F492630

General Info

Members Datasets Scaffolds Average Seq Length
1290 551 1289 163

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0101077|Ga0496121_0101077_386_991
Length 201
Sequence LLDRCLSVSCAGDACLLVLPQDRSKLAKAKNRPQALEFIMQGDPKVIEYLNKGLRHELTAINQYWLHYRLLANWGLSDMAKVWRKESIEEMQHADRITDRIIFLEGFPNMQTLDPLRIGQNVKEVIDCDLAAEMSARALYQEAATHCHSVKDYVTRDLFENLMMDEEHHIDFLETQLDLVNRIGLELYTQKHVGGLETEEH

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
102 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
103 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
147 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
148 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
149 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
232 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
239 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
240 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
241 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
242 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
243 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
244 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
245 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
249 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
252 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
255 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
256 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
257 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
264 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
265 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
266 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
270 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
272 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
283 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
284 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
300 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
308 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
309 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
310 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
311 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
312 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
313 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
314 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
315 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
316 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
317 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
318 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
319 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
320 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
321 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
322 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
323 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
324 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
325 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
326 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
327 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
328 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
329 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
330 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
335 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
341 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
342 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
343 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
344 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
349 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
353 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
354 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
355 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
356 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
357 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
358 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
359 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
363 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
364 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
367 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
368 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
369 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
370 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
371 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
372 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
373 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
374 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
375 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
376 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
377 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
378 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
379 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
380 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
389 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
390 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
391 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
392 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
393 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
394 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
395 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
398 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
405 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
406 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
407 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
408 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
409 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
410 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
411 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
412 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
413 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
414 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
415 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
416 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
417 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
418 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
419 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
420 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
421 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
422 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
423 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
424 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
425 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
426 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
427 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
428 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
429 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
430 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
431 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
432 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
435 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
436 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
437 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
438 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
439 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
440 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
441 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
442 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
456 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
457 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
458 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
459 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
460 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
461 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
464 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
465 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
476 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
477 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
478 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
479 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
480 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
481 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
482 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
483 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
484 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
485 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
486 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
487 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
488 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
489 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
490 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
491 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
492 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
493 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
494 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
495 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
496 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
497 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
498 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
499 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
500 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
501 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
502 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
503 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
504 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
505 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
506 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
507 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
508 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
509 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
510 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
511 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
512 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
513 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
514 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
515 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
516 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
517 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
518 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
519 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
520 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
521 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
522 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
523 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
524 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
525 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
526 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
527 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
528 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
529 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
530 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
531 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
532 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
535 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
536 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
537 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
538 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
539 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
550 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
551 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 1.78
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.27
Nodule 1.55
Rhizoplane 5.66
Rhizosphere 70.7
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10067365 3300001989 Bacteria 1119
2 JGI24735J21928_10137208 3300002067 Bacteria 705
3 JGI24735J21928_10167818 3300002067 Bacteria 634
4 JGI24750J21931_1033713 3300002070 Bacteria 759
5 JGI24750J21931_1058225 3300002070 Bacteria 614
6 JGI24744J21845_10093490 3300002077 Bacteria 553
7 JGI24742J22300_10048405 3300002244 Bacteria 767
8 JGI25153J46596_10003464 3300003215 Bacteria 8834
9 JGI25160J50197_1010655 3300003354 Bacteria 3309
10 JGI25160J50197_1044824 3300003354 Bacteria 984
11 JGI25404J52841_10012459 3300003659 Bacteria 1841
12 JGI25404J52841_10017379 3300003659 Bacteria 1559
13 Ga0055539_1008167 3300003752 Bacteria 1314
14 Ga0055529_1019281 3300003763 Bacteria 853
15 Ga0055526_1035146 3300003771 Bacteria 1356
16 Ga0055526_1071174 3300003771 Bacteria 704
17 Ga0055531_10002385 3300003794 Bacteria 12625
18 Ga0058861_11722842 3300004800 Bacteria 631
19 Ga0065165_1000866 3300005262 Bacteria 39512
20 Ga0065165_1027432 3300005262 Bacteria 1857
21 Ga0065165_1028002 3300005262 Bacteria 1827
22 Ga0065715_10347024 3300005293 Bacteria 957
23 Ga0070658_10871776 3300005327 Bacteria 782
24 Ga0070683_100020536 3300005329 Bacteria 5877
25 Ga0070683_100037099 3300005329 Bacteria 4461
26 Ga0070690_100163112 3300005330 Bacteria 1529
27 Ga0070690_100304757 3300005330 Bacteria 1143
28 Ga0070690_100586341 3300005330 Bacteria 845
29 Ga0068869_100227656 3300005334 Bacteria 1480
30 Ga0068869_100476503 3300005334 Bacteria 1038
31 Ga0070666_10055910 3300005335 Bacteria 2664
32 Ga0070666_10066299 3300005335 Bacteria 2450
33 Ga0070680_100009562 3300005336 Bacteria 7447
34 Ga0070680_100149075 3300005336 Bacteria 1964
35 Ga0070680_100271572 3300005336 Bacteria 1436
36 Ga0070680_100321609 3300005336 Bacteria 1313
37 Ga0070682_100286069 3300005337 Bacteria 1204
38 Ga0070660_100830413 3300005339 Bacteria 778
39 Ga0070689_100034015 3300005340 Bacteria 3887
40 Ga0070692_10224600 3300005345 Bacteria 1112
41 Ga0070668_100070419 3300005347 Bacteria 2722
42 Ga0070668_100103768 3300005347 Bacteria 2255
43 Ga0070668_100170575 3300005347 Bacteria 1771
44 Ga0070668_100271325 3300005347 Bacteria 1414
45 Ga0070668_100416686 3300005347 Bacteria 1149
46 Ga0070668_100471584 3300005347 Bacteria 1083
47 Ga0070669_100407461 3300005353 Bacteria 1114
48 Ga0070669_100438594 3300005353 Bacteria 1074
49 Ga0070669_101025567 3300005353 Bacteria 709
50 Ga0070675_100820351 3300005354 Bacteria 851
51 Ga0070675_100963929 3300005354 Bacteria 783
52 Ga0070671_100155706 3300005355 Bacteria 1930
53 Ga0070671_100267608 3300005355 Bacteria 1453
54 Ga0070671_100296056 3300005355 Bacteria 1377
55 Ga0070674_100031897 3300005356 Bacteria 3496
56 Ga0070674_100558501 3300005356 Bacteria 962
57 Ga0070674_100660203 3300005356 Bacteria 890
58 Ga0070674_101694092 3300005356 Bacteria 572
59 Ga0070673_100041021 3300005364 Bacteria 3555
60 Ga0070688_100094709 3300005365 Bacteria 1958
61 Ga0070688_100392323 3300005365 Bacteria 1026
62 Ga0070659_101018122 3300005366 Bacteria 727
63 Ga0070667_100080227 3300005367 Bacteria 2790
64 Ga0070667_100081492 3300005367 Bacteria 2769
65 Ga0070667_100151812 3300005367 Bacteria 2035
66 Ga0070667_100154449 3300005367 Bacteria 2018
67 Ga0070667_100593794 3300005367 Bacteria 1020
68 Ga0070667_100797734 3300005367 Bacteria 877
69 Ga0070667_100857454 3300005367 Bacteria 844
70 Ga0070709_10008945 3300005434 Bacteria 5513
71 Ga0070709_10013521 3300005434 Bacteria 4592
72 Ga0070709_10140877 3300005434 Bacteria 1657
73 Ga0070714_100143060 3300005435 Bacteria 2149
74 Ga0070714_100431403 3300005435 Bacteria 1250
75 Ga0070714_100809222 3300005435 Bacteria 908
76 Ga0070714_100854158 3300005435 Bacteria 883
77 Ga0070714_101144525 3300005435 Bacteria 759
78 Ga0070714_101238926 3300005435 Bacteria 728
79 Ga0070713_100041543 3300005436 Bacteria 3747
80 Ga0070713_100072309 3300005436 Bacteria 2916
81 Ga0070710_10000417 3300005437 Bacteria 19992
82 Ga0070710_10001492 3300005437 Bacteria 11017
83 Ga0070710_10214467 3300005437 Bacteria 1222
84 Ga0070710_10400266 3300005437 Bacteria 920
85 Ga0070701_10059454 3300005438 Bacteria 2010
86 Ga0070701_10252452 3300005438 Bacteria 1066
87 Ga0070701_10257512 3300005438 Bacteria 1056
88 Ga0070711_100015591 3300005439 Bacteria 4811
89 Ga0070711_100035694 3300005439 Bacteria 3326
90 Ga0070711_100087582 3300005439 Bacteria 2236
91 Ga0070711_100588768 3300005439 Bacteria 927
92 Ga0070700_100161341 3300005441 Bacteria 1543
93 Ga0070700_100371903 3300005441 Bacteria 1066
94 Ga0070700_100636210 3300005441 Bacteria 840
95 Ga0070694_100220377 3300005444 Bacteria 1423
96 Ga0070663_100030355 3300005455 Bacteria 3703
97 Ga0070663_100032319 3300005455 Bacteria 3606
98 Ga0070663_100034871 3300005455 Bacteria 3487
99 Ga0070663_100160427 3300005455 Bacteria 1730
100 Ga0070663_100173352 3300005455 Bacteria 1669
101 Ga0070663_100260090 3300005455 Bacteria 1376
102 Ga0070663_101034190 3300005455 Bacteria 715
103 Ga0070678_100243174 3300005456 Bacteria 1506
104 Ga0070678_100262735 3300005456 Bacteria 1452
105 Ga0070678_100288955 3300005456 Bacteria 1389
106 Ga0070678_100295614 3300005456 Bacteria 1374
107 Ga0070678_100353203 3300005456 Bacteria 1264
108 Ga0070678_100577948 3300005456 Bacteria 1001
109 Ga0070662_100046557 3300005457 Bacteria 3116
110 Ga0070662_100645672 3300005457 Bacteria 893
111 Ga0070662_100832107 3300005457 Bacteria 785
112 Ga0070681_10042387 3300005458 Bacteria 4561
113 Ga0070681_10170876 3300005458 Bacteria 2096
114 Ga0070681_10222869 3300005458 Bacteria 1801
115 Ga0070681_10451919 3300005458 Bacteria 1197
116 Ga0068867_100189445 3300005459 Bacteria 1640
117 Ga0068867_100601507 3300005459 Bacteria 959
118 Ga0070685_10248771 3300005466 Bacteria 1177
119 Ga0070685_10447051 3300005466 Bacteria 905
120 Ga0070685_10579612 3300005466 Bacteria 805
121 Ga0070706_100164814 3300005467 Bacteria 2070
122 Ga0070706_100345420 3300005467 Bacteria 1387
123 Ga0070706_100426768 3300005467 Bacteria 1234
124 Ga0070698_100066177 3300005471 Bacteria 3638
125 Ga0070698_100075398 3300005471 Bacteria 3377
126 Ga0070698_100536799 3300005471 Bacteria 1108
127 Ga0070699_100002202 3300005518 Bacteria 17633
128 Ga0070699_101070924 3300005518 Bacteria 740
129 Ga0070679_100019564 3300005530 Bacteria 6587
130 Ga0070679_100049981 3300005530 Bacteria 4165
131 Ga0070679_100052225 3300005530 Bacteria 4072
132 Ga0070679_100155309 3300005530 Bacteria 2263
133 Ga0070679_100234569 3300005530 Bacteria 1794
134 Ga0070679_100324814 3300005530 Bacteria 1488
135 Ga0070679_100464047 3300005530 Bacteria 1211
136 Ga0070679_101241476 3300005530 Bacteria 691
137 Ga0070684_100007976 3300005535 Bacteria 8266
138 Ga0070684_100687489 3300005535 Bacteria 953
139 Ga0070684_101000850 3300005535 Bacteria 784
140 Ga0068853_100057591 3300005539 Bacteria 3354
141 Ga0068853_100232537 3300005539 Bacteria 1687
142 Ga0068853_100798726 3300005539 Bacteria 903
143 Ga0068853_101008163 3300005539 Bacteria 802
144 Ga0068853_101079883 3300005539 Bacteria 774
145 Ga0068853_101099154 3300005539 Bacteria 767
146 Ga0070672_100127896 3300005543 Bacteria 2086
147 Ga0070686_100014022 3300005544 Bacteria 4608
148 Ga0070693_100047860 3300005547 Bacteria 2434
149 Ga0070693_100130209 3300005547 Bacteria 1572
150 Ga0070693_100371047 3300005547 Bacteria 984
151 Ga0070693_100456748 3300005547 Bacteria 898
152 Ga0070665_100016553 3300005548 Bacteria 7392
153 Ga0070665_100018194 3300005548 Bacteria 7048
