F492630
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1290 | 551 | 1289 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0101077|Ga0496121_0101077_386_991 |
| Length | 201 |
| Sequence | LLDRCLSVSCAGDACLLVLPQDRSKLAKAKNRPQALEFIMQGDPKVIEYLNKGLRHELTAINQYWLHYRLLANWGLSDMAKVWRKESIEEMQHADRITDRIIFLEGFPNMQTLDPLRIGQNVKEVIDCDLAAEMSARALYQEAATHCHSVKDYVTRDLFENLMMDEEHHIDFLETQLDLVNRIGLELYTQKHVGGLETEEH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 102 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 103 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 141 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 147 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 148 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 149 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 150 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 155 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 240 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 255 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 256 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 257 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 258 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 259 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 264 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 265 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 266 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 270 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 272 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 282 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 290 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 291 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 292 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 299 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 300 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 307 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 308 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 315 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 316 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 317 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 318 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 319 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 320 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 321 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 322 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 323 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 324 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 325 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 326 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 327 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 328 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 329 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 330 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 333 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 334 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 335 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 336 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 418 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 419 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 420 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 421 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 422 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 423 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 426 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 427 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 428 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 429 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 430 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 431 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 432 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 433 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 434 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 435 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 436 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 437 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 438 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 481 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 485 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 489 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 491 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 492 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 493 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 494 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 495 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 496 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 497 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 498 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 499 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 500 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 501 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 502 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 503 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 504 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 505 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 506 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 507 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 508 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 509 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 510 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 511 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 512 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 514 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 515 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 516 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 517 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 518 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 