Bacteria 5107
308 Ga0114129_10162038 3300009147 Bacteria 3054
309 Ga0105243_10009596 3300009148 Bacteria 7369
310 Ga0105243_10010351 3300009148 Bacteria 7083
311 Ga0105243_10020161 3300009148 Bacteria 5054
312 Ga0105243_10067283 3300009148 Bacteria 2883
313 Ga0105243_10100833 3300009148 Bacteria 2396
314 Ga0105243_10119114 3300009148 Bacteria 2223
315 Ga0105242_10000485 3300009176 Bacteria 31627
316 Ga0105248_10022249 3300009177 Bacteria 7028
317 Ga0105248_10031969 3300009177 Bacteria 5880
318 Ga0105248_10072326 3300009177 Bacteria 3875
319 Ga0105248_10408599 3300009177 Bacteria 1529
320 Ga0105237_10168614 3300009545 Bacteria 2189
321 Ga0105237_10174704 3300009545 Bacteria 2148
322 Ga0105237_10179425 3300009545 Bacteria 2118
323 Ga0105237_10295006 3300009545 Bacteria 1624
324 Ga0105238_10017534 3300009551 Bacteria 7280
325 Ga0105238_10026760 3300009551 Bacteria 5879
326 Ga0105238_10044057 3300009551 Bacteria 4513
327 Ga0105238_10055566 3300009551 Bacteria 3974
328 Ga0105238_10128869 3300009551 Bacteria 2509
329 Ga0105238_10139751 3300009551 Bacteria 2399
330 Ga0105249_10007528 3300009553 Bacteria 9500
331 Ga0105249_10177425 3300009553 Bacteria 2070
332 Ga0105239_10027775 3300010375 Bacteria 6227
333 Ga0105239_10052753 3300010375 Bacteria 4460
334 Ga0105239_10182747 3300010375 Bacteria 2346
335 Ga0105239_10528229 3300010375 Bacteria 1343
336 Ga0157319_1000043 3300012497 Bacteria 22525
337 Ga0157347_1000854 3300012502 Bacteria 2185
338 Ga0157373_10035384 3300013100 Bacteria 3586
339 Ga0157373_10067144 3300013100 Bacteria 2536
340 Ga0157373_10085739 3300013100 Bacteria 2220
341 Ga0157373_10123000 3300013100 Bacteria 1824
342 Ga0157371_10001209 3300013102 Bacteria 27527
343 Ga0157371_10047817 3300013102 Bacteria 3041
344 Ga0157371_10124955 3300013102 Bacteria 1829
345 Ga0157370_10001652 3300013104 Bacteria 27514
346 Ga0157370_10007697 3300013104 Bacteria 11689
347 Ga0157370_10014694 3300013104 Bacteria 7997
348 Ga0157370_10185047 3300013104 Bacteria 1934
349 Ga0157369_10011577 3300013105 Bacteria 10013
350 Ga0157369_10077210 3300013105 Bacteria 3569
351 Ga0157374_10058382 3300013296 Bacteria 3605
352 Ga0157374_10093522 3300013296 Bacteria 2871
353 Ga0157374_10108482 3300013296 Bacteria 2668
354 Ga0157374_10118782 3300013296 Bacteria 2550
355 Ga0157378_10006194 3300013297 Bacteria 10468
356 Ga0157378_10081014 3300013297 Bacteria 2933
357 Ga0157378_10139820 3300013297 Bacteria 2248
358 Ga0163162_10029946 3300013306 Bacteria 5390
359 Ga0163162_10040965 3300013306 Bacteria 4633
360 Ga0157372_10005299 3300013307 Bacteria 13694
361 Ga0157372_10132393 3300013307 Bacteria 2870
362 Ga0157372_10209179 3300013307 Bacteria 2261
363 Ga0157372_10403426 3300013307 Bacteria 1593
364 Ga0157375_10008692 3300013308 Bacteria 8901
365 Ga0157375_10014347 3300013308 Bacteria 7064
366 Ga0157375_10032391 3300013308 Bacteria 4958
367 Ga0157375_10084511 3300013308 Bacteria 3223
368 Ga0157375_10296945 3300013308 Bacteria 1779
369 Ga0157380_10012147 3300014326 Bacteria 6236
370 Ga0157380_10028626 3300014326 Bacteria 4250
371 Ga0182008_10000215 3300014497 Bacteria 45361
372 Ga0182008_10010204 3300014497 Bacteria 5033
373 Ga0182008_10043605 3300014497 Bacteria 2233
374 Ga0182008_10073062 3300014497 Bacteria 1688
375 Ga0157377_10000038 3300014745 Bacteria 113777
376 Ga0157377_10006032 3300014745 Bacteria 5747
377 Ga0157379_10007916 3300014968 Bacteria 9212
378 Ga0157379_10010131 3300014968 Bacteria 8217
379 Ga0157376_10004863 3300014969 Bacteria 9364
380 Ga0157376_10014331 3300014969 Bacteria 5947
381 Ga0157376_10018648 3300014969 Bacteria 5326
382 Ga0157376_10122695 3300014969 Bacteria 2306
383 Ga0182006_1008804 3300015261 Bacteria 4563
384 Ga0182006_1026968 3300015261 Bacteria 2348
385 Ga0182007_10003586 3300015262 Bacteria 7293
386 Ga0183362_10005 3300015683 Bacteria 437616
387 Ga0163161_10000849 3300017792 Bacteria 23834
388 Ga0163161_10034546 3300017792 Bacteria 3617
389 Ga0163161_10066787 3300017792 Bacteria 2626
390 Ga0163161_10094501 3300017792 Bacteria 2216
391 Ga0197907_11214976 3300020069 Bacteria 2690
392 Ga0206355_1356493 3300020076 Bacteria 3466
393 Ga0206351_10095075 3300020077 Bacteria 12925
394 Ga0206351_10216415 3300020077 Bacteria 1622
395 Ga0154015_1017848 3300020610 Bacteria 29859
396 Ga0213872_10000003 3300021361 Bacteria 366948
397 Ga0213872_10000042 3300021361 Bacteria 118474
398 Ga0213872_10000129 3300021361 Bacteria 69032
399 Ga0213872_10000351 3300021361 Bacteria 38881
400 Ga0213872_10000411 3300021361 Bacteria 35059
401 Ga0213872_10009020 3300021361 Bacteria 4794
402 Ga0213872_10010720 3300021361 Bacteria 4354
403 Ga0213872_10012213 3300021361 Bacteria 4048
404 Ga0213872_10026271 3300021361 Bacteria 2675
405 Ga0224712_10034991 3300022467 Bacteria 1851
406 Ga0209435_100003 3300025206 Bacteria 669534
407 Ga0209784_100014 3300025224 Bacteria 496182
408 Ga0209784_100365 3300025224 Bacteria 21497
409 Ga0209566_100011 3300025225 Bacteria 496182
410 Ga0209566_100955 3300025225 Bacteria 13033
411 Ga0209674_100003 3300025226 Bacteria 2196646
412 Ga0209674_100032 3300025226 Bacteria 426888
413 Ga0209674_100184 3300025226 Bacteria 68529
414 Ga0209672_100094 3300025228 Bacteria 113800
415 Ga0209672_100517 3300025228 Bacteria 21267
416 Ga0209672_100689 3300025228 Bacteria 16922
417 Ga0209147_100002 3300025229 Bacteria 2158988
418 Ga0209147_100794 3300025229 Bacteria 15311
419 Ga0209563_100005 3300025230 Bacteria 1774893
420 Ga0209563_100010 3300025230 Bacteria 1337457
421 Ga0209563_100029 3300025230 Bacteria 496182
422 Ga0209563_102706 3300025230 Bacteria 3897
423 Ga0207427_100361 3300025231 Bacteria 28311
424 Ga0209258_100002 3300025242 Bacteria 2158988
425 Ga0209258_100009 3300025242 Bacteria 996276
426 Ga0209258_100044 3300025242 Bacteria 376336
427 Ga0209258_100525 3300025242 Bacteria 36665
428 Ga0207425_1000980 3300025245 Bacteria 13435
429 Ga0207425_1002133 3300025245 Bacteria 7264
430 Ga0207425_1003726 3300025245 Bacteria 4779
431 Ga0209646_1000008 3300025246 Bacteria 669534
432 Ga0209646_1000035 3300025246 Bacteria 363209
433 Ga0209646_1000067 3300025246 Bacteria 241595
434 Ga0209026_1000007 3300025250 Bacteria 669534
435 Ga0209026_1000033 3300025250 Bacteria 318512
436 Ga0209026_1007281 3300025250 Bacteria 2524
437 Ga0209677_100065 3300025253 Bacteria 151037
438 Ga0209677_100068 3300025253 Bacteria 146135
439 Ga0209677_100760 3300025253 Bacteria 16357
440 Ga0209677_102322 3300025253 Bacteria 7314
441 Ga0209148_1000007 3300025254 Bacteria 1592273
442 Ga0209148_1000293 3300025254 Bacteria 74776
443 Ga0209759_1000019 3300025256 Bacteria 357908
444 Ga0209759_1000024 3300025256 Bacteria 318512
445 Ga0209759_1000970 3300025256 Bacteria 19907
446 Ga0209759_1007504 3300025256 Bacteria 3500
447 Ga0209129_1000024 3300025258 Bacteria 417268
448 Ga0209129_1000043 3300025258 Bacteria 298978
449 Ga0209129_1015583 3300025258 Bacteria 1560
450 Ga0209565_1000043 3300025263 Bacteria 235332
451 Ga0209565_1000046 3300025263 Bacteria 226073
452 Ga0209565_1001386 3300025263 Bacteria 10846
453 Ga0209565_1007343 3300025263 Bacteria 2982
454 Ga0209455_1000009 3300025272 Bacteria 1042273
455 Ga0209455_1000048 3300025272 Bacteria 376260
456 Ga0209673_1000008 3300025273 Bacteria 626013
457 Ga0209673_1000058 3300025273 Bacteria 269028
458 Ga0209673_1000615 3300025273 Bacteria 54497
459 Ga0209673_1002626 3300025273 Bacteria 12066
460 Ga0209673_1004714 3300025273 Bacteria 7183
461 Ga0209673_1040023 3300025273 Bacteria 1345
462 Ga0209130_1000110 3300025284 Bacteria 133258
463 Ga0209130_1000569 3300025284 Bacteria 36292
464 Ga0209130_1001087 3300025284 Bacteria 20298
465 Ga0209130_1001597 3300025284 Bacteria 14166
466 Ga0209130_1002030 3300025284 Bacteria 11020
467 Ga0209675_1000010 3300025291 Bacteria 541927
468 Ga0209675_1000170 3300025291 Bacteria 78095
469 Ga0209675_1003361 3300025291 Bacteria 7649
470 Ga0209675_1005411 3300025291 Bacteria 5352
471 Ga0209675_1007213 3300025291 Bacteria 4304
472 Ga0209676_1000023 3300025292 Bacteria 589732
473 Ga0209676_1000028 3300025292 Bacteria 559745
474 Ga0209676_1000098 3300025292 Bacteria 234305
475 Ga0209676_1000194 3300025292 Bacteria 136666
476 Ga0209676_1001380 3300025292 Bacteria 23674
477 Ga0209676_1001840 3300025292 Bacteria 17529
478 Ga0209676_1005823 3300025292 Bacteria 6303
479 Ga0209025_1000057 3300025294 Bacteria 314601
480 Ga0209025_1000272 3300025294 Bacteria 120328
481 Ga0209025_1000289 3300025294 Bacteria 113555
482 Ga0209025_1006727 3300025294 Bacteria 8820
483 Ga0209025_1007832 3300025294 Bacteria 7848
484 Ga0209025_1009058 3300025294 Bacteria 7019
485 Ga0209025_1023858 3300025294 Bacteria 3180
486 Ga0209025_1042040 3300025294 Bacteria 1948
487 Ga0209025_1042382 3300025294 Bacteria 1934
488 Ga0209025_1046041 3300025294 Bacteria 1800
489 Ga0209564_1000003 3300025295 Bacteria 1585848
490 Ga0209564_1000014 3300025295 Bacteria 621501
491 Ga0209564_1000183 3300025295 Bacteria 150409
492 Ga0209564_1000198 3300025295 Bacteria 138511
493 Ga0209564_1001847 3300025295 Bacteria 19277
494 Ga0209758_1000049 3300025297 Bacteria 345104
495 Ga0209758_1000093 3300025297 Bacteria 241169
496 Ga0209758_1000204 3300025297 Bacteria 131754
497 Ga0209758_1017887 3300025297 Bacteria 3503
498 Ga0209050_1000002 3300025298 Bacteria 1792849
499 Ga0209050_1000022 3300025298 Bacteria 565239
500 Ga0209050_1000122 3300025298 Bacteria 195305
501 Ga0209050_1000145 3300025298 Bacteria 168151
502 Ga0209050_1000895 3300025298 Bacteria 39508
503 Ga0209050_1001124 3300025298 Bacteria 32325
504 Ga0209050_1004630 3300025298 Bacteria 9176
505 Ga0209050_1011786 3300025298 Bacteria 4098
506 Ga0209050_1016557 3300025298 Bacteria 3006
507 Ga0209050_1025076 3300025298 Bacteria 2039
508 Ga0209256_1000001 3300025299 Bacteria 2166974
509 Ga0209256_1000061 3300025299 Bacteria 260890
510 Ga0209256_1000098 3300025299 Bacteria 204152
511 Ga0209256_1000140 3300025299 Bacteria 152770
512 Ga0209256_1001268 3300025299 Bacteria 27564
513 Ga0209256_1007013 3300025299 Bacteria 5721
514 Ga0207426_1000038 3300025302 Bacteria 441522
515 Ga0207426_1000053 3300025302 Bacteria 384818
516 Ga0207426_1000117 3300025302 Bacteria 224652
517 Ga0207426_1001160 3300025302 Bacteria 23658
518 Ga0209051_1000013 3300025303 Bacteria 565239
519 Ga0209051_1000015 3300025303 Bacteria 546798
520 Ga0209051_1000018 3300025303 Bacteria 527061
521 Ga0209051_1000168 3300025303 Bacteria 119312
522 Ga0209051_1000173 3300025303 Bacteria 117170
523 Ga0209051_1000179 3300025303 Bacteria 114055
524 Ga0209051_1000488 3300025303 Bacteria 51079
525 Ga0209051_1000814 3300025303 Bacteria 32349
526 Ga0209051_1001925 3300025303 Bacteria 16051
527 Ga0209051_1004966 3300025303 Bacteria 7950
528 Ga0209051_1024867 3300025303 Bacteria 2452
529 Ga0209051_1037497 3300025303 Bacteria 1776
530 Ga0209257_1000002 3300025304 Bacteria 1767052
531 Ga0209257_1000017 3300025304 Bacteria 866287
532 Ga0209257_1000042 3300025304 Bacteria 537149
533 Ga0209257_1000084 3300025304 Bacteria 291502
534 Ga0209257_1000096 3300025304 Bacteria 259390
535 Ga0209257_1000412 3300025304 Bacteria 82996
536 Ga0209257_1003994 3300025304 Bacteria 11908
537 Ga0209257_1004271 3300025304 Bacteria 11259
538 Ga0207697_10013305 3300025315 Bacteria 3434
539 Ga0207697_10061246 3300025315 Bacteria 1565
540 Ga0207655_1003001 3300025728 Bacteria 12929
541 Ga0207682_10003157 3300025893 Bacteria 7219
542 Ga0207682_10006644 3300025893 Bacteria 4648
543 Ga0207682_10039210 3300025893 Bacteria 1925
544 Ga0207642_10011507 3300025899 Bacteria 3160
545 Ga0207642_10060567 3300025899 Bacteria 1756
546 Ga0207688_10024697 3300025901 Bacteria 3297
547 Ga0207688_10041033 3300025901 Bacteria 2573
548 Ga0207688_10076797 3300025901 Bacteria 1903
549 Ga0207680_10004287 3300025903 Bacteria 6759
550 Ga0207680_10126225 3300025903 Bacteria 1680
551 Ga0207680_10128342 3300025903 Bacteria 1668
552 Ga0207645_10042100 3300025907 Bacteria 2923
553 Ga0207645_10068933 3300025907 Bacteria 2262
554 Ga0207705_10071062 3300025909 Bacteria 2523
555 Ga0207684_10001414 3300025910 Bacteria 25976
556 Ga0207707_10068594 3300025912 Bacteria 3090
557 Ga0207695_10001669 3300025913 Bacteria 35740
558 Ga0207695_10010175 3300025913 Bacteria 11536
559 Ga0207695_10029800 3300025913 Bacteria 6021
560 Ga0207671_10033303 3300025914 Bacteria 3833
561 Ga0207660_10014917 3300025917 Bacteria 5122
562 Ga0207662_10002597 3300025918 Bacteria 9105
563 Ga0207657_10045327 3300025919 Bacteria 3861
564 Ga0207657_10088149 3300025919 Bacteria 2594
565 Ga0207649_10000231 3300025920 Bacteria 45424
566 Ga0207649_10093288 3300025920 Bacteria 1975
567 Ga0207649_10112984 3300025920 Bacteria 1818
568 Ga0207652_10025150 3300025921 Bacteria 4947
569 Ga0207681_10008770 3300025923 Bacteria 6176
570 Ga0207694_10019947 3300025924 Bacteria 5071
571 Ga0207650_10001837 3300025925 Bacteria 14987
572 Ga0207650_10006719 3300025925 Bacteria 7843
573 Ga0207650_10021604 3300025925 Bacteria 4547
574 Ga0207650_10130941 3300025925 Bacteria 1963
575 Ga0207650_10186671 3300025925 Bacteria 1655
576 Ga0207659_10001154 3300025926 Bacteria 15740
577 Ga0207659_10001657 3300025926 Bacteria 13216
578 Ga0207659_10003471 3300025926 Bacteria 9455
579 Ga0207687_10166300 3300025927 Bacteria 1697
580 Ga0207644_10003202 3300025931 Bacteria 10543
581 Ga0207644_10032324 3300025931 Bacteria 3650
582 Ga0207644_10047145 3300025931 Bacteria 3073
583 Ga0207644_10050485 3300025931 Bacteria 2982
584 Ga0207644_10062850 3300025931 Bacteria 2694
585 Ga0207644_10065110 3300025931 Bacteria 2650
586 Ga0207644_10129635 3300025931 Bacteria 1929
587 Ga0207690_10004058 3300025932 Bacteria 8649
588 Ga0207690_10077284 3300025932 Bacteria 2313
589 Ga0207706_10000499 3300025933 Bacteria 41776
590 Ga0207709_10000130 3300025935 Bacteria 110843
591 Ga0207709_10001694 3300025935 Bacteria 14834
592 Ga0207709_10002721 3300025935 Bacteria 10914
593 Ga0207709_10005799 3300025935 Bacteria 6981
594 Ga0207709_10067926 3300025935 Bacteria 2251
595 Ga0207669_10003780 3300025937 Bacteria 6581
596 Ga0207704_10063492 3300025938 Bacteria 2302
597 Ga0207691_10000511 3300025940 Bacteria 38559
598 Ga0207691_10005462 3300025940 Bacteria 12271
599 Ga0207691_10024751 3300025940 Bacteria 5643
600 Ga0207691_10034076 3300025940 Bacteria 4739
601 Ga0207691_10035416 3300025940 Bacteria 4633
602 Ga0207691_10129050 3300025940 Bacteria 2234
603 Ga0207691_10142036 3300025940 Bacteria 2115
604 Ga0207711_10011343 3300025941 Bacteria 7402
605 Ga0207711_10020600 3300025941 Bacteria 5503
606 Ga0207711_10179547 3300025941 Bacteria 1924
607 Ga0207711_10212709 3300025941 Bacteria 1766
608 Ga0207689_10003209 3300025942 Bacteria 14974
609 Ga0207689_10022772 3300025942 Bacteria 5263
610 Ga0207689_10100290 3300025942 Bacteria 2379
611 Ga0207689_10120235 3300025942 Bacteria 2161
612 Ga0207661_10052592 3300025944 Bacteria 3254
613 Ga0207679_10000003 3300025945 Bacteria 597553
614 Ga0207679_10006049 3300025945 Bacteria 7628
615 Ga0207679_10090162 3300025945 Bacteria 2369
616 Ga0207679_10222625 3300025945 Bacteria 1588
617 Ga0207667_10046059 3300025949 Bacteria 4618
618 Ga0207667_10084418 3300025949 Bacteria 3287
619 Ga0207667_10114793 3300025949 Bacteria 2775
620 Ga0207667_10339975 3300025949 Bacteria 1532
621 Ga0207651_10016902 3300025960 Bacteria 4292
622 Ga0207651_10018036 3300025960 Bacteria 4188
623 Ga0207651_10027991 3300025960 Bacteria 3548
624 Ga0207651_10087447 3300025960 Bacteria 2268
625 Ga0207712_10009755 3300025961 Bacteria 6084