154 Ga0070665_100050420 3300005548 Bacteria 4176
155 Ga0070665_100121319 3300005548 Bacteria 2615
156 Ga0070665_100155157 3300005548 Bacteria 2291
157 Ga0070665_100172127 3300005548 Bacteria 2166
158 Ga0070665_100173152 3300005548 Bacteria 2159
159 Ga0070665_100552691 3300005548 Bacteria 1163
160 Ga0070665_100593670 3300005548 Bacteria 1120
161 Ga0070665_100608603 3300005548 Bacteria 1106
162 Ga0070704_100262773 3300005549 Bacteria 1423
163 Ga0068855_100034049 3300005563 Bacteria 6077
164 Ga0068855_100265428 3300005563 Bacteria 1911
165 Ga0068855_100429882 3300005563 Bacteria 1443
166 Ga0068855_100664013 3300005563 Bacteria 1118
167 Ga0070664_100220459 3300005564 Bacteria 1697
168 Ga0070664_100311921 3300005564 Bacteria 1424
169 Ga0070664_100730249 3300005564 Bacteria 924
170 Ga0070664_100794547 3300005564 Bacteria 884
171 Ga0068857_100063620 3300005577 Bacteria 3280
172 Ga0068857_100077936 3300005577 Bacteria 2958
173 Ga0068857_100532995 3300005577 Bacteria 1105
174 Ga0068857_101506179 3300005577 Bacteria 656
175 Ga0068854_100067757 3300005578 Bacteria 2601
176 Ga0068856_100107968 3300005614 Bacteria 2779
177 Ga0068856_100128710 3300005614 Bacteria 2536
178 Ga0068856_100579133 3300005614 Bacteria 1144
179 Ga0068856_100717653 3300005614 Bacteria 1020
180 Ga0070702_100022746 3300005615 Bacteria 3320
181 Ga0068852_100004969 3300005616 Bacteria 9453
182 Ga0068852_100267549 3300005616 Bacteria 1644
183 Ga0068852_100373699 3300005616 Bacteria 1397
184 Ga0068852_100678265 3300005616 Bacteria 1040
185 Ga0068852_100836352 3300005616 Bacteria 936
186 Ga0068852_101034107 3300005616 Bacteria 841
187 Ga0068859_100151021 3300005617 Bacteria 2398
188 Ga0068859_100335297 3300005617 Bacteria 1607
189 Ga0068864_100012746 3300005618 Bacteria 6949
190 Ga0068864_100327678 3300005618 Bacteria 1440
191 Ga0068864_100489238 3300005618 Bacteria 1182
192 Ga0068864_101771802 3300005618 Bacteria 623
193 Ga0068866_10465704 3300005718 Bacteria 829
194 Ga0068866_11093538 3300005718 Bacteria 571
195 Ga0068861_100170911 3300005719 Bacteria 1801
196 Ga0068861_100336064 3300005719 Bacteria 1320
197 Ga0068861_100599818 3300005719 Bacteria 1010
198 Ga0068861_100886633 3300005719 Bacteria 844
199 Ga0068861_101145498 3300005719 Bacteria 749
200 Ga0068870_10039904 3300005840 Bacteria 2432
201 Ga0068870_10085321 3300005840 Bacteria 1755
202 Ga0068870_10313104 3300005840 Bacteria 995
203 Ga0068863_100460294 3300005841 Bacteria 1249
204 Ga0068863_101140189 3300005841 Bacteria 785
205 Ga0068863_101720090 3300005841 Bacteria 637
206 Ga0068858_100173930 3300005842 Bacteria 2031
207 Ga0068858_100255396 3300005842 Bacteria 1665
208 Ga0068858_100555269 3300005842 Bacteria 1112
209 Ga0068860_100004852 3300005843 Bacteria 13711
210 Ga0068860_100049838 3300005843 Bacteria 3987
211 Ga0068860_100055238 3300005843 Bacteria 3775
212 Ga0068862_100022728 3300005844 Bacteria 5247
213 Ga0068862_100084017 3300005844 Bacteria 2765
214 Ga0068862_100107550 3300005844 Bacteria 2445
215 Ga0068862_100427253 3300005844 Bacteria 1244
216 Ga0081455_10014398 3300005937 Bacteria 7759
217 Ga0081455_10032136 3300005937 Bacteria 4735
218 Ga0081455_10423265 3300005937 Bacteria 918
219 Ga0081538_10039714 3300005981 Bacteria 3013
220 Ga0081540_1003813 3300005983 Bacteria 11793
221 Ga0081540_1008010 3300005983 Bacteria 7436
222 Ga0081540_1024289 3300005983 Bacteria 3520
223 Ga0081540_1029677 3300005983 Bacteria 3042
224 Ga0081540_1114196 3300005983 Bacteria 1135
225 Ga0081540_1210743 3300005983 Bacteria 699
226 Ga0070717_10019823 3300006028 Bacteria 5280
227 Ga0070717_10023292 3300006028 Bacteria 4905
228 Ga0070717_10055976 3300006028 Bacteria 3256
229 Ga0070717_10225669 3300006028 Bacteria 1648
230 Ga0070717_10308958 3300006028 Bacteria 1407
231 Ga0070717_10316938 3300006028 Bacteria 1389
232 Ga0070717_11123073 3300006028 Bacteria 716
233 Ga0075365_10053752 3300006038 Bacteria 2668
234 Ga0075365_10063145 3300006038 Bacteria 2479
235 Ga0075365_10064660 3300006038 Bacteria 2451
236 Ga0075365_10106330 3300006038 Bacteria 1925
237 Ga0075365_10201427 3300006038 Bacteria 1394
238 Ga0075365_10269772 3300006038 Bacteria 1197
239 Ga0075365_10347864 3300006038 Bacteria 1045
240 Ga0075365_10567617 3300006038 Bacteria 802
241 Ga0075368_10021379 3300006042 Bacteria 2457
242 Ga0075368_10038998 3300006042 Bacteria 1861
243 Ga0075368_10075771 3300006042 Bacteria 1364
244 Ga0075368_10088245 3300006042 Bacteria 1267
245 Ga0075368_10096868 3300006042 Bacteria 1209
246 Ga0075368_10106919 3300006042 Bacteria 1151
247 Ga0075363_100007214 3300006048 Bacteria 5095
248 Ga0075363_100016054 3300006048 Bacteria 3692
249 Ga0075363_100026718 3300006048 Bacteria 2954
250 Ga0075364_10207161 3300006051 Bacteria 1329
251 Ga0075364_10249753 3300006051 Bacteria 1205
252 Ga0075364_10338005 3300006051 Bacteria 1026
253 Ga0075364_10386584 3300006051 Bacteria 954
254 Ga0075432_10085523 3300006058 Bacteria 1148
255 Ga0075432_10090801 3300006058 Bacteria 1118
256 Ga0070715_10039691 3300006163 Bacteria 1963
257 Ga0070715_10143542 3300006163 Bacteria 1162
258 Ga0070716_100004688 3300006173 Bacteria 6556
259 Ga0070716_100095473 3300006173 Bacteria 1810
260 Ga0070716_100273694 3300006173 Bacteria 1161
261 Ga0070716_100441086 3300006173 Bacteria 947
262 Ga0070716_100568934 3300006173 Bacteria 848
263 Ga0070712_100006062 3300006175 Bacteria 7485
264 Ga0070712_100277090 3300006175 Bacteria 1350
265 Ga0075362_10074388 3300006177 Bacteria 1556
266 Ga0075362_10091350 3300006177 Bacteria 1414
267 Ga0075362_10098807 3300006177 Bacteria 1363
268 Ga0075367_10015462 3300006178 Bacteria 4149
269 Ga0075367_10026029 3300006178 Bacteria 3313
270 Ga0075367_10042053 3300006178 Bacteria 2673
271 Ga0075367_10093686 3300006178 Bacteria 1829
272 Ga0075367_10098545 3300006178 Bacteria 1784
273 Ga0075367_10414252 3300006178 Bacteria 853
274 Ga0075367_10590870 3300006178 Bacteria 705
275 Ga0075369_10137562 3300006186 Bacteria 1112
276 Ga0075369_10139849 3300006186 Bacteria 1103
277 Ga0075369_10254701 3300006186 Bacteria 815
278 Ga0075366_10154003 3300006195 Bacteria 1392
279 Ga0075366_10399750 3300006195 Bacteria 845
280 Ga0097621_100078787 3300006237 Bacteria 2738
281 Ga0097621_100417483 3300006237 Bacteria 1204
282 Ga0097621_101324606 3300006237 Bacteria 680
283 Ga0075370_10045013 3300006353 Bacteria 2495
284 Ga0075370_10085553 3300006353 Bacteria 1815
285 Ga0075370_10105997 3300006353 Bacteria 1629
286 Ga0075370_10143332 3300006353 Bacteria 1397
287 Ga0075370_10351361 3300006353 Bacteria 881
288 Ga0075370_10384892 3300006353 Bacteria 840
289 Ga0068871_100453465 3300006358 Bacteria 1150
290 Ga0068871_100542323 3300006358 Bacteria 1053
291 Ga0068871_100793371 3300006358 Bacteria 872
292 Ga0068871_100916798 3300006358 Bacteria 813
293 Ga0075428_100169960 3300006844 Bacteria 2364
294 Ga0075428_100304419 3300006844 Bacteria 1714
295 Ga0075431_100162195 3300006847 Bacteria 2298
296 Ga0075431_100470328 3300006847 Bacteria 1251
297 Ga0075434_100083977 3300006871 Bacteria 3183
298 Ga0068865_100046207 3300006881 Bacteria 2987
299 Ga0068865_100335948 3300006881 Bacteria 1220
300 Ga0068865_100814137 3300006881 Bacteria 807
301 Ga0075436_100071375 3300006914 Bacteria 2401
302 Ga0075436_100494498 3300006914 Bacteria 894
303 Ga0097620_100151018 3300006931 Bacteria 2398
304 Ga0097620_100335321 3300006931 Bacteria 1607
305 Ga0099824_1010822 3300006942 Bacteria 10568
306 Ga0099824_1028382 3300006942 Bacteria 2548
307 Ga0099824_1049275 3300006942 Bacteria 808
308 Ga0099822_1005057 3300006943 Bacteria 17219
309 Ga0099823_1040671 3300006944 Bacteria 3346
310 Ga0075435_100082355 3300007076 Bacteria 2645
311 Ga0099794_10088487 3300007265 Bacteria 1535
312 Ga0099795_10030769 3300007788 Bacteria 1845
313 Ga0099795_10088712 3300007788 Bacteria 1196
314 Ga0105250_10216515 3300009092 Bacteria 811
315 Ga0105240_10014591 3300009093 Bacteria 10720
316 Ga0105240_10156831 3300009093 Bacteria 2706
317 Ga0111539_10255977 3300009094 Bacteria 2038
318 Ga0111539_11139549 3300009094 Bacteria 906
319 Ga0111539_11341686 3300009094 Bacteria 830
320 Ga0105245_10068919 3300009098 Bacteria 3206
321 Ga0105245_10329073 3300009098 Bacteria 1507
322 Ga0105245_10768895 3300009098 Bacteria 1000
323 Ga0105247_10010671 3300009101 Bacteria 5546
324 Ga0105247_10036878 3300009101 Bacteria 2981
325 Ga0105247_10050804 3300009101 Bacteria 2552
326 Ga0105247_10327780 3300009101 Bacteria 1070
327 Ga0105247_10407371 3300009101 Bacteria 970
328 Ga0105247_10604295 3300009101 Bacteria 814
329 Ga0105247_10635276 3300009101 Bacteria 796
330 Ga0105247_10906325 3300009101 Bacteria 681
331 Ga0114129_10083313 3300009147 Bacteria 4443
332 Ga0114129_10770696 3300009147 Bacteria 1230
333 Ga0105243_10078293 3300009148 Bacteria 2691
334 Ga0105243_10324676 3300009148 Bacteria 1404
335 Ga0105243_10631919 3300009148 Bacteria 1035
336 Ga0105243_11297237 3300009148 Bacteria 745
337 Ga0105243_11479152 3300009148 Bacteria 702
338 Ga0105241_10037810 3300009174 Bacteria 3637
339 Ga0105241_10412031 3300009174 Bacteria 1188
340 Ga0105241_10528991 3300009174 Bacteria 1055
341 Ga0105241_10594225 3300009174 Bacteria 999
342 Ga0105241_11502248 3300009174 Bacteria 648
343 Ga0105242_10234784 3300009176 Bacteria 1645
344 Ga0105242_10603637 3300009176 Bacteria 1060
345 Ga0105248_10032002 3300009177 Bacteria 5877
346 Ga0105248_10158583 3300009177 Bacteria 2553
347 Ga0105248_10458682 3300009177 Bacteria 1437
348 Ga0105237_10002547 3300009545 Bacteria 22555
349 Ga0105237_10013746 3300009545 Bacteria 8479
350 Ga0105237_10064660 3300009545 Bacteria 3654
351 Ga0105237_10067924 3300009545 Bacteria 3558
352 Ga0105237_10175622 3300009545 Bacteria 2142
353 Ga0105237_10230976 3300009545 Bacteria 1851
354 Ga0105237_10506411 3300009545 Bacteria 1214
355 Ga0105237_10826448 3300009545 Bacteria 933
356 Ga0105238_10054537 3300009551 Bacteria 4014
357 Ga0105238_10096074 3300009551 Bacteria 2950
358 Ga0105238_10130906 3300009551 Bacteria 2487
359 Ga0105238_10315214 3300009551 Bacteria 1549
360 Ga0105238_10523929 3300009551 Bacteria 1188
361 Ga0105238_10725723 3300009551 Bacteria 1007
362 Ga0105238_10824041 3300009551 Bacteria 944
363 Ga0105249_10143590 3300009553 Bacteria 2291
364 Ga0105249_10207839 3300009553 Bacteria 1919
365 Ga0105249_10536720 3300009553 Bacteria 1219
366 Ga0099796_10391085 3300010159 Bacteria 608
367 Ga0105239_10021794 3300010375 Bacteria 7062
368 Ga0105239_10022601 3300010375 Bacteria 6933
369 Ga0105239_10093731 3300010375 Bacteria 3316
370 Ga0105239_10099469 3300010375 Bacteria 3216
371 Ga0105239_10688990 3300010375 Bacteria 1168
372 Ga0105239_10726438 3300010375 Bacteria 1136
373 Ga0105239_11074281 3300010375 Bacteria 926
374 Ga0105239_11150125 3300010375 Bacteria 894
375 Ga0105246_10059706 3300011119 Bacteria 2646
376 Ga0105246_10134639 3300011119 Bacteria 1850
377 Ga0105246_10919517 3300011119 Bacteria 786
378 Ga0105246_11506098 3300011119 Bacteria 632
379 Ga0157373_10431744 3300013100 Bacteria 946
380 Ga0157373_10708077 3300013100 Bacteria 738
381 Ga0157371_10786705 3300013102 Bacteria 716
382 Ga0157370_10243254 3300013104 Bacteria 1665
383 Ga0157370_10249396 3300013104 Bacteria 1642
384 Ga0157369_10026489 3300013105 Bacteria 6430
385 Ga0157369_10034502 3300013105 Bacteria 5552
386 Ga0157369_10124032 3300013105 Bacteria 2740
387 Ga0157369_10932072 3300013105 Bacteria 890
388 Ga0157369_11065831 3300013105 Bacteria 827
389 Ga0157374_10202003 3300013296 Bacteria 1946
390 Ga0157374_10542760 3300013296 Bacteria 1170
391 Ga0157374_10748608 3300013296 Bacteria 992
392 Ga0157378_10045009 3300013297 Bacteria 3921
393 Ga0157378_10340673 3300013297 Bacteria 1462
394 Ga0157378_10366542 3300013297 Bacteria 1411
395 Ga0157378_10381656 3300013297 Bacteria 1384
396 Ga0157378_11504997 3300013297 Bacteria 718
397 Ga0163162_10144491 3300013306 Bacteria 2494
398 Ga0163162_10259131 3300013306 Bacteria 1871
399 Ga0163162_10400455 3300013306 Bacteria 1505
400 Ga0163162_10591094 3300013306 Bacteria 1237
401 Ga0157372_10176783 3300013307 Bacteria 2471
402 Ga0157372_10633039 3300013307 Bacteria 1246
403 Ga0157375_10089567 3300013308 Bacteria 3133
404 Ga0157375_10763161 3300013308 Bacteria 1118
405 Ga0163163_10023107 3300014325 Bacteria 5898
406 Ga0163163_10031785 3300014325 Bacteria 5097
407 Ga0163163_10067293 3300014325 Bacteria 3561
408 Ga0163163_10675613 3300014325 Bacteria 1096
409 Ga0157380_10025361 3300014326 Bacteria 4496
410 Ga0157380_10292763 3300014326 Bacteria 1496
411 Ga0157380_10336143 3300014326 Bacteria 1407
412 Ga0157380_10599357 3300014326 Bacteria 1090
413 Ga0157380_10807635 3300014326 Bacteria 956
414 Ga0182008_10155180 3300014497 Bacteria 1149
415 Ga0157379_10028501 3300014968 Bacteria 4966
416 Ga0157376_10520707 3300014969 Bacteria 1172
417 Ga0157376_10559144 3300014969 Bacteria 1133
418 Ga0157376_11655452 3300014969 Bacteria 675
419 Ga0157376_11699122 3300014969 Bacteria 666
420 Ga0163161_10525797 3300017792 Bacteria 966
421 Ga0163161_10720792 3300017792 Bacteria 832
422 Ga0163161_10951154 3300017792 Bacteria 731
423 Ga0197907_10446942 3300020069 Bacteria 767
424 Ga0206349_1097443 3300020075 Bacteria 873
425 Ga0206355_1264525 3300020076 Bacteria 858
426 Ga0206351_10235379 3300020077 Bacteria 734
427 Ga0206352_11046103 3300020078 Bacteria 712
428 Ga0206350_10726292 3300020080 Bacteria 890
429 Ga0206354_10827935 3300020081 Bacteria 891
430 Ga0206353_11793332 3300020082 Bacteria 676
431 Ga0214544_1000001 3300021320 Bacteria 783667
432 Ga0214542_1000005 3300021321 Bacteria 389646
433 Ga0214545_1000003 3300021324 Bacteria 720274
434 Ga0214543_1000002 3300021327 Bacteria 712733
435 Ga0213873_10019785 3300021358 Bacteria 1565
436 Ga0213873_10161295 3300021358 Bacteria 679
437 Ga0213873_10240959 3300021358 Bacteria 571
438 Ga0213872_10067877 3300021361 Bacteria 1609
439 Ga0213874_10003990 3300021377 Bacteria 3324
440 Ga0213874_10014556 3300021377 Bacteria 2059
441 Ga0213876_10192735 3300021384 Bacteria 1084
442 Ga0213876_10433693 3300021384 Bacteria 699
443 Ga0213871_10076770 3300021441 Bacteria 951
444 Ga0224712_10147305 3300022467 Bacteria 1041
445 Ga0224712_10328636 3300022467 Bacteria 719
446 Ga0209563_101046 3300025230 Bacteria 7992
447 Ga0209677_101355 3300025253 Bacteria 10740
448 Ga0209677_104016 3300025253 Bacteria 4435
449 Ga0209148_1000253 3300025254 Bacteria 84643
450 Ga0209129_1018292 3300025258 Bacteria 1349
451 Ga0209233_1000985 3300025261 Bacteria 12162
452 Ga0209233_1035856 3300025261 Bacteria 1116
453 Ga0209233_1054537 3300025261 Bacteria 797
454 Ga0209455_1000873 3300025272 Bacteria 15975
455 Ga0209455_1001420 3300025272 Bacteria 10852
456 Ga0209455_1009019 3300025272 Bacteria 2652
457 Ga0209455_1016237 3300025272 Bacteria 1605
458 Ga0209673_1067571 3300025273 Bacteria 864
459 Ga0209564_1002453 3300025295 Bacteria 14594
460 Ga0209564_1054797 3300025295 Bacteria 938
461 Ga0209758_1000026 3300025297 Bacteria 582706
462 Ga0209758_1000318 3300025297 Bacteria 92807
463 Ga0209758_1001681 3300025297 Bacteria 24938
464 Ga0209758_1001958 3300025297 Bacteria 22263
465 Ga0209758_1002426 3300025297 Bacteria 19054
466 Ga0209758_1028711 3300025297 Bacteria 2345
467 Ga0209758_1047293 3300025297 Bacteria 1541
468 Ga0209050_1073517 3300025298 Bacteria 754
469 Ga0209256_1005534 3300025299 Bacteria 7219
470 Ga0207426_1001230 3300025302 Bacteria 22561
471 Ga0207426_1005043 3300025302 Bacteria 6190
472 Ga0209257_1002140 3300025304 Bacteria 20574
473 Ga0207697_10103745 3300025315 Bacteria 1213
474 Ga0207697_10234688 3300025315 Bacteria 810
475 Ga0207682_10113093 3300025893 Bacteria 1197
476 Ga0207692_10003364 3300025898 Bacteria 6239
477 Ga0207692_10071779 3300025898 Bacteria 1827
478 Ga0207692_10241951 3300025898 Bacteria 1078
479 Ga0207692_10395923 3300025898 Bacteria 860
480 Ga0207710_10075792 3300025900 Bacteria 1551
481 Ga0207710_10480215 3300025900 Bacteria 644
482 Ga0207688_10089210 3300025901 Bacteria 1769
483 Ga0207688_10089241 3300025901 Bacteria 1768
484 Ga0207688_10572607 3300025901 Bacteria 711
485 Ga0207680_10032128 3300025903 Bacteria 2980
486 Ga0207647_10004054 3300025904 Bacteria 10913
487 Ga0207647_10262084 3300025904 Bacteria 990
488 Ga0207647_10435538 3300025904 Bacteria 736
489 Ga0207647_10459310 3300025904 Bacteria 713
490 Ga0207685_10074739 3300025905 Bacteria 1384
491 Ga0207685_10370467 3300025905 Bacteria 727
492 Ga0207699_10000473 3300025906 Bacteria 20435
493 Ga0207699_10121539 3300025906 Bacteria 1689
494 Ga0207699_10231449 3300025906 Bacteria 1266
495 Ga0207699_10279290 3300025906 Bacteria 1160
496 Ga0207645_10718127 3300025907 Bacteria 679
497 Ga0207643_10033091 3300025908 Bacteria 2892
498 Ga0207643_10683462 3300025908 Bacteria 663
499 Ga0207684_10129852 3300025910 Bacteria 2163
500 Ga0207684_10149107 3300025910 Bacteria 2012
501 Ga0207654_10047399 3300025911 Bacteria 2455
502 Ga0207654_10169941 3300025911 Bacteria 1415
503 Ga0207654_10218860 3300025911 Bacteria 1262
504 Ga0207654_10656938 3300025911 Bacteria 751
505 Ga0207707_10001008 3300025912 Bacteria 27003
506 Ga0207707_10005928 3300025912 Bacteria 10692
507 Ga0207707_10398285 3300025912 Bacteria 1182
508 Ga0207695_10000634 3300025913 Bacteria 70325
509 Ga0207695_10043518 3300025913 Bacteria 4785
510 Ga0207671_10007760 3300025914 Bacteria 9242
511 Ga0207671_10027280 3300025914 Bacteria 4270
512 Ga0207671_10051315 3300025914 Bacteria 3056
513 Ga0207671_10156859 3300025914 Bacteria 1761
514 Ga0207671_10222990 3300025914 Bacteria 1477
515 Ga0207671_10246630 3300025914 Bacteria 1404
516 Ga0207671_10247594 3300025914 Bacteria 1401
517 Ga0207671_10927534 3300025914 Bacteria 688
518 Ga0207693_10006327 3300025915 Bacteria 9817
519 Ga0207693_10030096 3300025915 Bacteria 4287
520 Ga0207693_10069142 3300025915 Bacteria 2764
521 Ga0207663_10030431 3300025916 Bacteria 3184
522 Ga0207663_10043308 3300025916 Bacteria 2755
523 Ga0207663_10060300 3300025916 Bacteria 2404
524 Ga0207663_10238315 3300025916 Bacteria 1333
525 Ga0207663_10275857 3300025916 Bacteria 1247
526 Ga0207660_10140017 3300025917 Bacteria 1849
527 Ga0207662_10070034 3300025918 Bacteria 2121
528 Ga0207657_10157818 3300025919 Bacteria 1844
529 Ga0207652_10026858 3300025921 Bacteria 4797
530 Ga0207652_11084181 3300025921 Bacteria 701
531 Ga0207652_11219921 3300025921 Bacteria 654
532 Ga0207652_11341665 3300025921 Bacteria 618
533 Ga0207681_10589821 3300025923 Bacteria 917
534 Ga0207694_10102308 3300025924 Bacteria 2271
535 Ga0207694_10411834 3300025924 Bacteria 1125
536 Ga0207694_10424139 3300025924 Bacteria 1108
537 Ga0207694_10702348 3300025924 Bacteria 853
538 Ga0207694_10798445 3300025924 Bacteria 797
539 Ga0207694_10864496 3300025924 Bacteria 764
540 Ga0207650_10505621 3300025925 Bacteria 1010
541 Ga0207659_10683660 3300025926 Bacteria 878
542 Ga0207659_11280220 3300025926 Bacteria 630
543 Ga0207687_10013234 3300025927 Bacteria 5387
544 Ga0207687_10324016 3300025927 Bacteria 1248
545 Ga0207687_10345988 3300025927 Bacteria 1210
546 Ga0207700_10005697 3300025928 Bacteria 7480
547 Ga0207700_10012732 3300025928 Bacteria 5438
548 Ga0207700_10029241 3300025928 Bacteria 3886
549 Ga0207664_10400900 3300025929 Bacteria 1220
550 Ga0207664_10533297 3300025929 Bacteria 1052
551 Ga0207664_10722934 3300025929 Bacteria 895
552 Ga0207664_10742397 3300025929 Bacteria 883
553 Ga0207664_10859993 3300025929 Bacteria 815
554 Ga0207644_10234760 3300025931 Bacteria 1458