519 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 520 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 522 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 523 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 524 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 525 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 526 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 528 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 529 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 530 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 531 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 532 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 533 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 534 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 535 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 536 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 537 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 538 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 550 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 551 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.14 |
| Metatranscriptomes | 1.78 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.27 |
| Nodule | 1.55 |
| Rhizoplane | 5.66 |
| Rhizosphere | 70.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10067365 | 3300001989 | Bacteria | 1119 |
| 2 | JGI24735J21928_10137208 | 3300002067 | Bacteria | 705 |
| 3 | JGI24735J21928_10167818 | 3300002067 | Bacteria | 634 |
| 4 | JGI24750J21931_1033713 | 3300002070 | Bacteria | 759 |
| 5 | JGI24750J21931_1058225 | 3300002070 | Bacteria | 614 |
| 6 | JGI24744J21845_10093490 | 3300002077 | Bacteria | 553 |
| 7 | JGI24742J22300_10048405 | 3300002244 | Bacteria | 767 |
| 8 | JGI25153J46596_10003464 | 3300003215 | Bacteria | 8834 |
| 9 | JGI25160J50197_1010655 | 3300003354 | Bacteria | 3309 |
| 10 | JGI25160J50197_1044824 | 3300003354 | Bacteria | 984 |
| 11 | JGI25404J52841_10012459 | 3300003659 | Bacteria | 1841 |
| 12 | JGI25404J52841_10017379 | 3300003659 | Bacteria | 1559 |
| 13 | Ga0055539_1008167 | 3300003752 | Bacteria | 1314 |
| 14 | Ga0055529_1019281 | 3300003763 | Bacteria | 853 |
| 15 | Ga0055526_1035146 | 3300003771 | Bacteria | 1356 |
| 16 | Ga0055526_1071174 | 3300003771 | Bacteria | 704 |
| 17 | Ga0055531_10002385 | 3300003794 | Bacteria | 12625 |
| 18 | Ga0058861_11722842 | 3300004800 | Bacteria | 631 |
| 19 | Ga0065165_1000866 | 3300005262 | Bacteria | 39512 |
| 20 | Ga0065165_1027432 | 3300005262 | Bacteria | 1857 |
| 21 | Ga0065165_1028002 | 3300005262 | Bacteria | 1827 |
| 22 | Ga0065715_10347024 | 3300005293 | Bacteria | 957 |
| 23 | Ga0070658_10871776 | 3300005327 | Bacteria | 782 |
| 24 | Ga0070683_100020536 | 3300005329 | Bacteria | 5877 |
| 25 | Ga0070683_100037099 | 3300005329 | Bacteria | 4461 |
| 26 | Ga0070690_100163112 | 3300005330 | Bacteria | 1529 |
| 27 | Ga0070690_100304757 | 3300005330 | Bacteria | 1143 |
| 28 | Ga0070690_100586341 | 3300005330 | Bacteria | 845 |
| 29 | Ga0068869_100227656 | 3300005334 | Bacteria | 1480 |
| 30 | Ga0068869_100476503 | 3300005334 | Bacteria | 1038 |
| 31 | Ga0070666_10055910 | 3300005335 | Bacteria | 2664 |
| 32 | Ga0070666_10066299 | 3300005335 | Bacteria | 2450 |
| 33 | Ga0070680_100009562 | 3300005336 | Bacteria | 7447 |
| 34 | Ga0070680_100149075 | 3300005336 | Bacteria | 1964 |
| 35 | Ga0070680_100271572 | 3300005336 | Bacteria | 1436 |
| 36 | Ga0070680_100321609 | 3300005336 | Bacteria | 1313 |
| 37 | Ga0070682_100286069 | 3300005337 | Bacteria | 1204 |
| 38 | Ga0070660_100830413 | 3300005339 | Bacteria | 778 |
| 39 | Ga0070689_100034015 | 3300005340 | Bacteria | 3887 |
| 40 | Ga0070692_10224600 | 3300005345 | Bacteria | 1112 |
| 41 | Ga0070668_100070419 | 3300005347 | Bacteria | 2722 |
| 42 | Ga0070668_100103768 | 3300005347 | Bacteria | 2255 |
| 43 | Ga0070668_100170575 | 3300005347 | Bacteria | 1771 |
| 44 | Ga0070668_100271325 | 3300005347 | Bacteria | 1414 |
| 45 | Ga0070668_100416686 | 3300005347 | Bacteria | 1149 |
| 46 | Ga0070668_100471584 | 3300005347 | Bacteria | 1083 |
| 47 | Ga0070669_100407461 | 3300005353 | Bacteria | 1114 |
| 48 | Ga0070669_100438594 | 3300005353 | Bacteria | 1074 |
| 49 | Ga0070669_101025567 | 3300005353 | Bacteria | 709 |
| 50 | Ga0070675_100820351 | 3300005354 | Bacteria | 851 |
| 51 | Ga0070675_100963929 | 3300005354 | Bacteria | 783 |
| 52 | Ga0070671_100155706 | 3300005355 | Bacteria | 1930 |
| 53 | Ga0070671_100267608 | 3300005355 | Bacteria | 1453 |
| 54 | Ga0070671_100296056 | 3300005355 | Bacteria | 1377 |
| 55 | Ga0070674_100031897 | 3300005356 | Bacteria | 3496 |
| 56 | Ga0070674_100558501 | 3300005356 | Bacteria | 962 |
| 57 | Ga0070674_100660203 | 3300005356 | Bacteria | 890 |
| 58 | Ga0070674_101694092 | 3300005356 | Bacteria | 572 |
| 59 | Ga0070673_100041021 | 3300005364 | Bacteria | 3555 |
| 60 | Ga0070688_100094709 | 3300005365 | Bacteria | 1958 |
| 61 | Ga0070688_100392323 | 3300005365 | Bacteria | 1026 |
| 62 | Ga0070659_101018122 | 3300005366 | Bacteria | 727 |
| 63 | Ga0070667_100080227 | 3300005367 | Bacteria | 2790 |
| 64 | Ga0070667_100081492 | 3300005367 | Bacteria | 2769 |
| 65 | Ga0070667_100151812 | 3300005367 | Bacteria | 2035 |
| 66 | Ga0070667_100154449 | 3300005367 | Bacteria | 2018 |
| 67 | Ga0070667_100593794 | 3300005367 | Bacteria | 1020 |
| 68 | Ga0070667_100797734 | 3300005367 | Bacteria | 877 |
| 69 | Ga0070667_100857454 | 3300005367 | Bacteria | 844 |
| 70 | Ga0070709_10008945 | 3300005434 | Bacteria | 5513 |
| 71 | Ga0070709_10013521 | 3300005434 | Bacteria | 4592 |
| 72 | Ga0070709_10140877 | 3300005434 | Bacteria | 1657 |
| 73 | Ga0070714_100143060 | 3300005435 | Bacteria | 2149 |
| 74 | Ga0070714_100431403 | 3300005435 | Bacteria | 1250 |
| 75 | Ga0070714_100809222 | 3300005435 | Bacteria | 908 |
| 76 | Ga0070714_100854158 | 3300005435 | Bacteria | 883 |
| 77 | Ga0070714_101144525 | 3300005435 | Bacteria | 759 |