626 Ga0207712_10198231 3300025961 Bacteria 1590
627 Ga0207640_10000204 3300025981 Bacteria 42427
628 Ga0207640_10042398 3300025981 Bacteria 2901
629 Ga0207640_10179312 3300025981 Bacteria 1587
630 Ga0207658_10001749 3300025986 Bacteria 16347
631 Ga0207658_10013291 3300025986 Bacteria 5622
632 Ga0207658_10033908 3300025986 Bacteria 3644
633 Ga0207658_10074735 3300025986 Bacteria 2576
634 Ga0207658_10111847 3300025986 Bacteria 2160
635 Ga0207658_10237765 3300025986 Bacteria 1541
636 Ga0207677_10001579 3300026023 Bacteria 12065
637 Ga0207677_10067151 3300026023 Bacteria 2511
638 Ga0207677_10090461 3300026023 Bacteria 2224
639 Ga0207677_10094849 3300026023 Bacteria 2179
640 Ga0207677_10163452 3300026023 Bacteria 1732
641 Ga0207703_10005816 3300026035 Bacteria 9879
642 Ga0207703_10007010 3300026035 Bacteria 8968
643 Ga0207703_10063397 3300026035 Bacteria 3030
644 Ga0207639_10003459 3300026041 Bacteria 10625
645 Ga0207639_10061438 3300026041 Bacteria 2902
646 Ga0207678_10000002 3300026067 Bacteria 371723
647 Ga0207678_10001741 3300026067 Bacteria 19919
648 Ga0207678_10042038 3300026067 Bacteria 3961
649 Ga0207678_10097384 3300026067 Bacteria 2514
650 Ga0207708_10019691 3300026075 Bacteria 5089
651 Ga0207708_10022978 3300026075 Bacteria 4710
652 Ga0207702_10000080 3300026078 Bacteria 108289
653 Ga0207702_10001261 3300026078 Bacteria 25509
654 Ga0207702_10005418 3300026078 Bacteria 11168
655 Ga0207641_10005241 3300026088 Bacteria 11086
656 Ga0207641_10229931 3300026088 Bacteria 1723
657 Ga0207648_10000053 3300026089 Bacteria 107516
658 Ga0207648_10003753 3300026089 Bacteria 15873
659 Ga0207648_10012937 3300026089 Bacteria 7793
660 Ga0207648_10013431 3300026089 Bacteria 7621
661 Ga0207648_10071700 3300026089 Bacteria 3019
662 Ga0207648_10212645 3300026089 Bacteria 1717
663 Ga0207676_10007553 3300026095 Bacteria 7713
664 Ga0207676_10016812 3300026095 Bacteria 5297
665 Ga0207676_10107975 3300026095 Bacteria 2322
666 Ga0207676_10187259 3300026095 Bacteria 1818
667 Ga0207676_10305798 3300026095 Bacteria 1453
668 Ga0207674_10004793 3300026116 Bacteria 16214
669 Ga0207674_10012238 3300026116 Bacteria 9598
670 Ga0207674_10052728 3300026116 Bacteria 4147
671 Ga0207675_100002925 3300026118 Bacteria 16801
672 Ga0207675_100004928 3300026118 Bacteria 12863
673 Ga0207675_100026001 3300026118 Bacteria 5448
674 Ga0207675_100038504 3300026118 Bacteria 4463
675 Ga0207675_100084556 3300026118 Bacteria 2977
676 Ga0207675_100133907 3300026118 Bacteria 2350
677 Ga0207683_10006050 3300026121 Bacteria 10361
678 Ga0207683_10008024 3300026121 Bacteria 9029
679 Ga0207683_10080738 3300026121 Bacteria 2885
680 Ga0207683_10160742 3300026121 Bacteria 2030
681 Ga0207683_10270416 3300026121 Bacteria 1552
682 Ga0207683_10373506 3300026121 Bacteria 1310
683 Ga0207698_10038535 3300026142 Bacteria 3532
684 Ga0207698_10057783 3300026142 Bacteria 3003
685 Ga0207698_10272726 3300026142 Bacteria 1560
686 Ga0209281_1000103 3300027111 Bacteria 221425
687 Ga0209973_1000593 3300027252 Bacteria 2825
688 Ga0209983_1010176 3300027665 Bacteria 1921
689 Ga0209282_1002486 3300027666 Bacteria 10675
690 Ga0209813_10011416 3300027866 Bacteria 2321
691 Ga0209974_10001308 3300027876 Bacteria 8953
692 Ga0209974_10015055 3300027876 Bacteria 2568
693 Ga0268266_10014299 3300028379 Bacteria 6825
694 Ga0268266_10343695 3300028379 Bacteria 1401
695 Ga0268265_10007752 3300028380 Bacteria 7247
696 Ga0268265_10016123 3300028380 Bacteria 5128
697 Ga0268265_10103334 3300028380 Bacteria 2307
698 Ga0268264_10005622 3300028381 Bacteria 10618
699 Ga0268264_10011457 3300028381 Bacteria 7321
700 Ga0268264_10063241 3300028381 Bacteria 3110
701 Ga0268264_10315708 3300028381 Bacteria 1476
702 Ga0265336_10000053 3300028666 Bacteria 113034
703 Ga0307517_10001511 3300028786 Bacteria 38826
704 Ga0307517_10126743 3300028786 Bacteria 1859
705 Ga0307515_10000040 3300028794 Bacteria 322704
706 Ga0307515_10000188 3300028794 Bacteria 151439
707 Ga0307515_10000708 3300028794 Bacteria 76903
708 Ga0307515_10002191 3300028794 Bacteria 42879
709 Ga0307515_10002971 3300028794 Bacteria 35983
710 Ga0307515_10012418 3300028794 Bacteria 16020
711 Ga0307515_10013083 3300028794 Bacteria 15535
712 Ga0307515_10041442 3300028794 Bacteria 7239
713 Ga0307515_10048737 3300028794 Bacteria 6397
714 Ga0307515_10071988 3300028794 Bacteria 4675
715 Ga0307515_10086241 3300028794 Bacteria 4005
716 Ga0307515_10090189 3300028794 Bacteria 3848
717 Ga0307515_10121393 3300028794 Bacteria 2956
718 Ga0307515_10131234 3300028794 Bacteria 2757
719 Ga0265324_10000132 3300029957 Bacteria 58866
720 Ga0307512_10106359 3300030522 Bacteria 1872
721 Ga0314311_1040207 3300030733 Bacteria 5569
722 Ga0316178_1118432 3300030735 Bacteria 5947
723 Ga0316183_1082423 3300030742 Bacteria 3684
724 Ga0316181_1082156 3300030744 Bacteria 5198
725 Ga0316182_1083649 3300030745 Bacteria 2333
726 Ga0316182_1306370 3300030745 Bacteria 1638
727 Ga0265332_10000020 3300031238 Bacteria 219119
728 Ga0265328_10018418 3300031239 Bacteria 2694
729 Ga0265331_10004933 3300031250 Bacteria 8200
730 Ga0265331_10011350 3300031250 Bacteria 4883
731 Ga0265331_10038086 3300031250 Bacteria 2352
732 Ga0265327_10000144 3300031251 Bacteria 156779
733 Ga0265327_10005627 3300031251 Bacteria 10374
734 Ga0265327_10073363 3300031251 Bacteria 1707
735 Ga0265316_10000005 3300031344 Bacteria 304442
736 Ga0307513_10000020 3300031456 Bacteria 228745
737 Ga0307513_10000129 3300031456 Bacteria 106759
738 Ga0307513_10032452 3300031456 Bacteria 5888
739 Ga0307513_10037752 3300031456 Bacteria 5372
740 Ga0307513_10056487 3300031456 Bacteria 4190
741 Ga0307513_10057757 3300031456 Bacteria 4130
742 Ga0307513_10157651 3300031456 Bacteria 2167
743 Ga0307509_10003552 3300031507 Bacteria 23484
744 Ga0307509_10004884 3300031507 Bacteria 19006
745 Ga0307509_10011369 3300031507 Bacteria 10786
746 Ga0307509_10030410 3300031507 Bacteria 5974
747 Ga0307509_10049375 3300031507 Bacteria 4511
748 Ga0307408_100000086 3300031548 Bacteria 101944
749 Ga0307408_100003486 3300031548 Bacteria 10733
750 Ga0307408_100049153 3300031548 Bacteria 3028
751 Ga0307408_100088756 3300031548 Bacteria 2329
752 Ga0307508_10000169 3300031616 Bacteria 78769
753 Ga0307508_10002731 3300031616 Bacteria 18438
754 Ga0307508_10214365 3300031616 Bacteria 1525
755 Ga0307514_10000920 3300031649 Bacteria 44996
756 Ga0307514_10014677 3300031649 Bacteria 6481
757 Ga0316579_10002053 3300031691 Bacteria 7543
758 Ga0265314_10001065 3300031711 Bacteria 31865
759 Ga0265342_10081970 3300031712 Bacteria 1862
760 Ga0316576_10008990 3300031727 Bacteria 6419
761 Ga0316576_10113349 3300031727 Bacteria 2033
762 Ga0316578_10024622 3300031728 Bacteria 3377
763 Ga0316578_10038197 3300031728 Bacteria 2768
764 Ga0307516_10000311 3300031730 Bacteria 63197
765 Ga0307516_10000678 3300031730 Bacteria 46164
766 Ga0307516_10004343 3300031730 Bacteria 17529
767 Ga0307516_10008972 3300031730 Bacteria 11204
768 Ga0307516_10009522 3300031730 Bacteria 10822
769 Ga0307516_10045613 3300031730 Bacteria 4328
770 Ga0307516_10081745 3300031730 Bacteria 3073
771 Ga0307405_10021785 3300031731 Bacteria 3609
772 Ga0307405_10038766 3300031731 Bacteria 2875
773 Ga0307413_10013379 3300031824 Bacteria 4123
774 Ga0307413_10088722 3300031824 Bacteria 2007
775 Ga0307413_10097706 3300031824 Bacteria 1931
776 Ga0307410_10032495 3300031852 Bacteria 3359
777 Ga0307406_10002476 3300031901 Bacteria 10069
778 Ga0307406_10004722 3300031901 Bacteria 7423
779 Ga0307406_10010926 3300031901 Bacteria 5135
780 Ga0307412_10006540 3300031911 Bacteria 6596
781 Ga0307412_10045274 3300031911 Bacteria 2875
782 Ga0307412_10056567 3300031911 Bacteria 2614
783 Ga0307412_10181360 3300031911 Bacteria 1584
784 Ga0307409_100000189 3300031995 Bacteria 24166
785 Ga0307409_100006670 3300031995 Bacteria 6819
786 Ga0307416_100001876 3300032002 Bacteria 11723
787 Ga0307411_10130385 3300032005 Bacteria 1836
788 Ga0307411_10131372 3300032005 Bacteria 1830
789 Ga0307415_100019230 3300032126 Bacteria 4143
790 Ga0307415_100027523 3300032126 Bacteria 3603
791 Ga0316593_10028412 3300032168 Bacteria 1802
792 Ga0316593_10033310 3300032168 Bacteria 1686
793 Ga0307507_10018253 3300033179 Bacteria 7989
794 Ga0307507_10021035 3300033179 Bacteria 7282
795 Ga0307510_10068525 3300033180 Bacteria 3559
796 Ga0316592_1005500 3300033524 Bacteria 2408
797 Ga0316592_1024929 3300033524 Bacteria 1288
798 Ga0316588_1001260 3300033528 Bacteria 4080
799 Ga0316588_1005901 3300033528 Bacteria 2419
800 Ga0316587_1010530 3300033529 Bacteria 1481
801 Ga0316596_1021026 3300033541 Bacteria 1662
802 Ga0373923_0077768 3300035111 Bacteria 1435
803 Ga0373939_0000004 3300035114 Bacteria 106519
804 Ga0373960_0006404 3300035121 Bacteria 2761
805 Ga0373931_0000140 3300035691 Bacteria 32698
806 Ga0373931_0002251 3300035691 Bacteria 8526
807 Ga0373931_0014186 3300035691 Bacteria 3891
808 Ga0373931_0016238 3300035691 Bacteria 3662
809 Ga0373927_0201911 3300035695 Bacteria 1305
810 Ga0373937_0100521 3300036401 Bacteria 2684
811 Ga0316582_0034544 3300036647 Bacteria 3115
812 Ga0316584_0006067 3300036712 Bacteria 8166
813 Ga0316584_0074349 3300036712 Bacteria 2547
814 Ga0373925_0034529 3300037068 Bacteria 3728
815 Ga0373925_0128586 3300037068 Bacteria 1973
816 Ga0395899_0005350 3300037312 Bacteria 9972
817 Ga0395899_0006712 3300037312 Bacteria 8914
818 Ga0395899_0102242 3300037312 Bacteria 2068
819 Ga0395900_0000131 3300037418 Bacteria 125554
820 Ga0395900_0005063 3300037418 Bacteria 13830
821 Ga0395900_0005396 3300037418 Bacteria 13392
822 Ga0395900_0018610 3300037418 Bacteria 7083
823 Ga0395900_0021753 3300037418 Bacteria 6557
824 Ga0395900_0119412 3300037418 Bacteria 2706
825 Ga0395898_0001532 3300037466 Bacteria 31823
826 Ga0395898_0006253 3300037466 Bacteria 12742
827 Ga0395898_0011606 3300037466 Bacteria 9144
828 Ga0395905_0000777 3300037471 Bacteria 41933
829 Ga0395905_0001157 3300037471 Bacteria 33035
830 Ga0395905_0001668 3300037471 Bacteria 26186
831 Ga0395905_0017710 3300037471 Bacteria 6763
832 Ga0395905_0026275 3300037471 Bacteria 5490
833 Ga0395905_0034757 3300037471 Bacteria 4733
834 Ga0395905_0040407 3300037471 Bacteria 4375
835 Ga0395905_0042849 3300037471 Bacteria 4246
836 Ga0395905_0078207 3300037471 Bacteria 3099
837 Ga0395905_0105542 3300037471 Bacteria 2645
838 Ga0395905_0113532 3300037471 Bacteria 2545
839 Ga0395905_0116952 3300037471 Bacteria 2505
840 Ga0395905_0176135 3300037471 Bacteria 2008
841 Ga0395905_0187142 3300037471 Bacteria 1943
842 Ga0395905_0309042 3300037471 Bacteria 1469
843 Ga0395901_0007241 3300038443 Bacteria 11191
844 Ga0395901_0022743 3300038443 Bacteria 6428
845 Ga0395901_0043010 3300038443 Bacteria 4685
846 Ga0395901_0099214 3300038443 Bacteria 3054
847 Ga0395901_0183218 3300038443 Bacteria 2196
848 Ga0395901_0236332 3300038443 Bacteria 1907
849 Ga0395901_0311371 3300038443 Bacteria 1630
850 Ga0400485_21670 3300038735 Bacteria 2148
851 Ga0436365_0350119 3300039437 Bacteria 7336
852 Ga0436365_0760616 3300039437 Bacteria 2085
853 Ga0436361_0255861 3300039447 Bacteria 53221
854 Ga0436361_0338967 3300039447 Bacteria 4771
855 Ga0436361_0355769 3300039447 Bacteria 5025
856 Ga0436361_0362312 3300039447 Bacteria 55943
857 Ga0436361_0393109 3300039447 Bacteria 4769
858 Ga0436361_0616441 3300039447 Bacteria 29495
859 Ga0436361_0709657 3300039447 Bacteria 1884
860 Ga0436361_0916159 3300039447 Bacteria 49060
861 Ga0436361_1150385 3300039447 Bacteria 105721
862 Ga0439436_0000635 3300041404 Bacteria 9346
863 Ga0439439_0000329 3300041406 Bacteria 7680
864 Ga0439466_0004216 3300041411 Bacteria 5551
865 Ga0439465_0000176 3300041413 Bacteria 16369
866 Ga0439465_0016982 3300041413 Bacteria 2271
867 Ga0451793_1605648 3300041452 Bacteria 2400
868 Ga0451793_1651023 3300041452 Bacteria 1896
869 Ga0451795_0983196 3300041456 Bacteria 1723
870 Ga0451798_0142848 3300041458 Bacteria 2634
871 Ga0451800_0241174 3300041459 Bacteria 2019
872 Ga0451802_0447858 3300041460 Bacteria 2093
873 Ga0451841_0619619 3300041498 Bacteria 1950
874 Ga0451853_0383239 3300041512 Bacteria 2822
875 Ga0451853_1507922 3300041512 Bacteria 3161
876 Ga0451853_2429987 3300041512 Bacteria 1493
877 Ga0439431_0009855 3300041997 Bacteria 2162
878 Ga0439445_0000181 3300042004 Bacteria 11274
879 Ga0439445_0009295 3300042004 Bacteria 2315
880 Ga0439449_0000632 3300042007 Bacteria 13206
881 Ga0439449_0000947 3300042007 Bacteria 11364
882 Ga0439449_0001266 3300042007 Bacteria 9907
883 Ga0439462_0001510 3300042015 Bacteria 5204
884 Ga0450911_000725 3300042115 Bacteria 9579
885 Ga0450923_001000 3300042125 Bacteria 3522
886 Ga0450899_001250 3300042135 Bacteria 2880
887 Ga0439446_0036617 3300042156 Bacteria 1434
888 Ga0450909_009165 3300042185 Bacteria 1444
889 Ga0439434_0000543 3300042435 Bacteria 10785
890 Ga0439434_0003310 3300042435 Bacteria 4734
891 Ga0439434_0035836 3300042435 Bacteria 1517
892 Ga0439434_0051958 3300042435 Bacteria 1272
893 Ga0450918_002647 3300042531 Bacteria 3371
894 Ga0450918_003930 3300042531 Bacteria 2730
895 Ga0451577_0000152 3300042876 Bacteria 153284
896 Ga0451577_0004023 3300042876 Bacteria 15811
897 Ga0451577_0018493 3300042876 Bacteria 6419
898 Ga0451577_0030135 3300042876 Bacteria 4903
899 Ga0451577_0041881 3300042876 Bacteria 4109
900 Ga0466969_0001257 3300044656 Bacteria 13672
901 Ga0466969_0001560 3300044656 Bacteria 12303
902 Ga0466969_0005210 3300044656 Bacteria 6918
903 Ga0466969_0012595 3300044656 Bacteria 4457
904 Ga0466969_0057686 3300044656 Bacteria 1892
905 Ga0466969_0076686 3300044656 Bacteria 1600
906 Ga0466973_0035278 3300044659 Bacteria 4754
907 Ga0466965_0008100 3300044683 Bacteria 4855
908 Ga0466965_0018908 3300044683 Bacteria 3306
909 Ga0466965_0097482 3300044683 Bacteria 1501
910 Ga0466966_0000687 3300044684 Bacteria 21520
911 Ga0466966_0001625 3300044684 Bacteria 14480
912 Ga0466966_0002631 3300044684 Bacteria 11760
913 Ga0466966_0080940 3300044684 Bacteria 2022
914 Ga0466961_0001458 3300044693 Bacteria 14699
915 Ga0466961_0002291 3300044693 Bacteria 11891
916 Ga0466961_0007342 3300044693 Bacteria 7013
917 Ga0466963_0002704 3300044694 Bacteria 9994
918 Ga0466963_0014486 3300044694 Bacteria 4862
919 Ga0466964_0001639 3300044706 Bacteria 7729
920 Ga0466964_0002848 3300044706 Bacteria 6238
921 Ga0466964_0053627 3300044706 Bacteria 1660
922 Ga0453684_0000122 3300044712 Bacteria 340529
923 Ga0453684_0197635 3300044712 Bacteria 2347
924 Ga0466971_0003452 3300044719 Bacteria 6749
925 Ga0466971_0005142 3300044719 Bacteria 5665
926 Ga0466968_0006689 3300044735 Bacteria 4355
927 Ga0466970_0005511 3300044765 Bacteria 6284
928 Ga0466970_0005981 3300044765 Bacteria 6061
929 Ga0466957_0012381 3300044842 Bacteria 4938
930 Ga0466957_0020799 3300044842 Bacteria 3860
931 Ga0466957_0087085 3300044842 Bacteria 1952
932 Ga0466960_0060962 3300044901 Bacteria 1850
933 Ga0466959_0000287 3300045049 Bacteria 30550
934 Ga0466959_0023408 3300045049 Bacteria 4570
935 Ga0466959_0057239 3300045049 Bacteria 2842
936 Ga0451576_0001995 3300045051 Bacteria 32320
937 Ga0451576_0006156 3300045051 Bacteria 14777
938 Ga0451576_0051233 3300045051 Bacteria 4328
939 Ga0451576_0058191 3300045051 Bacteria 4040
940 Ga0451576_0137794 3300045051 Bacteria 2545
941 Ga0451576_0297220 3300045051 Bacteria 1688
942 Ga0466958_0008673 3300045836 Bacteria 5644
943 Ga0466958_0011505 3300045836 Bacteria 4983
944 Ga0466958_0063425 3300045836 Bacteria 2253
945 Ga0466967_0029006 3300045976 Bacteria 4626
946 Ga0495627_029101 3300046453 Bacteria 1759
947 Ga0495592_0000250 3300046454 Bacteria 46017