555 Ga0207706_10080045 3300025933 Bacteria 2873
556 Ga0207706_10597116 3300025933 Bacteria 948
557 Ga0207686_10089819 3300025934 Bacteria 2025
558 Ga0207686_10587154 3300025934 Bacteria 875
559 Ga0207686_10761154 3300025934 Bacteria 774
560 Ga0207686_11623737 3300025934 Bacteria 534
561 Ga0207709_10328952 3300025935 Bacteria 1146
562 Ga0207709_10724362 3300025935 Bacteria 798
563 Ga0207670_10026987 3300025936 Bacteria 3626
564 Ga0207670_10570752 3300025936 Bacteria 926
565 Ga0207704_10147895 3300025938 Bacteria 1653
566 Ga0207704_10153434 3300025938 Bacteria 1628
567 Ga0207704_10350831 3300025938 Bacteria 1149
568 Ga0207665_10054422 3300025939 Bacteria 2698
569 Ga0207665_10227011 3300025939 Bacteria 1371
570 Ga0207691_10553016 3300025940 Bacteria 976
571 Ga0207691_10960546 3300025940 Bacteria 714
572 Ga0207711_10124863 3300025941 Bacteria 2301
573 Ga0207689_10246805 3300025942 Bacteria 1476
574 Ga0207661_10013913 3300025944 Bacteria 5882
575 Ga0207661_10030242 3300025944 Bacteria 4169
576 Ga0207679_10702135 3300025945 Bacteria 918
577 Ga0207679_10837688 3300025945 Bacteria 840
578 Ga0207667_10041143 3300025949 Bacteria 4917
579 Ga0207667_10523500 3300025949 Bacteria 1201
580 Ga0207667_10683171 3300025949 Bacteria 1030
581 Ga0207712_10019324 3300025961 Bacteria 4448
582 Ga0207712_10345339 3300025961 Bacteria 1235
583 Ga0207668_10022383 3300025972 Bacteria 4045
584 Ga0207668_10028830 3300025972 Bacteria 3634
585 Ga0207668_10168221 3300025972 Bacteria 1716
586 Ga0207640_10154178 3300025981 Bacteria 1691
587 Ga0207640_10335688 3300025981 Bacteria 1209
588 Ga0207640_10862722 3300025981 Bacteria 788
589 Ga0207658_10235007 3300025986 Bacteria 1549
590 Ga0207658_10345592 3300025986 Bacteria 1294
591 Ga0207658_11038046 3300025986 Bacteria 748
592 Ga0207677_10818622 3300026023 Bacteria 835
593 Ga0207703_10009809 3300026035 Bacteria 7511
594 Ga0207703_10130141 3300026035 Bacteria 2172
595 Ga0207703_10433869 3300026035 Bacteria 1225
596 Ga0207703_10551496 3300026035 Bacteria 1087
597 Ga0207639_10134516 3300026041 Bacteria 2051
598 Ga0207639_10234449 3300026041 Bacteria 1593
599 Ga0207639_10490580 3300026041 Bacteria 1121
600 Ga0207639_11494625 3300026041 Bacteria 634
601 Ga0207678_10020238 3300026067 Bacteria 5842
602 Ga0207678_10035725 3300026067 Bacteria 4327
603 Ga0207678_10045271 3300026067 Bacteria 3806
604 Ga0207678_10070613 3300026067 Bacteria 2994
605 Ga0207678_10378862 3300026067 Bacteria 1223
606 Ga0207708_10033443 3300026075 Bacteria 3906
607 Ga0207708_10234355 3300026075 Bacteria 1475
608 Ga0207708_10301397 3300026075 Bacteria 1303
609 Ga0207702_10178192 3300026078 Bacteria 1955
610 Ga0207702_10204597 3300026078 Bacteria 1832
611 Ga0207702_10302276 3300026078 Bacteria 1519
612 Ga0207702_10455912 3300026078 Bacteria 1241
613 Ga0207641_10315477 3300026088 Bacteria 1481
614 Ga0207641_10627152 3300026088 Bacteria 1054
615 Ga0207641_11509944 3300026088 Bacteria 673
616 Ga0207648_10094412 3300026089 Bacteria 2615
617 Ga0207648_10398043 3300026089 Bacteria 1247
618 Ga0207648_10437454 3300026089 Bacteria 1189
619 Ga0207676_10176877 3300026095 Bacteria 1865
620 Ga0207676_10566698 3300026095 Bacteria 1087
621 Ga0207674_10017324 3300026116 Bacteria 7860
622 Ga0207674_10326633 3300026116 Bacteria 1484
623 Ga0207674_10691940 3300026116 Bacteria 984
624 Ga0207675_100139003 3300026118 Bacteria 2306
625 Ga0207675_100154819 3300026118 Bacteria 2184
626 Ga0207675_100631907 3300026118 Bacteria 1076
627 Ga0207683_10023560 3300026121 Bacteria 5296
628 Ga0207683_10249625 3300026121 Bacteria 1619
629 Ga0207683_10391595 3300026121 Bacteria 1278
630 Ga0207683_11309915 3300026121 Bacteria 670
631 Ga0207698_10102271 3300026142 Bacteria 2378
632 Ga0207698_10264414 3300026142 Bacteria 1582
633 Ga0209389_1000090 3300027296 Bacteria 83470
634 Ga0209389_1000119 3300027296 Bacteria 70614
635 Ga0209589_1000007 3300027357 Bacteria 425699
636 Ga0209589_1000010 3300027357 Bacteria 237657
637 Ga0209489_100008 3300027361 Bacteria 425699
638 Ga0209489_100011 3300027361 Bacteria 244710
639 Ga0209489_100385 3300027361 Bacteria 79532
640 Ga0209700_100009 3300027363 Bacteria 425699
641 Ga0209700_100013 3300027363 Bacteria 341906
642 Ga0209984_1044705 3300027424 Bacteria 642
643 Ga0209588_1120750 3300027671 Bacteria 839
644 Ga0209813_10027474 3300027866 Bacteria 1652
645 Ga0209813_10197252 3300027866 Bacteria 744
646 Ga0268266_10000446 3300028379 Bacteria 61283
647 Ga0268266_10014950 3300028379 Bacteria 6663
648 Ga0268266_10017902 3300028379 Bacteria 6038
649 Ga0268266_10059310 3300028379 Bacteria 3297
650 Ga0268266_10075473 3300028379 Bacteria 2928
651 Ga0268266_10274114 3300028379 Bacteria 1567
652 Ga0268266_10760074 3300028379 Bacteria 935
653 Ga0268266_11997431 3300028379 Bacteria 553
654 Ga0268265_10124097 3300028380 Bacteria 2133
655 Ga0268265_10208678 3300028380 Bacteria 1700
656 Ga0268265_10636468 3300028380 Bacteria 1023
657 Ga0268264_10000158 3300028381 Bacteria 153433
658 Ga0268264_10446924 3300028381 Bacteria 1252
659 Ga0265337_1021645 3300028556 Bacteria 2001
660 Ga0265326_10001072 3300028558 Bacteria 9744
661 Ga0265319_1018091 3300028563 Bacteria 2665
662 Ga0265334_10006784 3300028573 Bacteria 4917
663 Ga0265318_10016818 3300028577 Bacteria 3014
664 Ga0265323_10000529 3300028653 Bacteria 21172
665 Ga0265336_10000169 3300028666 Bacteria 45875
666 Ga0307517_10001444 3300028786 Bacteria 39936
667 Ga0307517_10091019 3300028786 Bacteria 2496
668 Ga0307515_10069057 3300028794 Bacteria 4840
669 Ga0307515_10555648 3300028794 Bacteria 758
670 Ga0265338_10000624 3300028800 Bacteria 61670
671 Ga0265324_10002965 3300029957 Bacteria 8306
672 Ga0307511_10062880 3300030521 Bacteria 2811
673 Ga0307513_10517498 3300031456 Bacteria 909
674 Ga0307513_10585594 3300031456 Bacteria 826
675 Ga0307509_10043981 3300031507 Bacteria 4826
676 Ga0307509_10073911 3300031507 Bacteria 3548
677 Ga0307509_10384712 3300031507 Bacteria 1115
678 Ga0265313_10001400 3300031595 Bacteria 22611
679 Ga0307508_10000184 3300031616 Bacteria 75613
680 Ga0307508_10007695 3300031616 Bacteria 10018
681 Ga0307508_10339083 3300031616 Bacteria 1095
682 Ga0307508_10533142 3300031616 Bacteria 771
683 Ga0316575_10000635 3300031665 Bacteria 10352
684 Ga0316575_10023931 3300031665 Bacteria 2363
685 Ga0316579_10015621 3300031691 Bacteria 3301
686 Ga0316576_10080740 3300031727 Bacteria 2412
687 Ga0316578_10035125 3300031728 Bacteria 2880
688 Ga0307516_10007195 3300031730 Bacteria 12842
689 Ga0307516_10022096 3300031730 Bacteria 6538
690 Ga0307516_10101395 3300031730 Bacteria 2694
691 Ga0307405_10415765 3300031731 Bacteria 1057
692 Ga0307406_11198040 3300031901 Bacteria 659
693 Ga0307414_10658123 3300032004 Bacteria 945
694 Ga0307415_100061963 3300032126 Bacteria 2592
695 Ga0316583_10001515 3300032133 Bacteria 7799
696 Ga0316585_10002313 3300032137 Bacteria 5125
697 Ga0316580_10002044 3300032139 Bacteria 5467
698 Ga0316593_10043581 3300032168 Bacteria 1499
699 Ga0307507_10011889 3300033179 Bacteria 10880
700 Ga0307510_10009874 3300033180 Bacteria 11359
701 Ga0307510_10034758 3300033180 Bacteria 5636
702 Ga0307510_10163778 3300033180 Bacteria 1816
703 Ga0307510_10243522 3300033180 Bacteria 1291
704 Ga0315911_1000004 3300033442 Bacteria 472637
705 Ga0316596_1074199 3300033541 Bacteria 912
706 Ga0373930_0008728 3300034816 Bacteria 1778
707 Ga0373950_0057981 3300034818 Bacteria 772
708 Ga0373934_0084208 3300035086 Bacteria 1279
709 Ga0373923_0079720 3300035111 Bacteria 1418
710 Ga0373932_0064100 3300035112 Bacteria 1124
711 Ga0373936_0032215 3300035113 Bacteria 2072
712 Ga0373939_0295107 3300035114 Bacteria 645
713 Ga0373953_0190987 3300035117 Bacteria 885
714 Ga0373953_0315189 3300035117 Bacteria 683
715 Ga0373954_0000381 3300035118 Bacteria 16501
716 Ga0373954_0036923 3300035118 Bacteria 2269
717 Ga0373956_0203287 3300035119 Bacteria 939
718 Ga0373957_0197119 3300035120 Bacteria 838
719 Ga0373943_0017111 3300035170 Bacteria 3316
720 Ga0373943_0045634 3300035170 Bacteria 2136
721 Ga0373943_0359058 3300035170 Bacteria 836
722 Ga0373946_0373444 3300035171 Bacteria 716
723 Ga0373955_0027515 3300035172 Bacteria 2940
724 Ga0373955_0243811 3300035172 Bacteria 1077
725 Ga0373962_0137919 3300035242 Bacteria 790
726 Ga0316574_0016544 3300035398 Bacteria 4300
727 Ga0373931_0060534 3300035691 Bacteria 2038
728 Ga0373935_0010312 3300035692 Bacteria 5603
729 Ga0373935_0041354 3300035692 Bacteria 2895
730 Ga0373927_0026222 3300035695 Bacteria 3808
731 Ga0373927_0053805 3300035695 Bacteria 2604
732 Ga0373927_0063432 3300035695 Bacteria 2390
733 Ga0373927_0271346 3300035695 Bacteria 1115
734 Ga0373927_0559924 3300035695 Bacteria 755
735 Ga0373933_0002890 3300035724 Bacteria 9602
736 Ga0373933_0068282 3300035724 Bacteria 2159
737 Ga0373947_0005469 3300035725 Bacteria 7415
738 Ga0373947_0079574 3300035725 Bacteria 2026
739 Ga0373947_0128709 3300035725 Bacteria 1614
740 Ga0373937_0151735 3300036401 Bacteria 2170
741 Ga0316584_0019546 3300036712 Bacteria 4897
742 Ga0316584_0054000 3300036712 Bacteria 3006
743 Ga0373925_0003584 3300037068 Bacteria 11964
744 Ga0373925_0060136 3300037068 Bacteria 2853
745 Ga0373925_0467058 3300037068 Bacteria 1034
746 Ga0373925_0590211 3300037068 Bacteria 915
747 Ga0373925_1222464 3300037068 Bacteria 617
748 Ga0395899_0031588 3300037312 Bacteria 3980
749 Ga0395900_0005987 3300037418 Bacteria 12697
750 Ga0395900_0006562 3300037418 Bacteria 12123
751 Ga0395900_0117980 3300037418 Bacteria 2723
752 Ga0395900_0319963 3300037418 Bacteria 1532
753 Ga0395900_0498116 3300037418 Bacteria 1169
754 Ga0395898_0002317 3300037466 Bacteria 22750
755 Ga0395898_0003901 3300037466 Bacteria 16470
756 Ga0395898_0027942 3300037466 Bacteria 5658
757 Ga0395905_0024040 3300037471 Bacteria 5751
758 Ga0395905_0172771 3300037471 Bacteria 2030
759 Ga0395905_0212898 3300037471 Bacteria 1810
760 Ga0395905_0341953 3300037471 Bacteria 1387
761 Ga0395905_0375545 3300037471 Bacteria 1315
762 Ga0395905_0672230 3300037471 Bacteria 938
763 Ga0316581_0100512 3300037588 Bacteria 890
764 Ga0436364_0166995 3300037853 Bacteria 962
765 Ga0436364_0972203 3300037853 Bacteria 1173
766 Ga0395901_0071983 3300038443 Bacteria 3603
767 Ga0395901_0133538 3300038443 Bacteria 2609
768 Ga0395901_0273920 3300038443 Bacteria 1755
769 Ga0395901_0304864 3300038443 Bacteria 1651
770 Ga0395901_0362661 3300038443 Bacteria 1494
771 Ga0395901_0769100 3300038443 Bacteria 955
772 Ga0400483_150976 3300039062 Bacteria 1419
773 Ga0436365_0959977 3300039437 Bacteria 23998
774 Ga0436365_1099024 3300039437 Bacteria 2833
775 Ga0436365_1161464 3300039437 Bacteria 3810
776 Ga0436365_1552255 3300039437 Bacteria 718
777 Ga0436365_1809413 3300039437 Bacteria 2227
778 Ga0436360_0470849 3300039438 Bacteria 1274
779 Ga0436360_0503236 3300039438 Bacteria 1744
780 Ga0436360_0613744 3300039438 Bacteria 816
781 Ga0436360_0727276 3300039438 Bacteria 680
782 Ga0436360_1374083 3300039438 Bacteria 1146
783 Ga0436361_0169041 3300039447 Bacteria 849
784 Ga0436361_0348664 3300039447 Bacteria 2728
785 Ga0436361_0523159 3300039447 Bacteria 3048
786 Ga0436361_0988201 3300039447 Bacteria 910
787 Ga0436361_1003794 3300039447 Bacteria 602
788 Ga0436363_0002469 3300039450 Bacteria 3179
789 Ga0436363_0532944 3300039450 Bacteria 940
790 Ga0436363_0602143 3300039450 Bacteria 631
791 Ga0436363_0914045 3300039450 Bacteria 580
792 Ga0436363_1181528 3300039450 Bacteria 2136
793 Ga0436363_1346086 3300039450 Bacteria 711
794 Ga0436362_0651173 3300039453 Bacteria 657
795 Ga0436362_1003352 3300039453 Bacteria 3365
796 Ga0436362_1058248 3300039453 Bacteria 3068
797 Ga0436362_1162318 3300039453 Bacteria 772
798 Ga0436362_1221089 3300039453 Bacteria 1116
799 Ga0451791_1382345 3300041451 Bacteria 576
800 Ga0451793_1056189 3300041452 Bacteria 891
801 Ga0451797_0711704 3300041453 Bacteria 2480
802 Ga0451800_1299814 3300041459 Bacteria 946
803 Ga0451802_0615921 3300041460 Bacteria 788
804 Ga0451804_0979417 3300041463 Bacteria 677
805 Ga0451841_0229262 3300041498 Bacteria 629
806 Ga0451841_0609926 3300041498 Bacteria 998
807 Ga0451845_0755152 3300041501 Bacteria 629
808 Ga0451843_0518491 3300041509 Bacteria 1032
809 Ga0451853_0618708 3300041512 Bacteria 1399
810 Ga0451853_3679622 3300041512 Bacteria 740
811 Ga0439445_0094604 3300042004 Bacteria 844
812 Ga0439455_0105813 3300042012 Bacteria 780
813 Ga0439456_105182 3300042013 Bacteria 641
814 Ga0466969_0127291 3300044656 Bacteria 1183
815 Ga0466972_0000090 3300044658 Bacteria 82487
816 Ga0466972_0020304 3300044658 Bacteria 3319
817 Ga0466972_0193438 3300044658 Bacteria 953
818 Ga0466965_0178605 3300044683 Bacteria 1119
819 Ga0466966_0000376 3300044684 Bacteria 29152
820 Ga0466961_0001144 3300044693 Bacteria 16294
821 Ga0466963_0097174 3300044694 Bacteria 2012
822 Ga0466964_0026879 3300044706 Bacteria 2255
823 Ga0466964_0485825 3300044706 Bacteria 661
824 Ga0466971_0064851 3300044719 Bacteria 1654
825 Ga0466971_0314109 3300044719 Bacteria 754
826 Ga0466968_0031144 3300044735 Bacteria 2212
827 Ga0466970_0357709 3300044765 Bacteria 829
828 Ga0466957_0102949 3300044842 Bacteria 1802
829 Ga0466957_0110589 3300044842 Bacteria 1742
830 Ga0466957_1021942 3300044842 Bacteria 594
831 Ga0466960_0131830 3300044901 Bacteria 1320
832 Ga0466959_0004580 3300045049 Bacteria 9281
833 Ga0466959_0021227 3300045049 Bacteria 4788
834 Ga0466959_0839640 3300045049 Bacteria 614
835 Ga0466959_0857890 3300045049 Bacteria 606
836 Ga0466958_0238972 3300045836 Bacteria 1160
837 Ga0466958_0709949 3300045836 Bacteria 655
838 Ga0466958_0872087 3300045836 Bacteria 587
839 Ga0466967_0045828 3300045976 Bacteria 3802
840 Ga0466967_0045943 3300045976 Bacteria 3799
841 Ga0466967_0124582 3300045976 Bacteria 2386
842 Ga0466967_0145351 3300045976 Bacteria 2212
843 Ga0466967_0387509 3300045976 Bacteria 1358
844 Ga0466967_0509965 3300045976 Bacteria 1181
845 Ga0466967_0539393 3300045976 Bacteria 1147
846 Ga0466967_0613773 3300045976 Bacteria 1074
847 Ga0466967_0725137 3300045976 Bacteria 985
848 Ga0495592_0021995 3300046454 Bacteria 4852
849 Ga0495592_0043623 3300046454 Bacteria 3354
850 Ga0495592_0140714 3300046454 Bacteria 1679
851 Ga0495592_0271327 3300046454 Bacteria 1113
852 Ga0495603_0001301 3300046455 Bacteria 14523
853 Ga0495603_0268188 3300046455 Bacteria 982
854 Ga0495590_0371023 3300046457 Bacteria 546
855 Ga0495629_0001832 3300046459 Bacteria 16639
856 Ga0495629_0002003 3300046459 Bacteria 15830
857 Ga0495638_0003300 3300046460 Bacteria 12727
858 Ga0495641_0011270 3300046461 Bacteria 5112
859 Ga0495651_0002649 3300046462 Bacteria 13871
860 Ga0495651_0017844 3300046462 Bacteria 5494
861 Ga0495653_0027297 3300046463 Bacteria 4570
862 Ga0495653_0129341 3300046463 Bacteria 1790
863 Ga0495650_0241458 3300046471 Bacteria 617
864 Ga0495580_0000261 3300046472 Bacteria 42129
865 Ga0495580_0033388 3300046472 Bacteria 3709
866 Ga0495580_0348846 3300046472 Bacteria 1003
867 Ga0495582_0078761 3300046473 Bacteria 1828
868 Ga0495582_0657951 3300046473 Bacteria 606
869 Ga0495605_0136661 3300046474 Bacteria 1102
870 Ga0495605_0196966 3300046474 Bacteria 879
871 Ga0495639_0012171 3300046475 Bacteria 3709
872 Ga0495639_0019487 3300046475 Bacteria 2962
873 Ga0495662_0026870 3300046476 Bacteria 2780
874 Ga0495662_0061704 3300046476 Bacteria 1811
875 Ga0495664_0099972 3300046477 Bacteria 1747
876 Ga0495664_0124161 3300046477 Bacteria 1561
877 Ga0495594_0000284 3300046499 Bacteria 24943
878 Ga0495594_0144858 3300046499 Bacteria 1348
879 Ga0495596_0105781 3300046500 Bacteria 1093
880 Ga0495583_0126726 3300046506 Bacteria 1071
881 Ga0495606_0014352 3300046507 Bacteria 6191
882 Ga0495606_0112020 3300046507 Bacteria 1645
883 Ga0495606_0284937 3300046507 Bacteria 901
884 Ga0495608_0009842 3300046511 Bacteria 6672
885 Ga0495610_0076882 3300046512 Bacteria 1543
886 Ga0495616_0168201 3300046513 Bacteria 982
887 Ga0495618_0021240 3300046514 Bacteria 4002
888 Ga0495620_0041665 3300046515 Bacteria 2012
889 Ga0495628_0033573 3300046516 Bacteria 4134
890 Ga0495628_0326223 3300046516 Bacteria 1132
891 Ga0495630_0009739 3300046517 Bacteria 6913
892 Ga0495631_0067298 3300046518 Bacteria 1550
893 Ga0495631_0404203 3300046518 Bacteria 581
894 Ga0495632_0188542 3300046519 Bacteria 942
895 Ga0495643_0022075 3300046522 Bacteria 3638
896 Ga0495648_0298688 3300046524 Bacteria 755
897 Ga0495666_0034048 3300046526 Bacteria 2487
898 Ga0495666_0155359 3300046526 Bacteria 1062
899 Ga0495652_0117980 3300046529 Bacteria 2121
900 Ga0495652_0508205 3300046529 Bacteria 834
901 Ga0495654_0177449 3300046530 Bacteria 925
902 Ga0495654_0373361 3300046530 Bacteria 570
903 Ga0495665_0008036 3300046531 Bacteria 5722
904 Ga0495665_0025604 3300046531 Bacteria 3169
905 Ga0495665_0319665 3300046531 Bacteria 793
906 Ga0495665_0602771 3300046531 Bacteria 549
907 Ga0495640_0024832 3300046533 Bacteria 4354
908 Ga0495640_0027591 3300046533 Bacteria 4093
909 Ga0495586_0608057 3300046535 Bacteria 632
910 Ga0495587_0017270 3300046536 Bacteria 4486
911 Ga0495587_0066722 3300046536 Bacteria 2098
912 Ga0495609_0189078 3300046538 Bacteria 864
913 Ga0495645_0131734 3300046543 Bacteria 1751
914 Ga0495622_0000747 3300046557 Bacteria 18182
915 Ga0495622_0022982 3300046557 Bacteria 2906
916 Ga0495622_0103788 3300046557 Bacteria 1302
917 Ga0495633_0178152 3300046558 Bacteria 979
918 Ga0495667_0009962 3300046559 Bacteria 6437
919 Ga0495667_0085323 3300046559 Bacteria 2049
920 Ga0495667_0383669 3300046559 Bacteria 886
921 Ga0495656_0056585 3300046615 Bacteria 1695
922 Ga0495656_0353838 3300046615 Bacteria 761
923 Ga0495634_0029373 3300046642 Bacteria 3806
924 Ga0495634_0053713 3300046642 Bacteria 2698
925 Ga0495634_0598214 3300046642 Bacteria 640
926 Ga0495634_0628857 3300046642 Bacteria 621
927 Ga0495611_0175257 3300046648 Bacteria 1002
928 Ga0495625_0133608 3300046660 Bacteria 1679
929 Ga0495635_0011899 3300046663 Bacteria 6098
930 Ga0495635_0157775 3300046663 Bacteria 1544
931 Ga0495588_0001508 3300046674 Bacteria 9973
932 Ga0495588_0012476 3300046674 Bacteria 4018
933 Ga0495657_0009271 3300046675 Bacteria 7469
934 Ga0495657_0028992 3300046675 Bacteria 3885
935 Ga0495599_0131157 3300046678 Bacteria 1556
936 Ga0495623_0003419 3300046679 Bacteria 10507
937 Ga0495623_0167521 3300046679 Bacteria 1286
938 Ga0495646_0006337 3300046680 Bacteria 7504
939 Ga0495646_0290397 3300046680 Bacteria 867
940 Ga0495646_0365906 3300046680 Bacteria 753
941 Ga0495647_0197054 3300046681 Bacteria 882
942 Ga0495669_0006057 3300046684 Bacteria 5048
943 Ga0495669_0222864 3300046684 Bacteria 904
944 Ga0495669_0275903 3300046684 Bacteria 808
945 Ga0495613_0009976 3300046689 Bacteria 7056
946 Ga0495613_0020985 3300046689 Bacteria 4869
947 Ga0495613_0116257 3300046689 Bacteria 1924
948 Ga0495624_0109087 3300046690 Bacteria 1702
949 Ga0495624_0141573 3300046690 Bacteria 1473
950 Ga0495624_0175381 3300046690 Bacteria 1307
951 Ga0495670_0235340 3300046691 Bacteria 974
952 Ga0495671_0210415 3300046692 Bacteria 942
953 Ga0495649_0162244 3300046694 Bacteria 1171
954 Ga0495589_0113743 3300046794 Bacteria 1305
955 Ga0495600_0003537 3300046809 Bacteria 9195
956 Ga0495600_0045680 3300046809 Bacteria 2858
957 Ga0495600_0309583 3300046809 Bacteria 995
958 Ga0495660_0158933 3300046810 Bacteria 1110
959 Ga0495581_0000368 3300047315 Bacteria 22619
960 Ga0495581_0020871 3300047315 Bacteria 3801
961 Ga0495581_0075374 3300047315 Bacteria 1952
962 Ga0495581_0238264 3300047315 Bacteria 1064