| 78 | Ga0070714_101238926 | 3300005435 | Bacteria | 728 |
| 79 | Ga0070713_100041543 | 3300005436 | Bacteria | 3747 |
| 80 | Ga0070713_100072309 | 3300005436 | Bacteria | 2916 |
| 81 | Ga0070710_10000417 | 3300005437 | Bacteria | 19992 |
| 82 | Ga0070710_10001492 | 3300005437 | Bacteria | 11017 |
| 83 | Ga0070710_10214467 | 3300005437 | Bacteria | 1222 |
| 84 | Ga0070710_10400266 | 3300005437 | Bacteria | 920 |
| 85 | Ga0070701_10059454 | 3300005438 | Bacteria | 2010 |
| 86 | Ga0070701_10252452 | 3300005438 | Bacteria | 1066 |
| 87 | Ga0070701_10257512 | 3300005438 | Bacteria | 1056 |
| 88 | Ga0070711_100015591 | 3300005439 | Bacteria | 4811 |
| 89 | Ga0070711_100035694 | 3300005439 | Bacteria | 3326 |
| 90 | Ga0070711_100087582 | 3300005439 | Bacteria | 2236 |
| 91 | Ga0070711_100588768 | 3300005439 | Bacteria | 927 |
| 92 | Ga0070700_100161341 | 3300005441 | Bacteria | 1543 |
| 93 | Ga0070700_100371903 | 3300005441 | Bacteria | 1066 |
| 94 | Ga0070700_100636210 | 3300005441 | Bacteria | 840 |
| 95 | Ga0070694_100220377 | 3300005444 | Bacteria | 1423 |
| 96 | Ga0070663_100030355 | 3300005455 | Bacteria | 3703 |
| 97 | Ga0070663_100032319 | 3300005455 | Bacteria | 3606 |
| 98 | Ga0070663_100034871 | 3300005455 | Bacteria | 3487 |
| 99 | Ga0070663_100160427 | 3300005455 | Bacteria | 1730 |
| 100 | Ga0070663_100173352 | 3300005455 | Bacteria | 1669 |
| 101 | Ga0070663_100260090 | 3300005455 | Bacteria | 1376 |
| 102 | Ga0070663_101034190 | 3300005455 | Bacteria | 715 |
| 103 | Ga0070678_100243174 | 3300005456 | Bacteria | 1506 |
| 104 | Ga0070678_100262735 | 3300005456 | Bacteria | 1452 |
| 105 | Ga0070678_100288955 | 3300005456 | Bacteria | 1389 |
| 106 | Ga0070678_100295614 | 3300005456 | Bacteria | 1374 |
| 107 | Ga0070678_100353203 | 3300005456 | Bacteria | 1264 |
| 108 | Ga0070678_100577948 | 3300005456 | Bacteria | 1001 |
| 109 | Ga0070662_100046557 | 3300005457 | Bacteria | 3116 |
| 110 | Ga0070662_100645672 | 3300005457 | Bacteria | 893 |
| 111 | Ga0070662_100832107 | 3300005457 | Bacteria | 785 |
| 112 | Ga0070681_10042387 | 3300005458 | Bacteria | 4561 |
| 113 | Ga0070681_10170876 | 3300005458 | Bacteria | 2096 |
| 114 | Ga0070681_10222869 | 3300005458 | Bacteria | 1801 |
| 115 | Ga0070681_10451919 | 3300005458 | Bacteria | 1197 |
| 116 | Ga0068867_100189445 | 3300005459 | Bacteria | 1640 |
| 117 | Ga0068867_100601507 | 3300005459 | Bacteria | 959 |
| 118 | Ga0070685_10248771 | 3300005466 | Bacteria | 1177 |
| 119 | Ga0070685_10447051 | 3300005466 | Bacteria | 905 |
| 120 | Ga0070685_10579612 | 3300005466 | Bacteria | 805 |
| 121 | Ga0070706_100164814 | 3300005467 | Bacteria | 2070 |
| 122 | Ga0070706_100345420 | 3300005467 | Bacteria | 1387 |
| 123 | Ga0070706_100426768 | 3300005467 | Bacteria | 1234 |
| 124 | Ga0070698_100066177 | 3300005471 | Bacteria | 3638 |
| 125 | Ga0070698_100075398 | 3300005471 | Bacteria | 3377 |
| 126 | Ga0070698_100536799 | 3300005471 | Bacteria | 1108 |
| 127 | Ga0070699_100002202 | 3300005518 | Bacteria | 17633 |
| 128 | Ga0070699_101070924 | 3300005518 | Bacteria | 740 |
| 129 | Ga0070679_100019564 | 3300005530 | Bacteria | 6587 |
| 130 | Ga0070679_100049981 | 3300005530 | Bacteria | 4165 |
| 131 | Ga0070679_100052225 | 3300005530 | Bacteria | 4072 |
| 132 | Ga0070679_100155309 | 3300005530 | Bacteria | 2263 |
| 133 | Ga0070679_100234569 | 3300005530 | Bacteria | 1794 |
| 134 | Ga0070679_100324814 | 3300005530 | Bacteria | 1488 |
| 135 | Ga0070679_100464047 | 3300005530 | Bacteria | 1211 |
| 136 | Ga0070679_101241476 | 3300005530 | Bacteria | 691 |
| 137 | Ga0070684_100007976 | 3300005535 | Bacteria | 8266 |
| 138 | Ga0070684_100687489 | 3300005535 | Bacteria | 953 |
| 139 | Ga0070684_101000850 | 3300005535 | Bacteria | 784 |
| 140 | Ga0068853_100057591 | 3300005539 | Bacteria | 3354 |
| 141 | Ga0068853_100232537 | 3300005539 | Bacteria | 1687 |
| 142 | Ga0068853_100798726 | 3300005539 | Bacteria | 903 |
| 143 | Ga0068853_101008163 | 3300005539 | Bacteria | 802 |
| 144 | Ga0068853_101079883 | 3300005539 | Bacteria | 774 |
| 145 | Ga0068853_101099154 | 3300005539 | Bacteria | 767 |
| 146 | Ga0070672_100127896 | 3300005543 | Bacteria | 2086 |
| 147 | Ga0070686_100014022 | 3300005544 | Bacteria | 4608 |
| 148 | Ga0070693_100047860 | 3300005547 | Bacteria | 2434 |
| 149 | Ga0070693_100130209 | 3300005547 | Bacteria | 1572 |
| 150 | Ga0070693_100371047 | 3300005547 | Bacteria | 984 |
| 151 | Ga0070693_100456748 | 3300005547 | Bacteria | 898 |
| 152 | Ga0070665_100016553 | 3300005548 | Bacteria | 7392 |
| 153 | Ga0070665_100018194 | 3300005548 | Bacteria | 7048 |
| 154 | Ga0070665_100050420 | 3300005548 | Bacteria | 4176 |
| 155 | Ga0070665_100121319 | 3300005548 | Bacteria | 2615 |
| 156 | Ga0070665_100155157 | 3300005548 | Bacteria | 2291 |
| 157 | Ga0070665_100172127 | 3300005548 | Bacteria | 2166 |
| 158 | Ga0070665_100173152 | 3300005548 | Bacteria | 2159 |
| 159 | Ga0070665_100552691 | 3300005548 | Bacteria | 1163 |
| 160 | Ga0070665_100593670 | 3300005548 | Bacteria | 1120 |
| 161 | Ga0070665_100608603 | 3300005548 | Bacteria | 1106 |
| 162 | Ga0070704_100262773 | 3300005549 | Bacteria | 1423 |
| 163 | Ga0068855_100034049 | 3300005563 | Bacteria | 6077 |
| 164 | Ga0068855_100265428 | 3300005563 | Bacteria | 1911 |
| 165 | Ga0068855_100429882 | 3300005563 | Bacteria | 1443 |
| 166 | Ga0068855_100664013 | 3300005563 | Bacteria | 1118 |
| 167 | Ga0070664_100220459 | 3300005564 | Bacteria | 1697 |
| 168 | Ga0070664_100311921 | 3300005564 | Bacteria | 1424 |
| 169 | Ga0070664_100730249 | 3300005564 | Bacteria | 924 |
| 170 | Ga0070664_100794547 | 3300005564 | Bacteria | 884 |
| 171 | Ga0068857_100063620 | 3300005577 | Bacteria | 3280 |
| 172 | Ga0068857_100077936 | 3300005577 | Bacteria | 2958 |
| 173 | Ga0068857_100532995 | 3300005577 | Bacteria | 1105 |
| 174 | Ga0068857_101506179 | 3300005577 | Bacteria | 656 |
| 175 | Ga0068854_100067757 | 3300005578 | Bacteria | 2601 |
| 176 | Ga0068856_100107968 | 3300005614 | Bacteria | 2779 |
| 177 | Ga0068856_100128710 | 3300005614 | Bacteria | 2536 |