948 Ga0495629_0000047 3300046459 Bacteria 109814
949 Ga0495638_0010294 3300046460 Bacteria 6503
950 Ga0495650_0020417 3300046471 Bacteria 3231
951 Ga0495650_0054156 3300046471 Bacteria 1639
952 Ga0495580_0003727 3300046472 Bacteria 12906
953 Ga0495580_0025643 3300046472 Bacteria 4308
954 Ga0495582_0003250 3300046473 Bacteria 9125
955 Ga0495639_0037468 3300046475 Bacteria 2174
956 Ga0495594_0024776 3300046499 Bacteria 3224
957 Ga0495606_0002998 3300046507 Bacteria 18539
958 Ga0495610_0026730 3300046512 Bacteria 3077
959 Ga0495616_0030690 3300046513 Bacteria 2821
960 Ga0495620_0019601 3300046515 Bacteria 3322
961 Ga0495620_0042573 3300046515 Bacteria 1983
962 Ga0495628_0165170 3300046516 Bacteria 1681
963 Ga0495632_0005520 3300046519 Bacteria 8342
964 Ga0495632_0116303 3300046519 Bacteria 1252
965 Ga0495637_0003930 3300046520 Bacteria 7787
966 Ga0495648_0057728 3300046524 Bacteria 2325
967 Ga0495666_0013084 3300046526 Bacteria 4135
968 Ga0495654_0000313 3300046530 Bacteria 42607
969 Ga0495640_0154113 3300046533 Bacteria 1475
970 Ga0495587_0019463 3300046536 Bacteria 4200
971 Ga0495621_0042373 3300046539 Bacteria 1602
972 Ga0495597_0059772 3300046542 Bacteria 1663
973 Ga0495656_0000087 3300046615 Bacteria 40520
974 Ga0495634_0008231 3300046642 Bacteria 7777
975 Ga0495625_0001451 3300046660 Bacteria 28777
976 Ga0495625_0004137 3300046660 Bacteria 13846
977 Ga0495625_0004296 3300046660 Bacteria 13552
978 Ga0495661_0000622 3300046665 Bacteria 36082
979 Ga0495658_0002569 3300046683 Bacteria 9129
980 Ga0495658_0041870 3300046683 Bacteria 2555
981 Ga0495670_0097686 3300046691 Bacteria 1509
982 Ga0495649_0001463 3300046694 Bacteria 17755
983 Ga0495649_0004909 3300046694 Bacteria 8623
984 Ga0495600_0027348 3300046809 Bacteria 3685
985 Ga0495660_0149470 3300046810 Bacteria 1155
986 Ga0495604_0010562 3300047317 Bacteria 7320
987 Ga0495676_0003280 3300047321 Bacteria 14621
988 Ga0495687_000700 3300047443 Bacteria 37469
989 Ga0495687_012571 3300047443 Bacteria 4466
990 Ga0495675_0005883 3300047444 Bacteria 7494
991 Ga0495686_0003614 3300047472 Bacteria 13266
992 Ga0495602_0003834 3300048088 Bacteria 15645
993 Ga0495626_0000003 3300048091 Bacteria 427774
994 Ga0495626_0022313 3300048091 Bacteria 3128
995 Ga0496100_0018438 3300048903 Bacteria 4139
996 Ga0496101_0005305 3300048904 Bacteria 8210
997 Ga0496101_0212307 3300048904 Bacteria 1500
998 Ga0496102_0008930 3300048905 Bacteria 8600
999 Ga0496102_0010550 3300048905 Bacteria 7955
1000 Ga0496102_0015155 3300048905 Bacteria 6712
1001 Ga0496102_0047897 3300048905 Bacteria 3886
1002 Ga0496105_0003188 3300048908 Bacteria 12077
1003 Ga0496105_0030017 3300048908 Bacteria 4453
1004 Ga0496105_0134301 3300048908 Bacteria 2039
1005 Ga0496106_0005942 3300048909 Bacteria 9016
1006 Ga0496108_0105917 3300048911 Bacteria 2401
1007 Ga0496109_0063912 3300048912 Bacteria 3367
1008 Ga0496109_0118393 3300048912 Bacteria 2466
1009 Ga0496109_0168704 3300048912 Bacteria 2053
1010 Ga0496110_0040628 3300048913 Bacteria 4054
1011 Ga0496110_0125528 3300048913 Bacteria 2315
1012 Ga0496112_0008823 3300048915 Bacteria 9048
1013 Ga0496112_0029309 3300048915 Bacteria 5322
1014 Ga0496112_0260384 3300048915 Bacteria 1684
1015 Ga0496113_0221609 3300048916 Bacteria 1507
1016 Ga0496114_0038012 3300048917 Bacteria 3982
1017 Ga0496114_0231527 3300048917 Bacteria 1623
1018 Ga0496116_0009604 3300048919 Bacteria 8232
1019 Ga0496116_0015236 3300048919 Bacteria 6088
1020 Ga0496116_0042395 3300048919 Bacteria 3111
1021 Ga0496117_0033970 3300048920 Bacteria 3850
1022 Ga0496118_0006180 3300048921 Bacteria 13271
1023 Ga0496118_0108075 3300048921 Bacteria 1855
1024 Ga0496119_0018064 3300048922 Bacteria 5269
1025 Ga0496120_0017510 3300048923 Bacteria 4642
1026 Ga0496121_0000012 3300048924 Bacteria 653131
1027 Ga0496121_0000568 3300048924 Bacteria 69617
1028 Ga0496121_0014158 3300048924 Bacteria 8495
1029 Ga0496121_0076519 3300048924 Bacteria 2668
1030 Ga0496122_0000063 3300048925 Bacteria 241378
1031 Ga0496122_0000329 3300048925 Bacteria 103316
1032 Ga0496123_0000045 3300048926 Bacteria 249294
1033 Ga0496123_0000260 3300048926 Bacteria 106988
1034 Ga0496124_0000036 3300048927 Bacteria 318032
1035 Ga0496124_0000086 3300048927 Bacteria 202844
1036 Ga0496124_0025394 3300048927 Bacteria 5366
1037 Ga0496124_0032613 3300048927 Bacteria 4596
1038 Ga0496124_0051122 3300048927 Bacteria 3517
1039 Ga0496125_0000105 3300048928 Bacteria 200717
1040 Ga0496125_0002103 3300048928 Bacteria 26737
1041 Ga0496125_0006290 3300048928 Bacteria 12893
1042 Ga0496125_0012141 3300048928 Bacteria 8569
1043 Ga0496125_0042518 3300048928 Bacteria 3868
1044 Ga0496125_0056695 3300048928 Bacteria 3179
1045 Ga0496125_0076766 3300048928 Bacteria 2578
1046 Ga0496126_0123311 3300048929 Bacteria 2245
1047 Ga0496126_0248983 3300048929 Bacteria 1481
1048 Ga0501310_004561 3300049130 Bacteria 1395
1049 Ga0501323_004115 3300049539 Bacteria 1521
1050 Ga0501031_0005466 3300049568 Bacteria 8267
1051 Ga0501032_0004732 3300049569 Bacteria 10217
1052 Ga0501033_0150483 3300049570 Bacteria 1679
1053 Ga0501034_0005422 3300049571 Bacteria 13943
1054 Ga0501034_0018726 3300049571 Bacteria 7095
1055 Ga0501034_0020618 3300049571 Bacteria 6733
1056 Ga0501034_0086590 3300049571 Bacteria 3133
1057 Ga0501036_0002318 3300049572 Bacteria 14880
1058 Ga0501036_0085956 3300049572 Bacteria 2659
1059 Ga0501037_0054613 3300049573 Bacteria 2921
1060 Ga0501038_0003581 3300049574 Bacteria 14451
1061 Ga0501039_0260047 3300049575 Bacteria 1364
1062 Ga0501043_0000002 3300049579 Bacteria 351081
1063 Ga0501046_0000008 3300049580 Bacteria 351167
1064 Ga0501046_0016051 3300049580 Bacteria 6279
1065 Ga0501047_0000003 3300049581 Bacteria 508375
1066 Ga0501047_0018196 3300049581 Bacteria 6734
1067 Ga0501047_0035507 3300049581 Bacteria 4816
1068 Ga0501047_0110172 3300049581 Bacteria 2636
1069 Ga0501048_0009085 3300049582 Bacteria 7480
1070 Ga0501070_0003847 3300049586 Bacteria 12948
1071 Ga0501072_0059851 3300049588 Bacteria 3003
1072 Ga0501073_0029410 3300049589 Bacteria 3927
1073 Ga0501073_0032823 3300049589 Bacteria 3700
1074 Ga0501074_0134826 3300049590 Bacteria 1766
1075 Ga0501222_000008 3300049662 Bacteria 120904
1076 Ga0501225_0001352 3300049705 Bacteria 7631
1077 Ga0501080_0007098 3300049742 Bacteria 10115
1078 Ga0501083_0025700 3300049744 Bacteria 4076
1079 Ga0501266_003344 3300049763 Bacteria 1995
1080 Ga0501035_0001682 3300049822 Bacteria 22366
1081 Ga0501035_0006696 3300049822 Bacteria 10768
1082 Ga0501044_0007167 3300049823 Bacteria 12264
1083 Ga0501044_0014188 3300049823 Bacteria 8605
1084 Ga0501044_0032540 3300049823 Bacteria 5481
1085 Ga0501044_0111779 3300049823 Bacteria 2739
1086 Ga0501044_0170750 3300049823 Bacteria 2146
1087 Ga0501045_0001048 3300049824 Bacteria 18195
1088 nmdc:mga03n38_11656_c1 3300050490 Bacteria 3284
1089 nmdc:mga03n38_12124_c1 3300050490 Bacteria 3234
1090 nmdc:mga03n38_61_c1 3300050490 Bacteria 22538
1091 nmdc:mga00v17_12094_c1 3300050491 Bacteria 4755
1092 nmdc:mga00v17_14156_c1 3300050491 Bacteria 4446
1093 nmdc:mga00v17_146_c1 3300050491 Bacteria 40788
1094 nmdc:mga00v17_2128_c1 3300050491 Bacteria 10183
1095 nmdc:mga00v17_22012_c1 3300050491 Bacteria 3674
1096 nmdc:mga00v17_505_c1 3300050491 Bacteria 21902
1097 nmdc:mga00v17_6135_c1 3300050491 Bacteria 6367
1098 nmdc:mga0yw44_176989_c1 3300050492 Bacteria 1403
1099 nmdc:mga0yw44_275_c1 3300050492 Bacteria 17637
1100 nmdc:mga0yw44_57_c1 3300050492 Bacteria 40136
1101 nmdc:mga0k408_10272_c1 3300050493 Bacteria 5060
1102 nmdc:mga0k408_122783_c1 3300050493 Bacteria 1539
1103 nmdc:mga0k408_12700_c1 3300050493 Bacteria 4605
1104 nmdc:mga0k408_134_c1 3300050493 Bacteria 27880
1105 nmdc:mga0k408_14316_c1 3300050493 Bacteria 4368
1106 nmdc:mga0k408_143498_c1 3300050493 Bacteria 1421
1107 nmdc:mga0k408_15212_c1 3300050493 Bacteria 4251
1108 nmdc:mga0k408_18434_c1 3300050493 Bacteria 3897
1109 nmdc:mga0k408_196527_c1 3300050493 Bacteria 1204
1110 nmdc:mga0k408_1969_c1 3300050493 Bacteria 11007
1111 nmdc:mga0k408_20201_c1 3300050493 Bacteria 3729
1112 nmdc:mga0k408_22699_c1 3300050493 Bacteria 3535
1113 nmdc:mga0k408_25606_c1 3300050493 Bacteria 3342
1114 nmdc:mga0k408_28295_c1 3300050493 Bacteria 3186
1115 nmdc:mga0k408_2894_c1 3300050493 Bacteria 9099
1116 nmdc:mga0k408_52536_c1 3300050493 Bacteria 2362
1117 nmdc:mga0k408_533_c1 3300050493 Bacteria 20949
1118 nmdc:mga0k408_62846_c1 3300050493 Bacteria 2159
1119 nmdc:mga0k408_84073_c1 3300050493 Bacteria 1867
1120 nmdc:mga0k408_951_c2 3300050493 Bacteria 6329
1121 nmdc:mga06z11_105_c1 3300050494 Bacteria 34898
1122 nmdc:mga06z11_22303_c1 3300050494 Bacteria 2955
1123 nmdc:mga06z11_6455_c1 3300050494 Bacteria 4774
1124 nmdc:mga07m45_11093_c1 3300050496 Bacteria 4726
1125 nmdc:mga07m45_121182_c1 3300050496 Bacteria 1511
1126 nmdc:mga07m45_13425_c1 3300050496 Bacteria 4347
1127 nmdc:mga07m45_142405_c1 3300050496 Bacteria 1389
1128 nmdc:mga07m45_142667_c1 3300050496 Bacteria 1387
1129 nmdc:mga07m45_1573_c1 3300050496 Bacteria 10505
1130 nmdc:mga07m45_18036_c1 3300050496 Bacteria 3802
1131 nmdc:mga07m45_212767_c1 3300050496 Bacteria 1125
1132 nmdc:mga07m45_25532_c1 3300050496 Bacteria 3241
1133 nmdc:mga07m45_3649_c1 3300050496 Bacteria 7434
1134 nmdc:mga07m45_4460_c1 3300050496 Bacteria 6850
1135 nmdc:mga07m45_45953_c1 3300050496 Bacteria 2452
1136 nmdc:mga07m45_5487_c1 3300050496 Bacteria 6318
1137 nmdc:mga07m45_66_c1 3300050496 Bacteria 40757
1138 nmdc:mga07m45_75_c1 3300050496 Bacteria 29787
1139 nmdc:mga07m45_810_c1 3300050496 Bacteria 13476
1140 nmdc:mga07m45_9440_c1 3300050496 Bacteria 5064
1141 nmdc:mga07m45_969_c1 3300050496 Bacteria 12632
1142 nmdc:mga08y16_312129_c1 3300050511 Bacteria 1619
1143 nmdc:mga0n895_165330_c1 3300050512 Bacteria 2244
1144 nmdc:mga0sz30_118_c1 3300050516 Bacteria 29758
1145 nmdc:mga0sz30_12949_c1 3300050516 Bacteria 3256
1146 nmdc:mga0sz30_13505_c1 3300050516 Bacteria 3199
1147 nmdc:mga0sz30_34430_c1 3300050516 Bacteria 2108
1148 Ga0500610_0029223 3300053079 Bacteria 2783
1149 Ga0500635_0000083 3300053080 Bacteria 61980
1150 Ga0500578_0000058 3300053086 Bacteria 119650
1151 Ga0500644_0001410 3300053088 Bacteria 6389
1152 Ga0500651_0000125 3300053093 Bacteria 47146
1153 Ga0500651_0042015 3300053093 Bacteria 2881
1154 Ga0500562_013588 3300053108 Bacteria 2081
1155 Ga0500571_006911 3300053110 Bacteria 6150
1156 Ga0500593_000810 3300053117 Bacteria 11698
1157 Ga0500593_001579 3300053117 Bacteria 8194
1158 Ga0500594_0000346 3300053118 Bacteria 10412
1159 Ga0500594_0000938 3300053118 Bacteria 6261
1160 Ga0500607_008170 3300053121 Bacteria 6383
1161 Ga0500608_020890 3300053122 Bacteria 3018
1162 Ga0500628_000906 3300053129 Bacteria 5229
1163 Ga0500642_0000990 3300053130 Bacteria 8165
1164 Ga0500652_000300 3300053131 Bacteria 17910
1165 Ga0500658_0002003 3300053134 Bacteria 7959
1166 Ga0500658_0002237 3300053134 Bacteria 7509
1167 Ga0500658_0005042 3300053134 Bacteria 4914
1168 Ga0500658_0021081 3300053134 Bacteria 2465
1169 Ga0500559_0000076 3300053136 Bacteria 76510
1170 Ga0500559_0034570 3300053136 Bacteria 2180
1171 Ga0500568_0004400 3300053139 Bacteria 7534
1172 Ga0500568_0010776 3300053139 Bacteria 4265
1173 Ga0500568_0028309 3300053139 Bacteria 2336
1174 Ga0500577_0013682 3300053142 Bacteria 2485
1175 Ga0500616_0020378 3300053153 Bacteria 3725
1176 Ga0500619_000040 3300053154 Bacteria 40525
1177 Ga0500622_0000094 3300053156 Bacteria 91975
1178 Ga0500622_0001530 3300053156 Bacteria 18329
1179 Ga0500622_0001780 3300053156 Bacteria 16470
1180 Ga0500622_0054734 3300053156 Bacteria 2045
1181 Ga0500634_0099122 3300053161 Bacteria 1462
1182 Ga0500570_034372 3300053724 Bacteria 2709
1183 Ga0500645_003945 3300053730 Bacteria 5843
1184 Ga0500645_007534 3300053730 Bacteria 3780
1185 Ga0500587_000079 3300053739 Bacteria 8123
1186 Ga0500587_004174 3300053739 Bacteria 1995
1187 Ga0500661_002024 3300055283 Bacteria 3826
1188 Ga0590071_010060 3300059421 Bacteria 2214
1189 Ga0587084_001004 3300059477 Bacteria 2522
1190 Ga0587084_009376 3300059477 Bacteria 1263
1191 Ga0587070_013470 3300059491 Bacteria 1262
1192 Ga0587085_009626 3300059506 Bacteria 1263
1193 Ga0587088_001114 3300059508 Bacteria 2664
1194 Ga0587088_002489 3300059508 Bacteria 2105
1195 Ga0587091_011847 3300059511 Bacteria 1369
1196 Ga0587101_001771 3300059623 Bacteria 1933
1197 Ga0587128_002004 3300059630 Bacteria 2049
1198 Ga0587128_008413 3300059630 Bacteria 1333
1199 Ga0587068_012091 3300059641 Bacteria 1313
1200 Ga0587072_000066 3300059643 Bacteria 7689
1201 Ga0587078_006703 3300059646 Bacteria 1256
1202 Ga0587104_000185 3300059650 Bacteria 2218
1203 Ga0466962_0002972 3300061719 Bacteria 8086
1204 Ga0466962_0003937 3300061719 Bacteria 7106
1205 Ga0466962_0029546 3300061719 Bacteria 2624

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0057728 Ga0495648_0057728_1256_2248 323
2 3300037471 Ga0395905_0309042 Ga0395905_0309042_434_1447 326
3 iso_pu_bacteria 2857537821 2857539084 330
4 3300048903 Ga0496100_0018438 Ga0496100_0018438_11_1051 336
5 3300038443 Ga0395901_0236332 Ga0395901_0236332_11_1060 341
6 3300050496 nmdc:mga07m45_121182_c1 nmdc:mga07m45_121182_c1_36_1085 341
7 3300025901 Ga0207688_10076797 Ga0207688_100767972 342
8 3300006042 Ga0075368_10024443 Ga0075368_100244432 345
9 3300006048 Ga0075363_100035250 Ga0075363_1000352501 345
10 3300006178 Ga0075367_10037548 Ga0075367_100375482 345
11 3300027866 Ga0209813_10011416 Ga0209813_100114161 345
12 3300050490 nmdc:mga03n38_12124_c1 nmdc:mga03n38_12124_c1_916_2148 345
13 3300050494 nmdc:mga06z11_22303_c1 nmdc:mga06z11_22303_c1_408_1640 345
14 3300042135 Ga0450899_001250 Ga0450899_001250_1576_2796 348
15 3300013307 Ga0157372_10403426 Ga0157372_104034262 351
16 3300050496 nmdc:mga07m45_212767_c1 nmdc:mga07m45_212767_c1_21_1109 351
17 3300049130 Ga0501310_004561 Ga0501310_004561_31_1227 355
18 3300046460 Ga0495638_0010294 Ga0495638_0010294_1145_2239 356
19 3300049575 Ga0501039_0260047 Ga0501039_0260047_26_1234 357
20 3300046539 Ga0495621_0042373 Ga0495621_0042373_30_1214 358
21 3300049568 Ga0501031_0005466 Ga0501031_0005466_1175_2383 359
22 3300049569 Ga0501032_0004732 Ga0501032_0004732_8203_9411 359
23 3300049571 Ga0501034_0018726 Ga0501034_0018726_385_1593 359
24 3300049572 Ga0501036_0002318 Ga0501036_0002318_767_1975 359
25 3300049573 Ga0501037_0054613 Ga0501037_0054613_1484_2692 359
26 3300049574 Ga0501038_0003581 Ga0501038_0003581_12109_13317 359
27 3300049581 Ga0501047_0018196 Ga0501047_0018196_4871_6079 359
28 3300049589 Ga0501073_0032823 Ga0501073_0032823_926_2134 359
29 3300049742 Ga0501080_0007098 Ga0501080_0007098_675_1883 359
30 3300049822 Ga0501035_0001682 Ga0501035_0001682_779_1987 359
31 3300049823 Ga0501044_0170750 Ga0501044_0170750_790_1998 359
32 3300049570 Ga0501033_0150483 Ga0501033_0150483_102_1310 360
33 3300005564 Ga0070664_100004542 Ga0070664_1000045424 361
34 3300005577 Ga0068857_100164713 Ga0068857_1001647131 361
35 3300049581 Ga0501047_0110172 Ga0501047_0110172_1511_2626 361
36 3300038735 Ga0400485_21670 Ga0400485_21670_25_1173 363
37 iso_pu_bacteria 2858950400 2858956091 363
38 3300044656 Ga0466969_0001257 Ga0466969_0001257_7593_8708 364
39 3300044659 Ga0466973_0035278 Ga0466973_0035278_2788_3903 364
40 3300044683 Ga0466965_0008100 Ga0466965_0008100_430_1545 364
41 3300044694 Ga0466963_0002704 Ga0466963_0002704_1979_3094 364
42 3300044719 Ga0466971_0003452 Ga0466971_0003452_5134_6249 364
43 3300044842 Ga0466957_0012381 Ga0466957_0012381_706_1821 364