963 Ga0495604_0002688 3300047317 Bacteria 14257
964 Ga0495604_0003063 3300047317 Bacteria 13358
965 Ga0495674_0012542 3300047319 Bacteria 7983
966 Ga0495674_0039664 3300047319 Bacteria 4219
967 Ga0495674_0331756 3300047319 Bacteria 1237
968 Ga0495674_0387419 3300047319 Bacteria 1130
969 Ga0495676_0013647 3300047321 Bacteria 7291
970 Ga0495676_0033223 3300047321 Bacteria 4348
971 Ga0495676_0128148 3300047321 Bacteria 1836
972 Ga0495680_0001592 3300047322 Bacteria 24241
973 Ga0495680_0033621 3300047322 Bacteria 4149
974 Ga0495683_0088990 3300047323 Bacteria 1498
975 Ga0495687_020883 3300047443 Bacteria 3182
976 Ga0495675_0355771 3300047444 Bacteria 860
977 Ga0495677_0053318 3300047445 Bacteria 1491
978 Ga0495679_070245 3300047446 Bacteria 1010
979 Ga0495673_0027314 3300047469 Bacteria 2718
980 Ga0495684_0003322 3300047471 Bacteria 12621
981 Ga0495684_0275799 3300047471 Bacteria 1215
982 Ga0495686_0045638 3300047472 Bacteria 2772
983 Ga0495686_0055651 3300047472 Bacteria 2473
984 Ga0495686_0350239 3300047472 Bacteria 803
985 Ga0495593_0002554 3300047673 Bacteria 10923
986 Ga0495602_0217160 3300048088 Bacteria 1446
987 Ga0495614_0004726 3300048089 Bacteria 6141
988 Ga0495614_0132890 3300048089 Bacteria 1102
989 Ga0495626_0400195 3300048091 Bacteria 531
990 Ga0496100_0016219 3300048903 Bacteria 4369
991 Ga0496100_0320412 3300048903 Bacteria 1164
992 Ga0496100_0444731 3300048903 Bacteria 993
993 Ga0496100_1020358 3300048903 Bacteria 651
994 Ga0496101_0015897 3300048904 Bacteria 5078
995 Ga0496101_0026707 3300048904 Bacteria 4015
996 Ga0496101_0248359 3300048904 Bacteria 1386
997 Ga0496101_0816414 3300048904 Bacteria 735
998 Ga0496102_0010081 3300048905 Bacteria 8129
999 Ga0496102_0134368 3300048905 Bacteria 2317
1000 Ga0496102_0183628 3300048905 Bacteria 1971
1001 Ga0496102_0908583 3300048905 Bacteria 802
1002 Ga0496102_1439813 3300048905 Bacteria 608
1003 Ga0496103_0021721 3300048906 Bacteria 3862
1004 Ga0496103_0608920 3300048906 Bacteria 695
1005 Ga0496104_0004648 3300048907 Bacteria 11947
1006 Ga0496104_0005053 3300048907 Bacteria 11507
1007 Ga0496104_0026218 3300048907 Bacteria 5378
1008 Ga0496104_0038909 3300048907 Bacteria 4451
1009 Ga0496104_0042550 3300048907 Bacteria 4263
1010 Ga0496104_0102698 3300048907 Bacteria 2738
1011 Ga0496104_0108038 3300048907 Bacteria 2666
1012 Ga0496104_0324293 3300048907 Bacteria 1453
1013 Ga0496104_0598343 3300048907 Bacteria 1013
1014 Ga0496105_0001274 3300048908 Bacteria 17615
1015 Ga0496105_0009624 3300048908 Bacteria 7564
1016 Ga0496105_0015741 3300048908 Bacteria 6035
1017 Ga0496105_0056519 3300048908 Bacteria 3239
1018 Ga0496105_0337044 3300048908 Bacteria 1206
1019 Ga0496106_0002771 3300048909 Bacteria 12986
1020 Ga0496106_0005375 3300048909 Bacteria 9477
1021 Ga0496106_0034118 3300048909 Bacteria 3799
1022 Ga0496106_0334408 3300048909 Bacteria 1216
1023 Ga0496107_0003657 3300048910 Bacteria 10335
1024 Ga0496107_0041511 3300048910 Bacteria 3303
1025 Ga0496107_0045585 3300048910 Bacteria 3155
1026 Ga0496107_0054182 3300048910 Bacteria 2894
1027 Ga0496108_0205237 3300048911 Bacteria 1710
1028 Ga0496108_0260738 3300048911 Bacteria 1508
1029 Ga0496109_0004541 3300048912 Bacteria 11596
1030 Ga0496109_0021306 3300048912 Bacteria 5731
1031 Ga0496109_0129391 3300048912 Bacteria 2356
1032 Ga0496109_0203959 3300048912 Bacteria 1859
1033 Ga0496110_0054167 3300048913 Bacteria 3528
1034 Ga0496110_0059781 3300048913 Bacteria 3360
1035 Ga0496110_0071417 3300048913 Bacteria 3078
1036 Ga0496110_0200072 3300048913 Bacteria 1815
1037 Ga0496111_0015228 3300048914 Bacteria 5273
1038 Ga0496111_0598531 3300048914 Bacteria 807
1039 Ga0496112_0008228 3300048915 Bacteria 9330
1040 Ga0496112_0011780 3300048915 Bacteria 8006
1041 Ga0496112_0093049 3300048915 Bacteria 2984
1042 Ga0496112_0175760 3300048915 Bacteria 2106
1043 Ga0496112_0691036 3300048915 Bacteria 948
1044 Ga0496112_0692481 3300048915 Bacteria 947
1045 Ga0496112_0766181 3300048915 Bacteria 891
1046 Ga0496112_0770462 3300048915 Bacteria 888
1047 Ga0496113_0016555 3300048916 Bacteria 5096
1048 Ga0496113_0035431 3300048916 Bacteria 3649
1049 Ga0496113_1288141 3300048916 Bacteria 569
1050 Ga0496114_0002797 3300048917 Bacteria 13362
1051 Ga0496114_0031727 3300048917 Bacteria 4346
1052 Ga0496114_0039763 3300048917 Bacteria 3892
1053 Ga0496114_0104779 3300048917 Bacteria 2419
1054 Ga0496115_0008294 3300048918 Bacteria 7680
1055 Ga0496115_0056477 3300048918 Bacteria 3155
1056 Ga0496115_0101595 3300048918 Bacteria 2358
1057 Ga0496117_0047639 3300048920 Bacteria 3071
1058 Ga0496117_0467314 3300048920 Bacteria 620
1059 Ga0496118_0003945 3300048921 Bacteria 18140
1060 Ga0496118_0013805 3300048921 Bacteria 7607
1061 Ga0496118_0215472 3300048921 Bacteria 1123
1062 Ga0496118_0352446 3300048921 Bacteria 784
1063 Ga0496119_0035093 3300048922 Bacteria 3291
1064 Ga0496119_0210350 3300048922 Bacteria 1001
1065 Ga0496120_0509034 3300048923 Bacteria 516
1066 Ga0496121_0001276 3300048924 Bacteria 43353
1067 Ga0496121_0013094 3300048924 Bacteria 8953
1068 Ga0496121_0027882 3300048924 Bacteria 5274
1069 Ga0496121_0050417 3300048924 Bacteria 3517
1070 Ga0496121_0051312 3300048924 Bacteria 3475
1071 Ga0496121_0083818 3300048924 Bacteria 2515
1072 Ga0496121_0101077 3300048924 Bacteria 2225
1073 Ga0496121_0110977 3300048924 Bacteria 2092
1074 Ga0496121_0124968 3300048924 Bacteria 1936
1075 Ga0496121_0353228 3300048924 Bacteria 978
1076 Ga0496121_0414292 3300048924 Bacteria 878
1077 Ga0496122_0181486 3300048925 Bacteria 1255
1078 Ga0496124_0002134 3300048927 Bacteria 26572
1079 Ga0496124_0112165 3300048927 Bacteria 2193
1080 Ga0496124_0276745 3300048927 Bacteria 1226
1081 Ga0496125_0025231 3300048928 Bacteria 5449
1082 Ga0496125_0037677 3300048928 Bacteria 4201
1083 Ga0496125_0190064 3300048928 Bacteria 1357
1084 Ga0496126_0011362 3300048929 Bacteria 9230
1085 Ga0496126_0012891 3300048929 Bacteria 8539
1086 Ga0496126_0013093 3300048929 Bacteria 8462
1087 Ga0496126_0029811 3300048929 Bacteria 5179
1088 Ga0496126_0067724 3300048929 Bacteria 3189
1089 Ga0496126_0069802 3300048929 Bacteria 3132
1090 Ga0496126_0091500 3300048929 Bacteria 2674
1091 Ga0496126_0100043 3300048929 Bacteria 2538
1092 Ga0496126_0100224 3300048929 Bacteria 2536
1093 Ga0496126_0135983 3300048929 Bacteria 2120
1094 Ga0496126_0137486 3300048929 Bacteria 2106
1095 Ga0496126_0345989 3300048929 Bacteria 1217
1096 Ga0496126_0475360 3300048929 Bacteria 1002
1097 Ga0496126_0569596 3300048929 Bacteria 896
1098 Ga0496126_0661822 3300048929 Bacteria 816
1099 Ga0495678_179405 3300049459 Bacteria 665
1100 Ga0495682_0084705 3300049460 Bacteria 1139
1101 Ga0501031_0454927 3300049568 Bacteria 827
1102 Ga0501032_0239344 3300049569 Bacteria 1179
1103 Ga0501034_0003588 3300049571 Bacteria 17615
1104 Ga0501036_0004751 3300049572 Bacteria 10966
1105 Ga0501036_0901495 3300049572 Bacteria 726
1106 Ga0501037_0018958 3300049573 Bacteria 5071
1107 Ga0501038_0827655 3300049574 Bacteria 687
1108 Ga0501039_0324632 3300049575 Bacteria 1210
1109 Ga0501039_0328428 3300049575 Bacteria 1202
1110 Ga0501039_0409430 3300049575 Bacteria 1065
1111 Ga0501039_0742493 3300049575 Bacteria 767
1112 Ga0501040_0644236 3300049576 Bacteria 766
1113 Ga0501041_0345755 3300049577 Bacteria 940
1114 Ga0501042_0169984 3300049578 Bacteria 1573
1115 Ga0501042_0983394 3300049578 Bacteria 615
1116 Ga0501043_0075494 3300049579 Bacteria 2647
1117 Ga0501047_0020483 3300049581 Bacteria 6349
1118 Ga0501048_0003860 3300049582 Bacteria 11418
1119 Ga0501070_0017987 3300049586 Bacteria 5931
1120 Ga0501071_0271692 3300049587 Bacteria 1282
1121 Ga0501072_0538532 3300049588 Bacteria 923
1122 Ga0501073_0212651 3300049589 Bacteria 1336
1123 Ga0501073_0650013 3300049589 Bacteria 728
1124 Ga0501074_0001697 3300049590 Bacteria 15002
1125 Ga0501074_0711054 3300049590 Bacteria 709
1126 Ga0501077_0399834 3300049593 Bacteria 878
1127 Ga0501079_0300783 3300049741 Bacteria 1255
1128 Ga0501080_0002496 3300049742 Bacteria 16104
1129 Ga0501080_0034681 3300049742 Bacteria 4712
1130 Ga0501080_0142125 3300049742 Bacteria 2219
1131 Ga0501081_0087063 3300049743 Bacteria 2194
1132 Ga0501083_0007005 3300049744 Bacteria 8002
1133 Ga0501044_0090322 3300049823 Bacteria 3090
1134 Ga0501044_0340448 3300049823 Bacteria 1421
1135 nmdc:mga03683_82299_c1 3300050489 Bacteria 1392
1136 nmdc:mga03n38_112700_c1 3300050490 Bacteria 1327
1137 nmdc:mga03n38_19136_c1 3300050490 Bacteria 2715
1138 nmdc:mga03n38_9425_c1 3300050490 Bacteria 3553
1139 nmdc:mga00v17_101091_c1 3300050491 Bacteria 1820
1140 nmdc:mga00v17_124062_c1 3300050491 Bacteria 1647
1141 nmdc:mga0yw44_165241_c1 3300050492 Bacteria 1451
1142 nmdc:mga0yw44_206342_c1 3300050492 Bacteria 1299
1143 nmdc:mga0yw44_53575_c1 3300050492 Bacteria 2451
1144 nmdc:mga0yw44_70549_c1 3300050492 Bacteria 2166
1145 nmdc:mga0yw44_738623_c1 3300050492 Bacteria 668
1146 nmdc:mga0k408_129854_c1 3300050493 Bacteria 1496
1147 nmdc:mga0k408_213672_c1 3300050493 Bacteria 1152
1148 nmdc:mga0k408_216106_c1 3300050493 Bacteria 1145
1149 nmdc:mga0k408_274258_c1 3300050493 Bacteria 1007
1150 nmdc:mga06z11_101998_c1 3300050494 Bacteria 1576
1151 nmdc:mga06z11_115427_c1 3300050494 Bacteria 1492
1152 nmdc:mga06z11_123511_c1 3300050494 Bacteria 1447
1153 nmdc:mga04h51_39692_c1 3300050495 Bacteria 1530
1154 nmdc:mga07m45_102261_c1 3300050496 Bacteria 1646
1155 nmdc:mga07m45_179015_c1 3300050496 Bacteria 1233
1156 nmdc:mga07m45_205513_c1 3300050496 Bacteria 1146
1157 nmdc:mga07m45_251530_c1 3300050496 Bacteria 1028
1158 nmdc:mga07m45_412426_c1 3300050496 Bacteria 784
1159 nmdc:mga07m45_531111_c1 3300050496 Bacteria 681
1160 nmdc:mga07m45_89977_c1 3300050496 Bacteria 1758
1161 nmdc:mga05p37_474979_c1 3300050507 Bacteria 1442
1162 nmdc:mga05p37_622521_c1 3300050507 Bacteria 1214
1163 nmdc:mga09592_421087_c1 3300050508 Bacteria 1153
1164 nmdc:mga0qj67_68083_c1 3300050509 Bacteria 2837
1165 nmdc:mga08y16_511535_c1 3300050511 Bacteria 1219
1166 nmdc:mga0n895_174471_c1 3300050512 Bacteria 2181
1167 nmdc:mga08x19_160725_c1 3300050514 Bacteria 1525
1168 nmdc:mga0sz30_132270_c1 3300050516 Bacteria 1100
1169 nmdc:mga0sz30_195165_c1 3300050516 Bacteria 899
1170 nmdc:mga0sz30_223271_c1 3300050516 Bacteria 838
1171 nmdc:mga0sz30_230778_c1 3300050516 Bacteria 823
1172 Ga0495601_0001907 3300053077 Bacteria 11671
1173 Ga0495601_0004725 3300053077 Bacteria 7896
1174 Ga0495601_0007199 3300053077 Bacteria 6527
1175 Ga0495601_0097696 3300053077 Bacteria 1895
1176 Ga0495601_0154563 3300053077 Bacteria 1498
1177 Ga0495601_0253112 3300053077 Bacteria 1150
1178 Ga0495612_0038753 3300053078 Bacteria 1937
1179 Ga0495612_0070359 3300053078 Bacteria 1458
1180 Ga0500610_0121034 3300053079 Bacteria 1338
1181 Ga0500635_0008869 3300053080 Bacteria 2772
1182 Ga0500635_0016667 3300053080 Bacteria 2189
1183 Ga0500635_0207927 3300053080 Bacteria 762
1184 Ga0495655_0232282 3300053083 Bacteria 614
1185 Ga0495595_0014577 3300053084 Bacteria 3339
1186 Ga0495595_0042157 3300053084 Bacteria 2091
1187 Ga0495595_0114625 3300053084 Bacteria 1309
1188 Ga0495619_0020759 3300053085 Bacteria 4189
1189 Ga0495619_0041314 3300053085 Bacteria 3016
1190 Ga0495619_0095556 3300053085 Bacteria 2016
1191 Ga0495619_0106544 3300053085 Bacteria 1912
1192 Ga0500643_000057 3300053087 Bacteria 131401
1193 Ga0500643_037143 3300053087 Bacteria 1452
1194 Ga0500581_136541 3300053089 Bacteria 1167
1195 Ga0500647_0023284 3300053091 Bacteria 2904
1196 Ga0500583_0522955 3300053092 Bacteria 554
1197 Ga0500651_0015044 3300053093 Bacteria 4744
1198 Ga0500651_0332479 3300053093 Bacteria 865
1199 Ga0500566_0000782 3300053094 Bacteria 18024
1200 Ga0500566_0013301 3300053094 Bacteria 4845
1201 Ga0500566_0069359 3300053094 Bacteria 1981
1202 Ga0500566_0128497 3300053094 Bacteria 1359
1203 Ga0500640_000202 3300053095 Bacteria 12821
1204 Ga0500641_0009460 3300053096 Bacteria 3506
1205 Ga0500554_002164 3300053102 Bacteria 3819
1206 Ga0500554_136372 3300053102 Bacteria 829
1207 Ga0500555_007068 3300053103 Bacteria 3191
1208 Ga0500557_000166 3300053105 Bacteria 14367
1209 Ga0500562_005331 3300053108 Bacteria 3228
1210 Ga0500569_138904 3300053109 Bacteria 816
1211 Ga0500572_000491 3300053111 Bacteria 13611
1212 Ga0500572_000589 3300053111 Bacteria 12248
1213 Ga0500572_169376 3300053111 Bacteria 715
1214 Ga0500582_017624 3300053114 Bacteria 1958
1215 Ga0500592_009627 3300053116 Bacteria 1537
1216 Ga0500595_000941 3300053119 Bacteria 16447
1217 Ga0500595_006374 3300053119 Bacteria 5012
1218 Ga0500595_007766 3300053119 Bacteria 4429
1219 Ga0500595_010224 3300053119 Bacteria 3738
1220 Ga0500607_037062 3300053121 Bacteria 2659
1221 Ga0500608_004402 3300053122 Bacteria 5450
1222 Ga0500608_124583 3300053122 Bacteria 1163
1223 Ga0500614_000997 3300053123 Bacteria 7029
1224 Ga0500618_019597 3300053125 Bacteria 1663
1225 Ga0500642_0000339 3300053130 Bacteria 15985
1226 Ga0500642_0009945 3300053130 Bacteria 3330
1227 Ga0500655_006563 3300053133 Bacteria 2094
1228 Ga0500655_038742 3300053133 Bacteria 932
1229 Ga0500559_0000685 3300053136 Bacteria 22515
1230 Ga0500559_0004967 3300053136 Bacteria 6182
1231 Ga0500564_049917 3300053138 Bacteria 1915
1232 Ga0500568_0002843 3300053139 Bacteria 9980
1233 Ga0500577_0022124 3300053142 Bacteria 2105
1234 Ga0500577_0167513 3300053142 Bacteria 938
1235 Ga0500585_051361 3300053144 Bacteria 1473
1236 Ga0500585_184063 3300053144 Bacteria 707
1237 Ga0500590_019293 3300053148 Bacteria 3533
1238 Ga0500603_000410 3300053150 Bacteria 11214
1239 Ga0500603_001295 3300053150 Bacteria 5753
1240 Ga0500604_0052467 3300053151 Bacteria 1262
1241 Ga0500616_0022650 3300053153 Bacteria 3505
1242 Ga0500619_022091 3300053154 Bacteria 1842
1243 Ga0500619_145257 3300053154 Bacteria 808
1244 Ga0500622_0137036 3300053156 Bacteria 1171
1245 Ga0500622_0219357 3300053156 Bacteria 853
1246 Ga0500627_0035720 3300053158 Bacteria 2112
1247 Ga0500630_004401 3300053159 Bacteria 6860
1248 Ga0500633_0084953 3300053160 Bacteria 1150
1249 Ga0500633_0145162 3300053160 Bacteria 889
1250 Ga0500634_0080110 3300053161 Bacteria 1685
1251 Ga0500638_000054 3300053162 Bacteria 23606
1252 Ga0500638_006087 3300053162 Bacteria 4896
1253 Ga0500638_039905 3300053162 Bacteria 2279
1254 Ga0500638_153202 3300053162 Bacteria 1023
1255 Ga0500639_000014 3300053163 Bacteria 122926
1256 Ga0500639_019925 3300053163 Bacteria 3536
1257 Ga0500636_0009861 3300053177 Bacteria 5560
1258 Ga0500636_0242554 3300053177 Bacteria 924
1259 Ga0500636_0334024 3300053177 Bacteria 731
1260 Ga0500637_0000775 3300053178 Bacteria 12832
1261 Ga0500637_0359574 3300053178 Bacteria 771
1262 Ga0500576_118601 3300053725 Bacteria 1047
1263 Ga0500657_060034 3300053728 Bacteria 1703
1264 Ga0500625_000205 3300053729 Bacteria 13352
1265 Ga0500625_200884 3300053729 Bacteria 667
1266 Ga0500645_041952 3300053730 Bacteria 1350
1267 Ga0500552_001084 3300053733 Bacteria 2571
1268 Ga0500596_000125 3300053735 Bacteria 11135
1269 Ga0500596_001106 3300053735 Bacteria 5421
1270 Ga0500596_003950 3300053735 Bacteria 2767
1271 Ga0500599_001758 3300053736 Bacteria 2533
1272 Ga0500601_000513 3300053737 Bacteria 5941
1273 Ga0501084_0446612 3300054114 Bacteria 1093
1274 Ga0501084_0578713 3300054114 Bacteria 949
1275 Ga0501084_1243030 3300054114 Bacteria 625
1276 Ga0587084_030140 3300059477 Bacteria 869
1277 Ga0587070_050959 3300059491 Bacteria 826
1278 Ga0587077_138695 3300059493 Bacteria 624
1279 Ga0587085_036960 3300059506 Bacteria 832
1280 Ga0587106_111468 3300059605 Bacteria 570
1281 Ga0587099_035001 3300059622 Bacteria 624
1282 Ga0587115_070856 3300059626 Bacteria 602
1283 Ga0587067_146027 3300059640 Bacteria 590
1284 Ga0587069_107743 3300059642 Bacteria 577
1285 Ga0587071_148886 3300060344 Bacteria 581
1286 Ga0501082_0293842 3300060353 Bacteria 1415
1287 Ga0501082_1140868 3300060353 Bacteria 681
1288 Ga0530510_0289353 3300061734 Bacteria 1225
1289 Ga0530510_0743946 3300061734 Bacteria 748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100321609 Ga0070680_1003216092 160
2 3300005347 Ga0070668_100271325 Ga0070668_1002713251 160
3 3300005367 Ga0070667_100593794 Ga0070667_1005937942 160
4 3300005458 Ga0070681_10222869 Ga0070681_102228693 160
5 3300005471 Ga0070698_100066177 Ga0070698_1000661773 160
6 3300005518 Ga0070699_100002202 Ga0070699_10000220216 160
7 3300005530 Ga0070679_100155309 Ga0070679_1001553093 160
8 3300005563 Ga0068855_100265428 Ga0068855_1002654284 160
9 3300005719 Ga0068861_100886633 Ga0068861_1008866332 160
10 3300005719 Ga0068861_101145498 Ga0068861_1011454982 160
11 3300006028 Ga0070717_10023292 Ga0070717_100232922 160
12 3300006042 Ga0075368_10088245 Ga0075368_100882452 160
13 3300006177 Ga0075362_10091350 Ga0075362_100913502 160
14 3300006353 Ga0075370_10351361 Ga0075370_103513611 160
15 3300006914 Ga0075436_100494498 Ga0075436_1004944981 160
16 3300009148 Ga0105243_11297237 Ga0105243_112972371 160
17 3300009148 Ga0105243_11479152 Ga0105243_114791521 160
18 3300009545 Ga0105237_10826448 Ga0105237_108264481 160
19 3300011119 Ga0105246_11506098 Ga0105246_115060981 160
20 3300025924 Ga0207694_10424139 Ga0207694_104241392 160
21 3300026088 Ga0207641_10315477 Ga0207641_103154772 160
22 3300039450 Ga0436363_0914045 Ga0436363_0914045_29_556 160
23 3300047319 Ga0495674_0039664 Ga0495674_0039664_2026_2598 160
24 3300048921 Ga0496118_0215472 Ga0496118_0215472_356_859 160
25 3300049572 Ga0501036_0901495 Ga0501036_0901495_12_497 160
26 3300049575 Ga0501039_0409430 Ga0501039_0409430_476_961 160
27 3300049575 Ga0501039_0742493 Ga0501039_0742493_98_583 160
28 3300049576 Ga0501040_0644236 Ga0501040_0644236_21_506 160
29 3300049577 Ga0501041_0345755 Ga0501041_0345755_300_800 160
30 3300049588 Ga0501072_0538532 Ga0501072_0538532_149_634 160
31 3300049741 Ga0501079_0300783 Ga0501079_0300783_289_849 160
32 3300050516 nmdc:mga0sz30_230778_c1 nmdc:mga0sz30_230778_c1_218_733 160
33 3300061734 Ga0530510_0743946 Ga0530510_0743946_26_511 160
34 3300002070 JGI24750J21931_1033713 JGI24750J21931_10337131 161
35 3300002070 JGI24750J21931_1058225 JGI24750J21931_10582251 161
36 3300002077 JGI24744J21845_10093490 JGI24744J21845_100934901 161
37 3300002244 JGI24742J22300_10048405 JGI24742J22300_100484052 161
38 3300003659 JGI25404J52841_10012459 JGI25404J52841_100124591 161
39 3300003659 JGI25404J52841_10017379 JGI25404J52841_100173792 161
40 3300003752 Ga0055539_1008167 Ga0055539_10081672 161
41 3300003763 Ga0055529_1019281 Ga0055529_10192811 161
42 3300004800 Ga0058861_11722842 Ga0058861_117228421 161
43 3300005293 Ga0065715_10347024 Ga0065715_103470242 161
44 3300005329 Ga0070683_100020536 Ga0070683_1000205362 161
45 3300005329 Ga0070683_100037099 Ga0070683_1000370997 161
46 3300005330 Ga0070690_100163112 Ga0070690_1001631121 161
47 3300005330 Ga0070690_100586341 Ga0070690_1005863411 161
48 3300005334 Ga0068869_100227656 Ga0068869_1002276563 161
49 3300005334 Ga0068869_100476503 Ga0068869_1004765032 161
50 3300005335 Ga0070666_10055910 Ga0070666_100559101 161
51 3300005336 Ga0070680_100149075 Ga0070680_1001490751 161
52 3300005336 Ga0070680_100271572 Ga0070680_1002715722 161
53 3300005339 Ga0070660_100830413 Ga0070660_1008304131 161
54 3300005345 Ga0070692_10224600 Ga0070692_102246001 161
55 3300005347 Ga0070668_100103768 Ga0070668_1001037682 161
56 3300005347 Ga0070668_100170575 Ga0070668_1001705753 161
57 3300005347 Ga0070668_100416686 Ga0070668_1004166862 161