| 178 | Ga0068856_100579133 | 3300005614 | Bacteria | 1144 |
| 179 | Ga0068856_100717653 | 3300005614 | Bacteria | 1020 |
| 180 | Ga0070702_100022746 | 3300005615 | Bacteria | 3320 |
| 181 | Ga0068852_100004969 | 3300005616 | Bacteria | 9453 |
| 182 | Ga0068852_100267549 | 3300005616 | Bacteria | 1644 |
| 183 | Ga0068852_100373699 | 3300005616 | Bacteria | 1397 |
| 184 | Ga0068852_100678265 | 3300005616 | Bacteria | 1040 |
| 185 | Ga0068852_100836352 | 3300005616 | Bacteria | 936 |
| 186 | Ga0068852_101034107 | 3300005616 | Bacteria | 841 |
| 187 | Ga0068859_100151021 | 3300005617 | Bacteria | 2398 |
| 188 | Ga0068859_100335297 | 3300005617 | Bacteria | 1607 |
| 189 | Ga0068864_100012746 | 3300005618 | Bacteria | 6949 |
| 190 | Ga0068864_100327678 | 3300005618 | Bacteria | 1440 |
| 191 | Ga0068864_100489238 | 3300005618 | Bacteria | 1182 |
| 192 | Ga0068864_101771802 | 3300005618 | Bacteria | 623 |
| 193 | Ga0068866_10465704 | 3300005718 | Bacteria | 829 |
| 194 | Ga0068866_11093538 | 3300005718 | Bacteria | 571 |
| 195 | Ga0068861_100170911 | 3300005719 | Bacteria | 1801 |
| 196 | Ga0068861_100336064 | 3300005719 | Bacteria | 1320 |
| 197 | Ga0068861_100599818 | 3300005719 | Bacteria | 1010 |
| 198 | Ga0068861_100886633 | 3300005719 | Bacteria | 844 |
| 199 | Ga0068861_101145498 | 3300005719 | Bacteria | 749 |
| 200 | Ga0068870_10039904 | 3300005840 | Bacteria | 2432 |
| 201 | Ga0068870_10085321 | 3300005840 | Bacteria | 1755 |
| 202 | Ga0068870_10313104 | 3300005840 | Bacteria | 995 |
| 203 | Ga0068863_100460294 | 3300005841 | Bacteria | 1249 |
| 204 | Ga0068863_101140189 | 3300005841 | Bacteria | 785 |
| 205 | Ga0068863_101720090 | 3300005841 | Bacteria | 637 |
| 206 | Ga0068858_100173930 | 3300005842 | Bacteria | 2031 |
| 207 | Ga0068858_100255396 | 3300005842 | Bacteria | 1665 |
| 208 | Ga0068858_100555269 | 3300005842 | Bacteria | 1112 |
| 209 | Ga0068860_100004852 | 3300005843 | Bacteria | 13711 |
| 210 | Ga0068860_100049838 | 3300005843 | Bacteria | 3987 |
| 211 | Ga0068860_100055238 | 3300005843 | Bacteria | 3775 |
| 212 | Ga0068862_100022728 | 3300005844 | Bacteria | 5247 |
| 213 | Ga0068862_100084017 | 3300005844 | Bacteria | 2765 |
| 214 | Ga0068862_100107550 | 3300005844 | Bacteria | 2445 |
| 215 | Ga0068862_100427253 | 3300005844 | Bacteria | 1244 |
| 216 | Ga0081455_10014398 | 3300005937 | Bacteria | 7759 |
| 217 | Ga0081455_10032136 | 3300005937 | Bacteria | 4735 |
| 218 | Ga0081455_10423265 | 3300005937 | Bacteria | 918 |
| 219 | Ga0081538_10039714 | 3300005981 | Bacteria | 3013 |
| 220 | Ga0081540_1003813 | 3300005983 | Bacteria | 11793 |
| 221 | Ga0081540_1008010 | 3300005983 | Bacteria | 7436 |
| 222 | Ga0081540_1024289 | 3300005983 | Bacteria | 3520 |
| 223 | Ga0081540_1029677 | 3300005983 | Bacteria | 3042 |
| 224 | Ga0081540_1114196 | 3300005983 | Bacteria | 1135 |
| 225 | Ga0081540_1210743 | 3300005983 | Bacteria | 699 |
| 226 | Ga0070717_10019823 | 3300006028 | Bacteria | 5280 |
| 227 | Ga0070717_10023292 | 3300006028 | Bacteria | 4905 |
| 228 | Ga0070717_10055976 | 3300006028 | Bacteria | 3256 |
| 229 | Ga0070717_10225669 | 3300006028 | Bacteria | 1648 |
| 230 | Ga0070717_10308958 | 3300006028 | Bacteria | 1407 |
| 231 | Ga0070717_10316938 | 3300006028 | Bacteria | 1389 |
| 232 | Ga0070717_11123073 | 3300006028 | Bacteria | 716 |
| 233 | Ga0075365_10053752 | 3300006038 | Bacteria | 2668 |
| 234 | Ga0075365_10063145 | 3300006038 | Bacteria | 2479 |
| 235 | Ga0075365_10064660 | 3300006038 | Bacteria | 2451 |
| 236 | Ga0075365_10106330 | 3300006038 | Bacteria | 1925 |
| 237 | Ga0075365_10201427 | 3300006038 | Bacteria | 1394 |
| 238 | Ga0075365_10269772 | 3300006038 | Bacteria | 1197 |
| 239 | Ga0075365_10347864 | 3300006038 | Bacteria | 1045 |
| 240 | Ga0075365_10567617 | 3300006038 | Bacteria | 802 |
| 241 | Ga0075368_10021379 | 3300006042 | Bacteria | 2457 |
| 242 | Ga0075368_10038998 | 3300006042 | Bacteria | 1861 |
| 243 | Ga0075368_10075771 | 3300006042 | Bacteria | 1364 |
| 244 | Ga0075368_10088245 | 3300006042 | Bacteria | 1267 |
| 245 | Ga0075368_10096868 | 3300006042 | Bacteria | 1209 |
| 246 | Ga0075368_10106919 | 3300006042 | Bacteria | 1151 |
| 247 | Ga0075363_100007214 | 3300006048 | Bacteria | 5095 |
| 248 | Ga0075363_100016054 | 3300006048 | Bacteria | 3692 |
| 249 | Ga0075363_100026718 | 3300006048 | Bacteria | 2954 |
| 250 | Ga0075364_10207161 | 3300006051 | Bacteria | 1329 |
| 251 | Ga0075364_10249753 | 3300006051 | Bacteria | 1205 |
| 252 | Ga0075364_10338005 | 3300006051 | Bacteria | 1026 |
| 253 | Ga0075364_10386584 | 3300006051 | Bacteria | 954 |
| 254 | Ga0075432_10085523 | 3300006058 | Bacteria | 1148 |
| 255 | Ga0075432_10090801 | 3300006058 | Bacteria | 1118 |
| 256 | Ga0070715_10039691 | 3300006163 | Bacteria | 1963 |
| 257 | Ga0070715_10143542 | 3300006163 | Bacteria | 1162 |
| 258 | Ga0070716_100004688 | 3300006173 | Bacteria | 6556 |
| 259 | Ga0070716_100095473 | 3300006173 | Bacteria | 1810 |
| 260 | Ga0070716_100273694 | 3300006173 | Bacteria | 1161 |
| 261 | Ga0070716_100441086 | 3300006173 | Bacteria | 947 |
| 262 | Ga0070716_100568934 | 3300006173 | Bacteria | 848 |
| 263 | Ga0070712_100006062 | 3300006175 | Bacteria | 7485 |
| 264 | Ga0070712_100277090 | 3300006175 | Bacteria | 1350 |
| 265 | Ga0075362_10074388 | 3300006177 | Bacteria | 1556 |
| 266 | Ga0075362_10091350 | 3300006177 | Bacteria | 1414 |
| 267 | Ga0075362_10098807 | 3300006177 | Bacteria | 1363 |
| 268 | Ga0075367_10015462 | 3300006178 | Bacteria | 4149 |
| 269 | Ga0075367_10026029 | 3300006178 | Bacteria | 3313 |
| 270 | Ga0075367_10042053 | 3300006178 | Bacteria | 2673 |
| 271 | Ga0075367_10093686 | 3300006178 | Bacteria | 1829 |
| 272 | Ga0075367_10098545 | 3300006178 | Bacteria | 1784 |
| 273 | Ga0075367_10414252 | 3300006178 | Bacteria | 853 |
| 274 | Ga0075367_10590870 | 3300006178 | Bacteria | 705 |
| 275 | Ga0075369_10137562 | 3300006186 | Bacteria | 1112 |
| 276 | Ga0075369_10139849 | 3300006186 | Bacteria | 1103 |