44 3300045836 Ga0466958_0008673 Ga0466958_0008673_270_1385 364
45 3300025245 Ga0207425_1000980 Ga0207425_10009806 366
46 3300025258 Ga0209129_1000043 Ga0209129_1000043184 366
47 3300025295 Ga0209564_1000014 Ga0209564_1000014291 366
48 3300025297 Ga0209758_1000093 Ga0209758_100009334 366
49 3300031824 Ga0307413_10097706 Ga0307413_100977062 366
50 3300042156 Ga0439446_0036617 Ga0439446_0036617_48_1268 366
51 3300028794 Ga0307515_10012418 Ga0307515_100124181 367
52 3300046810 Ga0495660_0149470 Ga0495660_0149470_14_1141 367
53 3300050493 nmdc:mga0k408_143498_c1 nmdc:mga0k408_143498_c1_14_1141 367
54 3300053136 Ga0500559_0034570 Ga0500559_0034570_476_1690 367
55 3300027252 Ga0209973_1000593 Ga0209973_10005932 368
56 3300046519 Ga0495632_0116303 Ga0495632_0116303_14_1156 369
57 3300049571 Ga0501034_0005422 Ga0501034_0005422_343_1551 369
58 3300050493 nmdc:mga0k408_196527_c1 nmdc:mga0k408_196527_c1_50_1192 369
59 iso_pu_bacteria 2843690924 2843691986 369
60 3300031727 Ga0316576_10008990 Ga0316576_100089902 370
61 3300031728 Ga0316578_10024622 Ga0316578_100246222 370
62 3300032168 Ga0316593_10028412 Ga0316593_100284121 370
63 3300033528 Ga0316588_1001260 Ga0316588_10012603 370
64 3300033529 Ga0316587_1010530 Ga0316587_10105301 370
65 3300033541 Ga0316596_1021026 Ga0316596_10210261 370
66 3300036647 Ga0316582_0034544 Ga0316582_0034544_606_1793 370
67 3300036712 Ga0316584_0006067 Ga0316584_0006067_3805_4992 370
68 3300002704 JGI25155J39150_1000053 JGI25155J39150_100005325 371
69 3300002705 JGI25156J39149_1000045 JGI25156J39149_100004544 371
70 3300002738 JGI25154J39366_1000064 JGI25154J39366_100006455 371
71 3300002741 JGI25157J39369_1000063 JGI25157J39369_100006355 371
72 3300002774 JGI25150J39212_1003417 JGI25150J39212_10034172 371
73 3300002774 JGI25150J39212_1005429 JGI25150J39212_10054292 371
74 3300002987 JGI25159J45721_1000581 JGI25159J45721_10005811 371
75 3300002987 JGI25159J45721_1002137 JGI25159J45721_10021372 371
76 3300003187 JGI25151J46595_10016821 JGI25151J46595_100168212 371
77 3300003354 JGI25160J50197_1000517 JGI25160J50197_100051713 371
78 3300003374 JGI25161J50226_1000081 JGI25161J50226_100008125 371
79 3300003771 Ga0055526_1017809 Ga0055526_10178091 371
80 3300003773 Ga0055537_1000430 Ga0055537_100043027 371
81 3300003773 Ga0055537_1006949 Ga0055537_10069491 371
82 3300003775 Ga0055524_1000114 Ga0055524_10001148 371
83 3300003784 Ga0055534_1000972 Ga0055534_10009726 371
84 3300003790 Ga0055528_1000405 Ga0055528_100040522 371
85 3300003791 Ga0055530_10000317 Ga0055530_1000031710 371
86 3300003792 Ga0055540_1000153 Ga0055540_100015350 371
87 3300003794 Ga0055531_10002088 Ga0055531_100020881 371
88 3300004625 Ga0055543_1000291 Ga0055543_10002917 371
89 3300005262 Ga0065165_1005595 Ga0065165_10055955 371
90 3300005262 Ga0065165_1007565 Ga0065165_10075654 371
91 3300005468 Ga0070707_100175277 Ga0070707_1001752771 371
92 3300006058 Ga0075432_10034745 Ga0075432_100347451 371
93 3300006353 Ga0075370_10014707 Ga0075370_100147073 371
94 3300025206 Ga0209435_100003 Ga0209435_100003557 371
95 3300025245 Ga0207425_1003726 Ga0207425_10037262 371
96 3300025246 Ga0209646_1000008 Ga0209646_1000008557 371
97 3300025250 Ga0209026_1000007 Ga0209026_1000007557 371
98 3300025256 Ga0209759_1000019 Ga0209759_1000019278 371
99 3300025263 Ga0209565_1000043 Ga0209565_1000043113 371
100 3300025263 Ga0209565_1007343 Ga0209565_10073432 371
101 3300025273 Ga0209673_1000008 Ga0209673_1000008340 371
102 3300025284 Ga0209130_1000110 Ga0209130_100011061 371
103 3300025284 Ga0209130_1000569 Ga0209130_10005692 371
104 3300025291 Ga0209675_1000170 Ga0209675_10001702 371
105 3300025291 Ga0209675_1005411 Ga0209675_10054115 371
106 3300025292 Ga0209676_1000023 Ga0209676_100002393 371
107 3300025292 Ga0209676_1001380 Ga0209676_10013808 371
108 3300025294 Ga0209025_1006727 Ga0209025_10067278 371
109 3300025294 Ga0209025_1007832 Ga0209025_10078322 371
110 3300025294 Ga0209025_1009058 Ga0209025_10090582 371
111 3300025295 Ga0209564_1001847 Ga0209564_10018472 371
112 3300025297 Ga0209758_1017887 Ga0209758_10178872 371
113 3300025298 Ga0209050_1000022 Ga0209050_100002275 371
114 3300025298 Ga0209050_1016557 Ga0209050_10165572 371
115 3300025299 Ga0209256_1000001 Ga0209256_10000011561 371
116 3300025302 Ga0207426_1000117 Ga0207426_1000117139 371
117 3300025302 Ga0207426_1001160 Ga0207426_100116020 371
118 3300025303 Ga0209051_1000013 Ga0209051_100001375 371
119 3300025304 Ga0209257_1000042 Ga0209257_1000042411 371
120 3300026041 Ga0207639_10061438 Ga0207639_100614381 371
121 3300031456 Ga0307513_10000020 Ga0307513_10000020145 371
122 3300042876 Ga0451577_0018493 Ga0451577_0018493_2720_3943 371
123 3300046472 Ga0495580_0025643 Ga0495580_0025643_2691_3902 371
124 3300046473 Ga0495582_0003250 Ga0495582_0003250_4260_5471 371
125 3300046499 Ga0495594_0024776 Ga0495594_0024776_558_1769 371
126 3300046526 Ga0495666_0013084 Ga0495666_0013084_1335_2546 371
127 3300046533 Ga0495640_0154113 Ga0495640_0154113_155_1366 371
128 3300046536 Ga0495587_0019463 Ga0495587_0019463_1046_2257 371
129 3300046642 Ga0495634_0008231 Ga0495634_0008231_82_1293 371
130 3300046809 Ga0495600_0027348 Ga0495600_0027348_2102_3313 371
131 3300047317 Ga0495604_0010562 Ga0495604_0010562_4775_5986 371
132 3300047444 Ga0495675_0005883 Ga0495675_0005883_5925_7136 371
133 3300048088 Ga0495602_0003834 Ga0495602_0003834_6832_8043 371
134 3300053088 Ga0500644_0001410 Ga0500644_0001410_2807_4006 371
135 3300053117 Ga0500593_000810 Ga0500593_000810_6628_7827 371
136 3300053730 Ga0500645_003945 Ga0500645_003945_3983_5182 371
137 3300031456 Ga0307513_10000129 Ga0307513_1000012915 372
138 3300053093 Ga0500651_0042015 Ga0500651_0042015_1129_2328 372
139 3300055283 Ga0500661_002024 Ga0500661_002024_1632_2831 372
140 3300025910 Ga0207684_10001414 Ga0207684_1000141410 373
141 3300046665 Ga0495661_0000622 Ga0495661_0000622_23107_24294 373
142 3300021361 Ga0213872_10000129 Ga0213872_100001299 374
143 3300039447 Ga0436361_0355769 Ga0436361_0355769_2976_4202 374
144 3300039447 Ga0436361_0362312 Ga0436361_0362312_7347_8573 374
145 3300049571 Ga0501034_0020618 Ga0501034_0020618_180_1340 374
146 3300003794 Ga0055531_10000314 Ga0055531_100003143 375
147 3300025298 Ga0209050_1004630 Ga0209050_10046305 375
148 3300025303 Ga0209051_1004966 Ga0209051_10049668 375
149 3300025304 Ga0209257_1000017 Ga0209257_1000017570 375
150 3300031901 Ga0307406_10004722 Ga0307406_100047225 375
151 3300049822 Ga0501035_0006696 Ga0501035_0006696_4510_5727 375
152 3300049823 Ga0501044_0032540 Ga0501044_0032540_2458_3675 375
153 iso_pu_bacteria 2547132103 2547376117 375
154 iso_pu_bacteria 2846037992 2846040415 375
155 iso_pu_bacteria 2998344455 2998346302 375
156 3300031250 Ga0265331_10011350 Ga0265331_100113501 376
157 3300005618 Ga0068864_100220720 Ga0068864_1002207201 377
158 3300025903 Ga0207680_10126225 Ga0207680_101262252 378
159 3300005355 Ga0070671_100042594 Ga0070671_1000425942 379
160 3300005459 Ga0068867_100003928 Ga0068867_1000039289 379
161 3300006051 Ga0075364_10018465 Ga0075364_100184653 379
162 3300013308 Ga0157375_10084511 Ga0157375_100845112 379
163 3300025926 Ga0207659_10003471 Ga0207659_100034718 379
164 3300025931 Ga0207644_10062850 Ga0207644_100628504 379
165 3300025940 Ga0207691_10005462 Ga0207691_1000546211 379
166 3300025942 Ga0207689_10022772 Ga0207689_100227724 379
167 3300025960 Ga0207651_10027991 Ga0207651_100279913 379
168 3300026089 Ga0207648_10013431 Ga0207648_100134314 379
169 3300026116 Ga0207674_10012238 Ga0207674_100122385 379
170 3300050493 nmdc:mga0k408_15212_c1 nmdc:mga0k408_15212_c1_2536_3759 379
171 3300006051 Ga0075364_10015326 Ga0075364_100153261 380
172 3300006195 Ga0075366_10017339 Ga0075366_100173392 380
173 3300006195 Ga0075366_10079412 Ga0075366_100794122 380
174 3300006353 Ga0075370_10000742 Ga0075370_100007427 380
175 3300035695 Ga0373927_0201911 Ga0373927_0201911_79_1263 380
176 3300037312 Ga0395899_0102242 Ga0395899_0102242_506_1711 380
177 3300050491 nmdc:mga00v17_12094_c1 nmdc:mga00v17_12094_c1_97_1281 380
178 3300050493 nmdc:mga0k408_22699_c1 nmdc:mga0k408_22699_c1_1796_2989 380
179 3300050496 nmdc:mga07m45_13425_c1 nmdc:mga07m45_13425_c1_2158_3351 380
180 iso_pu_bacteria 2839138175 2839142611 380
181 3300031691 Ga0316579_10002053 Ga0316579_100020537 381
182 3300031727 Ga0316576_10113349 Ga0316576_101133492 381
183 3300031728 Ga0316578_10038197 Ga0316578_100381971 381
184 3300032168 Ga0316593_10033310 Ga0316593_100333102 381
185 3300033524 Ga0316592_1005500 Ga0316592_10055002 381
186 3300033524 Ga0316592_1024929 Ga0316592_10249291 381
187 3300033528 Ga0316588_1005901 Ga0316588_10059014 381
188 3300036712 Ga0316584_0074349 Ga0316584_0074349_408_1598 381
189 3300045051 Ga0451576_0006156 Ga0451576_0006156_12273_13463 381
190 3300006038 Ga0075365_10000227 Ga0075365_1000022714 382
191 3300006048 Ga0075363_100004105 Ga0075363_1000041055 382
192 3300006051 Ga0075364_10001197 Ga0075364_1000119711 382
193 3300006178 Ga0075367_10001265 Ga0075367_1000126511 382
194 3300006186 Ga0075369_10000060 Ga0075369_100000608 382
195 3300006194 Ga0075427_10000023 Ga0075427_100000235 382
196 3300006353 Ga0075370_10000066 Ga0075370_1000006618 382
197 3300031238 Ga0265332_10000020 Ga0265332_1000002078 382
198 3300042007 Ga0439449_0000947 Ga0439449_0000947_6524_7738 382
199 3300049823 Ga0501044_0007167 Ga0501044_0007167_9506_10684 382
200 3300050490 nmdc:mga03n38_61_c1 nmdc:mga03n38_61_c1_10372_11559 382
201 3300050491 nmdc:mga00v17_146_c1 nmdc:mga00v17_146_c1_23887_25074 382
202 3300050491 nmdc:mga00v17_505_c1 nmdc:mga00v17_505_c1_13568_14755 382
203 3300050492 nmdc:mga0yw44_57_c1 nmdc:mga0yw44_57_c1_21601_22788 382
204 3300050494 nmdc:mga06z11_105_c1 nmdc:mga06z11_105_c1_24064_25251 382
205 3300050494 nmdc:mga06z11_6455_c1 nmdc:mga06z11_6455_c1_243_1430 382
206 3300050496 nmdc:mga07m45_142667_c1 nmdc:mga07m45_142667_c1_154_1341 382
207 3300050496 nmdc:mga07m45_66_c1 nmdc:mga07m45_66_c1_23865_25052 382
208 3300050516 nmdc:mga0sz30_118_c1 nmdc:mga0sz30_118_c1_15789_16976 382
209 3300005563 Ga0068855_100041043 Ga0068855_1000410434 383
210 3300025949 Ga0207667_10046059 Ga0207667_100460594 383
211 3300045049 Ga0466959_0023408 Ga0466959_0023408_2403_3569 383
212 3300050493 nmdc:mga0k408_28295_c1 nmdc:mga0k408_28295_c1_1533_2744 383
213 3300006038 Ga0075365_10002710 Ga0075365_100027105 384
214 3300006195 Ga0075366_10023387 Ga0075366_100233873 384
215 3300009176 Ga0105242_10000485 Ga0105242_1000048512 384
216 3300021361 Ga0213872_10000411 Ga0213872_100004112 384
217 3300021361 Ga0213872_10009020 Ga0213872_100090204 384
218 3300039447 Ga0436361_0255861 Ga0436361_0255861_47328_48524 384
219 3300048924 Ga0496121_0000012 Ga0496121_0000012_444107_445294 384
220 3300050492 nmdc:mga0yw44_275_c1 nmdc:mga0yw44_275_c1_8743_9930 384
221 3300050516 nmdc:mga0sz30_34430_c1 nmdc:mga0sz30_34430_c1_197_1384 384
222 3300059630 Ga0587128_002004 Ga0587128_002004_528_1736 384
223 iso_pu_bacteria 2599185292 2599904959 384
224 iso_pu_bacteria 2643221569 2643860404 384
225 iso_pu_bacteria 2643221594 2643981740 384
226 iso_pu_bacteria 2643221621 2644119860 384
227 iso_pu_bacteria 2808606395 2809035644 384
228 iso_pu_bacteria 2855730933 2855732529 384
229 iso_pu_bacteria 2855767633 2855769237 384
230 iso_pu_bacteria 2881927736 2881928119 384
231 iso_pu_bacteria 2887375801 2887379238 384
232 iso_pu_bacteria 2928084124 2928086878 384
233 iso_pu_bacteria 2941479691 2941483874 384
234 3300005458 Ga0070681_10019572 Ga0070681_100195725 385
235 3300009551 Ga0105238_10128869 Ga0105238_101288691 385
236 3300013100 Ga0157373_10123000 Ga0157373_101230001 385
237 3300013104 Ga0157370_10007697 Ga0157370_100076972 385
238 3300021361 Ga0213872_10010720 Ga0213872_100107203 385
239 3300039447 Ga0436361_0393109 Ga0436361_0393109_1104_2309 385
240 3300049586 Ga0501070_0003847 Ga0501070_0003847_1504_2700 385
241 3300049588 Ga0501072_0059851 Ga0501072_0059851_470_1666 385
242 3300049589 Ga0501073_0029410 Ga0501073_0029410_1526_2722 385
243 3300049590 Ga0501074_0134826 Ga0501074_0134826_108_1304 385
244 3300049744 Ga0501083_0025700 Ga0501083_0025700_2451_3647 385
245 iso_pu_bacteria 2857542790 2857546935 385
246 iso_pu_bacteria 2881412998 2881414871 385
247 3300006358 Ga0068871_100090123 Ga0068871_1000901232 386
248 3300044683 Ga0466965_0097482 Ga0466965_0097482_221_1435 386
249 iso_pu_bacteria 2511231002 2511242903 386
250 3300005328 Ga0070676_10162578 Ga0070676_101625781 387
251 3300005355 Ga0070671_100106280 Ga0070671_1001062802 387
252 3300005617 Ga0068859_100060955 Ga0068859_1000609553 387
253 3300006931 Ga0097620_100060960 Ga0097620_1000609603 387
254 3300025931 Ga0207644_10050485 Ga0207644_100504853 387
255 3300026095 Ga0207676_10187259 Ga0207676_101872592 387
256 3300048915 Ga0496112_0008823 Ga0496112_0008823_3101_4315 387
257 3300048915 Ga0496112_0260384 Ga0496112_0260384_182_1393 387
258 iso_pu_bacteria 2596583598 2597029785 387
259 iso_pu_bacteria 2599185178 2599446772 387
260 iso_pu_bacteria 2885266251 2885267795 387
261 iso_pu_bacteria 2900577576 2900577623 387
262 iso_pu_bacteria 2928058823 2928061791 387
263 3300003187 JGI25151J46595_10001460 JGI25151J46595_1000146011 388
264 3300006051 Ga0075364_10018914 Ga0075364_100189142 388
265 3300009551 Ga0105238_10044057 Ga0105238_100440572 388
266 3300025284 Ga0209130_1001087 Ga0209130_10010877 388
267 3300025292 Ga0209676_1005823 Ga0209676_10058231 388
268 3300025294 Ga0209025_1000057 Ga0209025_1000057204 388
269 3300025294 Ga0209025_1023858 Ga0209025_10238583 388
270 3300025298 Ga0209050_1025076 Ga0209050_10250762 388
271 3300025303 Ga0209051_1037497 Ga0209051_10374972 388
272 3300031239 Ga0265328_10018418 Ga0265328_100184183 388
273 3300031250 Ga0265331_10004933 Ga0265331_100049333 388
274 3300031251 Ga0265327_10000144 Ga0265327_1000014412 388
275 3300031548 Ga0307408_100000086 Ga0307408_10000008622 388
276 3300035114 Ga0373939_0000004 Ga0373939_0000004_5168_6379 388
277 3300035121 Ga0373960_0006404 Ga0373960_0006404_348_1559 388
278 3300035691 Ga0373931_0000140 Ga0373931_0000140_8466_9677 388
279 3300037471 Ga0395905_0000777 Ga0395905_0000777_36546_37757 388
280 3300045051 Ga0451576_0058191 Ga0451576_0058191_403_1614 388
281 3300045051 Ga0451576_0137794 Ga0451576_0137794_1056_2267 388
282 3300048919 Ga0496116_0009604 Ga0496116_0009604_3041_4249 388
283 3300048919 Ga0496116_0015236 Ga0496116_0015236_379_1587 388
284 3300048921 Ga0496118_0006180 Ga0496118_0006180_9473_10681 388
285 3300048922 Ga0496119_0018064 Ga0496119_0018064_2477_3685 388
286 3300048923 Ga0496120_0017510 Ga0496120_0017510_2854_4062 388
287 3300048924 Ga0496121_0000568 Ga0496121_0000568_101_1309 388
288 3300048925 Ga0496122_0000329 Ga0496122_0000329_43309_44517 388
289 3300048926 Ga0496123_0000260 Ga0496123_0000260_45411_46619 388
290 3300048927 Ga0496124_0051122 Ga0496124_0051122_284_1492 388
291 3300048928 Ga0496125_0000105 Ga0496125_0000105_14316_15524 388
292 3300048928 Ga0496125_0042518 Ga0496125_0042518_94_1302 388
293 3300048928 Ga0496125_0076766 Ga0496125_0076766_1357_2565 388
294 3300048929 Ga0496126_0248983 Ga0496126_0248983_207_1415 388
295 3300049823 Ga0501044_0014188 Ga0501044_0014188_2203_3411 388
296 iso_pu_bacteria 2643221544 2643745715 388
297 iso_pu_bacteria 2738541337 2739058606 388
298 iso_pu_bacteria 2831864461 2831870103 388
299 3300003374 JGI25161J50226_1001581 JGI25161J50226_10015817 389
300 3300003578 Ga0006562J51391_1011363 Ga0006562J51391_10113637 389