58 3300005353 Ga0070669_100407461 Ga0070669_1004074612 161
59 3300005353 Ga0070669_100438594 Ga0070669_1004385941 161
60 3300005353 Ga0070669_101025567 Ga0070669_1010255671 161
61 3300005354 Ga0070675_100963929 Ga0070675_1009639291 161
62 3300005355 Ga0070671_100267608 Ga0070671_1002676082 161
63 3300005356 Ga0070674_100660203 Ga0070674_1006602031 161
64 3300005356 Ga0070674_101694092 Ga0070674_1016940921 161
65 3300005364 Ga0070673_100041021 Ga0070673_1000410215 161
66 3300005367 Ga0070667_100080227 Ga0070667_1000802273 161
67 3300005367 Ga0070667_100151812 Ga0070667_1001518123 161
68 3300005367 Ga0070667_100797734 Ga0070667_1007977342 161
69 3300005367 Ga0070667_100857454 Ga0070667_1008574542 161
70 3300005434 Ga0070709_10008945 Ga0070709_100089452 161
71 3300005434 Ga0070709_10013521 Ga0070709_100135212 161
72 3300005435 Ga0070714_100143060 Ga0070714_1001430604 161
73 3300005435 Ga0070714_100431403 Ga0070714_1004314031 161
74 3300005435 Ga0070714_100854158 Ga0070714_1008541581 161
75 3300005435 Ga0070714_101144525 Ga0070714_1011445251 161
76 3300005436 Ga0070713_100041543 Ga0070713_1000415431 161
77 3300005436 Ga0070713_100072309 Ga0070713_1000723092 161
78 3300005437 Ga0070710_10000417 Ga0070710_1000041714 161
79 3300005437 Ga0070710_10001492 Ga0070710_100014921 161
80 3300005438 Ga0070701_10059454 Ga0070701_100594543 161
81 3300005438 Ga0070701_10252452 Ga0070701_102524521 161
82 3300005439 Ga0070711_100015591 Ga0070711_1000155915 161
83 3300005439 Ga0070711_100035694 Ga0070711_1000356945 161
84 3300005441 Ga0070700_100161341 Ga0070700_1001613412 161
85 3300005441 Ga0070700_100636210 Ga0070700_1006362102 161
86 3300005444 Ga0070694_100220377 Ga0070694_1002203773 161
87 3300005455 Ga0070663_100030355 Ga0070663_1000303553 161
88 3300005455 Ga0070663_100032319 Ga0070663_1000323191 161
89 3300005455 Ga0070663_100173352 Ga0070663_1001733523 161
90 3300005455 Ga0070663_100260090 Ga0070663_1002600902 161
91 3300005455 Ga0070663_101034190 Ga0070663_1010341901 161
92 3300005456 Ga0070678_100243174 Ga0070678_1002431743 161
93 3300005456 Ga0070678_100262735 Ga0070678_1002627352 161
94 3300005456 Ga0070678_100295614 Ga0070678_1002956142 161
95 3300005456 Ga0070678_100353203 Ga0070678_1003532032 161
96 3300005456 Ga0070678_100577948 Ga0070678_1005779482 161
97 3300005457 Ga0070662_100046557 Ga0070662_1000465572 161
98 3300005457 Ga0070662_100832107 Ga0070662_1008321071 161
99 3300005458 Ga0070681_10042387 Ga0070681_100423873 161
100 3300005458 Ga0070681_10170876 Ga0070681_101708764 161
101 3300005459 Ga0068867_100189445 Ga0068867_1001894451 161
102 3300005466 Ga0070685_10248771 Ga0070685_102487711 161
103 3300005466 Ga0070685_10447051 Ga0070685_104470511 161
104 3300005466 Ga0070685_10579612 Ga0070685_105796121 161
105 3300005467 Ga0070706_100164814 Ga0070706_1001648141 161
106 3300005467 Ga0070706_100345420 Ga0070706_1003454201 161
107 3300005467 Ga0070706_100426768 Ga0070706_1004267681 161
108 3300005471 Ga0070698_100075398 Ga0070698_1000753983 161
109 3300005471 Ga0070698_100536799 Ga0070698_1005367992 161
110 3300005518 Ga0070699_101070924 Ga0070699_1010709241 161
111 3300005530 Ga0070679_100049981 Ga0070679_1000499813 161
112 3300005530 Ga0070679_100052225 Ga0070679_1000522257 161
113 3300005530 Ga0070679_100234569 Ga0070679_1002345691 161
114 3300005530 Ga0070679_100324814 Ga0070679_1003248141 161
115 3300005530 Ga0070679_100464047 Ga0070679_1004640471 161
116 3300005530 Ga0070679_101241476 Ga0070679_1012414761 161
117 3300005535 Ga0070684_100007976 Ga0070684_10000797610 161
118 3300005535 Ga0070684_100687489 Ga0070684_1006874892 161
119 3300005539 Ga0068853_100057591 Ga0068853_1000575915 161
120 3300005539 Ga0068853_100232537 Ga0068853_1002325372 161
121 3300005539 Ga0068853_100798726 Ga0068853_1007987262 161
122 3300005539 Ga0068853_101099154 Ga0068853_1010991542 161
123 3300005543 Ga0070672_100127896 Ga0070672_1001278963 161
124 3300005544 Ga0070686_100014022 Ga0070686_1000140224 161
125 3300005547 Ga0070693_100047860 Ga0070693_1000478603 161
126 3300005547 Ga0070693_100130209 Ga0070693_1001302092 161
127 3300005548 Ga0070665_100018194 Ga0070665_1000181949 161
128 3300005548 Ga0070665_100050420 Ga0070665_1000504205 161
129 3300005548 Ga0070665_100121319 Ga0070665_1001213195 161
130 3300005548 Ga0070665_100155157 Ga0070665_1001551571 161
131 3300005548 Ga0070665_100172127 Ga0070665_1001721271 161
132 3300005548 Ga0070665_100552691 Ga0070665_1005526912 161
133 3300005549 Ga0070704_100262773 Ga0070704_1002627732 161
134 3300005563 Ga0068855_100034049 Ga0068855_1000340498 161
135 3300005564 Ga0070664_100311921 Ga0070664_1003119213 161
136 3300005564 Ga0070664_100730249 Ga0070664_1007302491 161
137 3300005564 Ga0070664_100794547 Ga0070664_1007945472 161
138 3300005577 Ga0068857_100063620 Ga0068857_1000636206 161
139 3300005577 Ga0068857_100077936 Ga0068857_1000779365 161
140 3300005577 Ga0068857_101506179 Ga0068857_1015061791 161
141 3300005578 Ga0068854_100067757 Ga0068854_1000677572 161
142 3300005614 Ga0068856_100579133 Ga0068856_1005791333 161
143 3300005615 Ga0070702_100022746 Ga0070702_1000227464 161
144 3300005616 Ga0068852_100267549 Ga0068852_1002675492 161
145 3300005616 Ga0068852_100373699 Ga0068852_1003736992 161
146 3300005616 Ga0068852_100678265 Ga0068852_1006782652 161
147 3300005616 Ga0068852_100836352 Ga0068852_1008363521 161
148 3300005616 Ga0068852_101034107 Ga0068852_1010341072 161
149 3300005617 Ga0068859_100151021 Ga0068859_1001510213 161
150 3300005618 Ga0068864_100012746 Ga0068864_10001274611 161
151 3300005618 Ga0068864_101771802 Ga0068864_1017718021 161
152 3300005718 Ga0068866_10465704 Ga0068866_104657041 161
153 3300005718 Ga0068866_11093538 Ga0068866_110935381 161
154 3300005719 Ga0068861_100170911 Ga0068861_1001709112 161
155 3300005719 Ga0068861_100336064 Ga0068861_1003360642 161
156 3300005719 Ga0068861_100599818 Ga0068861_1005998182 161
157 3300005840 Ga0068870_10039904 Ga0068870_100399043 161
158 3300005840 Ga0068870_10085321 Ga0068870_100853212 161
159 3300005840 Ga0068870_10313104 Ga0068870_103131041 161
160 3300005841 Ga0068863_101140189 Ga0068863_1011401891 161
161 3300005842 Ga0068858_100173930 Ga0068858_1001739303 161
162 3300005842 Ga0068858_100255396 Ga0068858_1002553961 161
163 3300005842 Ga0068858_100555269 Ga0068858_1005552692 161
164 3300005843 Ga0068860_100004852 Ga0068860_10000485213 161
165 3300005843 Ga0068860_100049838 Ga0068860_1000498387 161
166 3300005844 Ga0068862_100022728 Ga0068862_1000227286 161
167 3300005844 Ga0068862_100084017 Ga0068862_1000840172 161
168 3300005844 Ga0068862_100107550 Ga0068862_1001075504 161
169 3300005937 Ga0081455_10423265 Ga0081455_104232652 161
170 3300005981 Ga0081538_10039714 Ga0081538_100397142 161
171 3300005983 Ga0081540_1003813 Ga0081540_100381313 161
172 3300005983 Ga0081540_1008010 Ga0081540_100801010 161
173 3300005983 Ga0081540_1029677 Ga0081540_10296773 161
174 3300005983 Ga0081540_1114196 Ga0081540_11141961 161
175 3300006028 Ga0070717_10019823 Ga0070717_100198237 161
176 3300006028 Ga0070717_10055976 Ga0070717_100559761 161
177 3300006028 Ga0070717_10225669 Ga0070717_102256691 161
178 3300006028 Ga0070717_10308958 Ga0070717_103089581 161
179 3300006028 Ga0070717_11123073 Ga0070717_111230731 161
180 3300006038 Ga0075365_10053752 Ga0075365_100537524 161
181 3300006038 Ga0075365_10064660 Ga0075365_100646602 161
182 3300006038 Ga0075365_10201427 Ga0075365_102014271 161
183 3300006038 Ga0075365_10347864 Ga0075365_103478642 161
184 3300006038 Ga0075365_10567617 Ga0075365_105676171 161
185 3300006042 Ga0075368_10096868 Ga0075368_100968683 161
186 3300006042 Ga0075368_10106919 Ga0075368_101069192 161
187 3300006048 Ga0075363_100007214 Ga0075363_1000072147 161
188 3300006048 Ga0075363_100016054 Ga0075363_1000160544 161
189 3300006048 Ga0075363_100026718 Ga0075363_1000267185 161
190 3300006051 Ga0075364_10249753 Ga0075364_102497533 161
191 3300006051 Ga0075364_10386584 Ga0075364_103865842 161
192 3300006058 Ga0075432_10085523 Ga0075432_100855232 161
193 3300006058 Ga0075432_10090801 Ga0075432_100908011 161
194 3300006163 Ga0070715_10039691 Ga0070715_100396912 161
195 3300006173 Ga0070716_100004688 Ga0070716_1000046887 161
196 3300006173 Ga0070716_100273694 Ga0070716_1002736941 161
197 3300006173 Ga0070716_100441086 Ga0070716_1004410861 161
198 3300006175 Ga0070712_100006062 Ga0070712_1000060629 161
199 3300006175 Ga0070712_100277090 Ga0070712_1002770903 161
200 3300006178 Ga0075367_10015462 Ga0075367_100154621 161
201 3300006178 Ga0075367_10042053 Ga0075367_100420531 161
202 3300006178 Ga0075367_10098545 Ga0075367_100985453 161
203 3300006178 Ga0075367_10414252 Ga0075367_104142522 161
204 3300006178 Ga0075367_10590870 Ga0075367_105908701 161
205 3300006186 Ga0075369_10137562 Ga0075369_101375621 161
206 3300006186 Ga0075369_10139849 Ga0075369_101398491 161
207 3300006195 Ga0075366_10399750 Ga0075366_103997502 161
208 3300006237 Ga0097621_101324606 Ga0097621_1013246062 161
209 3300006353 Ga0075370_10085553 Ga0075370_100855532 161
210 3300006353 Ga0075370_10105997 Ga0075370_101059973 161
211 3300006353 Ga0075370_10384892 Ga0075370_103848921 161
212 3300006358 Ga0068871_100542323 Ga0068871_1005423232 161
213 3300006358 Ga0068871_100793371 Ga0068871_1007933712 161
214 3300006844 Ga0075428_100169960 Ga0075428_1001699603 161
215 3300006844 Ga0075428_100304419 Ga0075428_1003044192 161
216 3300006847 Ga0075431_100162195 Ga0075431_1001621953 161
217 3300006847 Ga0075431_100470328 Ga0075431_1004703283 161
218 3300006881 Ga0068865_100335948 Ga0068865_1003359482 161
219 3300006881 Ga0068865_100814137 Ga0068865_1008141371 161
220 3300006931 Ga0097620_100151018 Ga0097620_1001510183 161
221 3300007265 Ga0099794_10088487 Ga0099794_100884873 161
222 3300007788 Ga0099795_10030769 Ga0099795_100307692 161
223 3300009092 Ga0105250_10216515 Ga0105250_102165151 161
224 3300009094 Ga0111539_10255977 Ga0111539_102559775 161
225 3300009094 Ga0111539_11341686 Ga0111539_113416862 161
226 3300009098 Ga0105245_10329073 Ga0105245_103290733 161
227 3300009101 Ga0105247_10036878 Ga0105247_100368782 161
228 3300009101 Ga0105247_10050804 Ga0105247_100508041 161
229 3300009101 Ga0105247_10327780 Ga0105247_103277802 161
230 3300009101 Ga0105247_10407371 Ga0105247_104073711 161
231 3300009101 Ga0105247_10635276 Ga0105247_106352761 161
232 3300009147 Ga0114129_10083313 Ga0114129_100833138 161
233 3300009148 Ga0105243_10078293 Ga0105243_100782933 161
234 3300009148 Ga0105243_10631919 Ga0105243_106319192 161
235 3300009174 Ga0105241_10412031 Ga0105241_104120312 161
236 3300009176 Ga0105242_10234784 Ga0105242_102347841 161
237 3300009177 Ga0105248_10458682 Ga0105248_104586822 161
238 3300009545 Ga0105237_10013746 Ga0105237_1001374611 161
239 3300009545 Ga0105237_10064660 Ga0105237_100646607 161
240 3300009545 Ga0105237_10067924 Ga0105237_100679246 161
241 3300009545 Ga0105237_10230976 Ga0105237_102309762 161
242 3300009551 Ga0105238_10054537 Ga0105238_100545376 161
243 3300009551 Ga0105238_10096074 Ga0105238_100960743 161
244 3300009551 Ga0105238_10130906 Ga0105238_101309065 161
245 3300009551 Ga0105238_10315214 Ga0105238_103152142 161
246 3300009551 Ga0105238_10725723 Ga0105238_107257232 161
247 3300009553 Ga0105249_10143590 Ga0105249_101435903 161
248 3300009553 Ga0105249_10536720 Ga0105249_105367202 161
249 3300010375 Ga0105239_10021794 Ga0105239_100217942 161
250 3300010375 Ga0105239_10022601 Ga0105239_100226017 161
251 3300010375 Ga0105239_10688990 Ga0105239_106889902 161
252 3300010375 Ga0105239_10726438 Ga0105239_107264381 161
253 3300010375 Ga0105239_11074281 Ga0105239_110742811 161
254 3300010375 Ga0105239_11150125 Ga0105239_111501251 161
255 3300011119 Ga0105246_10059706 Ga0105246_100597065 161
256 3300013100 Ga0157373_10708077 Ga0157373_107080771 161
257 3300013102 Ga0157371_10786705 Ga0157371_107867051 161
258 3300013104 Ga0157370_10243254 Ga0157370_102432543 161
259 3300013104 Ga0157370_10249396 Ga0157370_102493962 161
260 3300013105 Ga0157369_10034502 Ga0157369_100345023 161
261 3300013296 Ga0157374_10202003 Ga0157374_102020031 161
262 3300013297 Ga0157378_10045009 Ga0157378_100450096 161
263 3300013297 Ga0157378_10340673 Ga0157378_103406732 161
264 3300013297 Ga0157378_10381656 Ga0157378_103816563 161
265 3300013306 Ga0163162_10400455 Ga0163162_104004551 161
266 3300013306 Ga0163162_10591094 Ga0163162_105910942 161
267 3300013307 Ga0157372_10176783 Ga0157372_101767835 161
268 3300013308 Ga0157375_10763161 Ga0157375_107631612 161
269 3300014325 Ga0163163_10675613 Ga0163163_106756132 161
270 3300014326 Ga0157380_10292763 Ga0157380_102927633 161
271 3300014326 Ga0157380_10336143 Ga0157380_103361432 161
272 3300014326 Ga0157380_10599357 Ga0157380_105993572 161
273 3300014326 Ga0157380_10807635 Ga0157380_108076352 161
274 3300014969 Ga0157376_11699122 Ga0157376_116991221 161
275 3300017792 Ga0163161_10525797 Ga0163161_105257972 161
276 3300017792 Ga0163161_10951154 Ga0163161_109511541 161
277 3300020069 Ga0197907_10446942 Ga0197907_104469421 161
278 3300020078 Ga0206352_11046103 Ga0206352_110461031 161
279 3300021358 Ga0213873_10019785 Ga0213873_100197852 161
280 3300021384 Ga0213876_10433693 Ga0213876_104336931 161
281 3300022467 Ga0224712_10147305 Ga0224712_101473051 161
282 3300025253 Ga0209677_101355 Ga0209677_10135516 161
283 3300025261 Ga0209233_1000985 Ga0209233_10009857 161
284 3300025272 Ga0209455_1001420 Ga0209455_10014203 161
285 3300025272 Ga0209455_1009019 Ga0209455_10090192 161
286 3300025297 Ga0209758_1028711 Ga0209758_10287112 161
287 3300025297 Ga0209758_1047293 Ga0209758_10472933 161
288 3300025315 Ga0207697_10103745 Ga0207697_101037452 161
289 3300025893 Ga0207682_10113093 Ga0207682_101130931 161
290 3300025898 Ga0207692_10003364 Ga0207692_100033646 161
291 3300025898 Ga0207692_10071779 Ga0207692_100717792 161
292 3300025898 Ga0207692_10395923 Ga0207692_103959231 161
293 3300025900 Ga0207710_10075792 Ga0207710_100757922 161
294 3300025901 Ga0207688_10089210 Ga0207688_100892102 161
295 3300025901 Ga0207688_10089241 Ga0207688_100892413 161
296 3300025901 Ga0207688_10572607 Ga0207688_105726071 161
297 3300025903 Ga0207680_10032128 Ga0207680_100321285 161
298 3300025904 Ga0207647_10459310 Ga0207647_104593102 161
299 3300025905 Ga0207685_10074739 Ga0207685_100747392 161
300 3300025906 Ga0207699_10000473 Ga0207699_100004737 161
301 3300025906 Ga0207699_10121539 Ga0207699_101215392 161
302 3300025907 Ga0207645_10718127 Ga0207645_107181271 161
303 3300025908 Ga0207643_10033091 Ga0207643_100330913 161
304 3300025908 Ga0207643_10683462 Ga0207643_106834621 161
305 3300025910 Ga0207684_10129852 Ga0207684_101298524 161
306 3300025910 Ga0207684_10149107 Ga0207684_101491072 161
307 3300025911 Ga0207654_10656938 Ga0207654_106569381 161
308 3300025912 Ga0207707_10005928 Ga0207707_100059284 161
309 3300025912 Ga0207707_10398285 Ga0207707_103982851 161
310 3300025914 Ga0207671_10027280 Ga0207671_100272801 161
311 3300025914 Ga0207671_10156859 Ga0207671_101568591 161
312 3300025914 Ga0207671_10222990 Ga0207671_102229903 161
313 3300025914 Ga0207671_10246630 Ga0207671_102466302 161
314 3300025914 Ga0207671_10247594 Ga0207671_102475942 161
315 3300025915 Ga0207693_10006327 Ga0207693_1000632714 161
316 3300025915 Ga0207693_10030096 Ga0207693_100300962 161
317 3300025915 Ga0207693_10069142 Ga0207693_100691426 161
318 3300025916 Ga0207663_10030431 Ga0207663_100304313 161
319 3300025916 Ga0207663_10043308 Ga0207663_100433084 161
320 3300025918 Ga0207662_10070034 Ga0207662_100700342 161
321 3300025921 Ga0207652_11084181 Ga0207652_110841811 161
322 3300025921 Ga0207652_11219921 Ga0207652_112199211 161
323 3300025921 Ga0207652_11341665 Ga0207652_113416651 161
324 3300025923 Ga0207681_10589821 Ga0207681_105898212 161
325 3300025924 Ga0207694_10102308 Ga0207694_101023082 161
326 3300025924 Ga0207694_10411834 Ga0207694_104118342 161
327 3300025924 Ga0207694_10798445 Ga0207694_107984451 161
328 3300025926 Ga0207659_11280220 Ga0207659_112802201 161
329 3300025927 Ga0207687_10345988 Ga0207687_103459882 161
330 3300025928 Ga0207700_10005697 Ga0207700_100056977 161
331 3300025928 Ga0207700_10012732 Ga0207700_100127325 161
332 3300025928 Ga0207700_10029241 Ga0207700_100292415 161
333 3300025929 Ga0207664_10400900 Ga0207664_104009001 161
334 3300025929 Ga0207664_10533297 Ga0207664_105332972 161
335 3300025929 Ga0207664_10742397 Ga0207664_107423971 161
336 3300025933 Ga0207706_10080045 Ga0207706_100800455 161
337 3300025933 Ga0207706_10597116 Ga0207706_105971162 161
338 3300025934 Ga0207686_10089819 Ga0207686_100898193 161
339 3300025934 Ga0207686_10587154 Ga0207686_105871542 161
340 3300025935 Ga0207709_10724362 Ga0207709_107243622 161
341 3300025936 Ga0207670_10570752 Ga0207670_105707522 161
342 3300025938 Ga0207704_10153434 Ga0207704_101534342 161
343 3300025938 Ga0207704_10350831 Ga0207704_103508312 161
344 3300025940 Ga0207691_10553016 Ga0207691_105530162 161
345 3300025940 Ga0207691_10960546 Ga0207691_109605461 161
346 3300025941 Ga0207711_10124863 Ga0207711_101248633 161
347 3300025944 Ga0207661_10013913 Ga0207661_100139132 161
348 3300025944 Ga0207661_10030242 Ga0207661_100302427 161
349 3300025945 Ga0207679_10837688 Ga0207679_108376881 161
350 3300025949 Ga0207667_10041143 Ga0207667_100411436 161
351 3300025949 Ga0207667_10683171 Ga0207667_106831711 161
352 3300025961 Ga0207712_10019324 Ga0207712_100193243 161
353 3300025961 Ga0207712_10345339 Ga0207712_103453392 161
354 3300025972 Ga0207668_10022383 Ga0207668_100223831 161
355 3300025972 Ga0207668_10028830 Ga0207668_100288306 161
356 3300025972 Ga0207668_10168221 Ga0207668_101682213 161
357 3300025981 Ga0207640_10862722 Ga0207640_108627221 161
358 3300025986 Ga0207658_10345592 Ga0207658_103455921 161
359 3300025986 Ga0207658_11038046 Ga0207658_110380461 161
360 3300026023 Ga0207677_10818622 Ga0207677_108186221 161
361 3300026035 Ga0207703_10009809 Ga0207703_100098097 161
362 3300026035 Ga0207703_10130141 Ga0207703_101301413 161
363 3300026035 Ga0207703_10551496 Ga0207703_105514961 161
364 3300026041 Ga0207639_10134516 Ga0207639_101345162 161
365 3300026041 Ga0207639_10234449 Ga0207639_102344491 161
366 3300026067 Ga0207678_10020238 Ga0207678_100202383 161
367 3300026067 Ga0207678_10035725 Ga0207678_100357256 161
368 3300026067 Ga0207678_10045271 Ga0207678_100452712 161
369 3300026067 Ga0207678_10378862 Ga0207678_103788621 161
370 3300026075 Ga0207708_10033443 Ga0207708_100334432 161
371 3300026075 Ga0207708_10301397 Ga0207708_103013971 161
372 3300026089 Ga0207648_10094412 Ga0207648_100944123 161
373 3300026116 Ga0207674_10017324 Ga0207674_100173247 161
374 3300026116 Ga0207674_10326633 Ga0207674_103266332 161
375 3300026118 Ga0207675_100139003 Ga0207675_1001390034 161
376 3300026118 Ga0207675_100154819 Ga0207675_1001548192 161
377 3300026121 Ga0207683_10023560 Ga0207683_100235606 161
378 3300026121 Ga0207683_10391595 Ga0207683_103915952 161
379 3300026121 Ga0207683_11309915 Ga0207683_113099151 161
380 3300027671 Ga0209588_1120750 Ga0209588_11207501 161
381 3300027866 Ga0209813_10027474 Ga0209813_100274742 161
382 3300028379 Ga0268266_10000446 Ga0268266_1000044651 161
383 3300028379 Ga0268266_10017902 Ga0268266_100179021 161
384 3300028379 Ga0268266_10075473 Ga0268266_100754734 161
385 3300028379 Ga0268266_10274114 Ga0268266_102741142 161