| 277 | Ga0075369_10254701 | 3300006186 | Bacteria | 815 |
| 278 | Ga0075366_10154003 | 3300006195 | Bacteria | 1392 |
| 279 | Ga0075366_10399750 | 3300006195 | Bacteria | 845 |
| 280 | Ga0097621_100078787 | 3300006237 | Bacteria | 2738 |
| 281 | Ga0097621_100417483 | 3300006237 | Bacteria | 1204 |
| 282 | Ga0097621_101324606 | 3300006237 | Bacteria | 680 |
| 283 | Ga0075370_10045013 | 3300006353 | Bacteria | 2495 |
| 284 | Ga0075370_10085553 | 3300006353 | Bacteria | 1815 |
| 285 | Ga0075370_10105997 | 3300006353 | Bacteria | 1629 |
| 286 | Ga0075370_10143332 | 3300006353 | Bacteria | 1397 |
| 287 | Ga0075370_10351361 | 3300006353 | Bacteria | 881 |
| 288 | Ga0075370_10384892 | 3300006353 | Bacteria | 840 |
| 289 | Ga0068871_100453465 | 3300006358 | Bacteria | 1150 |
| 290 | Ga0068871_100542323 | 3300006358 | Bacteria | 1053 |
| 291 | Ga0068871_100793371 | 3300006358 | Bacteria | 872 |
| 292 | Ga0068871_100916798 | 3300006358 | Bacteria | 813 |
| 293 | Ga0075428_100169960 | 3300006844 | Bacteria | 2364 |
| 294 | Ga0075428_100304419 | 3300006844 | Bacteria | 1714 |
| 295 | Ga0075431_100162195 | 3300006847 | Bacteria | 2298 |
| 296 | Ga0075431_100470328 | 3300006847 | Bacteria | 1251 |
| 297 | Ga0075434_100083977 | 3300006871 | Bacteria | 3183 |
| 298 | Ga0068865_100046207 | 3300006881 | Bacteria | 2987 |
| 299 | Ga0068865_100335948 | 3300006881 | Bacteria | 1220 |
| 300 | Ga0068865_100814137 | 3300006881 | Bacteria | 807 |
| 301 | Ga0075436_100071375 | 3300006914 | Bacteria | 2401 |
| 302 | Ga0075436_100494498 | 3300006914 | Bacteria | 894 |
| 303 | Ga0097620_100151018 | 3300006931 | Bacteria | 2398 |
| 304 | Ga0097620_100335321 | 3300006931 | Bacteria | 1607 |
| 305 | Ga0099824_1010822 | 3300006942 | Bacteria | 10568 |
| 306 | Ga0099824_1028382 | 3300006942 | Bacteria | 2548 |
| 307 | Ga0099824_1049275 | 3300006942 | Bacteria | 808 |
| 308 | Ga0099822_1005057 | 3300006943 | Bacteria | 17219 |
| 309 | Ga0099823_1040671 | 3300006944 | Bacteria | 3346 |
| 310 | Ga0075435_100082355 | 3300007076 | Bacteria | 2645 |
| 311 | Ga0099794_10088487 | 3300007265 | Bacteria | 1535 |
| 312 | Ga0099795_10030769 | 3300007788 | Bacteria | 1845 |
| 313 | Ga0099795_10088712 | 3300007788 | Bacteria | 1196 |
| 314 | Ga0105250_10216515 | 3300009092 | Bacteria | 811 |
| 315 | Ga0105240_10014591 | 3300009093 | Bacteria | 10720 |
| 316 | Ga0105240_10156831 | 3300009093 | Bacteria | 2706 |
| 317 | Ga0111539_10255977 | 3300009094 | Bacteria | 2038 |
| 318 | Ga0111539_11139549 | 3300009094 | Bacteria | 906 |
| 319 | Ga0111539_11341686 | 3300009094 | Bacteria | 830 |
| 320 | Ga0105245_10068919 | 3300009098 | Bacteria | 3206 |
| 321 | Ga0105245_10329073 | 3300009098 | Bacteria | 1507 |
| 322 | Ga0105245_10768895 | 3300009098 | Bacteria | 1000 |
| 323 | Ga0105247_10010671 | 3300009101 | Bacteria | 5546 |
| 324 | Ga0105247_10036878 | 3300009101 | Bacteria | 2981 |
| 325 | Ga0105247_10050804 | 3300009101 | Bacteria | 2552 |
| 326 | Ga0105247_10327780 | 3300009101 | Bacteria | 1070 |
| 327 | Ga0105247_10407371 | 3300009101 | Bacteria | 970 |
| 328 | Ga0105247_10604295 | 3300009101 | Bacteria | 814 |
| 329 | Ga0105247_10635276 | 3300009101 | Bacteria | 796 |
| 330 | Ga0105247_10906325 | 3300009101 | Bacteria | 681 |
| 331 | Ga0114129_10083313 | 3300009147 | Bacteria | 4443 |
| 332 | Ga0114129_10770696 | 3300009147 | Bacteria | 1230 |
| 333 | Ga0105243_10078293 | 3300009148 | Bacteria | 2691 |
| 334 | Ga0105243_10324676 | 3300009148 | Bacteria | 1404 |
| 335 | Ga0105243_10631919 | 3300009148 | Bacteria | 1035 |
| 336 | Ga0105243_11297237 | 3300009148 | Bacteria | 745 |
| 337 | Ga0105243_11479152 | 3300009148 | Bacteria | 702 |
| 338 | Ga0105241_10037810 | 3300009174 | Bacteria | 3637 |
| 339 | Ga0105241_10412031 | 3300009174 | Bacteria | 1188 |
| 340 | Ga0105241_10528991 | 3300009174 | Bacteria | 1055 |
| 341 | Ga0105241_10594225 | 3300009174 | Bacteria | 999 |
| 342 | Ga0105241_11502248 | 3300009174 | Bacteria | 648 |
| 343 | Ga0105242_10234784 | 3300009176 | Bacteria | 1645 |
| 344 | Ga0105242_10603637 | 3300009176 | Bacteria | 1060 |
| 345 | Ga0105248_10032002 | 3300009177 | Bacteria | 5877 |
| 346 | Ga0105248_10158583 | 3300009177 | Bacteria | 2553 |
| 347 | Ga0105248_10458682 | 3300009177 | Bacteria | 1437 |
| 348 | Ga0105237_10002547 | 3300009545 | Bacteria | 22555 |
| 349 | Ga0105237_10013746 | 3300009545 | Bacteria | 8479 |
| 350 | Ga0105237_10064660 | 3300009545 | Bacteria | 3654 |
| 351 | Ga0105237_10067924 | 3300009545 | Bacteria | 3558 |
| 352 | Ga0105237_10175622 | 3300009545 | Bacteria | 2142 |
| 353 | Ga0105237_10230976 | 3300009545 | Bacteria | 1851 |
| 354 | Ga0105237_10506411 | 3300009545 | Bacteria | 1214 |
| 355 | Ga0105237_10826448 | 3300009545 | Bacteria | 933 |
| 356 | Ga0105238_10054537 | 3300009551 | Bacteria | 4014 |
| 357 | Ga0105238_10096074 | 3300009551 | Bacteria | 2950 |
| 358 | Ga0105238_10130906 | 3300009551 | Bacteria | 2487 |
| 359 | Ga0105238_10315214 | 3300009551 | Bacteria | 1549 |
| 360 | Ga0105238_10523929 | 3300009551 | Bacteria | 1188 |
| 361 | Ga0105238_10725723 | 3300009551 | Bacteria | 1007 |
| 362 | Ga0105238_10824041 | 3300009551 | Bacteria | 944 |
| 363 | Ga0105249_10143590 | 3300009553 | Bacteria | 2291 |
| 364 | Ga0105249_10207839 | 3300009553 | Bacteria | 1919 |
| 365 | Ga0105249_10536720 | 3300009553 | Bacteria | 1219 |
| 366 | Ga0099796_10391085 | 3300010159 | Bacteria | 608 |
| 367 | Ga0105239_10021794 | 3300010375 | Bacteria | 7062 |
| 368 | Ga0105239_10022601 | 3300010375 | Bacteria | 6933 |
| 369 | Ga0105239_10093731 | 3300010375 | Bacteria | 3316 |
| 370 | Ga0105239_10099469 | 3300010375 | Bacteria | 3216 |
| 371 | Ga0105239_10688990 | 3300010375 | Bacteria | 1168 |
| 372 | Ga0105239_10726438 | 3300010375 | Bacteria | 1136 |
| 373 | Ga0105239_11074281 | 3300010375 | Bacteria | 926 |
| 374 | Ga0105239_11150125 | 3300010375 | Bacteria | 894 |
| 375 | Ga0105246_10059706 | 3300011119 | Bacteria | 2646 |
| 376 | Ga0105246_10134639 | 3300011119 | Bacteria | 1850 |