301 3300003578 Ga0006562J51391_1011704 Ga0006562J51391_10117041 389
302 3300003759 Ga0055525_1000011 Ga0055525_1000011425 389
303 3300003759 Ga0055525_1000046 Ga0055525_100004613 389
304 3300003761 Ga0055535_1000142 Ga0055535_100014242 389
305 3300003762 Ga0055542_1000022 Ga0055542_1000022189 389
306 3300003773 Ga0055537_1002108 Ga0055537_10021087 389
307 3300003773 Ga0055537_1004361 Ga0055537_10043612 389
308 3300003781 Ga0055536_1011706 Ga0055536_10117061 389
309 3300003784 Ga0055534_1000963 Ga0055534_100096313 389
310 3300003790 Ga0055528_1002010 Ga0055528_10020101 389
311 3300003790 Ga0055528_1014951 Ga0055528_10149512 389
312 3300003791 Ga0055530_10004544 Ga0055530_100045447 389
313 3300003791 Ga0055530_10004603 Ga0055530_100046037 389
314 3300003792 Ga0055540_1003508 Ga0055540_10035088 389
315 3300003792 Ga0055540_1003949 Ga0055540_10039491 389
316 3300003792 Ga0055540_1019060 Ga0055540_10190602 389
317 3300003794 Ga0055531_10000493 Ga0055531_1000049322 389
318 3300004785 Ga0058858_1433317 Ga0058858_14333171 389
319 3300004798 Ga0058859_10135176 Ga0058859_101351761 389
320 3300005289 Ga0065704_10079392 Ga0065704_100793922 389
321 3300005289 Ga0065704_10135769 Ga0065704_101357691 389
322 3300005327 Ga0070658_10042765 Ga0070658_100427654 389
323 3300005338 Ga0068868_100045277 Ga0068868_1000452773 389
324 3300005354 Ga0070675_100271986 Ga0070675_1002719861 389
325 3300005366 Ga0070659_100003171 Ga0070659_1000031712 389
326 3300005367 Ga0070667_100081311 Ga0070667_1000813114 389
327 3300005456 Ga0070678_100017957 Ga0070678_1000179575 389
328 3300005530 Ga0070679_100179178 Ga0070679_1001791781 389
329 3300005548 Ga0070665_100108615 Ga0070665_1001086154 389
330 3300005548 Ga0070665_100112005 Ga0070665_1001120051 389
331 3300006038 Ga0075365_10003284 Ga0075365_1000328410 389
332 3300006042 Ga0075368_10014400 Ga0075368_100144004 389
333 3300006051 Ga0075364_10003065 Ga0075364_100030654 389
334 3300006051 Ga0075364_10007708 Ga0075364_100077081 389
335 3300006051 Ga0075364_10026882 Ga0075364_100268823 389
336 3300006177 Ga0075362_10027844 Ga0075362_100278444 389
337 3300006177 Ga0075362_10083585 Ga0075362_100835852 389
338 3300006178 Ga0075367_10037556 Ga0075367_100375562 389
339 3300006195 Ga0075366_10016779 Ga0075366_100167795 389
340 3300006195 Ga0075366_10022612 Ga0075366_100226123 389
341 3300006195 Ga0075366_10093416 Ga0075366_100934162 389
342 3300006195 Ga0075366_10120475 Ga0075366_101204752 389
343 3300006353 Ga0075370_10010506 Ga0075370_100105065 389
344 3300006353 Ga0075370_10028371 Ga0075370_100283711 389
345 3300006353 Ga0075370_10029346 Ga0075370_100293462 389
346 3300006353 Ga0075370_10032406 Ga0075370_100324062 389
347 3300006353 Ga0075370_10042707 Ga0075370_100427072 389
348 3300006353 Ga0075370_10067354 Ga0075370_100673542 389
349 3300006353 Ga0075370_10067965 Ga0075370_100679652 389
350 3300006353 Ga0075370_10088870 Ga0075370_100888702 389
351 3300006846 Ga0075430_100083106 Ga0075430_1000831062 389
352 3300006948 Ga0099826_10005550 Ga0099826_100055509 389
353 3300009093 Ga0105240_10005483 Ga0105240_100054839 389
354 3300009148 Ga0105243_10010351 Ga0105243_100103517 389
355 3300009148 Ga0105243_10020161 Ga0105243_100201612 389
356 3300009177 Ga0105248_10072326 Ga0105248_100723262 389
357 3300009177 Ga0105248_10408599 Ga0105248_104085992 389
358 3300009545 Ga0105237_10174704 Ga0105237_101747042 389
359 3300009551 Ga0105238_10017534 Ga0105238_100175346 389
360 3300010375 Ga0105239_10182747 Ga0105239_101827472 389
361 3300010375 Ga0105239_10528229 Ga0105239_105282291 389
362 3300012502 Ga0157347_1000854 Ga0157347_10008542 389
363 3300013100 Ga0157373_10067144 Ga0157373_100671442 389
364 3300013100 Ga0157373_10085739 Ga0157373_100857392 389
365 3300013102 Ga0157371_10047817 Ga0157371_100478172 389
366 3300013104 Ga0157370_10014694 Ga0157370_100146948 389
367 3300013105 Ga0157369_10011577 Ga0157369_100115777 389
368 3300013307 Ga0157372_10132393 Ga0157372_101323934 389
369 3300014497 Ga0182008_10000215 Ga0182008_1000021537 389
370 3300014497 Ga0182008_10010204 Ga0182008_100102042 389
371 3300014497 Ga0182008_10043605 Ga0182008_100436052 389
372 3300014497 Ga0182008_10073062 Ga0182008_100730622 389
373 3300014969 Ga0157376_10018648 Ga0157376_100186482 389
374 3300015261 Ga0182006_1008804 Ga0182006_10088042 389
375 3300015261 Ga0182006_1026968 Ga0182006_10269682 389
376 3300015262 Ga0182007_10003586 Ga0182007_100035867 389
377 3300015683 Ga0183362_10005 Ga0183362_10005400 389
378 3300017792 Ga0163161_10000849 Ga0163161_100008492 389
379 3300017792 Ga0163161_10066787 Ga0163161_100667871 389
380 3300017792 Ga0163161_10094501 Ga0163161_100945012 389
381 3300020077 Ga0206351_10216415 Ga0206351_102164151 389
382 3300021361 Ga0213872_10000003 Ga0213872_10000003278 389
383 3300021361 Ga0213872_10000042 Ga0213872_1000004218 389
384 3300021361 Ga0213872_10000351 Ga0213872_100003519 389
385 3300021361 Ga0213872_10026271 Ga0213872_100262713 389
386 3300025228 Ga0209672_100689 Ga0209672_1006898 389
387 3300025229 Ga0209147_100794 Ga0209147_1007943 389
388 3300025230 Ga0209563_100005 Ga0209563_100005751 389
389 3300025242 Ga0209258_100009 Ga0209258_100009852 389
390 3300025245 Ga0207425_1002133 Ga0207425_10021337 389
391 3300025254 Ga0209148_1000007 Ga0209148_1000007852 389
392 3300025258 Ga0209129_1000024 Ga0209129_1000024219 389
393 3300025258 Ga0209129_1015583 Ga0209129_10155832 389
394 3300025263 Ga0209565_1000046 Ga0209565_1000046156 389
395 3300025263 Ga0209565_1001386 Ga0209565_10013862 389
396 3300025273 Ga0209673_1000058 Ga0209673_100005862 389
397 3300025273 Ga0209673_1000615 Ga0209673_100061547 389
398 3300025273 Ga0209673_1002626 Ga0209673_10026267 389
399 3300025273 Ga0209673_1040023 Ga0209673_10400231 389
400 3300025284 Ga0209130_1001597 Ga0209130_10015978 389
401 3300025284 Ga0209130_1002030 Ga0209130_10020306 389
402 3300025291 Ga0209675_1000010 Ga0209675_1000010203 389
403 3300025291 Ga0209675_1003361 Ga0209675_10033613 389
404 3300025292 Ga0209676_1000028 Ga0209676_1000028120 389
405 3300025292 Ga0209676_1000098 Ga0209676_1000098170 389
406 3300025292 Ga0209676_1000194 Ga0209676_100019413 389
407 3300025292 Ga0209676_1001840 Ga0209676_100184017 389
408 3300025294 Ga0209025_1000272 Ga0209025_10002722 389
409 3300025294 Ga0209025_1000289 Ga0209025_10002892 389
410 3300025294 Ga0209025_1042040 Ga0209025_10420402 389
411 3300025294 Ga0209025_1042382 Ga0209025_10423822 389
412 3300025294 Ga0209025_1046041 Ga0209025_10460413 389
413 3300025295 Ga0209564_1000183 Ga0209564_1000183119 389
414 3300025295 Ga0209564_1000198 Ga0209564_1000198109 389
415 3300025297 Ga0209758_1000049 Ga0209758_1000049138 389
416 3300025297 Ga0209758_1000204 Ga0209758_1000204116 389
417 3300025298 Ga0209050_1000002 Ga0209050_1000002123 389
418 3300025298 Ga0209050_1000122 Ga0209050_1000122111 389
419 3300025298 Ga0209050_1000895 Ga0209050_100089536 389
420 3300025299 Ga0209256_1000098 Ga0209256_1000098184 389
421 3300025299 Ga0209256_1000140 Ga0209256_1000140119 389
422 3300025302 Ga0207426_1000038 Ga0207426_1000038184 389
423 3300025302 Ga0207426_1000053 Ga0207426_1000053174 389
424 3300025303 Ga0209051_1000015 Ga0209051_100001549 389
425 3300025303 Ga0209051_1000168 Ga0209051_1000168116 389
426 3300025303 Ga0209051_1000173 Ga0209051_100017366 389
427 3300025303 Ga0209051_1000179 Ga0209051_10001794 389
428 3300025303 Ga0209051_1000488 Ga0209051_100048849 389
429 3300025303 Ga0209051_1000814 Ga0209051_100081430 389
430 3300025303 Ga0209051_1001925 Ga0209051_100192514 389
431 3300025304 Ga0209257_1000002 Ga0209257_100000232 389
432 3300025304 Ga0209257_1000096 Ga0209257_100009675 389
433 3300025304 Ga0209257_1000412 Ga0209257_100041279 389
434 3300025728 Ga0207655_1003001 Ga0207655_10030019 389
435 3300025909 Ga0207705_10071062 Ga0207705_100710622 389
436 3300025913 Ga0207695_10029800 Ga0207695_100298006 389
437 3300025919 Ga0207657_10045327 Ga0207657_100453274 389
438 3300025921 Ga0207652_10025150 Ga0207652_100251505 389
439 3300025924 Ga0207694_10019947 Ga0207694_100199472 389
440 3300025932 Ga0207690_10004058 Ga0207690_100040587 389
441 3300025935 Ga0207709_10000130 Ga0207709_10000130103 389
442 3300025935 Ga0207709_10001694 Ga0207709_100016946 389
443 3300025942 Ga0207689_10100290 Ga0207689_101002902 389
444 3300025945 Ga0207679_10006049 Ga0207679_100060496 389
445 3300025949 Ga0207667_10339975 Ga0207667_103399752 389
446 3300025981 Ga0207640_10179312 Ga0207640_101793121 389
447 3300025986 Ga0207658_10111847 Ga0207658_101118472 389
448 3300026023 Ga0207677_10163452 Ga0207677_101634522 389
449 3300026041 Ga0207639_10003459 Ga0207639_100034592 389
450 3300026089 Ga0207648_10212645 Ga0207648_102126451 389
451 3300026121 Ga0207683_10006050 Ga0207683_1000605010 389
452 3300026121 Ga0207683_10373506 Ga0207683_103735061 389
453 3300026142 Ga0207698_10272726 Ga0207698_102727262 389
454 3300027665 Ga0209983_1010176 Ga0209983_10101761 389
455 3300027666 Ga0209282_1002486 Ga0209282_10024868 389
456 3300027876 Ga0209974_10015055 Ga0209974_100150552 389
457 3300028379 Ga0268266_10014299 Ga0268266_100142996 389
458 3300028380 Ga0268265_10016123 Ga0268265_100161236 389
459 3300028794 Ga0307515_10000040 Ga0307515_10000040295 389
460 3300028794 Ga0307515_10041442 Ga0307515_100414422 389
461 3300028794 Ga0307515_10090189 Ga0307515_100901892 389
462 3300030733 Ga0314311_1040207 Ga0314311_10402072 389
463 3300030735 Ga0316178_1118432 Ga0316178_11184324 389
464 3300030742 Ga0316183_1082423 Ga0316183_10824232 389
465 3300030744 Ga0316181_1082156 Ga0316181_10821561 389
466 3300030745 Ga0316182_1083649 Ga0316182_10836492 389
467 3300030745 Ga0316182_1306370 Ga0316182_13063701 389
468 3300031250 Ga0265331_10038086 Ga0265331_100380861 389
469 3300031251 Ga0265327_10005627 Ga0265327_100056276 389
470 3300031251 Ga0265327_10073363 Ga0265327_100733632 389
471 3300031344 Ga0265316_10000005 Ga0265316_1000000592 389
472 3300031456 Ga0307513_10032452 Ga0307513_100324521 389
473 3300031548 Ga0307408_100003486 Ga0307408_1000034864 389
474 3300031548 Ga0307408_100049153 Ga0307408_1000491532 389
475 3300031548 Ga0307408_100088756 Ga0307408_1000887562 389
476 3300031649 Ga0307514_10000920 Ga0307514_1000092034 389
477 3300031711 Ga0265314_10001065 Ga0265314_1000106510 389
478 3300031712 Ga0265342_10081970 Ga0265342_100819701 389
479 3300031731 Ga0307405_10038766 Ga0307405_100387662 389
480 3300031901 Ga0307406_10002476 Ga0307406_100024764 389
481 3300031911 Ga0307412_10045274 Ga0307412_100452742 389
482 3300031911 Ga0307412_10056567 Ga0307412_100565674 389
483 3300032005 Ga0307411_10130385 Ga0307411_101303851 389
484 3300037312 Ga0395899_0005350 Ga0395899_0005350_8285_9499 389
485 3300037312 Ga0395899_0006712 Ga0395899_0006712_6263_7477 389
486 3300037418 Ga0395900_0000131 Ga0395900_0000131_98556_99776 389
487 3300037418 Ga0395900_0005063 Ga0395900_0005063_5923_7137 389
488 3300037418 Ga0395900_0005396 Ga0395900_0005396_464_1678 389
489 3300037418 Ga0395900_0018610 Ga0395900_0018610_726_1940 389
490 3300037418 Ga0395900_0021753 Ga0395900_0021753_1218_2429 389
491 3300037418 Ga0395900_0119412 Ga0395900_0119412_1300_2514 389
492 3300037466 Ga0395898_0006253 Ga0395898_0006253_724_1938 389
493 3300037466 Ga0395898_0011606 Ga0395898_0011606_3413_4627 389
494 3300037471 Ga0395905_0001157 Ga0395905_0001157_25197_26411 389
495 3300037471 Ga0395905_0001668 Ga0395905_0001668_5704_6930 389
496 3300037471 Ga0395905_0026275 Ga0395905_0026275_2874_4088 389
497 3300037471 Ga0395905_0040407 Ga0395905_0040407_452_1666 389
498 3300037471 Ga0395905_0078207 Ga0395905_0078207_1509_2732 389
499 3300037471 Ga0395905_0105542 Ga0395905_0105542_418_1632 389
500 3300037471 Ga0395905_0116952 Ga0395905_0116952_1097_2311 389
501 3300038443 Ga0395901_0007241 Ga0395901_0007241_2122_3345 389
502 3300038443 Ga0395901_0022743 Ga0395901_0022743_1234_2445 389
503 3300038443 Ga0395901_0043010 Ga0395901_0043010_1515_2729 389
504 3300038443 Ga0395901_0099214 Ga0395901_0099214_1211_2425 389
505 3300038443 Ga0395901_0183218 Ga0395901_0183218_565_1779 389
506 3300038443 Ga0395901_0311371 Ga0395901_0311371_83_1297 389
507 3300039447 Ga0436361_0616441 Ga0436361_0616441_23217_24449 389
508 3300039447 Ga0436361_0916159 Ga0436361_0916159_8206_9438 389
509 3300039447 Ga0436361_1150385 Ga0436361_1150385_43601_44944 389
510 3300041404 Ga0439436_0000635 Ga0439436_0000635_4130_5344 389
511 3300041406 Ga0439439_0000329 Ga0439439_0000329_1767_2981 389
512 3300041411 Ga0439466_0004216 Ga0439466_0004216_621_1835 389
513 3300041413 Ga0439465_0000176 Ga0439465_0000176_12201_13415 389
514 3300041413 Ga0439465_0016982 Ga0439465_0016982_591_1805 389
515 3300041997 Ga0439431_0009855 Ga0439431_0009855_423_1637 389
516 3300042004 Ga0439445_0000181 Ga0439445_0000181_9837_11051 389
517 3300042004 Ga0439445_0009295 Ga0439445_0009295_788_2002 389
518 3300042007 Ga0439449_0000632 Ga0439449_0000632_10574_11788 389
519 3300042007 Ga0439449_0001266 Ga0439449_0001266_2558_3772 389
520 3300042015 Ga0439462_0001510 Ga0439462_0001510_2374_3588 389
521 3300042115 Ga0450911_000725 Ga0450911_000725_7339_8553 389
522 3300042125 Ga0450923_001000 Ga0450923_001000_2160_3374 389
523 3300042185 Ga0450909_009165 Ga0450909_009165_84_1298 389
524 3300042435 Ga0439434_0000543 Ga0439434_0000543_9192_10406 389
525 3300042435 Ga0439434_0003310 Ga0439434_0003310_1362_2576 389
526 3300042435 Ga0439434_0035836 Ga0439434_0035836_283_1497 389
527 3300042531 Ga0450918_002647 Ga0450918_002647_198_1412 389
528 3300042876 Ga0451577_0041881 Ga0451577_0041881_2146_3366 389
529 3300044656 Ga0466969_0001560 Ga0466969_0001560_1089_2303 389
530 3300044656 Ga0466969_0057686 Ga0466969_0057686_490_1746 389
531 3300044693 Ga0466961_0002291 Ga0466961_0002291_1422_2678 389
532 3300044706 Ga0466964_0053627 Ga0466964_0053627_366_1622 389
533 3300044901 Ga0466960_0060962 Ga0466960_0060962_82_1296 389
534 3300045051 Ga0451576_0001995 Ga0451576_0001995_27280_28500 389
535 3300046471 Ga0495650_0020417 Ga0495650_0020417_1979_3199 389
536 3300046471 Ga0495650_0054156 Ga0495650_0054156_155_1366 389
537 3300046512 Ga0495610_0026730 Ga0495610_0026730_1061_2275 389
538 3300046513 Ga0495616_0030690 Ga0495616_0030690_1372_2586 389
539 3300046515 Ga0495620_0019601 Ga0495620_0019601_479_1693 389
540 3300046520 Ga0495637_0003930 Ga0495637_0003930_2171_3385 389
541 3300046530 Ga0495654_0000313 Ga0495654_0000313_35844_37058 389
542 3300046615 Ga0495656_0000087 Ga0495656_0000087_20076_21290 389
543 3300046660 Ga0495625_0001451 Ga0495625_0001451_27181_28395 389
544 3300046683 Ga0495658_0002569 Ga0495658_0002569_4272_5486 389
545 3300046691 Ga0495670_0097686 Ga0495670_0097686_95_1309 389
546 3300047321 Ga0495676_0003280 Ga0495676_0003280_12526_13740 389
547 3300048904 Ga0496101_0005305 Ga0496101_0005305_2912_4126 389
548 3300048905 Ga0496102_0010550 Ga0496102_0010550_5020_6234 389
549 3300048908 Ga0496105_0003188 Ga0496105_0003188_6703_7917 389
550 3300048913 Ga0496110_0040628 Ga0496110_0040628_1579_2793 389
551 3300048917 Ga0496114_0231527 Ga0496114_0231527_296_1510 389
552 3300048919 Ga0496116_0042395 Ga0496116_0042395_287_1483 389
553 3300048920 Ga0496117_0033970 Ga0496117_0033970_2246_3460 389
554 3300048921 Ga0496118_0108075 Ga0496118_0108075_118_1332 389
555 3300048924 Ga0496121_0014158 Ga0496121_0014158_2596_3810 389
556 3300048924 Ga0496121_0076519 Ga0496121_0076519_75_1292 389
557 3300048925 Ga0496122_0000063 Ga0496122_0000063_104312_105526 389