386 3300028379 Ga0268266_10760074 Ga0268266_107600742 161
387 3300028380 Ga0268265_10124097 Ga0268265_101240972 161
388 3300028380 Ga0268265_10208678 Ga0268265_102086781 161
389 3300028380 Ga0268265_10636468 Ga0268265_106364682 161
390 3300028381 Ga0268264_10000158 Ga0268264_10000158123 161
391 3300028381 Ga0268264_10446924 Ga0268264_104469242 161
392 3300028556 Ga0265337_1021645 Ga0265337_10216453 161
393 3300028558 Ga0265326_10001072 Ga0265326_1000107211 161
394 3300028563 Ga0265319_1018091 Ga0265319_10180913 161
395 3300028573 Ga0265334_10006784 Ga0265334_100067844 161
396 3300028577 Ga0265318_10016818 Ga0265318_100168183 161
397 3300028653 Ga0265323_10000529 Ga0265323_1000052910 161
398 3300028666 Ga0265336_10000169 Ga0265336_100001696 161
399 3300028786 Ga0307517_10001444 Ga0307517_1000144438 161
400 3300028786 Ga0307517_10091019 Ga0307517_100910192 161
401 3300028794 Ga0307515_10069057 Ga0307515_100690574 161
402 3300028794 Ga0307515_10555648 Ga0307515_105556481 161
403 3300028800 Ga0265338_10000624 Ga0265338_1000062416 161
404 3300029957 Ga0265324_10002965 Ga0265324_100029656 161
405 3300030521 Ga0307511_10062880 Ga0307511_100628804 161
406 3300031456 Ga0307513_10517498 Ga0307513_105174981 161
407 3300031507 Ga0307509_10043981 Ga0307509_100439816 161
408 3300031507 Ga0307509_10073911 Ga0307509_100739115 161
409 3300031507 Ga0307509_10384712 Ga0307509_103847121 161
410 3300031616 Ga0307508_10000184 Ga0307508_1000018461 161
411 3300031616 Ga0307508_10007695 Ga0307508_100076957 161
412 3300031616 Ga0307508_10339083 Ga0307508_103390832 161
413 3300031665 Ga0316575_10023931 Ga0316575_100239313 161
414 3300031730 Ga0307516_10007195 Ga0307516_1000719510 161
415 3300031730 Ga0307516_10022096 Ga0307516_1002209610 161
416 3300031730 Ga0307516_10101395 Ga0307516_101013953 161
417 3300031731 Ga0307405_10415765 Ga0307405_104157651 161
418 3300031901 Ga0307406_11198040 Ga0307406_111980401 161
419 3300032004 Ga0307414_10658123 Ga0307414_106581231 161
420 3300032126 Ga0307415_100061963 Ga0307415_1000619632 161
421 3300033179 Ga0307507_10011889 Ga0307507_100118898 161
422 3300033180 Ga0307510_10009874 Ga0307510_1000987416 161
423 3300033180 Ga0307510_10163778 Ga0307510_101637782 161
424 3300033180 Ga0307510_10243522 Ga0307510_102435221 161
425 3300034816 Ga0373930_0008728 Ga0373930_0008728_193_678 161
426 3300034818 Ga0373950_0057981 Ga0373950_0057981_79_564 161
427 3300035086 Ga0373934_0084208 Ga0373934_0084208_721_1206 161
428 3300035111 Ga0373923_0079720 Ga0373923_0079720_177_662 161
429 3300035112 Ga0373932_0064100 Ga0373932_0064100_563_1048 161
430 3300035113 Ga0373936_0032215 Ga0373936_0032215_888_1373 161
431 3300035114 Ga0373939_0295107 Ga0373939_0295107_79_564 161
432 3300035117 Ga0373953_0315189 Ga0373953_0315189_187_672 161
433 3300035118 Ga0373954_0036923 Ga0373954_0036923_483_968 161
434 3300035119 Ga0373956_0203287 Ga0373956_0203287_285_770 161
435 3300035170 Ga0373943_0017111 Ga0373943_0017111_2110_2595 161
436 3300035170 Ga0373943_0359058 Ga0373943_0359058_268_753 161
437 3300035171 Ga0373946_0373444 Ga0373946_0373444_131_616 161
438 3300035172 Ga0373955_0027515 Ga0373955_0027515_998_1483 161
439 3300035172 Ga0373955_0243811 Ga0373955_0243811_144_629 161
440 3300035691 Ga0373931_0060534 Ga0373931_0060534_862_1347 161
441 3300035692 Ga0373935_0010312 Ga0373935_0010312_3229_3714 161
442 3300035692 Ga0373935_0041354 Ga0373935_0041354_822_1367 161
443 3300035695 Ga0373927_0053805 Ga0373927_0053805_1260_1745 161
444 3300035695 Ga0373927_0271346 Ga0373927_0271346_501_1046 161
445 3300035695 Ga0373927_0559924 Ga0373927_0559924_49_534 161
446 3300035724 Ga0373933_0002890 Ga0373933_0002890_2387_2872 161
447 3300035725 Ga0373947_0128709 Ga0373947_0128709_774_1259 161
448 3300036712 Ga0316584_0054000 Ga0316584_0054000_505_1002 161
449 3300037068 Ga0373925_0060136 Ga0373925_0060136_2064_2549 161
450 3300037068 Ga0373925_0467058 Ga0373925_0467058_301_786 161
451 3300037068 Ga0373925_1222464 Ga0373925_1222464_87_572 161
452 3300037418 Ga0395900_0319963 Ga0395900_0319963_1008_1505 161
453 3300037471 Ga0395905_0024040 Ga0395905_0024040_1669_2154 161
454 3300037471 Ga0395905_0172771 Ga0395905_0172771_495_980 161
455 3300037471 Ga0395905_0212898 Ga0395905_0212898_394_879 161
456 3300037471 Ga0395905_0375545 Ga0395905_0375545_763_1248 161
457 3300037471 Ga0395905_0672230 Ga0395905_0672230_286_771 161
458 3300038443 Ga0395901_0304864 Ga0395901_0304864_412_909 161
459 3300038443 Ga0395901_0769100 Ga0395901_0769100_124_609 161
460 3300039437 Ga0436365_0959977 Ga0436365_0959977_5318_5803 161
461 3300039437 Ga0436365_1809413 Ga0436365_1809413_689_1174 161
462 3300039438 Ga0436360_0470849 Ga0436360_0470849_496_981 161
463 3300039450 Ga0436363_0532944 Ga0436363_0532944_207_692 161
464 3300039450 Ga0436363_0602143 Ga0436363_0602143_114_599 161
465 3300039450 Ga0436363_1346086 Ga0436363_1346086_180_665 161
466 3300039453 Ga0436362_0651173 Ga0436362_0651173_55_540 161
467 3300039453 Ga0436362_1003352 Ga0436362_1003352_452_937 161
468 3300039453 Ga0436362_1221089 Ga0436362_1221089_599_1084 161
469 3300041451 Ga0451791_1382345 Ga0451791_1382345_65_550 161
470 3300041453 Ga0451797_0711704 Ga0451797_0711704_1950_2435 161
471 3300041459 Ga0451800_1299814 Ga0451800_1299814_291_776 161
472 3300041460 Ga0451802_0615921 Ga0451802_0615921_153_638 161
473 3300041463 Ga0451804_0979417 Ga0451804_0979417_141_626 161
474 3300041498 Ga0451841_0229262 Ga0451841_0229262_57_542 161
475 3300041512 Ga0451853_3679622 Ga0451853_3679622_74_559 161
476 3300042004 Ga0439445_0094604 Ga0439445_0094604_153_638 161
477 3300042013 Ga0439456_105182 Ga0439456_105182_82_567 161
478 3300044694 Ga0466963_0097174 Ga0466963_0097174_1308_1793 161
479 3300044706 Ga0466964_0485825 Ga0466964_0485825_86_571 161
480 3300044719 Ga0466971_0064851 Ga0466971_0064851_348_833 161
481 3300044765 Ga0466970_0357709 Ga0466970_0357709_247_732 161
482 3300044842 Ga0466957_0102949 Ga0466957_0102949_169_654 161
483 3300044842 Ga0466957_0110589 Ga0466957_0110589_397_882 161
484 3300045049 Ga0466959_0004580 Ga0466959_0004580_1965_2450 161
485 3300045836 Ga0466958_0238972 Ga0466958_0238972_582_1067 161
486 3300045836 Ga0466958_0709949 Ga0466958_0709949_64_552 161
487 3300045836 Ga0466958_0872087 Ga0466958_0872087_42_527 161
488 3300045976 Ga0466967_0045828 Ga0466967_0045828_1822_2307 161
489 3300045976 Ga0466967_0045943 Ga0466967_0045943_1573_2058 161
490 3300045976 Ga0466967_0124582 Ga0466967_0124582_933_1430 161
491 3300045976 Ga0466967_0145351 Ga0466967_0145351_1313_1798 161
492 3300045976 Ga0466967_0509965 Ga0466967_0509965_532_1017 161
493 3300046454 Ga0495592_0271327 Ga0495592_0271327_55_540 161
494 3300046472 Ga0495580_0348846 Ga0495580_0348846_189_674 161
495 3300046473 Ga0495582_0657951 Ga0495582_0657951_102_587 161
496 3300046474 Ga0495605_0196966 Ga0495605_0196966_262_747 161
497 3300046475 Ga0495639_0012171 Ga0495639_0012171_1192_1677 161
498 3300046477 Ga0495664_0099972 Ga0495664_0099972_1099_1584 161
499 3300046477 Ga0495664_0124161 Ga0495664_0124161_14_499 161
500 3300046507 Ga0495606_0112020 Ga0495606_0112020_1009_1494 161
501 3300046507 Ga0495606_0284937 Ga0495606_0284937_296_781 161
502 3300046512 Ga0495610_0076882 Ga0495610_0076882_317_802 161
503 3300046514 Ga0495618_0021240 Ga0495618_0021240_2638_3123 161
504 3300046516 Ga0495628_0326223 Ga0495628_0326223_262_747 161
505 3300046517 Ga0495630_0009739 Ga0495630_0009739_5506_5991 161
506 3300046518 Ga0495631_0404203 Ga0495631_0404203_54_539 161
507 3300046519 Ga0495632_0188542 Ga0495632_0188542_92_577 161
508 3300046526 Ga0495666_0155359 Ga0495666_0155359_516_1001 161
509 3300046530 Ga0495654_0373361 Ga0495654_0373361_16_501 161
510 3300046531 Ga0495665_0025604 Ga0495665_0025604_1940_2425 161
511 3300046531 Ga0495665_0319665 Ga0495665_0319665_274_759 161
512 3300046531 Ga0495665_0602771 Ga0495665_0602771_49_534 161
513 3300046533 Ga0495640_0027591 Ga0495640_0027591_646_1131 161
514 3300046535 Ga0495586_0608057 Ga0495586_0608057_47_532 161
515 3300046536 Ga0495587_0066722 Ga0495587_0066722_126_623 161
516 3300046557 Ga0495622_0103788 Ga0495622_0103788_72_617 161
517 3300046558 Ga0495633_0178152 Ga0495633_0178152_398_883 161
518 3300046615 Ga0495656_0056585 Ga0495656_0056585_1147_1677 161
519 3300046615 Ga0495656_0353838 Ga0495656_0353838_241_726 161
520 3300046642 Ga0495634_0598214 Ga0495634_0598214_131_616 161
521 3300046648 Ga0495611_0175257 Ga0495611_0175257_268_753 161
522 3300046679 Ga0495623_0167521 Ga0495623_0167521_11_496 161
523 3300046684 Ga0495669_0006057 Ga0495669_0006057_662_1147 161
524 3300046684 Ga0495669_0275903 Ga0495669_0275903_256_741 161
525 3300046689 Ga0495613_0116257 Ga0495613_0116257_524_1009 161
526 3300046690 Ga0495624_0141573 Ga0495624_0141573_198_683 161
527 3300046691 Ga0495670_0235340 Ga0495670_0235340_325_855 161
528 3300046692 Ga0495671_0210415 Ga0495671_0210415_303_833 161
529 3300046694 Ga0495649_0162244 Ga0495649_0162244_612_1097 161
530 3300046794 Ga0495589_0113743 Ga0495589_0113743_180_665 161
531 3300047315 Ga0495581_0020871 Ga0495581_0020871_309_794 161
532 3300047315 Ga0495581_0075374 Ga0495581_0075374_1337_1822 161
533 3300047319 Ga0495674_0331756 Ga0495674_0331756_531_1016 161
534 3300047445 Ga0495677_0053318 Ga0495677_0053318_277_807 161
535 3300047446 Ga0495679_070245 Ga0495679_070245_35_520 161
536 3300047472 Ga0495686_0045638 Ga0495686_0045638_537_1022 161
537 3300047472 Ga0495686_0350239 Ga0495686_0350239_197_727 161
538 3300048088 Ga0495602_0217160 Ga0495602_0217160_567_1052 161
539 3300048903 Ga0496100_0320412 Ga0496100_0320412_34_519 161
540 3300048904 Ga0496101_0026707 Ga0496101_0026707_48_533 161
541 3300048904 Ga0496101_0248359 Ga0496101_0248359_20_550 161
542 3300048907 Ga0496104_0026218 Ga0496104_0026218_1410_1895 161
543 3300048907 Ga0496104_0324293 Ga0496104_0324293_879_1364 161
544 3300048907 Ga0496104_0598343 Ga0496104_0598343_419_904 161
545 3300048908 Ga0496105_0009624 Ga0496105_0009624_5480_5965 161
546 3300048909 Ga0496106_0002771 Ga0496106_0002771_8875_9465 161
547 3300048910 Ga0496107_0054182 Ga0496107_0054182_1353_1880 161
548 3300048911 Ga0496108_0205237 Ga0496108_0205237_1135_1620 161
549 3300048912 Ga0496109_0021306 Ga0496109_0021306_2303_2788 161
550 3300048913 Ga0496110_0200072 Ga0496110_0200072_1017_1502 161
551 3300048914 Ga0496111_0015228 Ga0496111_0015228_1261_1746 161
552 3300048915 Ga0496112_0691036 Ga0496112_0691036_69_554 161
553 3300048915 Ga0496112_0692481 Ga0496112_0692481_129_614 161
554 3300048915 Ga0496112_0770462 Ga0496112_0770462_41_526 161
555 3300048916 Ga0496113_0035431 Ga0496113_0035431_105_590 161
556 3300048916 Ga0496113_1288141 Ga0496113_1288141_62_547 161
557 3300048917 Ga0496114_0031727 Ga0496114_0031727_2208_2693 161
558 3300048918 Ga0496115_0056477 Ga0496115_0056477_2116_2601 161
559 3300048920 Ga0496117_0047639 Ga0496117_0047639_2436_3026 161
560 3300048921 Ga0496118_0003945 Ga0496118_0003945_6318_6908 161
561 3300048921 Ga0496118_0013805 Ga0496118_0013805_3638_4123 161
562 3300048921 Ga0496118_0352446 Ga0496118_0352446_160_645 161
563 3300048922 Ga0496119_0210350 Ga0496119_0210350_253_783 161
564 3300048923 Ga0496120_0509034 Ga0496120_0509034_17_502 161
565 3300048924 Ga0496121_0001276 Ga0496121_0001276_28961_29551 161
566 3300048924 Ga0496121_0013094 Ga0496121_0013094_4676_5161 161
567 3300048924 Ga0496121_0050417 Ga0496121_0050417_991_1533 161
568 3300048924 Ga0496121_0051312 Ga0496121_0051312_1954_2466 161
569 3300048924 Ga0496121_0083818 Ga0496121_0083818_248_778 161
570 3300048924 Ga0496121_0110977 Ga0496121_0110977_1468_1998 161
571 3300048924 Ga0496121_0124968 Ga0496121_0124968_72_557 161
572 3300048924 Ga0496121_0353228 Ga0496121_0353228_268_753 161
573 3300048927 Ga0496124_0002134 Ga0496124_0002134_4926_5516 161
574 3300048927 Ga0496124_0112165 Ga0496124_0112165_453_983 161
575 3300048928 Ga0496125_0025231 Ga0496125_0025231_4886_5371 161
576 3300048928 Ga0496125_0037677 Ga0496125_0037677_1732_2217 161
577 3300048928 Ga0496125_0190064 Ga0496125_0190064_372_902 161
578 3300048929 Ga0496126_0011362 Ga0496126_0011362_8646_9131 161
579 3300048929 Ga0496126_0012891 Ga0496126_0012891_1963_2460 161
580 3300048929 Ga0496126_0013093 Ga0496126_0013093_3484_4074 161
581 3300048929 Ga0496126_0029811 Ga0496126_0029811_1221_1706 161
582 3300048929 Ga0496126_0069802 Ga0496126_0069802_2176_2661 161
583 3300048929 Ga0496126_0091500 Ga0496126_0091500_1847_2332 161
584 3300048929 Ga0496126_0100043 Ga0496126_0100043_1795_2325 161
585 3300048929 Ga0496126_0135983 Ga0496126_0135983_334_819 161
586 3300048929 Ga0496126_0345989 Ga0496126_0345989_540_1082 161
587 3300048929 Ga0496126_0475360 Ga0496126_0475360_244_729 161
588 3300048929 Ga0496126_0569596 Ga0496126_0569596_268_780 161
589 3300048929 Ga0496126_0661822 Ga0496126_0661822_147_632 161
590 3300049460 Ga0495682_0084705 Ga0495682_0084705_218_703 161
591 3300049575 Ga0501039_0324632 Ga0501039_0324632_367_891 161
592 3300049578 Ga0501042_0169984 Ga0501042_0169984_526_1011 161
593 3300050490 nmdc:mga03n38_112700_c1 nmdc:mga03n38_112700_c1_178_663 161
594 3300050490 nmdc:mga03n38_19136_c1 nmdc:mga03n38_19136_c1_378_863 161
595 3300050490 nmdc:mga03n38_9425_c1 nmdc:mga03n38_9425_c1_1796_2281 161
596 3300050491 nmdc:mga00v17_101091_c1 nmdc:mga00v17_101091_c1_1299_1784 161
597 3300050492 nmdc:mga0yw44_206342_c1 nmdc:mga0yw44_206342_c1_434_919 161
598 3300050492 nmdc:mga0yw44_53575_c1 nmdc:mga0yw44_53575_c1_1006_1491 161
599 3300050492 nmdc:mga0yw44_70549_c1 nmdc:mga0yw44_70549_c1_1435_1920 161
600 3300050493 nmdc:mga0k408_216106_c1 nmdc:mga0k408_216106_c1_635_1120 161
601 3300050493 nmdc:mga0k408_274258_c1 nmdc:mga0k408_274258_c1_403_888 161
602 3300050494 nmdc:mga06z11_101998_c1 nmdc:mga06z11_101998_c1_526_1011 161
603 3300050494 nmdc:mga06z11_115427_c1 nmdc:mga06z11_115427_c1_591_1121 161
604 3300050495 nmdc:mga04h51_39692_c1 nmdc:mga04h51_39692_c1_568_1053 161
605 3300050496 nmdc:mga07m45_179015_c1 nmdc:mga07m45_179015_c1_52_537 161
606 3300050496 nmdc:mga07m45_251530_c1 nmdc:mga07m45_251530_c1_171_656 161
607 3300050496 nmdc:mga07m45_412426_c1 nmdc:mga07m45_412426_c1_19_504 161
608 3300050496 nmdc:mga07m45_89977_c1 nmdc:mga07m45_89977_c1_664_1194 161
609 3300050507 nmdc:mga05p37_474979_c1 nmdc:mga05p37_474979_c1_615_1145 161
610 3300050508 nmdc:mga09592_421087_c1 nmdc:mga09592_421087_c1_250_735 161
611 3300050509 nmdc:mga0qj67_68083_c1 nmdc:mga0qj67_68083_c1_1581_2066 161
612 3300050511 nmdc:mga08y16_511535_c1 nmdc:mga08y16_511535_c1_623_1153 161
613 3300050514 nmdc:mga08x19_160725_c1 nmdc:mga08x19_160725_c1_582_1067 161
614 3300053077 Ga0495601_0097696 Ga0495601_0097696_912_1397 161
615 3300053079 Ga0500610_0121034 Ga0500610_0121034_685_1170 161
616 3300053080 Ga0500635_0008869 Ga0500635_0008869_377_922 161
617 3300053080 Ga0500635_0016667 Ga0500635_0016667_1233_1760 161
618 3300053085 Ga0495619_0106544 Ga0495619_0106544_845_1330 161
619 3300053087 Ga0500643_037143 Ga0500643_037143_347_832 161
620 3300053089 Ga0500581_136541 Ga0500581_136541_646_1131 161
621 3300053093 Ga0500651_0332479 Ga0500651_0332479_295_780 161
622 3300053094 Ga0500566_0000782 Ga0500566_0000782_13865_14386 161
623 3300053094 Ga0500566_0069359 Ga0500566_0069359_946_1431 161
624 3300053095 Ga0500640_000202 Ga0500640_000202_11567_12088 161
625 3300053102 Ga0500554_002164 Ga0500554_002164_2347_2832 161
626 3300053102 Ga0500554_136372 Ga0500554_136372_83_610 161
627 3300053111 Ga0500572_000491 Ga0500572_000491_8215_8736 161
628 3300053111 Ga0500572_000589 Ga0500572_000589_8452_8937 161
629 3300053111 Ga0500572_169376 Ga0500572_169376_130_615 161
630 3300053114 Ga0500582_017624 Ga0500582_017624_176_661 161
631 3300053119 Ga0500595_000941 Ga0500595_000941_2396_2881 161
632 3300053119 Ga0500595_010224 Ga0500595_010224_831_1361 161
633 3300053122 Ga0500608_004402 Ga0500608_004402_3828_4349 161
634 3300053123 Ga0500614_000997 Ga0500614_000997_2798_3319 161
635 3300053133 Ga0500655_038742 Ga0500655_038742_335_820 161
636 3300053136 Ga0500559_0000685 Ga0500559_0000685_6332_6817 161
637 3300053136 Ga0500559_0004967 Ga0500559_0004967_3350_3871 161
638 3300053142 Ga0500577_0022124 Ga0500577_0022124_286_771 161
639 3300053144 Ga0500585_184063 Ga0500585_184063_147_632 161
640 3300053150 Ga0500603_000410 Ga0500603_000410_6539_7066 161
641 3300053150 Ga0500603_001295 Ga0500603_001295_2949_3470 161
642 3300053154 Ga0500619_145257 Ga0500619_145257_115_600 161
643 3300053156 Ga0500622_0137036 Ga0500622_0137036_194_679 161
644 3300053159 Ga0500630_004401 Ga0500630_004401_2910_3431 161
645 3300053160 Ga0500633_0084953 Ga0500633_0084953_317_802 161
646 3300053161 Ga0500634_0080110 Ga0500634_0080110_475_960 161
647 3300053162 Ga0500638_000054 Ga0500638_000054_9866_10351 161
648 3300053162 Ga0500638_006087 Ga0500638_006087_1823_2344 161
649 3300053162 Ga0500638_153202 Ga0500638_153202_165_650 161
650 3300053163 Ga0500639_000014 Ga0500639_000014_101376_101897 161
651 3300053163 Ga0500639_019925 Ga0500639_019925_692_1177 161
652 3300053177 Ga0500636_0242554 Ga0500636_0242554_423_908 161
653 3300053177 Ga0500636_0334024 Ga0500636_0334024_165_650 161
654 3300053178 Ga0500637_0000775 Ga0500637_0000775_7412_7897 161
655 3300053178 Ga0500637_0359574 Ga0500637_0359574_93_623 161
656 3300053725 Ga0500576_118601 Ga0500576_118601_455_976 161
657 3300053728 Ga0500657_060034 Ga0500657_060034_556_1101 161
658 3300053730 Ga0500645_041952 Ga0500645_041952_698_1183 161
659 3300053733 Ga0500552_001084 Ga0500552_001084_1857_2402 161
660 3300053735 Ga0500596_000125 Ga0500596_000125_10228_10713 161
661 3300053735 Ga0500596_001106 Ga0500596_001106_1421_1942 161
662 3300053735 Ga0500596_003950 Ga0500596_003950_1842_2432 161
663 3300054114 Ga0501084_1243030 Ga0501084_1243030_45_569 161
664 3300059640 Ga0587067_146027 Ga0587067_146027_73_558 161
665 3300001989 JGI24739J22299_10067365 JGI24739J22299_100673651 162
666 3300002067 JGI24735J21928_10137208 JGI24735J21928_101372081 162
667 3300002067 JGI24735J21928_10167818 JGI24735J21928_101678181 162
668 3300003215 JGI25153J46596_10003464 JGI25153J46596_100034648 162
669 3300003354 JGI25160J50197_1010655 JGI25160J50197_10106555 162
670 3300003354 JGI25160J50197_1044824 JGI25160J50197_10448242 162
671 3300003771 Ga0055526_1035146 Ga0055526_10351463 162
672 3300003771 Ga0055526_1071174 Ga0055526_10711741 162
673 3300003794 Ga0055531_10002385 Ga0055531_1000238516 162
674 3300005262 Ga0065165_1000866 Ga0065165_100086638 162
675 3300005262 Ga0065165_1027432 Ga0065165_10274321 162
676 3300005262 Ga0065165_1028002 Ga0065165_10280023 162
677 3300005327 Ga0070658_10871776 Ga0070658_108717762 162
678 3300005330 Ga0070690_100304757 Ga0070690_1003047572 162
679 3300005335 Ga0070666_10066299 Ga0070666_100662993 162
680 3300005336 Ga0070680_100009562 Ga0070680_1000095623 162
681 3300005337 Ga0070682_100286069 Ga0070682_1002860693 162
682 3300005340 Ga0070689_100034015 Ga0070689_1000340153 162
683 3300005347 Ga0070668_100070419 Ga0070668_1000704191 162
684 3300005347 Ga0070668_100471584 Ga0070668_1004715842 162
685 3300005354 Ga0070675_100820351 Ga0070675_1008203511 162
686 3300005355 Ga0070671_100155706 Ga0070671_1001557062 162
687 3300005355 Ga0070671_100296056 Ga0070671_1002960562 162
688 3300005356 Ga0070674_100031897 Ga0070674_1000318973 162