| 377 | Ga0105246_10919517 | 3300011119 | Bacteria | 786 |
| 378 | Ga0105246_11506098 | 3300011119 | Bacteria | 632 |
| 379 | Ga0157373_10431744 | 3300013100 | Bacteria | 946 |
| 380 | Ga0157373_10708077 | 3300013100 | Bacteria | 738 |
| 381 | Ga0157371_10786705 | 3300013102 | Bacteria | 716 |
| 382 | Ga0157370_10243254 | 3300013104 | Bacteria | 1665 |
| 383 | Ga0157370_10249396 | 3300013104 | Bacteria | 1642 |
| 384 | Ga0157369_10026489 | 3300013105 | Bacteria | 6430 |
| 385 | Ga0157369_10034502 | 3300013105 | Bacteria | 5552 |
| 386 | Ga0157369_10124032 | 3300013105 | Bacteria | 2740 |
| 387 | Ga0157369_10932072 | 3300013105 | Bacteria | 890 |
| 388 | Ga0157369_11065831 | 3300013105 | Bacteria | 827 |
| 389 | Ga0157374_10202003 | 3300013296 | Bacteria | 1946 |
| 390 | Ga0157374_10542760 | 3300013296 | Bacteria | 1170 |
| 391 | Ga0157374_10748608 | 3300013296 | Bacteria | 992 |
| 392 | Ga0157378_10045009 | 3300013297 | Bacteria | 3921 |
| 393 | Ga0157378_10340673 | 3300013297 | Bacteria | 1462 |
| 394 | Ga0157378_10366542 | 3300013297 | Bacteria | 1411 |
| 395 | Ga0157378_10381656 | 3300013297 | Bacteria | 1384 |
| 396 | Ga0157378_11504997 | 3300013297 | Bacteria | 718 |
| 397 | Ga0163162_10144491 | 3300013306 | Bacteria | 2494 |
| 398 | Ga0163162_10259131 | 3300013306 | Bacteria | 1871 |
| 399 | Ga0163162_10400455 | 3300013306 | Bacteria | 1505 |
| 400 | Ga0163162_10591094 | 3300013306 | Bacteria | 1237 |
| 401 | Ga0157372_10176783 | 3300013307 | Bacteria | 2471 |
| 402 | Ga0157372_10633039 | 3300013307 | Bacteria | 1246 |
| 403 | Ga0157375_10089567 | 3300013308 | Bacteria | 3133 |
| 404 | Ga0157375_10763161 | 3300013308 | Bacteria | 1118 |
| 405 | Ga0163163_10023107 | 3300014325 | Bacteria | 5898 |
| 406 | Ga0163163_10031785 | 3300014325 | Bacteria | 5097 |
| 407 | Ga0163163_10067293 | 3300014325 | Bacteria | 3561 |
| 408 | Ga0163163_10675613 | 3300014325 | Bacteria | 1096 |
| 409 | Ga0157380_10025361 | 3300014326 | Bacteria | 4496 |
| 410 | Ga0157380_10292763 | 3300014326 | Bacteria | 1496 |
| 411 | Ga0157380_10336143 | 3300014326 | Bacteria | 1407 |
| 412 | Ga0157380_10599357 | 3300014326 | Bacteria | 1090 |
| 413 | Ga0157380_10807635 | 3300014326 | Bacteria | 956 |
| 414 | Ga0182008_10155180 | 3300014497 | Bacteria | 1149 |
| 415 | Ga0157379_10028501 | 3300014968 | Bacteria | 4966 |
| 416 | Ga0157376_10520707 | 3300014969 | Bacteria | 1172 |
| 417 | Ga0157376_10559144 | 3300014969 | Bacteria | 1133 |
| 418 | Ga0157376_11655452 | 3300014969 | Bacteria | 675 |
| 419 | Ga0157376_11699122 | 3300014969 | Bacteria | 666 |
| 420 | Ga0163161_10525797 | 3300017792 | Bacteria | 966 |
| 421 | Ga0163161_10720792 | 3300017792 | Bacteria | 832 |
| 422 | Ga0163161_10951154 | 3300017792 | Bacteria | 731 |
| 423 | Ga0197907_10446942 | 3300020069 | Bacteria | 767 |
| 424 | Ga0206349_1097443 | 3300020075 | Bacteria | 873 |
| 425 | Ga0206355_1264525 | 3300020076 | Bacteria | 858 |
| 426 | Ga0206351_10235379 | 3300020077 | Bacteria | 734 |
| 427 | Ga0206352_11046103 | 3300020078 | Bacteria | 712 |
| 428 | Ga0206350_10726292 | 3300020080 | Bacteria | 890 |
| 429 | Ga0206354_10827935 | 3300020081 | Bacteria | 891 |
| 430 | Ga0206353_11793332 | 3300020082 | Bacteria | 676 |
| 431 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 432 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 433 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 434 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 435 | Ga0213873_10019785 | 3300021358 | Bacteria | 1565 |
| 436 | Ga0213873_10161295 | 3300021358 | Bacteria | 679 |
| 437 | Ga0213873_10240959 | 3300021358 | Bacteria | 571 |
| 438 | Ga0213872_10067877 | 3300021361 | Bacteria | 1609 |
| 439 | Ga0213874_10003990 | 3300021377 | Bacteria | 3324 |
| 440 | Ga0213874_10014556 | 3300021377 | Bacteria | 2059 |
| 441 | Ga0213876_10192735 | 3300021384 | Bacteria | 1084 |
| 442 | Ga0213876_10433693 | 3300021384 | Bacteria | 699 |
| 443 | Ga0213871_10076770 | 3300021441 | Bacteria | 951 |
| 444 | Ga0224712_10147305 | 3300022467 | Bacteria | 1041 |
| 445 | Ga0224712_10328636 | 3300022467 | Bacteria | 719 |
| 446 | Ga0209563_101046 | 3300025230 | Bacteria | 7992 |
| 447 | Ga0209677_101355 | 3300025253 | Bacteria | 10740 |
| 448 | Ga0209677_104016 | 3300025253 | Bacteria | 4435 |
| 449 | Ga0209148_1000253 | 3300025254 | Bacteria | 84643 |
| 450 | Ga0209129_1018292 | 3300025258 | Bacteria | 1349 |
| 451 | Ga0209233_1000985 | 3300025261 | Bacteria | 12162 |
| 452 | Ga0209233_1035856 | 3300025261 | Bacteria | 1116 |
| 453 | Ga0209233_1054537 | 3300025261 | Bacteria | 797 |
| 454 | Ga0209455_1000873 | 3300025272 | Bacteria | 15975 |
| 455 | Ga0209455_1001420 | 3300025272 | Bacteria | 10852 |
| 456 | Ga0209455_1009019 | 3300025272 | Bacteria | 2652 |
| 457 | Ga0209455_1016237 | 3300025272 | Bacteria | 1605 |
| 458 | Ga0209673_1067571 | 3300025273 | Bacteria | 864 |
| 459 | Ga0209564_1002453 | 3300025295 | Bacteria | 14594 |
| 460 | Ga0209564_1054797 | 3300025295 | Bacteria | 938 |
| 461 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 462 | Ga0209758_1000318 | 3300025297 | Bacteria | 92807 |
| 463 | Ga0209758_1001681 | 3300025297 | Bacteria | 24938 |
| 464 | Ga0209758_1001958 | 3300025297 | Bacteria | 22263 |
| 465 | Ga0209758_1002426 | 3300025297 | Bacteria | 19054 |
| 466 | Ga0209758_1028711 | 3300025297 | Bacteria | 2345 |
| 467 | Ga0209758_1047293 | 3300025297 | Bacteria | 1541 |
| 468 | Ga0209050_1073517 | 3300025298 | Bacteria | 754 |
| 469 | Ga0209256_1005534 | 3300025299 | Bacteria | 7219 |
| 470 | Ga0207426_1001230 | 3300025302 | Bacteria | 22561 |
| 471 | Ga0207426_1005043 | 3300025302 | Bacteria | 6190 |
| 472 | Ga0209257_1002140 | 3300025304 | Bacteria | 20574 |
| 473 | Ga0207697_10103745 | 3300025315 | Bacteria | 1213 |
| 474 | Ga0207697_10234688 | 3300025315 | Bacteria | 810 |
| 475 | Ga0207682_10113093 | 3300025893 | Bacteria | 1197 |
| 476 | Ga0207692_10003364 | 3300025898 | Bacteria | 6239 |
| 477 | Ga0207692_10071779 | 3300025898 | Bacteria | 1827 |