558 3300048926 Ga0496123_0000045 Ga0496123_0000045_154737_155951 389
559 3300048927 Ga0496124_0000036 Ga0496124_0000036_200328_201545 389
560 3300048927 Ga0496124_0025394 Ga0496124_0025394_1640_2854 389
561 3300048928 Ga0496125_0002103 Ga0496125_0002103_23689_24903 389
562 3300048928 Ga0496125_0006290 Ga0496125_0006290_10620_11834 389
563 3300048928 Ga0496125_0012141 Ga0496125_0012141_2645_3859 389
564 3300048928 Ga0496125_0056695 Ga0496125_0056695_964_2178 389
565 3300048929 Ga0496126_0123311 Ga0496126_0123311_802_2016 389
566 3300049539 Ga0501323_004115 Ga0501323_004115_257_1471 389
567 3300049571 Ga0501034_0086590 Ga0501034_0086590_1813_3027 389
568 3300049572 Ga0501036_0085956 Ga0501036_0085956_491_1705 389
569 3300049580 Ga0501046_0016051 Ga0501046_0016051_1385_2599 389
570 3300049581 Ga0501047_0035507 Ga0501047_0035507_1842_3056 389
571 3300049662 Ga0501222_000008 Ga0501222_000008_108637_109878 389
572 3300049705 Ga0501225_0001352 Ga0501225_0001352_3274_4488 389
573 3300049763 Ga0501266_003344 Ga0501266_003344_290_1504 389
574 3300049823 Ga0501044_0111779 Ga0501044_0111779_730_1944 389
575 3300050491 nmdc:mga00v17_2128_c1 nmdc:mga00v17_2128_c1_8753_9970 389
576 3300050491 nmdc:mga00v17_22012_c1 nmdc:mga00v17_22012_c1_234_1484 389
577 3300050491 nmdc:mga00v17_6135_c1 nmdc:mga00v17_6135_c1_4629_5846 389
578 3300050492 nmdc:mga0yw44_176989_c1 nmdc:mga0yw44_176989_c1_23_1237 389
579 3300050493 nmdc:mga0k408_12700_c1 nmdc:mga0k408_12700_c1_1557_2771 389
580 3300050493 nmdc:mga0k408_18434_c1 nmdc:mga0k408_18434_c1_2333_3547 389
581 3300050493 nmdc:mga0k408_1969_c1 nmdc:mga0k408_1969_c1_1884_3104 389
582 3300050493 nmdc:mga0k408_25606_c1 nmdc:mga0k408_25606_c1_1734_2948 389
583 3300050493 nmdc:mga0k408_84073_c1 nmdc:mga0k408_84073_c1_553_1767 389
584 3300050496 nmdc:mga07m45_1573_c1 nmdc:mga07m45_1573_c1_802_2016 389
585 3300050496 nmdc:mga07m45_25532_c1 nmdc:mga07m45_25532_c1_1047_2261 389
586 3300050496 nmdc:mga07m45_3649_c1 nmdc:mga07m45_3649_c1_5746_6960 389
587 3300050496 nmdc:mga07m45_45953_c1 nmdc:mga07m45_45953_c1_1169_2392 389
588 3300050496 nmdc:mga07m45_810_c1 nmdc:mga07m45_810_c1_1955_3169 389
589 3300050496 nmdc:mga07m45_9440_c1 nmdc:mga07m45_9440_c1_2486_3700 389
590 3300053079 Ga0500610_0029223 Ga0500610_0029223_294_1508 389
591 3300053093 Ga0500651_0000125 Ga0500651_0000125_20742_21956 389
592 3300053108 Ga0500562_013588 Ga0500562_013588_272_1486 389
593 3300053110 Ga0500571_006911 Ga0500571_006911_4500_5714 389
594 3300053117 Ga0500593_001579 Ga0500593_001579_2304_3518 389
595 3300053118 Ga0500594_0000938 Ga0500594_0000938_2560_3774 389
596 3300053121 Ga0500607_008170 Ga0500607_008170_246_1460 389
597 3300053122 Ga0500608_020890 Ga0500608_020890_754_1968 389
598 3300053134 Ga0500658_0002003 Ga0500658_0002003_4233_5447 389
599 3300053134 Ga0500658_0002237 Ga0500658_0002237_3783_4997 389
600 3300053139 Ga0500568_0004400 Ga0500568_0004400_3565_4779 389
601 3300053153 Ga0500616_0020378 Ga0500616_0020378_1319_2533 389
602 3300053161 Ga0500634_0099122 Ga0500634_0099122_98_1312 389
603 3300059477 Ga0587084_009376 Ga0587084_009376_36_1250 389
604 3300059491 Ga0587070_013470 Ga0587070_013470_13_1227 389
605 3300059506 Ga0587085_009626 Ga0587085_009626_13_1227 389
606 3300059508 Ga0587088_002489 Ga0587088_002489_215_1429 389
607 3300059511 Ga0587091_011847 Ga0587091_011847_141_1355 389
608 3300059623 Ga0587101_001771 Ga0587101_001771_683_1897 389
609 3300059630 Ga0587128_008413 Ga0587128_008413_36_1250 389
610 3300059641 Ga0587068_012091 Ga0587068_012091_15_1229 389
611 3300059646 Ga0587078_006703 Ga0587078_006703_13_1227 389
612 3300061719 Ga0466962_0029546 Ga0466962_0029546_777_2033 389
613 iso_pu_bacteria 2513020051 2513227666 389
614 iso_pu_bacteria 2547132374 2548499804 389
615 iso_pu_bacteria 2599185214 2599625702 389
616 iso_pu_bacteria 2599185226 2599673715 389
617 iso_pu_bacteria 2599185227 2599683385 389
618 iso_pu_bacteria 2599185229 2599695127 389
619 iso_pu_bacteria 2643221570 2643868045 389
620 iso_pu_bacteria 2643221585 2643936783 389
621 iso_pu_bacteria 2643221596 2643993950 389
622 iso_pu_bacteria 2643221609 2644059604 389
623 iso_pu_bacteria 2643221611 2644074746 389
624 iso_pu_bacteria 2643221628 2644162277 389
625 iso_pu_bacteria 2643221652 2644293656 389
626 iso_pu_bacteria 2643221656 2644318682 389
627 iso_pu_bacteria 2643221658 2644324427 389
628 iso_pu_bacteria 2643221672 2644396276 389
629 iso_pu_bacteria 2643221683 2644464748 389
630 iso_pu_bacteria 2643221717 2644644869 389
631 iso_pu_bacteria 2738541277 2738719221 389
632 iso_pu_bacteria 2738541307 2738880240 389
633 iso_pu_bacteria 2738543012 2739241134 389
634 iso_pu_bacteria 2738543013 2739248060 389
635 iso_pu_bacteria 2738543019 2739281983 389
636 iso_pu_bacteria 2816332133 2816471788 389
637 iso_pu_bacteria 2818991446 2819599724 389
638 iso_pu_bacteria 2831265667 2831271679 389
639 iso_pu_bacteria 2838054893 2838055592 389
640 iso_pu_bacteria 2842677519 2842681201 389
641 iso_pu_bacteria 2842718218 2842721490 389
642 iso_pu_bacteria 2842733646 2842734203 389
643 iso_pu_bacteria 2842747753 2842749536 389
644 iso_pu_bacteria 2881101125 2881102954 389
645 iso_pu_bacteria 2885192300 2885194753 389
646 iso_pu_bacteria 2885198086 2885200874 389
647 iso_pu_bacteria 2885211737 2885214343 389
648 iso_pu_bacteria 2894023352 2894024225 389
649 iso_pu_bacteria 2899924645 2899927643 389
650 iso_pu_bacteria 2904449895 2904450653 389
651 iso_pu_bacteria 2904456579 2904459847 389
652 iso_pu_bacteria 2904541872 2904549815 389
653 iso_pu_bacteria 2919462493 2919462819 389
654 iso_pu_bacteria 2928037797 2928042080 389
655 iso_pu_bacteria 2928044640 2928049644 389
656 iso_pu_bacteria 2928051484 2928051682 389
657 iso_pu_bacteria 2928064002 2928065627 389
658 iso_pu_bacteria 2928070936 2928073094 389
659 iso_pu_bacteria 2928115317 2928120798 389
660 iso_pu_bacteria 2929160207 2929161782 389
661 iso_pu_bacteria 2929520902 2929521370 389
662 iso_pu_bacteria 2939631187 2939632611 389
663 iso_pu_bacteria 2945909444 2945913823 389
664 iso_pu_bacteria 2945945610 2945949384 389
665 iso_pu_bacteria 2945972063 2945973429 389
666 iso_pu_bacteria 2945984333 2945990781 389
667 iso_pu_bacteria 2954767861 2954770964 389
668 iso_pu_bacteria 2974320154 2974322408 389
669 iso_pu_bacteria 2990710928 2990713596 389
670 3300002705 JGI25156J39149_1009053 JGI25156J39149_10090532 390
671 3300002738 JGI25154J39366_1003432 JGI25154J39366_10034322 390
672 3300002738 JGI25154J39366_1003510 JGI25154J39366_10035102 390
673 3300002741 JGI25157J39369_1000018 JGI25157J39369_100001867 390
674 3300003162 Ga0006778J45830_1016434 Ga0006778J45830_10164341 390
675 3300003305 Ga0006770J48903_1020431 Ga0006770J48903_10204311 390
676 3300003308 Ga0006777J48905_1028280 Ga0006777J48905_10282801 390
677 3300003316 rootH1_10006215 rootH1_100062151 390
678 3300003322 rootL2_10000982 rootL2_1000098211 390
679 3300003756 Ga0055533_1000103 Ga0055533_100010311 390
680 3300003761 Ga0055535_1000087 Ga0055535_100008730 390
681 3300003763 Ga0055529_1000139 Ga0055529_100013937 390
682 3300003771 Ga0055526_1001236 Ga0055526_100123616 390
683 3300003775 Ga0055524_1000013 Ga0055524_1000013119 390
684 3300003775 Ga0055524_1001778 Ga0055524_100177812 390
685 3300003775 Ga0055524_1005899 Ga0055524_10058993 390
686 3300003791 Ga0055530_10001043 Ga0055530_1000104323 390
687 3300003792 Ga0055540_1000001 Ga0055540_1000001129 390
688 3300003794 Ga0055531_10002737 Ga0055531_100027377 390
689 3300003794 Ga0055531_10007375 Ga0055531_100073756 390
690 3300003794 Ga0055531_10015669 Ga0055531_100156693 390
691 3300004625 Ga0055543_1005397 Ga0055543_10053975 390
692 3300004625 Ga0055543_1007792 Ga0055543_10077922 390
693 3300005262 Ga0065165_1000197 Ga0065165_100019773 390
694 3300005262 Ga0065165_1000239 Ga0065165_10002395 390
695 3300005262 Ga0065165_1005742 Ga0065165_10057426 390
696 3300005295 Ga0065707_10084601 Ga0065707_100846012 390
697 3300005327 Ga0070658_10082456 Ga0070658_100824562 390
698 3300005327 Ga0070658_10150734 Ga0070658_101507342 390
699 3300005328 Ga0070676_10001955 Ga0070676_100019558 390
700 3300005328 Ga0070676_10039117 Ga0070676_100391172 390
701 3300005329 Ga0070683_100081114 Ga0070683_1000811144 390
702 3300005329 Ga0070683_100093253 Ga0070683_1000932532 390
703 3300005331 Ga0070670_100000939 Ga0070670_10000093914 390
704 3300005331 Ga0070670_100023500 Ga0070670_1000235003 390
705 3300005331 Ga0070670_100043384 Ga0070670_1000433844 390
706 3300005331 Ga0070670_100184444 Ga0070670_1001844442 390
707 3300005333 Ga0070677_10002616 Ga0070677_100026163 390
708 3300005333 Ga0070677_10005224 Ga0070677_100052241 390
709 3300005333 Ga0070677_10035481 Ga0070677_100354812 390
710 3300005334 Ga0068869_100002798 Ga0068869_1000027985 390
711 3300005335 Ga0070666_10111468 Ga0070666_101114682 390
712 3300005335 Ga0070666_10218578 Ga0070666_102185781 390
713 3300005336 Ga0070680_100012342 Ga0070680_1000123425 390
714 3300005337 Ga0070682_100167209 Ga0070682_1001672091 390
715 3300005338 Ga0068868_100004119 Ga0068868_1000041197 390
716 3300005338 Ga0068868_100050588 Ga0068868_1000505884 390
717 3300005338 Ga0068868_100076693 Ga0068868_1000766932 390
718 3300005340 Ga0070689_100008358 Ga0070689_1000083585 390
719 3300005344 Ga0070661_100012486 Ga0070661_1000124863 390
720 3300005347 Ga0070668_100140829 Ga0070668_1001408292 390
721 3300005353 Ga0070669_100066138 Ga0070669_1000661383 390
722 3300005354 Ga0070675_100003660 Ga0070675_10000366012 390
723 3300005354 Ga0070675_100003790 Ga0070675_10000379011 390
724 3300005354 Ga0070675_100026036 Ga0070675_1000260364 390
725 3300005354 Ga0070675_100031337 Ga0070675_1000313374 390
726 3300005354 Ga0070675_100124465 Ga0070675_1001244652 390
727 3300005355 Ga0070671_100002857 Ga0070671_1000028574 390
728 3300005355 Ga0070671_100017900 Ga0070671_1000179003 390
729 3300005355 Ga0070671_100035058 Ga0070671_1000350585 390
730 3300005355 Ga0070671_100043352 Ga0070671_1000433524 390
731 3300005355 Ga0070671_100064946 Ga0070671_1000649463 390
732 3300005355 Ga0070671_100118012 Ga0070671_1001180122 390
733 3300005355 Ga0070671_100146539 Ga0070671_1001465391 390
734 3300005356 Ga0070674_100004270 Ga0070674_1000042706 390
735 3300005356 Ga0070674_100156771 Ga0070674_1001567712 390
736 3300005364 Ga0070673_100002423 Ga0070673_10000242311 390
737 3300005364 Ga0070673_100021355 Ga0070673_1000213552 390
738 3300005364 Ga0070673_100044183 Ga0070673_1000441833 390
739 3300005364 Ga0070673_100103569 Ga0070673_1001035692 390
740 3300005365 Ga0070688_100006265 Ga0070688_1000062655 390
741 3300005367 Ga0070667_100001132 Ga0070667_10000113221 390
742 3300005367 Ga0070667_100002718 Ga0070667_1000027183 390
743 3300005367 Ga0070667_100081411 Ga0070667_1000814112 390
744 3300005367 Ga0070667_100122000 Ga0070667_1001220003 390
745 3300005455 Ga0070663_100021379 Ga0070663_1000213794 390
746 3300005455 Ga0070663_100022223 Ga0070663_1000222234 390
747 3300005455 Ga0070663_100209582 Ga0070663_1002095821 390
748 3300005456 Ga0070678_100014813 Ga0070678_1000148132 390
749 3300005456 Ga0070678_100037399 Ga0070678_1000373993 390
750 3300005456 Ga0070678_100231595 Ga0070678_1002315951 390
751 3300005457 Ga0070662_100004327 Ga0070662_1000043278 390
752 3300005457 Ga0070662_100009659 Ga0070662_1000096594 390
753 3300005457 Ga0070662_100015254 Ga0070662_1000152543 390
754 3300005457 Ga0070662_100016597 Ga0070662_1000165972 390
755 3300005458 Ga0070681_10182314 Ga0070681_101823142 390
756 3300005459 Ga0068867_100000086 Ga0068867_10000008616 390
757 3300005459 Ga0068867_100003769 Ga0068867_1000037698 390
758 3300005459 Ga0068867_100005351 Ga0068867_1000053516 390
759 3300005471 Ga0070698_100084064 Ga0070698_1000840644 390
760 3300005530 Ga0070679_100023124 Ga0070679_1000231241 390
761 3300005543 Ga0070672_100001075 Ga0070672_1000010757 390
762 3300005543 Ga0070672_100079457 Ga0070672_1000794574 390
763 3300005543 Ga0070672_100135687 Ga0070672_1001356872 390
764 3300005543 Ga0070672_100183285 Ga0070672_1001832852 390
765 3300005544 Ga0070686_100182932 Ga0070686_1001829321 390
766 3300005548 Ga0070665_100099545 Ga0070665_1000995454 390
767 3300005563 Ga0068855_100221152 Ga0068855_1002211522 390
768 3300005564 Ga0070664_100096677 Ga0070664_1000966773 390
769 3300005577 Ga0068857_100007953 Ga0068857_1000079537 390
770 3300005577 Ga0068857_100127847 Ga0068857_1001278472 390
771 3300005578 Ga0068854_100067299 Ga0068854_1000672993 390
772 3300005578 Ga0068854_100203468 Ga0068854_1002034681 390
773 3300005614 Ga0068856_100008259 Ga0068856_1000082596 390
774 3300005615 Ga0070702_100123102 Ga0070702_1001231021 390
775 3300005616 Ga0068852_100080615 Ga0068852_1000806152 390
776 3300005616 Ga0068852_100126184 Ga0068852_1001261842 390
777 3300005616 Ga0068852_100148792 Ga0068852_1001487922 390
778 3300005617 Ga0068859_100092966 Ga0068859_1000929663 390
779 3300005618 Ga0068864_100001313 Ga0068864_1000013138 390
780 3300005618 Ga0068864_100013771 Ga0068864_1000137714 390
781 3300005618 Ga0068864_100203793 Ga0068864_1002037932 390
782 3300005718 Ga0068866_10041851 Ga0068866_100418514 390
783 3300005719 Ga0068861_100004782 Ga0068861_1000047828 390
784 3300005719 Ga0068861_100016063 Ga0068861_1000160634 390
785 3300005719 Ga0068861_100034130 Ga0068861_1000341302 390
786 3300005719 Ga0068861_100046860 Ga0068861_1000468604 390
787 3300005719 Ga0068861_100069495 Ga0068861_1000694953 390
788 3300005834 Ga0068851_10104349 Ga0068851_101043491 390
789 3300005834 Ga0068851_10110720 Ga0068851_101107201 390
790 3300005840 Ga0068870_10102541 Ga0068870_101025412 390
791 3300005841 Ga0068863_100019781 Ga0068863_1000197815 390
792 3300005842 Ga0068858_100017353 Ga0068858_1000173535 390
793 3300005842 Ga0068858_100031050 Ga0068858_1000310503 390
794 3300005842 Ga0068858_100050526 Ga0068858_1000505264 390
795 3300005843 Ga0068860_100000685 Ga0068860_1000006854 390
796 3300005843 Ga0068860_100014044 Ga0068860_1000140446 390
797 3300005843 Ga0068860_100022963 Ga0068860_1000229635 390
798 3300005843 Ga0068860_100063757 Ga0068860_1000637572 390
799 3300005843 Ga0068860_100099993 Ga0068860_1000999932 390
800 3300005844 Ga0068862_100011753 Ga0068862_1000117536 390
801 3300005844 Ga0068862_100022287 Ga0068862_1000222873 390
802 3300006042 Ga0075368_10019630 Ga0075368_100196302 390
803 3300006042 Ga0075368_10053543 Ga0075368_100535431 390
804 3300006048 Ga0075363_100010719 Ga0075363_1000107192 390
805 3300006048 Ga0075363_100037680 Ga0075363_1000376804 390
806 3300006048 Ga0075363_100067436 Ga0075363_1000674362 390
807 3300006051 Ga0075364_10014953 Ga0075364_100149536 390
808 3300006051 Ga0075364_10045003 Ga0075364_100450033 390
809 3300006177 Ga0075362_10017189 Ga0075362_100171891 390
810 3300006178 Ga0075367_10004232 Ga0075367_100042326 390
811 3300006178 Ga0075367_10059536 Ga0075367_100595364 390
812 3300006186 Ga0075369_10025008 Ga0075369_100250082 390
813 3300006195 Ga0075366_10001613 Ga0075366_100016136 390
814 3300006195 Ga0075366_10022200 Ga0075366_100222003 390
815 3300006195 Ga0075366_10022341 Ga0075366_100223412 390
816 3300006195 Ga0075366_10023366 Ga0075366_100233663 390
817 3300006195 Ga0075366_10033534 Ga0075366_100335342 390
818 3300006195 Ga0075366_10039026 Ga0075366_100390264 390
819 3300006195 Ga0075366_10053078 Ga0075366_100530782 390
820 3300006195 Ga0075366_10058191 Ga0075366_100581912 390
821 3300006195 Ga0075366_10089780 Ga0075366_100897802 390