689 3300005356 Ga0070674_100558501 Ga0070674_1005585012 162
690 3300005365 Ga0070688_100094709 Ga0070688_1000947093 162
691 3300005365 Ga0070688_100392323 Ga0070688_1003923231 162
692 3300005366 Ga0070659_101018122 Ga0070659_1010181222 162
693 3300005367 Ga0070667_100081492 Ga0070667_1000814926 162
694 3300005367 Ga0070667_100154449 Ga0070667_1001544492 162
695 3300005434 Ga0070709_10140877 Ga0070709_101408772 162
696 3300005435 Ga0070714_100809222 Ga0070714_1008092221 162
697 3300005435 Ga0070714_101238926 Ga0070714_1012389261 162
698 3300005437 Ga0070710_10214467 Ga0070710_102144671 162
699 3300005437 Ga0070710_10400266 Ga0070710_104002662 162
700 3300005438 Ga0070701_10257512 Ga0070701_102575122 162
701 3300005439 Ga0070711_100087582 Ga0070711_1000875823 162
702 3300005439 Ga0070711_100588768 Ga0070711_1005887682 162
703 3300005441 Ga0070700_100371903 Ga0070700_1003719031 162
704 3300005455 Ga0070663_100034871 Ga0070663_1000348713 162
705 3300005455 Ga0070663_100160427 Ga0070663_1001604273 162
706 3300005456 Ga0070678_100288955 Ga0070678_1002889551 162
707 3300005457 Ga0070662_100645672 Ga0070662_1006456721 162
708 3300005458 Ga0070681_10451919 Ga0070681_104519192 162
709 3300005459 Ga0068867_100601507 Ga0068867_1006015071 162
710 3300005530 Ga0070679_100019564 Ga0070679_10001956411 162
711 3300005535 Ga0070684_101000850 Ga0070684_1010008501 162
712 3300005539 Ga0068853_101008163 Ga0068853_1010081632 162
713 3300005539 Ga0068853_101079883 Ga0068853_1010798831 162
714 3300005547 Ga0070693_100371047 Ga0070693_1003710472 162
715 3300005547 Ga0070693_100456748 Ga0070693_1004567481 162
716 3300005548 Ga0070665_100016553 Ga0070665_1000165537 162
717 3300005548 Ga0070665_100173152 Ga0070665_1001731522 162
718 3300005548 Ga0070665_100593670 Ga0070665_1005936703 162
719 3300005548 Ga0070665_100608603 Ga0070665_1006086032 162
720 3300005563 Ga0068855_100429882 Ga0068855_1004298822 162
721 3300005563 Ga0068855_100664013 Ga0068855_1006640132 162
722 3300005564 Ga0070664_100220459 Ga0070664_1002204592 162
723 3300005577 Ga0068857_100532995 Ga0068857_1005329952 162
724 3300005614 Ga0068856_100107968 Ga0068856_1001079681 162
725 3300005614 Ga0068856_100128710 Ga0068856_1001287103 162
726 3300005614 Ga0068856_100717653 Ga0068856_1007176531 162
727 3300005616 Ga0068852_100004969 Ga0068852_10000496914 162
728 3300005617 Ga0068859_100335297 Ga0068859_1003352971 162
729 3300005618 Ga0068864_100327678 Ga0068864_1003276782 162
730 3300005618 Ga0068864_100489238 Ga0068864_1004892382 162
731 3300005841 Ga0068863_100460294 Ga0068863_1004602943 162
732 3300005841 Ga0068863_101720090 Ga0068863_1017200901 162
733 3300005843 Ga0068860_100055238 Ga0068860_1000552382 162
734 3300005844 Ga0068862_100427253 Ga0068862_1004272532 162
735 3300005937 Ga0081455_10014398 Ga0081455_100143986 162
736 3300005937 Ga0081455_10032136 Ga0081455_100321363 162
737 3300005983 Ga0081540_1024289 Ga0081540_10242891 162
738 3300005983 Ga0081540_1210743 Ga0081540_12107431 162
739 3300006028 Ga0070717_10316938 Ga0070717_103169383 162
740 3300006038 Ga0075365_10063145 Ga0075365_100631452 162
741 3300006038 Ga0075365_10106330 Ga0075365_101063304 162
742 3300006038 Ga0075365_10269772 Ga0075365_102697722 162
743 3300006042 Ga0075368_10021379 Ga0075368_100213793 162
744 3300006042 Ga0075368_10038998 Ga0075368_100389985 162
745 3300006042 Ga0075368_10075771 Ga0075368_100757712 162
746 3300006051 Ga0075364_10207161 Ga0075364_102071612 162
747 3300006051 Ga0075364_10338005 Ga0075364_103380052 162
748 3300006163 Ga0070715_10143542 Ga0070715_101435421 162
749 3300006173 Ga0070716_100095473 Ga0070716_1000954734 162
750 3300006173 Ga0070716_100568934 Ga0070716_1005689341 162
751 3300006177 Ga0075362_10074388 Ga0075362_100743881 162
752 3300006177 Ga0075362_10098807 Ga0075362_100988072 162
753 3300006178 Ga0075367_10026029 Ga0075367_100260294 162
754 3300006178 Ga0075367_10093686 Ga0075367_100936862 162
755 3300006186 Ga0075369_10254701 Ga0075369_102547012 162
756 3300006195 Ga0075366_10154003 Ga0075366_101540032 162
757 3300006237 Ga0097621_100078787 Ga0097621_1000787874 162
758 3300006237 Ga0097621_100417483 Ga0097621_1004174832 162
759 3300006353 Ga0075370_10045013 Ga0075370_100450132 162
760 3300006353 Ga0075370_10143332 Ga0075370_101433322 162
761 3300006358 Ga0068871_100453465 Ga0068871_1004534652 162
762 3300006358 Ga0068871_100916798 Ga0068871_1009167982 162
763 3300006871 Ga0075434_100083977 Ga0075434_1000839772 162
764 3300006881 Ga0068865_100046207 Ga0068865_1000462074 162
765 3300006914 Ga0075436_100071375 Ga0075436_1000713753 162
766 3300006931 Ga0097620_100335321 Ga0097620_1003353211 162
767 3300006942 Ga0099824_1010822 Ga0099824_101082216 162
768 3300006942 Ga0099824_1028382 Ga0099824_10283823 162
769 3300006942 Ga0099824_1049275 Ga0099824_10492751 162
770 3300006943 Ga0099822_1005057 Ga0099822_10050573 162
771 3300006944 Ga0099823_1040671 Ga0099823_10406714 162
772 3300007076 Ga0075435_100082355 Ga0075435_1000823555 162
773 3300007788 Ga0099795_10088712 Ga0099795_100887122 162
774 3300009093 Ga0105240_10014591 Ga0105240_1001459113 162
775 3300009093 Ga0105240_10156831 Ga0105240_101568313 162
776 3300009094 Ga0111539_11139549 Ga0111539_111395491 162
777 3300009098 Ga0105245_10068919 Ga0105245_100689195 162
778 3300009098 Ga0105245_10768895 Ga0105245_107688951 162
779 3300009101 Ga0105247_10010671 Ga0105247_100106714 162
780 3300009101 Ga0105247_10604295 Ga0105247_106042951 162
781 3300009101 Ga0105247_10906325 Ga0105247_109063251 162
782 3300009147 Ga0114129_10770696 Ga0114129_107706962 162
783 3300009148 Ga0105243_10324676 Ga0105243_103246763 162
784 3300009174 Ga0105241_10037810 Ga0105241_100378102 162
785 3300009174 Ga0105241_10528991 Ga0105241_105289911 162
786 3300009174 Ga0105241_10594225 Ga0105241_105942252 162
787 3300009174 Ga0105241_11502248 Ga0105241_115022481 162
788 3300009176 Ga0105242_10603637 Ga0105242_106036372 162
789 3300009177 Ga0105248_10032002 Ga0105248_100320026 162
790 3300009177 Ga0105248_10158583 Ga0105248_101585835 162
791 3300009545 Ga0105237_10002547 Ga0105237_1000254715 162
792 3300009545 Ga0105237_10175622 Ga0105237_101756223 162
793 3300009545 Ga0105237_10506411 Ga0105237_105064113 162
794 3300009551 Ga0105238_10523929 Ga0105238_105239292 162
795 3300009551 Ga0105238_10824041 Ga0105238_108240412 162
796 3300009553 Ga0105249_10207839 Ga0105249_102078392 162
797 3300010159 Ga0099796_10391085 Ga0099796_103910851 162
798 3300010375 Ga0105239_10093731 Ga0105239_100937314 162
799 3300010375 Ga0105239_10099469 Ga0105239_100994691 162
800 3300011119 Ga0105246_10134639 Ga0105246_101346394 162
801 3300011119 Ga0105246_10919517 Ga0105246_109195171 162
802 3300013100 Ga0157373_10431744 Ga0157373_104317442 162
803 3300013105 Ga0157369_10026489 Ga0157369_100264893 162
804 3300013105 Ga0157369_10124032 Ga0157369_101240323 162
805 3300013105 Ga0157369_10932072 Ga0157369_109320721 162
806 3300013105 Ga0157369_11065831 Ga0157369_110658311 162
807 3300013296 Ga0157374_10542760 Ga0157374_105427601 162
808 3300013296 Ga0157374_10748608 Ga0157374_107486082 162
809 3300013297 Ga0157378_10366542 Ga0157378_103665422 162
810 3300013297 Ga0157378_11504997 Ga0157378_115049971 162
811 3300013306 Ga0163162_10144491 Ga0163162_101444915 162
812 3300013306 Ga0163162_10259131 Ga0163162_102591313 162
813 3300013307 Ga0157372_10633039 Ga0157372_106330392 162
814 3300013308 Ga0157375_10089567 Ga0157375_100895673 162
815 3300014325 Ga0163163_10023107 Ga0163163_100231078 162
816 3300014325 Ga0163163_10031785 Ga0163163_100317855 162
817 3300014325 Ga0163163_10067293 Ga0163163_100672934 162
818 3300014326 Ga0157380_10025361 Ga0157380_100253617 162
819 3300014497 Ga0182008_10155180 Ga0182008_101551802 162
820 3300014968 Ga0157379_10028501 Ga0157379_100285014 162
821 3300014969 Ga0157376_10520707 Ga0157376_105207072 162
822 3300014969 Ga0157376_10559144 Ga0157376_105591442 162
823 3300014969 Ga0157376_11655452 Ga0157376_116554521 162
824 3300017792 Ga0163161_10720792 Ga0163161_107207922 162
825 3300020075 Ga0206349_1097443 Ga0206349_10974431 162
826 3300020076 Ga0206355_1264525 Ga0206355_12645252 162
827 3300020077 Ga0206351_10235379 Ga0206351_102353792 162
828 3300020080 Ga0206350_10726292 Ga0206350_107262921 162
829 3300020081 Ga0206354_10827935 Ga0206354_108279352 162
830 3300020082 Ga0206353_11793332 Ga0206353_117933321 162
831 3300021320 Ga0214544_1000001 Ga0214544_1000001255 162
832 3300021321 Ga0214542_1000005 Ga0214542_1000005255 162
833 3300021324 Ga0214545_1000003 Ga0214545_1000003509 162
834 3300021327 Ga0214543_1000002 Ga0214543_1000002256 162
835 3300021358 Ga0213873_10161295 Ga0213873_101612951 162
836 3300021358 Ga0213873_10240959 Ga0213873_102409591 162
837 3300021361 Ga0213872_10067877 Ga0213872_100678772 162
838 3300021377 Ga0213874_10003990 Ga0213874_100039903 162
839 3300021377 Ga0213874_10014556 Ga0213874_100145562 162
840 3300021384 Ga0213876_10192735 Ga0213876_101927351 162
841 3300021441 Ga0213871_10076770 Ga0213871_100767701 162
842 3300022467 Ga0224712_10328636 Ga0224712_103286361 162
843 3300025230 Ga0209563_101046 Ga0209563_1010465 162
844 3300025253 Ga0209677_104016 Ga0209677_1040169 162
845 3300025254 Ga0209148_1000253 Ga0209148_100025350 162
846 3300025258 Ga0209129_1018292 Ga0209129_10182921 162
847 3300025261 Ga0209233_1035856 Ga0209233_10358562 162
848 3300025261 Ga0209233_1054537 Ga0209233_10545371 162
849 3300025272 Ga0209455_1000873 Ga0209455_100087312 162
850 3300025272 Ga0209455_1016237 Ga0209455_10162371 162
851 3300025273 Ga0209673_1067571 Ga0209673_10675711 162
852 3300025295 Ga0209564_1002453 Ga0209564_10024539 162
853 3300025295 Ga0209564_1054797 Ga0209564_10547971 162
854 3300025297 Ga0209758_1000026 Ga0209758_100002668 162
855 3300025297 Ga0209758_1000318 Ga0209758_100031858 162
856 3300025297 Ga0209758_1001681 Ga0209758_100168126 162
857 3300025297 Ga0209758_1001958 Ga0209758_100195814 162
858 3300025297 Ga0209758_1002426 Ga0209758_100242625 162
859 3300025298 Ga0209050_1073517 Ga0209050_10735171 162
860 3300025299 Ga0209256_1005534 Ga0209256_10055341 162
861 3300025302 Ga0207426_1001230 Ga0207426_10012309 162
862 3300025302 Ga0207426_1005043 Ga0207426_10050433 162
863 3300025304 Ga0209257_1002140 Ga0209257_10021409 162
864 3300025315 Ga0207697_10234688 Ga0207697_102346881 162
865 3300025898 Ga0207692_10241951 Ga0207692_102419512 162
866 3300025900 Ga0207710_10480215 Ga0207710_104802151 162
867 3300025904 Ga0207647_10004054 Ga0207647_1000405416 162
868 3300025904 Ga0207647_10262084 Ga0207647_102620842 162
869 3300025904 Ga0207647_10435538 Ga0207647_104355381 162
870 3300025905 Ga0207685_10370467 Ga0207685_103704671 162
871 3300025906 Ga0207699_10231449 Ga0207699_102314492 162
872 3300025906 Ga0207699_10279290 Ga0207699_102792901 162
873 3300025911 Ga0207654_10047399 Ga0207654_100473992 162
874 3300025911 Ga0207654_10169941 Ga0207654_101699412 162
875 3300025911 Ga0207654_10218860 Ga0207654_102188601 162
876 3300025912 Ga0207707_10001008 Ga0207707_1000100838 162
877 3300025913 Ga0207695_10000634 Ga0207695_1000063435 162
878 3300025913 Ga0207695_10043518 Ga0207695_100435187 162
879 3300025914 Ga0207671_10007760 Ga0207671_100077605 162
880 3300025914 Ga0207671_10051315 Ga0207671_100513153 162
881 3300025914 Ga0207671_10927534 Ga0207671_109275341 162
882 3300025916 Ga0207663_10060300 Ga0207663_100603002 162
883 3300025916 Ga0207663_10238315 Ga0207663_102383152 162
884 3300025916 Ga0207663_10275857 Ga0207663_102758572 162
885 3300025917 Ga0207660_10140017 Ga0207660_101400172 162
886 3300025919 Ga0207657_10157818 Ga0207657_101578181 162
887 3300025921 Ga0207652_10026858 Ga0207652_100268581 162
888 3300025924 Ga0207694_10702348 Ga0207694_107023482 162
889 3300025924 Ga0207694_10864496 Ga0207694_108644962 162
890 3300025925 Ga0207650_10505621 Ga0207650_105056211 162
891 3300025926 Ga0207659_10683660 Ga0207659_106836601 162
892 3300025927 Ga0207687_10013234 Ga0207687_100132346 162
893 3300025927 Ga0207687_10324016 Ga0207687_103240163 162
894 3300025929 Ga0207664_10722934 Ga0207664_107229342 162
895 3300025929 Ga0207664_10859993 Ga0207664_108599931 162
896 3300025931 Ga0207644_10234760 Ga0207644_102347602 162
897 3300025934 Ga0207686_10761154 Ga0207686_107611541 162
898 3300025934 Ga0207686_11623737 Ga0207686_116237371 162
899 3300025935 Ga0207709_10328952 Ga0207709_103289521 162
900 3300025936 Ga0207670_10026987 Ga0207670_100269873 162
901 3300025938 Ga0207704_10147895 Ga0207704_101478952 162
902 3300025939 Ga0207665_10054422 Ga0207665_100544223 162
903 3300025939 Ga0207665_10227011 Ga0207665_102270111 162
904 3300025942 Ga0207689_10246805 Ga0207689_102468051 162
905 3300025945 Ga0207679_10702135 Ga0207679_107021351 162
906 3300025949 Ga0207667_10523500 Ga0207667_105235002 162
907 3300025981 Ga0207640_10154178 Ga0207640_101541782 162
908 3300025981 Ga0207640_10335688 Ga0207640_103356882 162
909 3300025986 Ga0207658_10235007 Ga0207658_102350074 162
910 3300026035 Ga0207703_10433869 Ga0207703_104338692 162
911 3300026041 Ga0207639_10490580 Ga0207639_104905802 162
912 3300026041 Ga0207639_11494625 Ga0207639_114946251 162
913 3300026067 Ga0207678_10070613 Ga0207678_100706132 162
914 3300026075 Ga0207708_10234355 Ga0207708_102343552 162
915 3300026078 Ga0207702_10178192 Ga0207702_101781921 162
916 3300026078 Ga0207702_10204597 Ga0207702_102045973 162
917 3300026078 Ga0207702_10302276 Ga0207702_103022762 162
918 3300026078 Ga0207702_10455912 Ga0207702_104559123 162
919 3300026088 Ga0207641_10627152 Ga0207641_106271522 162
920 3300026088 Ga0207641_11509944 Ga0207641_115099441 162
921 3300026089 Ga0207648_10398043 Ga0207648_103980432 162
922 3300026089 Ga0207648_10437454 Ga0207648_104374543 162
923 3300026095 Ga0207676_10176877 Ga0207676_101768771 162
924 3300026095 Ga0207676_10566698 Ga0207676_105666982 162
925 3300026116 Ga0207674_10691940 Ga0207674_106919401 162
926 3300026118 Ga0207675_100631907 Ga0207675_1006319071 162
927 3300026121 Ga0207683_10249625 Ga0207683_102496252 162
928 3300026142 Ga0207698_10102271 Ga0207698_101022711 162
929 3300026142 Ga0207698_10264414 Ga0207698_102644143 162
930 3300027296 Ga0209389_1000090 Ga0209389_100009016 162
931 3300027296 Ga0209389_1000119 Ga0209389_100011962 162
932 3300027357 Ga0209589_1000007 Ga0209589_1000007108 162
933 3300027357 Ga0209589_1000010 Ga0209589_1000010219 162
934 3300027361 Ga0209489_100008 Ga0209489_100008108 162
935 3300027361 Ga0209489_100011 Ga0209489_10001117 162
936 3300027361 Ga0209489_100385 Ga0209489_10038573 162
937 3300027363 Ga0209700_100009 Ga0209700_100009108 162
938 3300027363 Ga0209700_100013 Ga0209700_10001316 162
939 3300027424 Ga0209984_1044705 Ga0209984_10447051 162
940 3300027866 Ga0209813_10197252 Ga0209813_101972521 162
941 3300028379 Ga0268266_10014950 Ga0268266_100149507 162
942 3300028379 Ga0268266_10059310 Ga0268266_100593105 162
943 3300028379 Ga0268266_11997431 Ga0268266_119974311 162
944 3300031456 Ga0307513_10585594 Ga0307513_105855941 162
945 3300031595 Ga0265313_10001400 Ga0265313_1000140018 162
946 3300031616 Ga0307508_10533142 Ga0307508_105331421 162
947 3300031665 Ga0316575_10000635 Ga0316575_1000063515 162
948 3300031691 Ga0316579_10015621 Ga0316579_100156212 162
949 3300031727 Ga0316576_10080740 Ga0316576_100807404 162
950 3300031728 Ga0316578_10035125 Ga0316578_100351251 162
951 3300032133 Ga0316583_10001515 Ga0316583_1000151510 162
952 3300032137 Ga0316585_10002313 Ga0316585_100023133 162
953 3300032139 Ga0316580_10002044 Ga0316580_100020441 162
954 3300032168 Ga0316593_10043581 Ga0316593_100435813 162
955 3300033180 Ga0307510_10034758 Ga0307510_100347583 162
956 3300033442 Ga0315911_1000004 Ga0315911_1000004426 162
957 3300033541 Ga0316596_1074199 Ga0316596_10741992 162
958 3300035117 Ga0373953_0190987 Ga0373953_0190987_153_656 162
959 3300035118 Ga0373954_0000381 Ga0373954_0000381_188_676 162
960 3300035120 Ga0373957_0197119 Ga0373957_0197119_300_788 162
961 3300035170 Ga0373943_0045634 Ga0373943_0045634_1254_1751 162
962 3300035242 Ga0373962_0137919 Ga0373962_0137919_57_557 162
963 3300035398 Ga0316574_0016544 Ga0316574_0016544_3772_4266 162
964 3300035695 Ga0373927_0026222 Ga0373927_0026222_1894_2391 162
965 3300035695 Ga0373927_0063432 Ga0373927_0063432_16_594 162
966 3300035724 Ga0373933_0068282 Ga0373933_0068282_14_517 162
967 3300035725 Ga0373947_0005469 Ga0373947_0005469_2064_2561 162
968 3300035725 Ga0373947_0079574 Ga0373947_0079574_953_1531 162
969 3300036401 Ga0373937_0151735 Ga0373937_0151735_380_877 162
970 3300036712 Ga0316584_0019546 Ga0316584_0019546_3510_4004 162
971 3300037068 Ga0373925_0003584 Ga0373925_0003584_6959_7456 162
972 3300037068 Ga0373925_0590211 Ga0373925_0590211_153_641 162
973 3300037312 Ga0395899_0031588 Ga0395899_0031588_1902_2390 162
974 3300037418 Ga0395900_0005987 Ga0395900_0005987_1777_2265 162
975 3300037418 Ga0395900_0006562 Ga0395900_0006562_362_850 162
976 3300037418 Ga0395900_0117980 Ga0395900_0117980_2029_2517 162
977 3300037418 Ga0395900_0498116 Ga0395900_0498116_25_513 162
978 3300037466 Ga0395898_0002317 Ga0395898_0002317_5611_6174 162
979 3300037466 Ga0395898_0003901 Ga0395898_0003901_14318_14806 162
980 3300037466 Ga0395898_0027942 Ga0395898_0027942_3036_3524 162
981 3300037471 Ga0395905_0341953 Ga0395905_0341953_780_1268 162
982 3300037588 Ga0316581_0100512 Ga0316581_0100512_135_629 162
983 3300037853 Ga0436364_0166995 Ga0436364_0166995_233_721 162
984 3300037853 Ga0436364_0972203 Ga0436364_0972203_319_807 162
985 3300038443 Ga0395901_0071983 Ga0395901_0071983_1771_2259 162
986 3300038443 Ga0395901_0133538 Ga0395901_0133538_2044_2532 162
987 3300038443 Ga0395901_0273920 Ga0395901_0273920_1140_1628 162
988 3300038443 Ga0395901_0362661 Ga0395901_0362661_219_782 162
989 3300039062 Ga0400483_150976 Ga0400483_150976_56_544 162
990 3300039437 Ga0436365_1099024 Ga0436365_1099024_2188_2676 162
991 3300039437 Ga0436365_1161464 Ga0436365_1161464_984_1472 162
992 3300039437 Ga0436365_1552255 Ga0436365_1552255_83_571 162
993 3300039438 Ga0436360_0503236 Ga0436360_0503236_381_869 162
994 3300039438 Ga0436360_0613744 Ga0436360_0613744_116_604 162
995 3300039438 Ga0436360_0727276 Ga0436360_0727276_90_581 162
996 3300039438 Ga0436360_1374083 Ga0436360_1374083_121_609 162
997 3300039447 Ga0436361_0169041 Ga0436361_0169041_171_659 162
998 3300039447 Ga0436361_0348664 Ga0436361_0348664_936_1424 162
999 3300039447 Ga0436361_0523159 Ga0436361_0523159_931_1422 162
1000 3300039447 Ga0436361_0988201 Ga0436361_0988201_290_781 162
1001 3300039447 Ga0436361_1003794 Ga0436361_1003794_22_510 162
1002 3300039450 Ga0436363_0002469 Ga0436363_0002469_1358_1846 162
1003 3300039450 Ga0436363_1181528 Ga0436363_1181528_869_1357 162
1004 3300039453 Ga0436362_1058248 Ga0436362_1058248_125_613 162
1005 3300039453 Ga0436362_1162318 Ga0436362_1162318_21_548 162
1006 3300041452 Ga0451793_1056189 Ga0451793_1056189_88_576 162
1007 3300041498 Ga0451841_0609926 Ga0451841_0609926_244_732 162
1008 3300041501 Ga0451845_0755152 Ga0451845_0755152_79_567 162
1009 3300041509 Ga0451843_0518491 Ga0451843_0518491_176_664 162
1010 3300041512 Ga0451853_0618708 Ga0451853_0618708_797_1285 162
1011 3300042012 Ga0439455_0105813 Ga0439455_0105813_262_750 162
1012 3300044656 Ga0466969_0127291 Ga0466969_0127291_423_911 162
1013 3300044658 Ga0466972_0000090 Ga0466972_0000090_47953_48441 162