| 478 | Ga0207692_10241951 | 3300025898 | Bacteria | 1078 |
| 479 | Ga0207692_10395923 | 3300025898 | Bacteria | 860 |
| 480 | Ga0207710_10075792 | 3300025900 | Bacteria | 1551 |
| 481 | Ga0207710_10480215 | 3300025900 | Bacteria | 644 |
| 482 | Ga0207688_10089210 | 3300025901 | Bacteria | 1769 |
| 483 | Ga0207688_10089241 | 3300025901 | Bacteria | 1768 |
| 484 | Ga0207688_10572607 | 3300025901 | Bacteria | 711 |
| 485 | Ga0207680_10032128 | 3300025903 | Bacteria | 2980 |
| 486 | Ga0207647_10004054 | 3300025904 | Bacteria | 10913 |
| 487 | Ga0207647_10262084 | 3300025904 | Bacteria | 990 |
| 488 | Ga0207647_10435538 | 3300025904 | Bacteria | 736 |
| 489 | Ga0207647_10459310 | 3300025904 | Bacteria | 713 |
| 490 | Ga0207685_10074739 | 3300025905 | Bacteria | 1384 |
| 491 | Ga0207685_10370467 | 3300025905 | Bacteria | 727 |
| 492 | Ga0207699_10000473 | 3300025906 | Bacteria | 20435 |
| 493 | Ga0207699_10121539 | 3300025906 | Bacteria | 1689 |
| 494 | Ga0207699_10231449 | 3300025906 | Bacteria | 1266 |
| 495 | Ga0207699_10279290 | 3300025906 | Bacteria | 1160 |
| 496 | Ga0207645_10718127 | 3300025907 | Bacteria | 679 |
| 497 | Ga0207643_10033091 | 3300025908 | Bacteria | 2892 |
| 498 | Ga0207643_10683462 | 3300025908 | Bacteria | 663 |
| 499 | Ga0207684_10129852 | 3300025910 | Bacteria | 2163 |
| 500 | Ga0207684_10149107 | 3300025910 | Bacteria | 2012 |
| 501 | Ga0207654_10047399 | 3300025911 | Bacteria | 2455 |
| 502 | Ga0207654_10169941 | 3300025911 | Bacteria | 1415 |
| 503 | Ga0207654_10218860 | 3300025911 | Bacteria | 1262 |
| 504 | Ga0207654_10656938 | 3300025911 | Bacteria | 751 |
| 505 | Ga0207707_10001008 | 3300025912 | Bacteria | 27003 |
| 506 | Ga0207707_10005928 | 3300025912 | Bacteria | 10692 |
| 507 | Ga0207707_10398285 | 3300025912 | Bacteria | 1182 |
| 508 | Ga0207695_10000634 | 3300025913 | Bacteria | 70325 |
| 509 | Ga0207695_10043518 | 3300025913 | Bacteria | 4785 |
| 510 | Ga0207671_10007760 | 3300025914 | Bacteria | 9242 |
| 511 | Ga0207671_10027280 | 3300025914 | Bacteria | 4270 |
| 512 | Ga0207671_10051315 | 3300025914 | Bacteria | 3056 |
| 513 | Ga0207671_10156859 | 3300025914 | Bacteria | 1761 |
| 514 | Ga0207671_10222990 | 3300025914 | Bacteria | 1477 |
| 515 | Ga0207671_10246630 | 3300025914 | Bacteria | 1404 |
| 516 | Ga0207671_10247594 | 3300025914 | Bacteria | 1401 |
| 517 | Ga0207671_10927534 | 3300025914 | Bacteria | 688 |
| 518 | Ga0207693_10006327 | 3300025915 | Bacteria | 9817 |
| 519 | Ga0207693_10030096 | 3300025915 | Bacteria | 4287 |
| 520 | Ga0207693_10069142 | 3300025915 | Bacteria | 2764 |
| 521 | Ga0207663_10030431 | 3300025916 | Bacteria | 3184 |
| 522 | Ga0207663_10043308 | 3300025916 | Bacteria | 2755 |
| 523 | Ga0207663_10060300 | 3300025916 | Bacteria | 2404 |
| 524 | Ga0207663_10238315 | 3300025916 | Bacteria | 1333 |
| 525 | Ga0207663_10275857 | 3300025916 | Bacteria | 1247 |
| 526 | Ga0207660_10140017 | 3300025917 | Bacteria | 1849 |
| 527 | Ga0207662_10070034 | 3300025918 | Bacteria | 2121 |
| 528 | Ga0207657_10157818 | 3300025919 | Bacteria | 1844 |
| 529 | Ga0207652_10026858 | 3300025921 | Bacteria | 4797 |
| 530 | Ga0207652_11084181 | 3300025921 | Bacteria | 701 |
| 531 | Ga0207652_11219921 | 3300025921 | Bacteria | 654 |
| 532 | Ga0207652_11341665 | 3300025921 | Bacteria | 618 |
| 533 | Ga0207681_10589821 | 3300025923 | Bacteria | 917 |
| 534 | Ga0207694_10102308 | 3300025924 | Bacteria | 2271 |
| 535 | Ga0207694_10411834 | 3300025924 | Bacteria | 1125 |
| 536 | Ga0207694_10424139 | 3300025924 | Bacteria | 1108 |
| 537 | Ga0207694_10702348 | 3300025924 | Bacteria | 853 |
| 538 | Ga0207694_10798445 | 3300025924 | Bacteria | 797 |
| 539 | Ga0207694_10864496 | 3300025924 | Bacteria | 764 |
| 540 | Ga0207650_10505621 | 3300025925 | Bacteria | 1010 |
| 541 | Ga0207659_10683660 | 3300025926 | Bacteria | 878 |
| 542 | Ga0207659_11280220 | 3300025926 | Bacteria | 630 |
| 543 | Ga0207687_10013234 | 3300025927 | Bacteria | 5387 |
| 544 | Ga0207687_10324016 | 3300025927 | Bacteria | 1248 |
| 545 | Ga0207687_10345988 | 3300025927 | Bacteria | 1210 |
| 546 | Ga0207700_10005697 | 3300025928 | Bacteria | 7480 |
| 547 | Ga0207700_10012732 | 3300025928 | Bacteria | 5438 |
| 548 | Ga0207700_10029241 | 3300025928 | Bacteria | 3886 |
| 549 | Ga0207664_10400900 | 3300025929 | Bacteria | 1220 |
| 550 | Ga0207664_10533297 | 3300025929 | Bacteria | 1052 |
| 551 | Ga0207664_10722934 | 3300025929 | Bacteria | 895 |
| 552 | Ga0207664_10742397 | 3300025929 | Bacteria | 883 |
| 553 | Ga0207664_10859993 | 3300025929 | Bacteria | 815 |
| 554 | Ga0207644_10234760 | 3300025931 | Bacteria | 1458 |
| 555 | Ga0207706_10080045 | 3300025933 | Bacteria | 2873 |
| 556 | Ga0207706_10597116 | 3300025933 | Bacteria | 948 |
| 557 | Ga0207686_10089819 | 3300025934 | Bacteria | 2025 |
| 558 | Ga0207686_10587154 | 3300025934 | Bacteria | 875 |
| 559 | Ga0207686_10761154 | 3300025934 | Bacteria | 774 |
| 560 | Ga0207686_11623737 | 3300025934 | Bacteria | 534 |
| 561 | Ga0207709_10328952 | 3300025935 | Bacteria | 1146 |
| 562 | Ga0207709_10724362 | 3300025935 | Bacteria | 798 |
| 563 | Ga0207670_10026987 | 3300025936 | Bacteria | 3626 |
| 564 | Ga0207670_10570752 | 3300025936 | Bacteria | 926 |
| 565 | Ga0207704_10147895 | 3300025938 | Bacteria | 1653 |
| 566 | Ga0207704_10153434 | 3300025938 | Bacteria | 1628 |
| 567 | Ga0207704_10350831 | 3300025938 | Bacteria | 1149 |
| 568 | Ga0207665_10054422 | 3300025939 | Bacteria | 2698 |
| 569 | Ga0207665_10227011 | 3300025939 | Bacteria | 1371 |
| 570 | Ga0207691_10553016 | 3300025940 | Bacteria | 976 |
| 571 | Ga0207691_10960546 | 3300025940 | Bacteria | 714 |
| 572 | Ga0207711_10124863 | 3300025941 | Bacteria | 2301 |
| 573 | Ga0207689_10246805 | 3300025942 | Bacteria | 1476 |
| 574 | Ga0207661_10013913 | 3300025944 | Bacteria | 5882 |
| 575 | Ga0207661_10030242 | 3300025944 | Bacteria | 4169 |
| 576 | Ga0207679_10702135 | 3300025945 | Bacteria | 918 |
| 577 | Ga0207679_10837688 | 3300025945 | Bacteria | 840 |
| 578 | Ga0207667_10041143 | 3300025949 | Bacteria | 4917 |