822 3300006195 Ga0075366_10101873 Ga0075366_101018731 390
823 3300006237 Ga0097621_100073888 Ga0097621_1000738882 390
824 3300006237 Ga0097621_100091912 Ga0097621_1000919124 390
825 3300006237 Ga0097621_100179383 Ga0097621_1001793831 390
826 3300006353 Ga0075370_10002946 Ga0075370_100029462 390
827 3300006353 Ga0075370_10005250 Ga0075370_100052502 390
828 3300006353 Ga0075370_10006000 Ga0075370_100060002 390
829 3300006353 Ga0075370_10011147 Ga0075370_100111472 390
830 3300006353 Ga0075370_10036327 Ga0075370_100363271 390
831 3300006353 Ga0075370_10114709 Ga0075370_101147091 390
832 3300006358 Ga0068871_100022463 Ga0068871_1000224635 390
833 3300006358 Ga0068871_100078882 Ga0068871_1000788824 390
834 3300006358 Ga0068871_100138221 Ga0068871_1001382212 390
835 3300006358 Ga0068871_100180783 Ga0068871_1001807832 390
836 3300006881 Ga0068865_100017504 Ga0068865_1000175045 390
837 3300006881 Ga0068865_100020853 Ga0068865_1000208532 390
838 3300006931 Ga0097620_100092964 Ga0097620_1000929643 390
839 3300006946 Ga0079104_1000309 Ga0079104_100030950 390
840 3300009093 Ga0105240_10034284 Ga0105240_100342844 390
841 3300009098 Ga0105245_10026446 Ga0105245_100264463 390
842 3300009147 Ga0114129_10162038 Ga0114129_101620382 390
843 3300009148 Ga0105243_10009596 Ga0105243_100095962 390
844 3300009148 Ga0105243_10067283 Ga0105243_100672832 390
845 3300009148 Ga0105243_10100833 Ga0105243_101008331 390
846 3300009148 Ga0105243_10119114 Ga0105243_101191142 390
847 3300009177 Ga0105248_10022249 Ga0105248_100222496 390
848 3300009177 Ga0105248_10031969 Ga0105248_100319692 390
849 3300009545 Ga0105237_10168614 Ga0105237_101686142 390
850 3300009545 Ga0105237_10179425 Ga0105237_101794252 390
851 3300009545 Ga0105237_10295006 Ga0105237_102950062 390
852 3300009551 Ga0105238_10026760 Ga0105238_100267604 390
853 3300009551 Ga0105238_10055566 Ga0105238_100555663 390
854 3300009551 Ga0105238_10139751 Ga0105238_101397512 390
855 3300009553 Ga0105249_10007528 Ga0105249_100075282 390
856 3300009553 Ga0105249_10177425 Ga0105249_101774252 390
857 3300010375 Ga0105239_10027775 Ga0105239_100277754 390
858 3300010375 Ga0105239_10052753 Ga0105239_100527534 390
859 3300012497 Ga0157319_1000043 Ga0157319_10000435 390
860 3300013102 Ga0157371_10124955 Ga0157371_101249552 390
861 3300013104 Ga0157370_10185047 Ga0157370_101850471 390
862 3300013296 Ga0157374_10058382 Ga0157374_100583823 390
863 3300013296 Ga0157374_10093522 Ga0157374_100935222 390
864 3300013296 Ga0157374_10108482 Ga0157374_101084823 390
865 3300013296 Ga0157374_10118782 Ga0157374_101187822 390
866 3300013297 Ga0157378_10006194 Ga0157378_100061945 390
867 3300013297 Ga0157378_10081014 Ga0157378_100810142 390
868 3300013297 Ga0157378_10139820 Ga0157378_101398202 390
869 3300013306 Ga0163162_10029946 Ga0163162_100299465 390
870 3300013306 Ga0163162_10040965 Ga0163162_100409655 390
871 3300013307 Ga0157372_10209179 Ga0157372_102091793 390
872 3300013308 Ga0157375_10008692 Ga0157375_1000869210 390
873 3300013308 Ga0157375_10014347 Ga0157375_100143475 390
874 3300013308 Ga0157375_10032391 Ga0157375_100323915 390
875 3300013308 Ga0157375_10296945 Ga0157375_102969452 390
876 3300014326 Ga0157380_10012147 Ga0157380_100121476 390
877 3300014326 Ga0157380_10028626 Ga0157380_100286262 390
878 3300014745 Ga0157377_10000038 Ga0157377_1000003890 390
879 3300014745 Ga0157377_10006032 Ga0157377_100060324 390
880 3300014968 Ga0157379_10007916 Ga0157379_100079166 390
881 3300014968 Ga0157379_10010131 Ga0157379_100101316 390
882 3300014969 Ga0157376_10004863 Ga0157376_1000486310 390
883 3300014969 Ga0157376_10014331 Ga0157376_100143315 390
884 3300014969 Ga0157376_10122695 Ga0157376_101226952 390
885 3300017792 Ga0163161_10034546 Ga0163161_100345464 390
886 3300021361 Ga0213872_10012213 Ga0213872_100122133 390
887 3300025226 Ga0209674_100003 Ga0209674_100003292 390
888 3300025230 Ga0209563_100010 Ga0209563_10001021 390
889 3300025231 Ga0207427_100361 Ga0207427_1003614 390
890 3300025242 Ga0209258_100044 Ga0209258_10004437 390
891 3300025242 Ga0209258_100525 Ga0209258_10052529 390
892 3300025246 Ga0209646_1000067 Ga0209646_10000672 390
893 3300025250 Ga0209026_1000033 Ga0209026_1000033229 390
894 3300025253 Ga0209677_100068 Ga0209677_100068101 390
895 3300025253 Ga0209677_100760 Ga0209677_1007605 390
896 3300025256 Ga0209759_1000024 Ga0209759_1000024229 390
897 3300025256 Ga0209759_1000970 Ga0209759_100097011 390
898 3300025256 Ga0209759_1007504 Ga0209759_10075042 390
899 3300025272 Ga0209455_1000048 Ga0209455_100004837 390
900 3300025273 Ga0209673_1004714 Ga0209673_10047144 390
901 3300025291 Ga0209675_1007213 Ga0209675_10072135 390
902 3300025295 Ga0209564_1000003 Ga0209564_10000031218 390
903 3300025298 Ga0209050_1000145 Ga0209050_1000145138 390
904 3300025298 Ga0209050_1001124 Ga0209050_100112433 390
905 3300025298 Ga0209050_1011786 Ga0209050_10117862 390
906 3300025299 Ga0209256_1000061 Ga0209256_1000061121 390
907 3300025299 Ga0209256_1001268 Ga0209256_100126812 390
908 3300025299 Ga0209256_1007013 Ga0209256_10070134 390
909 3300025303 Ga0209051_1000018 Ga0209051_1000018323 390
910 3300025303 Ga0209051_1024867 Ga0209051_10248671 390
911 3300025304 Ga0209257_1000084 Ga0209257_100008449 390
912 3300025304 Ga0209257_1003994 Ga0209257_10039944 390
913 3300025304 Ga0209257_1004271 Ga0209257_10042715 390
914 3300025315 Ga0207697_10013305 Ga0207697_100133054 390
915 3300025315 Ga0207697_10061246 Ga0207697_100612462 390
916 3300025893 Ga0207682_10003157 Ga0207682_100031575 390
917 3300025893 Ga0207682_10006644 Ga0207682_100066443 390
918 3300025893 Ga0207682_10039210 Ga0207682_100392102 390
919 3300025899 Ga0207642_10011507 Ga0207642_100115074 390
920 3300025899 Ga0207642_10060567 Ga0207642_100605672 390
921 3300025901 Ga0207688_10024697 Ga0207688_100246974 390
922 3300025901 Ga0207688_10041033 Ga0207688_100410332 390
923 3300025903 Ga0207680_10004287 Ga0207680_100042877 390
924 3300025903 Ga0207680_10128342 Ga0207680_101283422 390
925 3300025907 Ga0207645_10042100 Ga0207645_100421003 390
926 3300025907 Ga0207645_10068933 Ga0207645_100689332 390
927 3300025912 Ga0207707_10068594 Ga0207707_100685944 390
928 3300025913 Ga0207695_10010175 Ga0207695_100101758 390
929 3300025914 Ga0207671_10033303 Ga0207671_100333033 390
930 3300025917 Ga0207660_10014917 Ga0207660_100149175 390
931 3300025918 Ga0207662_10002597 Ga0207662_100025975 390
932 3300025919 Ga0207657_10088149 Ga0207657_100881492 390
933 3300025920 Ga0207649_10093288 Ga0207649_100932882 390
934 3300025920 Ga0207649_10112984 Ga0207649_101129842 390
935 3300025923 Ga0207681_10008770 Ga0207681_100087706 390
936 3300025925 Ga0207650_10001837 Ga0207650_100018378 390
937 3300025925 Ga0207650_10006719 Ga0207650_100067198 390
938 3300025925 Ga0207650_10021604 Ga0207650_100216043 390
939 3300025925 Ga0207650_10130941 Ga0207650_101309413 390
940 3300025925 Ga0207650_10186671 Ga0207650_101866711 390
941 3300025926 Ga0207659_10001154 Ga0207659_1000115410 390
942 3300025926 Ga0207659_10001657 Ga0207659_100016576 390
943 3300025927 Ga0207687_10166300 Ga0207687_101663001 390
944 3300025931 Ga0207644_10003202 Ga0207644_100032024 390
945 3300025931 Ga0207644_10032324 Ga0207644_100323241 390
946 3300025931 Ga0207644_10047145 Ga0207644_100471454 390
947 3300025931 Ga0207644_10065110 Ga0207644_100651103 390
948 3300025931 Ga0207644_10129635 Ga0207644_101296352 390
949 3300025932 Ga0207690_10077284 Ga0207690_100772841 390
950 3300025933 Ga0207706_10000499 Ga0207706_100004999 390
951 3300025935 Ga0207709_10002721 Ga0207709_100027215 390
952 3300025935 Ga0207709_10005799 Ga0207709_100057992 390
953 3300025935 Ga0207709_10067926 Ga0207709_100679262 390
954 3300025937 Ga0207669_10003780 Ga0207669_100037806 390
955 3300025938 Ga0207704_10063492 Ga0207704_100634922 390
956 3300025940 Ga0207691_10000511 Ga0207691_1000051131 390
957 3300025940 Ga0207691_10024751 Ga0207691_100247516 390
958 3300025940 Ga0207691_10034076 Ga0207691_100340765 390
959 3300025940 Ga0207691_10035416 Ga0207691_100354162 390
960 3300025940 Ga0207691_10129050 Ga0207691_101290502 390
961 3300025940 Ga0207691_10142036 Ga0207691_101420362 390
962 3300025941 Ga0207711_10011343 Ga0207711_100113436 390
963 3300025941 Ga0207711_10020600 Ga0207711_100206005 390
964 3300025941 Ga0207711_10179547 Ga0207711_101795472 390
965 3300025941 Ga0207711_10212709 Ga0207711_102127091 390
966 3300025942 Ga0207689_10003209 Ga0207689_100032098 390
967 3300025942 Ga0207689_10120235 Ga0207689_101202352 390
968 3300025944 Ga0207661_10052592 Ga0207661_100525924 390
969 3300025945 Ga0207679_10090162 Ga0207679_100901623 390
970 3300025945 Ga0207679_10222625 Ga0207679_102226252 390
971 3300025949 Ga0207667_10084418 Ga0207667_100844183 390
972 3300025949 Ga0207667_10114793 Ga0207667_101147932 390
973 3300025960 Ga0207651_10016902 Ga0207651_100169021 390
974 3300025960 Ga0207651_10018036 Ga0207651_100180363 390
975 3300025960 Ga0207651_10087447 Ga0207651_100874472 390
976 3300025961 Ga0207712_10009755 Ga0207712_100097556 390
977 3300025961 Ga0207712_10198231 Ga0207712_101982311 390
978 3300025981 Ga0207640_10042398 Ga0207640_100423982 390
979 3300025986 Ga0207658_10001749 Ga0207658_100017495 390
980 3300025986 Ga0207658_10013291 Ga0207658_100132912 390
981 3300025986 Ga0207658_10033908 Ga0207658_100339082 390
982 3300025986 Ga0207658_10074735 Ga0207658_100747352 390
983 3300025986 Ga0207658_10237765 Ga0207658_102377651 390
984 3300026023 Ga0207677_10001579 Ga0207677_1000157910 390
985 3300026023 Ga0207677_10067151 Ga0207677_100671514 390
986 3300026023 Ga0207677_10090461 Ga0207677_100904612 390
987 3300026023 Ga0207677_10094849 Ga0207677_100948494 390
988 3300026035 Ga0207703_10005816 Ga0207703_100058165 390
989 3300026035 Ga0207703_10007010 Ga0207703_100070105 390
990 3300026035 Ga0207703_10063397 Ga0207703_100633972 390
991 3300026067 Ga0207678_10001741 Ga0207678_1000174121 390
992 3300026067 Ga0207678_10042038 Ga0207678_100420382 390
993 3300026067 Ga0207678_10097384 Ga0207678_100973842 390
994 3300026075 Ga0207708_10019691 Ga0207708_100196914 390
995 3300026075 Ga0207708_10022978 Ga0207708_100229784 390
996 3300026078 Ga0207702_10001261 Ga0207702_1000126115 390
997 3300026078 Ga0207702_10005418 Ga0207702_100054184 390
998 3300026088 Ga0207641_10005241 Ga0207641_1000524110 390
999 3300026088 Ga0207641_10229931 Ga0207641_102299312 390
1000 3300026089 Ga0207648_10000053 Ga0207648_1000005391 390
1001 3300026089 Ga0207648_10003753 Ga0207648_100037534 390
1002 3300026089 Ga0207648_10012937 Ga0207648_100129376 390
1003 3300026089 Ga0207648_10071700 Ga0207648_100717002 390
1004 3300026095 Ga0207676_10007553 Ga0207676_100075534 390
1005 3300026095 Ga0207676_10016812 Ga0207676_100168124 390
1006 3300026095 Ga0207676_10107975 Ga0207676_101079752 390
1007 3300026095 Ga0207676_10305798 Ga0207676_103057981 390
1008 3300026116 Ga0207674_10052728 Ga0207674_100527284 390
1009 3300026118 Ga0207675_100002925 Ga0207675_10000292516 390
1010 3300026118 Ga0207675_100004928 Ga0207675_10000492810 390
1011 3300026118 Ga0207675_100026001 Ga0207675_1000260012 390
1012 3300026118 Ga0207675_100038504 Ga0207675_1000385044 390
1013 3300026118 Ga0207675_100084556 Ga0207675_1000845563 390
1014 3300026118 Ga0207675_100133907 Ga0207675_1001339072 390
1015 3300026121 Ga0207683_10008024 Ga0207683_100080246 390
1016 3300026121 Ga0207683_10080738 Ga0207683_100807381 390
1017 3300026121 Ga0207683_10160742 Ga0207683_101607422 390
1018 3300026121 Ga0207683_10270416 Ga0207683_102704162 390
1019 3300026142 Ga0207698_10038535 Ga0207698_100385352 390
1020 3300026142 Ga0207698_10057783 Ga0207698_100577832 390
1021 3300027111 Ga0209281_1000103 Ga0209281_1000103179 390
1022 3300027876 Ga0209974_10001308 Ga0209974_100013089 390
1023 3300028379 Ga0268266_10343695 Ga0268266_103436951 390
1024 3300028380 Ga0268265_10007752 Ga0268265_100077526 390
1025 3300028380 Ga0268265_10103334 Ga0268265_101033342 390
1026 3300028381 Ga0268264_10005622 Ga0268264_100056229 390
1027 3300028381 Ga0268264_10011457 Ga0268264_100114572 390
1028 3300028381 Ga0268264_10063241 Ga0268264_100632414 390
1029 3300028381 Ga0268264_10315708 Ga0268264_103157082 390
1030 3300028666 Ga0265336_10000053 Ga0265336_10000053106 390
1031 3300028786 Ga0307517_10001511 Ga0307517_1000151119 390
1032 3300028786 Ga0307517_10126743 Ga0307517_101267431 390
1033 3300028794 Ga0307515_10000188 Ga0307515_1000018847 390
1034 3300028794 Ga0307515_10000708 Ga0307515_1000070822 390
1035 3300028794 Ga0307515_10002191 Ga0307515_1000219132 390
1036 3300028794 Ga0307515_10002971 Ga0307515_100029715 390
1037 3300028794 Ga0307515_10013083 Ga0307515_100130836 390
1038 3300028794 Ga0307515_10048737 Ga0307515_100487376 390
1039 3300028794 Ga0307515_10071988 Ga0307515_100719881 390
1040 3300028794 Ga0307515_10086241 Ga0307515_100862412 390
1041 3300028794 Ga0307515_10121393 Ga0307515_101213933 390
1042 3300028794 Ga0307515_10131234 Ga0307515_101312344 390
1043 3300029957 Ga0265324_10000132 Ga0265324_1000013255 390
1044 3300030522 Ga0307512_10106359 Ga0307512_101063591 390
1045 3300031456 Ga0307513_10037752 Ga0307513_100377522 390
1046 3300031456 Ga0307513_10056487 Ga0307513_100564872 390
1047 3300031456 Ga0307513_10057757 Ga0307513_100577572 390
1048 3300031456 Ga0307513_10157651 Ga0307513_101576514 390
1049 3300031507 Ga0307509_10003552 Ga0307509_1000355221 390
1050 3300031507 Ga0307509_10004884 Ga0307509_100048844 390
1051 3300031507 Ga0307509_10011369 Ga0307509_100113692 390
1052 3300031507 Ga0307509_10030410 Ga0307509_100304104 390
1053 3300031507 Ga0307509_10049375 Ga0307509_100493753 390
1054 3300031616 Ga0307508_10000169 Ga0307508_1000016957 390
1055 3300031616 Ga0307508_10002731 Ga0307508_100027312 390
1056 3300031616 Ga0307508_10214365 Ga0307508_102143652 390
1057 3300031649 Ga0307514_10014677 Ga0307514_100146776 390
1058 3300031730 Ga0307516_10000311 Ga0307516_1000031113 390
1059 3300031730 Ga0307516_10000678 Ga0307516_1000067843 390
1060 3300031730 Ga0307516_10004343 Ga0307516_1000434310 390
1061 3300031730 Ga0307516_10008972 Ga0307516_100089722 390
1062 3300031730 Ga0307516_10009522 Ga0307516_100095222 390
1063 3300031730 Ga0307516_10045613 Ga0307516_100456134 390
1064 3300031730 Ga0307516_10081745 Ga0307516_100817452 390
1065 3300031731 Ga0307405_10021785 Ga0307405_100217854 390
1066 3300031824 Ga0307413_10013379 Ga0307413_100133793 390
1067 3300031824 Ga0307413_10088722 Ga0307413_100887223 390
1068 3300031852 Ga0307410_10032495 Ga0307410_100324953 390
1069 3300031901 Ga0307406_10010926 Ga0307406_100109261 390
1070 3300031911 Ga0307412_10006540 Ga0307412_100065406 390
1071 3300031911 Ga0307412_10181360 Ga0307412_101813602 390
1072 3300031995 Ga0307409_100000189 Ga0307409_1000001896 390
1073 3300031995 Ga0307409_100006670 Ga0307409_1000066704 390
1074 3300032002 Ga0307416_100001876 Ga0307416_1000018767 390
1075 3300032005 Ga0307411_10131372 Ga0307411_101313722 390
1076 3300032126 Ga0307415_100019230 Ga0307415_1000192304 390
1077 3300032126 Ga0307415_100027523 Ga0307415_1000275234 390
1078 3300033179 Ga0307507_10018253 Ga0307507_100182536 390
1079 3300033179 Ga0307507_10021035 Ga0307507_100210354 390
1080 3300033180 Ga0307510_10068525 Ga0307510_100685254 390
1081 3300035111 Ga0373923_0077768 Ga0373923_0077768_129_1355 390
1082 3300035691 Ga0373931_0002251 Ga0373931_0002251_5255_6478 390
1083 3300035691 Ga0373931_0014186 Ga0373931_0014186_11_1216 390
1084 3300035691 Ga0373931_0016238 Ga0373931_0016238_1423_2643 390