1014 3300044658 Ga0466972_0020304 Ga0466972_0020304_1576_2064 162
1015 3300044658 Ga0466972_0193438 Ga0466972_0193438_384_872 162
1016 3300044683 Ga0466965_0178605 Ga0466965_0178605_448_936 162
1017 3300044684 Ga0466966_0000376 Ga0466966_0000376_16042_16530 162
1018 3300044693 Ga0466961_0001144 Ga0466961_0001144_4804_5292 162
1019 3300044706 Ga0466964_0026879 Ga0466964_0026879_566_1054 162
1020 3300044719 Ga0466971_0314109 Ga0466971_0314109_252_740 162
1021 3300044735 Ga0466968_0031144 Ga0466968_0031144_716_1204 162
1022 3300044842 Ga0466957_1021942 Ga0466957_1021942_62_550 162
1023 3300044901 Ga0466960_0131830 Ga0466960_0131830_746_1234 162
1024 3300045049 Ga0466959_0021227 Ga0466959_0021227_4152_4640 162
1025 3300045049 Ga0466959_0839640 Ga0466959_0839640_34_522 162
1026 3300045049 Ga0466959_0857890 Ga0466959_0857890_80_580 162
1027 3300045976 Ga0466967_0387509 Ga0466967_0387509_837_1325 162
1028 3300045976 Ga0466967_0539393 Ga0466967_0539393_457_945 162
1029 3300045976 Ga0466967_0613773 Ga0466967_0613773_452_952 162
1030 3300045976 Ga0466967_0725137 Ga0466967_0725137_431_919 162
1031 3300046454 Ga0495592_0021995 Ga0495592_0021995_978_1466 162
1032 3300046454 Ga0495592_0043623 Ga0495592_0043623_1644_2132 162
1033 3300046454 Ga0495592_0140714 Ga0495592_0140714_803_1381 162
1034 3300046455 Ga0495603_0001301 Ga0495603_0001301_2937_3434 162
1035 3300046455 Ga0495603_0268188 Ga0495603_0268188_40_531 162
1036 3300046457 Ga0495590_0371023 Ga0495590_0371023_17_505 162
1037 3300046459 Ga0495629_0001832 Ga0495629_0001832_8214_8711 162
1038 3300046459 Ga0495629_0002003 Ga0495629_0002003_6850_7338 162
1039 3300046460 Ga0495638_0003300 Ga0495638_0003300_4475_4963 162
1040 3300046461 Ga0495641_0011270 Ga0495641_0011270_1909_2406 162
1041 3300046462 Ga0495651_0002649 Ga0495651_0002649_3956_4444 162
1042 3300046462 Ga0495651_0017844 Ga0495651_0017844_4016_4504 162
1043 3300046463 Ga0495653_0027297 Ga0495653_0027297_649_1137 162
1044 3300046463 Ga0495653_0129341 Ga0495653_0129341_203_700 162
1045 3300046471 Ga0495650_0241458 Ga0495650_0241458_40_528 162
1046 3300046472 Ga0495580_0000261 Ga0495580_0000261_17501_17998 162
1047 3300046472 Ga0495580_0033388 Ga0495580_0033388_498_1076 162
1048 3300046473 Ga0495582_0078761 Ga0495582_0078761_1297_1794 162
1049 3300046474 Ga0495605_0136661 Ga0495605_0136661_264_752 162
1050 3300046475 Ga0495639_0019487 Ga0495639_0019487_701_1198 162
1051 3300046476 Ga0495662_0026870 Ga0495662_0026870_2222_2710 162
1052 3300046476 Ga0495662_0061704 Ga0495662_0061704_630_1208 162
1053 3300046499 Ga0495594_0000284 Ga0495594_0000284_23192_23689 162
1054 3300046499 Ga0495594_0144858 Ga0495594_0144858_756_1244 162
1055 3300046500 Ga0495596_0105781 Ga0495596_0105781_543_1031 162
1056 3300046506 Ga0495583_0126726 Ga0495583_0126726_15_503 162
1057 3300046507 Ga0495606_0014352 Ga0495606_0014352_1341_1829 162
1058 3300046511 Ga0495608_0009842 Ga0495608_0009842_3172_3660 162
1059 3300046513 Ga0495616_0168201 Ga0495616_0168201_20_508 162
1060 3300046515 Ga0495620_0041665 Ga0495620_0041665_1312_1800 162
1061 3300046516 Ga0495628_0033573 Ga0495628_0033573_2682_3170 162
1062 3300046518 Ga0495631_0067298 Ga0495631_0067298_391_879 162
1063 3300046522 Ga0495643_0022075 Ga0495643_0022075_931_1419 162
1064 3300046524 Ga0495648_0298688 Ga0495648_0298688_14_502 162
1065 3300046526 Ga0495666_0034048 Ga0495666_0034048_308_805 162
1066 3300046529 Ga0495652_0117980 Ga0495652_0117980_210_698 162
1067 3300046529 Ga0495652_0508205 Ga0495652_0508205_57_545 162
1068 3300046530 Ga0495654_0177449 Ga0495654_0177449_375_863 162
1069 3300046531 Ga0495665_0008036 Ga0495665_0008036_3057_3554 162
1070 3300046533 Ga0495640_0024832 Ga0495640_0024832_1621_2109 162
1071 3300046536 Ga0495587_0017270 Ga0495587_0017270_3955_4443 162
1072 3300046538 Ga0495609_0189078 Ga0495609_0189078_240_728 162
1073 3300046543 Ga0495645_0131734 Ga0495645_0131734_694_1182 162
1074 3300046557 Ga0495622_0000747 Ga0495622_0000747_14426_14923 162
1075 3300046557 Ga0495622_0022982 Ga0495622_0022982_296_784 162
1076 3300046559 Ga0495667_0009962 Ga0495667_0009962_235_723 162
1077 3300046559 Ga0495667_0085323 Ga0495667_0085323_1508_2005 162
1078 3300046559 Ga0495667_0383669 Ga0495667_0383669_350_838 162
1079 3300046642 Ga0495634_0029373 Ga0495634_0029373_11_499 162
1080 3300046642 Ga0495634_0053713 Ga0495634_0053713_1254_1751 162
1081 3300046642 Ga0495634_0628857 Ga0495634_0628857_73_561 162
1082 3300046660 Ga0495625_0133608 Ga0495625_0133608_992_1480 162
1083 3300046663 Ga0495635_0011899 Ga0495635_0011899_3563_4051 162
1084 3300046663 Ga0495635_0157775 Ga0495635_0157775_212_709 162
1085 3300046674 Ga0495588_0001508 Ga0495588_0001508_8473_8970 162
1086 3300046674 Ga0495588_0012476 Ga0495588_0012476_2432_2920 162
1087 3300046675 Ga0495657_0009271 Ga0495657_0009271_2568_3056 162
1088 3300046675 Ga0495657_0028992 Ga0495657_0028992_124_612 162
1089 3300046678 Ga0495599_0131157 Ga0495599_0131157_1000_1488 162
1090 3300046679 Ga0495623_0003419 Ga0495623_0003419_3752_4240 162
1091 3300046680 Ga0495646_0006337 Ga0495646_0006337_425_913 162
1092 3300046680 Ga0495646_0290397 Ga0495646_0290397_102_680 162
1093 3300046680 Ga0495646_0365906 Ga0495646_0365906_80_568 162
1094 3300046681 Ga0495647_0197054 Ga0495647_0197054_33_611 162
1095 3300046684 Ga0495669_0222864 Ga0495669_0222864_359_847 162
1096 3300046689 Ga0495613_0009976 Ga0495613_0009976_5300_5797 162
1097 3300046689 Ga0495613_0020985 Ga0495613_0020985_277_855 162
1098 3300046690 Ga0495624_0109087 Ga0495624_0109087_1197_1685 162
1099 3300046690 Ga0495624_0175381 Ga0495624_0175381_334_912 162
1100 3300046809 Ga0495600_0003537 Ga0495600_0003537_6539_7027 162
1101 3300046809 Ga0495600_0045680 Ga0495600_0045680_442_930 162
1102 3300046809 Ga0495600_0309583 Ga0495600_0309583_96_593 162
1103 3300046810 Ga0495660_0158933 Ga0495660_0158933_462_950 162
1104 3300047315 Ga0495581_0000368 Ga0495581_0000368_5033_5530 162
1105 3300047315 Ga0495581_0238264 Ga0495581_0238264_356_847 162
1106 3300047317 Ga0495604_0002688 Ga0495604_0002688_2302_2790 162
1107 3300047317 Ga0495604_0003063 Ga0495604_0003063_120_608 162
1108 3300047319 Ga0495674_0012542 Ga0495674_0012542_6137_6625 162
1109 3300047319 Ga0495674_0387419 Ga0495674_0387419_426_929 162
1110 3300047321 Ga0495676_0013647 Ga0495676_0013647_3831_4319 162
1111 3300047321 Ga0495676_0033223 Ga0495676_0033223_1842_2339 162
1112 3300047321 Ga0495676_0128148 Ga0495676_0128148_671_1159 162
1113 3300047322 Ga0495680_0001592 Ga0495680_0001592_14822_15310 162
1114 3300047322 Ga0495680_0033621 Ga0495680_0033621_604_1101 162
1115 3300047323 Ga0495683_0088990 Ga0495683_0088990_509_997 162
1116 3300047443 Ga0495687_020883 Ga0495687_020883_307_795 162
1117 3300047444 Ga0495675_0355771 Ga0495675_0355771_230_718 162
1118 3300047469 Ga0495673_0027314 Ga0495673_0027314_397_885 162
1119 3300047471 Ga0495684_0003322 Ga0495684_0003322_3456_3944 162
1120 3300047471 Ga0495684_0275799 Ga0495684_0275799_120_617 162
1121 3300047472 Ga0495686_0055651 Ga0495686_0055651_890_1378 162
1122 3300047673 Ga0495593_0002554 Ga0495593_0002554_1148_1645 162
1123 3300048089 Ga0495614_0004726 Ga0495614_0004726_81_578 162
1124 3300048089 Ga0495614_0132890 Ga0495614_0132890_80_568 162
1125 3300048091 Ga0495626_0400195 Ga0495626_0400195_16_504 162
1126 3300048903 Ga0496100_0016219 Ga0496100_0016219_2181_2681 162
1127 3300048903 Ga0496100_0444731 Ga0496100_0444731_488_976 162
1128 3300048903 Ga0496100_1020358 Ga0496100_1020358_130_621 162
1129 3300048904 Ga0496101_0015897 Ga0496101_0015897_3696_4196 162
1130 3300048904 Ga0496101_0816414 Ga0496101_0816414_135_632 162
1131 3300048905 Ga0496102_0010081 Ga0496102_0010081_2155_2655 162
1132 3300048905 Ga0496102_0134368 Ga0496102_0134368_1776_2264 162
1133 3300048905 Ga0496102_0183628 Ga0496102_0183628_1105_1593 162
1134 3300048905 Ga0496102_0908583 Ga0496102_0908583_257_745 162
1135 3300048905 Ga0496102_1439813 Ga0496102_1439813_99_587 162
1136 3300048906 Ga0496103_0021721 Ga0496103_0021721_230_718 162
1137 3300048906 Ga0496103_0608920 Ga0496103_0608920_79_567 162
1138 3300048907 Ga0496104_0004648 Ga0496104_0004648_4393_4881 162
1139 3300048907 Ga0496104_0005053 Ga0496104_0005053_2210_2698 162
1140 3300048907 Ga0496104_0038909 Ga0496104_0038909_2065_2553 162
1141 3300048907 Ga0496104_0042550 Ga0496104_0042550_1219_1719 162
1142 3300048907 Ga0496104_0102698 Ga0496104_0102698_2196_2684 162
1143 3300048907 Ga0496104_0108038 Ga0496104_0108038_1082_1579 162
1144 3300048908 Ga0496105_0001274 Ga0496105_0001274_8713_9201 162
1145 3300048908 Ga0496105_0015741 Ga0496105_0015741_5271_5771 162
1146 3300048908 Ga0496105_0056519 Ga0496105_0056519_1602_2090 162
1147 3300048908 Ga0496105_0337044 Ga0496105_0337044_124_612 162
1148 3300048909 Ga0496106_0005375 Ga0496106_0005375_6601_7089 162
1149 3300048909 Ga0496106_0034118 Ga0496106_0034118_145_645 162
1150 3300048909 Ga0496106_0334408 Ga0496106_0334408_235_723 162
1151 3300048910 Ga0496107_0003657 Ga0496107_0003657_8020_8520 162
1152 3300048910 Ga0496107_0041511 Ga0496107_0041511_1267_1755 162
1153 3300048910 Ga0496107_0045585 Ga0496107_0045585_1256_1744 162
1154 3300048911 Ga0496108_0260738 Ga0496108_0260738_74_574 162
1155 3300048912 Ga0496109_0004541 Ga0496109_0004541_9928_10425 162
1156 3300048912 Ga0496109_0129391 Ga0496109_0129391_518_1015 162
1157 3300048912 Ga0496109_0203959 Ga0496109_0203959_257_745 162
1158 3300048913 Ga0496110_0054167 Ga0496110_0054167_771_1259 162
1159 3300048913 Ga0496110_0059781 Ga0496110_0059781_177_665 162
1160 3300048913 Ga0496110_0071417 Ga0496110_0071417_1402_1890 162
1161 3300048914 Ga0496111_0598531 Ga0496111_0598531_247_735 162
1162 3300048915 Ga0496112_0008228 Ga0496112_0008228_2694_3191 162
1163 3300048915 Ga0496112_0011780 Ga0496112_0011780_1655_2143 162
1164 3300048915 Ga0496112_0093049 Ga0496112_0093049_148_636 162
1165 3300048915 Ga0496112_0175760 Ga0496112_0175760_875_1363 162
1166 3300048915 Ga0496112_0766181 Ga0496112_0766181_278_856 162
1167 3300048916 Ga0496113_0016555 Ga0496113_0016555_3068_3556 162
1168 3300048917 Ga0496114_0002797 Ga0496114_0002797_6830_7330 162
1169 3300048917 Ga0496114_0039763 Ga0496114_0039763_1132_1620 162
1170 3300048917 Ga0496114_0104779 Ga0496114_0104779_300_788 162
1171 3300048918 Ga0496115_0008294 Ga0496115_0008294_4923_5423 162
1172 3300048918 Ga0496115_0101595 Ga0496115_0101595_1764_2252 162
1173 3300048920 Ga0496117_0467314 Ga0496117_0467314_56_544 162
1174 3300048922 Ga0496119_0035093 Ga0496119_0035093_191_679 162
1175 3300048924 Ga0496121_0027882 Ga0496121_0027882_1944_2432 162
1176 3300048924 Ga0496121_0101077 Ga0496121_0101077_386_991 162
1177 3300048924 Ga0496121_0414292 Ga0496121_0414292_361_849 162
1178 3300048925 Ga0496122_0181486 Ga0496122_0181486_355_843 162
1179 3300048927 Ga0496124_0276745 Ga0496124_0276745_96_584 162
1180 3300048929 Ga0496126_0067724 Ga0496126_0067724_433_921 162
1181 3300048929 Ga0496126_0100224 Ga0496126_0100224_417_905 162
1182 3300048929 Ga0496126_0137486 Ga0496126_0137486_1524_2027 162
1183 3300049459 Ga0495678_179405 Ga0495678_179405_134_622 162
1184 3300049568 Ga0501031_0454927 Ga0501031_0454927_278_781 162
1185 3300049569 Ga0501032_0239344 Ga0501032_0239344_190_690 162
1186 3300049571 Ga0501034_0003588 Ga0501034_0003588_15301_15801 162
1187 3300049572 Ga0501036_0004751 Ga0501036_0004751_8252_8752 162
1188 3300049573 Ga0501037_0018958 Ga0501037_0018958_1946_2446 162
1189 3300049574 Ga0501038_0827655 Ga0501038_0827655_73_561 162
1190 3300049575 Ga0501039_0328428 Ga0501039_0328428_212_718 162
1191 3300049578 Ga0501042_0983394 Ga0501042_0983394_98_598 162
1192 3300049579 Ga0501043_0075494 Ga0501043_0075494_1405_1905 162
1193 3300049581 Ga0501047_0020483 Ga0501047_0020483_1981_2481 162
1194 3300049582 Ga0501048_0003860 Ga0501048_0003860_8510_9010 162
1195 3300049586 Ga0501070_0017987 Ga0501070_0017987_3985_4473 162
1196 3300049587 Ga0501071_0271692 Ga0501071_0271692_422_928 162
1197 3300049589 Ga0501073_0212651 Ga0501073_0212651_110_610 162
1198 3300049589 Ga0501073_0650013 Ga0501073_0650013_62_550 162
1199 3300049590 Ga0501074_0001697 Ga0501074_0001697_383_883 162
1200 3300049590 Ga0501074_0711054 Ga0501074_0711054_160_663 162
1201 3300049593 Ga0501077_0399834 Ga0501077_0399834_307_807 162
1202 3300049742 Ga0501080_0002496 Ga0501080_0002496_6582_7082 162
1203 3300049742 Ga0501080_0034681 Ga0501080_0034681_3585_4073 162
1204 3300049742 Ga0501080_0142125 Ga0501080_0142125_617_1111 162
1205 3300049743 Ga0501081_0087063 Ga0501081_0087063_466_972 162
1206 3300049744 Ga0501083_0007005 Ga0501083_0007005_4739_5239 162
1207 3300049823 Ga0501044_0090322 Ga0501044_0090322_1636_2136 162
1208 3300049823 Ga0501044_0340448 Ga0501044_0340448_470_970 162
1209 3300050489 nmdc:mga03683_82299_c1 nmdc:mga03683_82299_c1_597_1085 162
1210 3300050491 nmdc:mga00v17_124062_c1 nmdc:mga00v17_124062_c1_636_1124 162
1211 3300050492 nmdc:mga0yw44_165241_c1 nmdc:mga0yw44_165241_c1_212_700 162
1212 3300050492 nmdc:mga0yw44_738623_c1 nmdc:mga0yw44_738623_c1_154_642 162
1213 3300050493 nmdc:mga0k408_129854_c1 nmdc:mga0k408_129854_c1_609_1097 162
1214 3300050493 nmdc:mga0k408_213672_c1 nmdc:mga0k408_213672_c1_609_1097 162
1215 3300050494 nmdc:mga06z11_123511_c1 nmdc:mga06z11_123511_c1_587_1075 162
1216 3300050496 nmdc:mga07m45_102261_c1 nmdc:mga07m45_102261_c1_664_1152 162
1217 3300050496 nmdc:mga07m45_205513_c1 nmdc:mga07m45_205513_c1_614_1102 162
1218 3300050496 nmdc:mga07m45_531111_c1 nmdc:mga07m45_531111_c1_132_620 162
1219 3300050507 nmdc:mga05p37_622521_c1 nmdc:mga05p37_622521_c1_211_702 162
1220 3300050512 nmdc:mga0n895_174471_c1 nmdc:mga0n895_174471_c1_731_1219 162
1221 3300050516 nmdc:mga0sz30_132270_c1 nmdc:mga0sz30_132270_c1_240_728 162
1222 3300050516 nmdc:mga0sz30_195165_c1 nmdc:mga0sz30_195165_c1_358_846 162
1223 3300050516 nmdc:mga0sz30_223271_c1 nmdc:mga0sz30_223271_c1_272_760 162
1224 3300053077 Ga0495601_0001907 Ga0495601_0001907_9243_9821 162
1225 3300053077 Ga0495601_0004725 Ga0495601_0004725_2995_3483 162
1226 3300053077 Ga0495601_0007199 Ga0495601_0007199_1368_1871 162
1227 3300053077 Ga0495601_0154563 Ga0495601_0154563_283_771 162
1228 3300053077 Ga0495601_0253112 Ga0495601_0253112_365_853 162
1229 3300053078 Ga0495612_0038753 Ga0495612_0038753_970_1548 162
1230 3300053078 Ga0495612_0070359 Ga0495612_0070359_891_1379 162
1231 3300053080 Ga0500635_0207927 Ga0500635_0207927_236_724 162
1232 3300053083 Ga0495655_0232282 Ga0495655_0232282_40_528 162
1233 3300053084 Ga0495595_0014577 Ga0495595_0014577_1736_2236 162
1234 3300053084 Ga0495595_0042157 Ga0495595_0042157_573_1070 162
1235 3300053084 Ga0495595_0114625 Ga0495595_0114625_213_701 162
1236 3300053085 Ga0495619_0020759 Ga0495619_0020759_2248_2751 162
1237 3300053085 Ga0495619_0041314 Ga0495619_0041314_148_636 162
1238 3300053085 Ga0495619_0095556 Ga0495619_0095556_963_1460 162
1239 3300053087 Ga0500643_000057 Ga0500643_000057_53246_53734 162
1240 3300053091 Ga0500647_0023284 Ga0500647_0023284_1344_1832 162
1241 3300053092 Ga0500583_0522955 Ga0500583_0522955_36_524 162
1242 3300053093 Ga0500651_0015044 Ga0500651_0015044_2701_3189 162
1243 3300053094 Ga0500566_0013301 Ga0500566_0013301_3970_4458 162
1244 3300053094 Ga0500566_0128497 Ga0500566_0128497_251_739 162
1245 3300053096 Ga0500641_0009460 Ga0500641_0009460_76_564 162
1246 3300053103 Ga0500555_007068 Ga0500555_007068_692_1180 162
1247 3300053105 Ga0500557_000166 Ga0500557_000166_12954_13442 162
1248 3300053108 Ga0500562_005331 Ga0500562_005331_2685_3173 162
1249 3300053109 Ga0500569_138904 Ga0500569_138904_286_774 162
1250 3300053116 Ga0500592_009627 Ga0500592_009627_993_1481 162
1251 3300053119 Ga0500595_006374 Ga0500595_006374_1754_2296 162
1252 3300053119 Ga0500595_007766 Ga0500595_007766_1991_2479 162
1253 3300053121 Ga0500607_037062 Ga0500607_037062_365_853 162
1254 3300053122 Ga0500608_124583 Ga0500608_124583_102_590 162
1255 3300053125 Ga0500618_019597 Ga0500618_019597_995_1483 162
1256 3300053130 Ga0500642_0000339 Ga0500642_0000339_2581_3069 162
1257 3300053130 Ga0500642_0009945 Ga0500642_0009945_1271_1759 162
1258 3300053133 Ga0500655_006563 Ga0500655_006563_1514_2002 162
1259 3300053138 Ga0500564_049917 Ga0500564_049917_1016_1504 162
1260 3300053139 Ga0500568_0002843 Ga0500568_0002843_1012_1500 162
1261 3300053142 Ga0500577_0167513 Ga0500577_0167513_422_910 162
1262 3300053144 Ga0500585_051361 Ga0500585_051361_103_591 162
1263 3300053148 Ga0500590_019293 Ga0500590_019293_230_718 162
1264 3300053151 Ga0500604_0052467 Ga0500604_0052467_626_1114 162
1265 3300053153 Ga0500616_0022650 Ga0500616_0022650_2417_2905 162
1266 3300053154 Ga0500619_022091 Ga0500619_022091_10_498 162
1267 3300053156 Ga0500622_0219357 Ga0500622_0219357_71_559 162
1268 3300053158 Ga0500627_0035720 Ga0500627_0035720_162_650 162
1269 3300053160 Ga0500633_0145162 Ga0500633_0145162_338_826 162
1270 3300053162 Ga0500638_039905 Ga0500638_039905_1033_1521 162
1271 3300053177 Ga0500636_0009861 Ga0500636_0009861_4036_4524 162
1272 3300053729 Ga0500625_000205 Ga0500625_000205_4574_5062 162
1273 3300053729 Ga0500625_200884 Ga0500625_200884_141_629 162
1274 3300053736 Ga0500599_001758 Ga0500599_001758_775_1263 162
1275 3300053737 Ga0500601_000513 Ga0500601_000513_1946_2434 162
1276 3300054114 Ga0501084_0446612 Ga0501084_0446612_178_672 162
1277 3300054114 Ga0501084_0578713 Ga0501084_0578713_341_847 162
1278 3300059477 Ga0587084_030140 Ga0587084_030140_139_627 162
1279 3300059491 Ga0587070_050959 Ga0587070_050959_164_652 162
1280 3300059493 Ga0587077_138695 Ga0587077_138695_116_604 162
1281 3300059506 Ga0587085_036960 Ga0587085_036960_136_624 162
1282 3300059605 Ga0587106_111468 Ga0587106_111468_33_521 162
1283 3300059622 Ga0587099_035001 Ga0587099_035001_105_593 162
1284 3300059626 Ga0587115_070856 Ga0587115_070856_86_574 162
1285 3300059642 Ga0587069_107743 Ga0587069_107743_26_514 162
1286 3300060344 Ga0587071_148886 Ga0587071_148886_61_549 162
1287 3300060353 Ga0501082_0293842 Ga0501082_0293842_768_1274 162
1288 3300060353 Ga0501082_1140868 Ga0501082_1140868_138_638 162
1289 3300061734 Ga0530510_0289353 Ga0530510_0289353_245_751 162
1290 iso_pu_bacteria 8016613128 8016613828 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

47

183

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sqq-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (apo cubic form 2, f16l mutant) 0.9932 2 153
3fvb-assembly1.cif.gz_A crystal structure of ferritin (bacterioferritin) from brucella melitensis 0.9927 2 153
3gvy-assembly1.cif.gz_B crystal structure of bacterioferritin from r.sphaeroides 0.9916 1 153
3gvy-assembly1.cif.gz_C crystal structure of bacterioferritin from r.sphaeroides 0.9901 1 153
4to9-assembly1.cif.gz_H 2.0a resolution structure of bfrb (n148l) from pseudomonas aeruginosa 0.9893 2 154
ID Description Score Start End Superfamily
5xx9B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.993 1 153 1.20.1260.10
3fvbA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9927 2 153 1.20.1260.10
3gvyB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9916 1 153 1.20.1260.10
af_P0ABD3_1_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9904 1 154 1.20.1260.10
3gvyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9897 1 153 1.20.1260.10

Feature Viewer

pLDDT pTM Quality
94.85 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map