1085 3300036401 Ga0373937_0100521 Ga0373937_0100521_914_2134 390
1086 3300037068 Ga0373925_0034529 Ga0373925_0034529_2207_3439 390
1087 3300037068 Ga0373925_0128586 Ga0373925_0128586_234_1457 390
1088 3300037466 Ga0395898_0001532 Ga0395898_0001532_6366_7574 390
1089 3300037471 Ga0395905_0017710 Ga0395905_0017710_5384_6607 390
1090 3300037471 Ga0395905_0034757 Ga0395905_0034757_1020_2243 390
1091 3300037471 Ga0395905_0042849 Ga0395905_0042849_2452_3675 390
1092 3300037471 Ga0395905_0113532 Ga0395905_0113532_1243_2466 390
1093 3300037471 Ga0395905_0187142 Ga0395905_0187142_410_1636 390
1094 3300039437 Ga0436365_0350119 Ga0436365_0350119_823_2043 390
1095 3300039437 Ga0436365_0760616 Ga0436365_0760616_136_1359 390
1096 3300039447 Ga0436361_0338967 Ga0436361_0338967_3315_4538 390
1097 3300039447 Ga0436361_0709657 Ga0436361_0709657_409_1632 390
1098 3300041452 Ga0451793_1605648 Ga0451793_1605648_107_1333 390
1099 3300041452 Ga0451793_1651023 Ga0451793_1651023_151_1374 390
1100 3300041456 Ga0451795_0983196 Ga0451795_0983196_136_1359 390
1101 3300041458 Ga0451798_0142848 Ga0451798_0142848_813_2039 390
1102 3300041459 Ga0451800_0241174 Ga0451800_0241174_354_1580 390
1103 3300041460 Ga0451802_0447858 Ga0451802_0447858_403_1626 390
1104 3300041498 Ga0451841_0619619 Ga0451841_0619619_672_1895 390
1105 3300041512 Ga0451853_0383239 Ga0451853_0383239_1244_2467 390
1106 3300041512 Ga0451853_1507922 Ga0451853_1507922_1335_2561 390
1107 3300041512 Ga0451853_2429987 Ga0451853_2429987_176_1396 390
1108 3300042435 Ga0439434_0051958 Ga0439434_0051958_17_1240 390
1109 3300042531 Ga0450918_003930 Ga0450918_003930_1487_2710 390
1110 3300042876 Ga0451577_0000152 Ga0451577_0000152_121727_122935 390
1111 3300042876 Ga0451577_0004023 Ga0451577_0004023_14235_15461 390
1112 3300042876 Ga0451577_0030135 Ga0451577_0030135_2711_3937 390
1113 3300044656 Ga0466969_0005210 Ga0466969_0005210_1680_2906 390
1114 3300044656 Ga0466969_0012595 Ga0466969_0012595_3011_4234 390
1115 3300044656 Ga0466969_0076686 Ga0466969_0076686_93_1316 390
1116 3300044683 Ga0466965_0018908 Ga0466965_0018908_1982_3208 390
1117 3300044684 Ga0466966_0000687 Ga0466966_0000687_5178_6401 390
1118 3300044684 Ga0466966_0002631 Ga0466966_0002631_8240_9463 390
1119 3300044684 Ga0466966_0080940 Ga0466966_0080940_739_1962 390
1120 3300044693 Ga0466961_0007342 Ga0466961_0007342_1094_2317 390
1121 3300044694 Ga0466963_0014486 Ga0466963_0014486_3282_4505 390
1122 3300044706 Ga0466964_0002848 Ga0466964_0002848_4258_5484 390
1123 3300044712 Ga0453684_0000122 Ga0453684_0000122_179508_180716 390
1124 3300044712 Ga0453684_0197635 Ga0453684_0197635_447_1673 390
1125 3300044719 Ga0466971_0005142 Ga0466971_0005142_1791_3017 390
1126 3300044765 Ga0466970_0005981 Ga0466970_0005981_1451_2674 390
1127 3300044842 Ga0466957_0020799 Ga0466957_0020799_378_1601 390
1128 3300045049 Ga0466959_0000287 Ga0466959_0000287_10959_12182 390
1129 3300045049 Ga0466959_0057239 Ga0466959_0057239_774_1982 390
1130 3300045051 Ga0451576_0051233 Ga0451576_0051233_333_1553 390
1131 3300045051 Ga0451576_0297220 Ga0451576_0297220_254_1462 390
1132 3300045836 Ga0466958_0011505 Ga0466958_0011505_2880_4106 390
1133 3300045836 Ga0466958_0063425 Ga0466958_0063425_183_1406 390
1134 3300046454 Ga0495592_0000250 Ga0495592_0000250_43900_45123 390
1135 3300046475 Ga0495639_0037468 Ga0495639_0037468_492_1718 390
1136 3300046507 Ga0495606_0002998 Ga0495606_0002998_14848_16074 390
1137 3300046515 Ga0495620_0042573 Ga0495620_0042573_627_1850 390
1138 3300046516 Ga0495628_0165170 Ga0495628_0165170_379_1599 390
1139 3300046519 Ga0495632_0005520 Ga0495632_0005520_4359_5582 390
1140 3300046542 Ga0495597_0059772 Ga0495597_0059772_212_1495 390
1141 3300046660 Ga0495625_0004137 Ga0495625_0004137_10020_11243 390
1142 3300046660 Ga0495625_0004296 Ga0495625_0004296_98_1321 390
1143 3300046683 Ga0495658_0041870 Ga0495658_0041870_207_1427 390
1144 3300046694 Ga0495649_0001463 Ga0495649_0001463_8625_9851 390
1145 3300046694 Ga0495649_0004909 Ga0495649_0004909_6643_7866 390
1146 3300047443 Ga0495687_000700 Ga0495687_000700_31868_33151 390
1147 3300047443 Ga0495687_012571 Ga0495687_012571_1674_2897 390
1148 3300047472 Ga0495686_0003614 Ga0495686_0003614_4421_5629 390
1149 3300048091 Ga0495626_0022313 Ga0495626_0022313_836_2059 390
1150 3300048904 Ga0496101_0212307 Ga0496101_0212307_109_1332 390
1151 3300048905 Ga0496102_0008930 Ga0496102_0008930_3418_4632 390
1152 3300048905 Ga0496102_0015155 Ga0496102_0015155_3720_4943 390
1153 3300048905 Ga0496102_0047897 Ga0496102_0047897_293_1513 390
1154 3300048908 Ga0496105_0030017 Ga0496105_0030017_3004_4227 390
1155 3300048908 Ga0496105_0134301 Ga0496105_0134301_724_1944 390
1156 3300048909 Ga0496106_0005942 Ga0496106_0005942_6067_7287 390
1157 3300048911 Ga0496108_0105917 Ga0496108_0105917_27_1250 390
1158 3300048912 Ga0496109_0063912 Ga0496109_0063912_2033_3253 390
1159 3300048912 Ga0496109_0118393 Ga0496109_0118393_1200_2423 390
1160 3300048912 Ga0496109_0168704 Ga0496109_0168704_630_1850 390
1161 3300048913 Ga0496110_0125528 Ga0496110_0125528_470_1690 390
1162 3300048915 Ga0496112_0029309 Ga0496112_0029309_2729_3952 390
1163 3300048916 Ga0496113_0221609 Ga0496113_0221609_32_1255 390
1164 3300048917 Ga0496114_0038012 Ga0496114_0038012_1012_2235 390
1165 3300048927 Ga0496124_0000086 Ga0496124_0000086_155938_157161 390
1166 3300048927 Ga0496124_0032613 Ga0496124_0032613_1697_2920 390
1167 3300049579 Ga0501043_0000002 Ga0501043_0000002_104821_106044 390
1168 3300049580 Ga0501046_0000008 Ga0501046_0000008_104904_106127 390
1169 3300049581 Ga0501047_0000003 Ga0501047_0000003_128086_129309 390
1170 3300049582 Ga0501048_0009085 Ga0501048_0009085_5788_7011 390
1171 3300049824 Ga0501045_0001048 Ga0501045_0001048_15628_16851 390
1172 3300050490 nmdc:mga03n38_11656_c1 nmdc:mga03n38_11656_c1_247_1470 390
1173 3300050491 nmdc:mga00v17_14156_c1 nmdc:mga00v17_14156_c1_3208_4434 390
1174 3300050493 nmdc:mga0k408_10272_c1 nmdc:mga0k408_10272_c1_1578_2801 390
1175 3300050493 nmdc:mga0k408_122783_c1 nmdc:mga0k408_122783_c1_209_1438 390
1176 3300050493 nmdc:mga0k408_134_c1 nmdc:mga0k408_134_c1_17495_18718 390
1177 3300050493 nmdc:mga0k408_14316_c1 nmdc:mga0k408_14316_c1_1596_2819 390
1178 3300050493 nmdc:mga0k408_20201_c1 nmdc:mga0k408_20201_c1_54_1277 390
1179 3300050493 nmdc:mga0k408_2894_c1 nmdc:mga0k408_2894_c1_751_1974 390
1180 3300050493 nmdc:mga0k408_52536_c1 nmdc:mga0k408_52536_c1_434_1657 390
1181 3300050493 nmdc:mga0k408_533_c1 nmdc:mga0k408_533_c1_941_2164 390
1182 3300050493 nmdc:mga0k408_62846_c1 nmdc:mga0k408_62846_c1_807_2030 390
1183 3300050493 nmdc:mga0k408_951_c2 nmdc:mga0k408_951_c2_840_2063 390
1184 3300050496 nmdc:mga07m45_11093_c1 nmdc:mga07m45_11093_c1_2736_3959 390
1185 3300050496 nmdc:mga07m45_142405_c1 nmdc:mga07m45_142405_c1_32_1255 390
1186 3300050496 nmdc:mga07m45_18036_c1 nmdc:mga07m45_18036_c1_2326_3549 390
1187 3300050496 nmdc:mga07m45_4460_c1 nmdc:mga07m45_4460_c1_1465_2688 390
1188 3300050496 nmdc:mga07m45_5487_c1 nmdc:mga07m45_5487_c1_689_1915 390
1189 3300050496 nmdc:mga07m45_75_c1 nmdc:mga07m45_75_c1_1776_2999 390
1190 3300050496 nmdc:mga07m45_969_c1 nmdc:mga07m45_969_c1_6568_7794 390
1191 3300050511 nmdc:mga08y16_312129_c1 nmdc:mga08y16_312129_c1_172_1392 390
1192 3300050512 nmdc:mga0n895_165330_c1 nmdc:mga0n895_165330_c1_146_1366 390
1193 3300050516 nmdc:mga0sz30_12949_c1 nmdc:mga0sz30_12949_c1_52_1275 390
1194 3300050516 nmdc:mga0sz30_13505_c1 nmdc:mga0sz30_13505_c1_1385_2611 390
1195 3300053080 Ga0500635_0000083 Ga0500635_0000083_41675_42901 390
1196 3300053086 Ga0500578_0000058 Ga0500578_0000058_99762_100976 390
1197 3300053118 Ga0500594_0000346 Ga0500594_0000346_224_1447 390
1198 3300053129 Ga0500628_000906 Ga0500628_000906_280_1506 390
1199 3300053130 Ga0500642_0000990 Ga0500642_0000990_4682_5908 390
1200 3300053131 Ga0500652_000300 Ga0500652_000300_4024_5250 390
1201 3300053134 Ga0500658_0005042 Ga0500658_0005042_2388_3611 390
1202 3300053134 Ga0500658_0021081 Ga0500658_0021081_678_1901 390
1203 3300053136 Ga0500559_0000076 Ga0500559_0000076_10118_11341 390
1204 3300053139 Ga0500568_0010776 Ga0500568_0010776_186_1436 390
1205 3300053139 Ga0500568_0028309 Ga0500568_0028309_982_2208 390
1206 3300053142 Ga0500577_0013682 Ga0500577_0013682_1088_2314 390
1207 3300053154 Ga0500619_000040 Ga0500619_000040_3820_5043 390
1208 3300053156 Ga0500622_0000094 Ga0500622_0000094_51830_53056 390
1209 3300053156 Ga0500622_0001530 Ga0500622_0001530_10768_11991 390
1210 3300053156 Ga0500622_0001780 Ga0500622_0001780_7491_8714 390
1211 3300053156 Ga0500622_0054734 Ga0500622_0054734_547_1764 390
1212 3300053724 Ga0500570_034372 Ga0500570_034372_994_2220 390
1213 3300053730 Ga0500645_007534 Ga0500645_007534_2309_3532 390
1214 3300053739 Ga0500587_000079 Ga0500587_000079_3212_4435 390
1215 3300053739 Ga0500587_004174 Ga0500587_004174_714_1937 390
1216 3300059421 Ga0590071_010060 Ga0590071_010060_885_2108 390
1217 3300061719 Ga0466962_0002972 Ga0466962_0002972_3752_4978 390
1218 iso_pu_bacteria 2585428057 2587728350 390
1219 iso_pu_bacteria 2585428058 2587735517 390
1220 iso_pu_bacteria 2585428062 2587758608 390
1221 iso_pu_bacteria 2588253510 2588294092 390
1222 iso_pu_bacteria 2643221592 2643970321 390
1223 iso_pu_bacteria 2643221625 2644139623 390
1224 iso_pu_bacteria 2643221644 2644246367 390
1225 iso_pu_bacteria 2643221648 2644272436 390
1226 iso_pu_bacteria 2643221654 2644303908 390
1227 3300001915 JGI24741J21665_1000133 JGI24741J21665_100013312 391
1228 3300001979 JGI24740J21852_10000527 JGI24740J21852_100005276 391
1229 3300001979 JGI24740J21852_10000561 JGI24740J21852_1000056110 391
1230 3300002705 JGI25156J39149_1003461 JGI25156J39149_10034612 391
1231 3300002738 JGI25154J39366_1001471 JGI25154J39366_10014713 391
1232 3300003752 Ga0055539_1000313 Ga0055539_100031318 391
1233 3300003752 Ga0055539_1005393 Ga0055539_10053931 391
1234 3300003758 Ga0055532_1000008 Ga0055532_1000008118 391
1235 3300003759 Ga0055525_1000169 Ga0055525_100016938 391
1236 3300003760 Ga0055527_1000617 Ga0055527_10006179 391
1237 3300003761 Ga0055535_1000006 Ga0055535_1000006274 391
1238 3300003762 Ga0055542_1002372 Ga0055542_10023726 391
1239 3300003763 Ga0055529_1000025 Ga0055529_1000025274 391
1240 3300003763 Ga0055529_1000030 Ga0055529_1000030157 391
1241 3300003841 Ga0055541_1000789 Ga0055541_10007896 391
1242 3300005344 Ga0070661_100000002 Ga0070661_100000002138 391
1243 3300005455 Ga0070663_100000007 Ga0070663_100000007109 391
1244 3300005564 Ga0070664_100000001 Ga0070664_100000001280 391
1245 3300005577 Ga0068857_100029445 Ga0068857_1000294455 391
1246 3300005578 Ga0068854_100000009 Ga0068854_100000009183 391
1247 3300005614 Ga0068856_100000007 Ga0068856_100000007183 391
1248 3300009093 Ga0105240_10203342 Ga0105240_102033422 391
1249 3300013100 Ga0157373_10035384 Ga0157373_100353842 391
1250 3300013102 Ga0157371_10001209 Ga0157371_1000120917 391
1251 3300013104 Ga0157370_10001652 Ga0157370_1000165210 391
1252 3300013105 Ga0157369_10077210 Ga0157369_100772102 391
1253 3300013307 Ga0157372_10005299 Ga0157372_100052996 391
1254 3300020069 Ga0197907_11214976 Ga0197907_112149763 391
1255 3300020076 Ga0206355_1356493 Ga0206355_13564933 391
1256 3300020077 Ga0206351_10095075 Ga0206351_1009507512 391
1257 3300020610 Ga0154015_1017848 Ga0154015_101784812 391
1258 3300022467 Ga0224712_10034991 Ga0224712_100349913 391
1259 3300025224 Ga0209784_100014 Ga0209784_100014158 391
1260 3300025224 Ga0209784_100365 Ga0209784_10036515 391
1261 3300025225 Ga0209566_100011 Ga0209566_100011158 391
1262 3300025225 Ga0209566_100955 Ga0209566_1009558 391
1263 3300025226 Ga0209674_100032 Ga0209674_100032327 391
1264 3300025226 Ga0209674_100184 Ga0209674_1001845 391
1265 3300025228 Ga0209672_100094 Ga0209672_10009497 391
1266 3300025228 Ga0209672_100517 Ga0209672_1005179 391
1267 3300025229 Ga0209147_100002 Ga0209147_100002397 391
1268 3300025230 Ga0209563_100029 Ga0209563_100029327 391
1269 3300025230 Ga0209563_102706 Ga0209563_1027063 391
1270 3300025242 Ga0209258_100002 Ga0209258_100002397 391
1271 3300025246 Ga0209646_1000035 Ga0209646_1000035257 391
1272 3300025250 Ga0209026_1007281 Ga0209026_10072811 391
1273 3300025253 Ga0209677_100065 Ga0209677_100065158 391
1274 3300025253 Ga0209677_102322 Ga0209677_1023222 391
1275 3300025254 Ga0209148_1000293 Ga0209148_100029363 391
1276 3300025272 Ga0209455_1000009 Ga0209455_1000009276 391
1277 3300025913 Ga0207695_10001669 Ga0207695_1000166933 391
1278 3300025920 Ga0207649_10000231 Ga0207649_1000023119 391
1279 3300025945 Ga0207679_10000003 Ga0207679_10000003243 391
1280 3300025981 Ga0207640_10000204 Ga0207640_100002042 391
1281 3300026067 Ga0207678_10000002 Ga0207678_10000002111 391
1282 3300026078 Ga0207702_10000080 Ga0207702_1000008031 391
1283 3300026116 Ga0207674_10004793 Ga0207674_1000479316 391
1284 3300037471 Ga0395905_0176135 Ga0395905_0176135_725_1936 391
1285 3300044684 Ga0466966_0001625 Ga0466966_0001625_12061_13338 391
1286 3300044693 Ga0466961_0001458 Ga0466961_0001458_9350_10558 391
1287 3300044706 Ga0466964_0001639 Ga0466964_0001639_3380_4588 391
1288 3300044735 Ga0466968_0006689 Ga0466968_0006689_1600_2808 391
1289 3300044765 Ga0466970_0005511 Ga0466970_0005511_796_2004 391
1290 3300044842 Ga0466957_0087085 Ga0466957_0087085_222_1430 391
1291 3300045976 Ga0466967_0029006 Ga0466967_0029006_2161_3369 391
1292 3300046453 Ga0495627_029101 Ga0495627_029101_459_1670 391
1293 3300046459 Ga0495629_0000047 Ga0495629_0000047_23542_24867 391
1294 3300046472 Ga0495580_0003727 Ga0495580_0003727_4109_5434 391
1295 3300048091 Ga0495626_0000003 Ga0495626_0000003_382093_383304 391
1296 3300059477 Ga0587084_001004 Ga0587084_001004_287_1495 391
1297 3300059508 Ga0587088_001114 Ga0587088_001114_291_1499 391
1298 3300059643 Ga0587072_000066 Ga0587072_000066_4522_5730 391
1299 3300059650 Ga0587104_000185 Ga0587104_000185_285_1493 391
1300 3300061719 Ga0466962_0003937 Ga0466962_0003937_587_1795 391

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

64

300

0.84

PF01610

DDE_Tnp_ISL3

Transposase

316

447

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.744 19 253
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.7301 23 256
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.6009 19 253
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.5565 23 256
5uh7-assembly1.cif.gz_A crystal structure of beta'mtbsi of mycobacterium tuberculosis rna polymerase 0.3679 251 373
ID Description Score Start End Superfamily
af_Q9XVQ6_118_225_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.6928 330 381 1.20.120.20
af_P02651_179_332_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.3636 267 381 1.20.120.20
af_Q9XVQ6_118_225_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.3426 330 381 1.20.120.20
af_Q9UNL4_2_105_6.10.140.1740 Special;Helix non-globular;Helix Hairpins; 0.3414 267 380 6.10.140.1740
af_I1M8I4_25_155_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.3387 269 384 1.20.930.20
ID Description Score Start End GO Terms
AF-A0A519FHA4-F1-model_v4 deleted 0.9965 2 184
AF-A0A4Q3ITD2-F1-model_v4 deleted 0.9947 2 171
AF-A0A5C8BC37-F1-model_v4 deleted 0.9942 11 246
AF-A0A848QJM9-F1-model_v4 deleted 0.9939 1 255
AF-A0A382KZD5-F1-model_v4 Fatty acid desaturase domain-containing protein 0.993 15 247 GO:0006631
GO:0016020
GO:0016717

Feature Viewer

pLDDT pTM Quality
88.46 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map