| 579 | Ga0207667_10523500 | 3300025949 | Bacteria | 1201 |
| 580 | Ga0207667_10683171 | 3300025949 | Bacteria | 1030 |
| 581 | Ga0207712_10019324 | 3300025961 | Bacteria | 4448 |
| 582 | Ga0207712_10345339 | 3300025961 | Bacteria | 1235 |
| 583 | Ga0207668_10022383 | 3300025972 | Bacteria | 4045 |
| 584 | Ga0207668_10028830 | 3300025972 | Bacteria | 3634 |
| 585 | Ga0207668_10168221 | 3300025972 | Bacteria | 1716 |
| 586 | Ga0207640_10154178 | 3300025981 | Bacteria | 1691 |
| 587 | Ga0207640_10335688 | 3300025981 | Bacteria | 1209 |
| 588 | Ga0207640_10862722 | 3300025981 | Bacteria | 788 |
| 589 | Ga0207658_10235007 | 3300025986 | Bacteria | 1549 |
| 590 | Ga0207658_10345592 | 3300025986 | Bacteria | 1294 |
| 591 | Ga0207658_11038046 | 3300025986 | Bacteria | 748 |
| 592 | Ga0207677_10818622 | 3300026023 | Bacteria | 835 |
| 593 | Ga0207703_10009809 | 3300026035 | Bacteria | 7511 |
| 594 | Ga0207703_10130141 | 3300026035 | Bacteria | 2172 |
| 595 | Ga0207703_10433869 | 3300026035 | Bacteria | 1225 |
| 596 | Ga0207703_10551496 | 3300026035 | Bacteria | 1087 |
| 597 | Ga0207639_10134516 | 3300026041 | Bacteria | 2051 |
| 598 | Ga0207639_10234449 | 3300026041 | Bacteria | 1593 |
| 599 | Ga0207639_10490580 | 3300026041 | Bacteria | 1121 |
| 600 | Ga0207639_11494625 | 3300026041 | Bacteria | 634 |
| 601 | Ga0207678_10020238 | 3300026067 | Bacteria | 5842 |
| 602 | Ga0207678_10035725 | 3300026067 | Bacteria | 4327 |
| 603 | Ga0207678_10045271 | 3300026067 | Bacteria | 3806 |
| 604 | Ga0207678_10070613 | 3300026067 | Bacteria | 2994 |
| 605 | Ga0207678_10378862 | 3300026067 | Bacteria | 1223 |
| 606 | Ga0207708_10033443 | 3300026075 | Bacteria | 3906 |
| 607 | Ga0207708_10234355 | 3300026075 | Bacteria | 1475 |
| 608 | Ga0207708_10301397 | 3300026075 | Bacteria | 1303 |
| 609 | Ga0207702_10178192 | 3300026078 | Bacteria | 1955 |
| 610 | Ga0207702_10204597 | 3300026078 | Bacteria | 1832 |
| 611 | Ga0207702_10302276 | 3300026078 | Bacteria | 1519 |
| 612 | Ga0207702_10455912 | 3300026078 | Bacteria | 1241 |
| 613 | Ga0207641_10315477 | 3300026088 | Bacteria | 1481 |
| 614 | Ga0207641_10627152 | 3300026088 | Bacteria | 1054 |
| 615 | Ga0207641_11509944 | 3300026088 | Bacteria | 673 |
| 616 | Ga0207648_10094412 | 3300026089 | Bacteria | 2615 |
| 617 | Ga0207648_10398043 | 3300026089 | Bacteria | 1247 |
| 618 | Ga0207648_10437454 | 3300026089 | Bacteria | 1189 |
| 619 | Ga0207676_10176877 | 3300026095 | Bacteria | 1865 |
| 620 | Ga0207676_10566698 | 3300026095 | Bacteria | 1087 |
| 621 | Ga0207674_10017324 | 3300026116 | Bacteria | 7860 |
| 622 | Ga0207674_10326633 | 3300026116 | Bacteria | 1484 |
| 623 | Ga0207674_10691940 | 3300026116 | Bacteria | 984 |
| 624 | Ga0207675_100139003 | 3300026118 | Bacteria | 2306 |
| 625 | Ga0207675_100154819 | 3300026118 | Bacteria | 2184 |
| 626 | Ga0207675_100631907 | 3300026118 | Bacteria | 1076 |
| 627 | Ga0207683_10023560 | 3300026121 | Bacteria | 5296 |
| 628 | Ga0207683_10249625 | 3300026121 | Bacteria | 1619 |
| 629 | Ga0207683_10391595 | 3300026121 | Bacteria | 1278 |
| 630 | Ga0207683_11309915 | 3300026121 | Bacteria | 670 |
| 631 | Ga0207698_10102271 | 3300026142 | Bacteria | 2378 |
| 632 | Ga0207698_10264414 | 3300026142 | Bacteria | 1582 |
| 633 | Ga0209389_1000090 | 3300027296 | Bacteria | 83470 |
| 634 | Ga0209389_1000119 | 3300027296 | Bacteria | 70614 |
| 635 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 636 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 637 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 638 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 639 | Ga0209489_100385 | 3300027361 | Bacteria | 79532 |
| 640 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 641 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 642 | Ga0209984_1044705 | 3300027424 | Bacteria | 642 |
| 643 | Ga0209588_1120750 | 3300027671 | Bacteria | 839 |
| 644 | Ga0209813_10027474 | 3300027866 | Bacteria | 1652 |
| 645 | Ga0209813_10197252 | 3300027866 | Bacteria | 744 |
| 646 | Ga0268266_10000446 | 3300028379 | Bacteria | 61283 |
| 647 | Ga0268266_10014950 | 3300028379 | Bacteria | 6663 |
| 648 | Ga0268266_10017902 | 3300028379 | Bacteria | 6038 |
| 649 | Ga0268266_10059310 | 3300028379 | Bacteria | 3297 |
| 650 | Ga0268266_10075473 | 3300028379 | Bacteria | 2928 |
| 651 | Ga0268266_10274114 | 3300028379 | Bacteria | 1567 |
| 652 | Ga0268266_10760074 | 3300028379 | Bacteria | 935 |
| 653 | Ga0268266_11997431 | 3300028379 | Bacteria | 553 |
| 654 | Ga0268265_10124097 | 3300028380 | Bacteria | 2133 |
| 655 | Ga0268265_10208678 | 3300028380 | Bacteria | 1700 |
| 656 | Ga0268265_10636468 | 3300028380 | Bacteria | 1023 |
| 657 | Ga0268264_10000158 | 3300028381 | Bacteria | 153433 |
| 658 | Ga0268264_10446924 | 3300028381 | Bacteria | 1252 |
| 659 | Ga0265337_1021645 | 3300028556 | Bacteria | 2001 |
| 660 | Ga0265326_10001072 | 3300028558 | Bacteria | 9744 |
| 661 | Ga0265319_1018091 | 3300028563 | Bacteria | 2665 |
| 662 | Ga0265334_10006784 | 3300028573 | Bacteria | 4917 |
| 663 | Ga0265318_10016818 | 3300028577 | Bacteria | 3014 |
| 664 | Ga0265323_10000529 | 3300028653 | Bacteria | 21172 |
| 665 | Ga0265336_10000169 | 3300028666 | Bacteria | 45875 |
| 666 | Ga0307517_10001444 | 3300028786 | Bacteria | 39936 |
| 667 | Ga0307517_10091019 | 3300028786 | Bacteria | 2496 |
| 668 | Ga0307515_10069057 | 3300028794 | Bacteria | 4840 |
| 669 | Ga0307515_10555648 | 3300028794 | Bacteria | 758 |
| 670 | Ga0265338_10000624 | 3300028800 | Bacteria | 61670 |
| 671 | Ga0265324_10002965 | 3300029957 | Bacteria | 8306 |
| 672 | Ga0307511_10062880 | 3300030521 | Bacteria | 2811 |
| 673 | Ga0307513_10517498 | 3300031456 | Bacteria | 909 |
| 674 | Ga0307513_10585594 | 3300031456 | Bacteria | 826 |
| 675 | Ga0307509_10043981 | 3300031507 | Bacteria | 4826 |
| 676 | Ga0307509_10073911 | 3300031507 | Bacteria | 3548 |
| 677 | Ga0307509_10384712 | 3300031507 | Bacteria | 1115 |
| 678 | Ga0265313_10001400 | 3300031595 | Bacteria | 22611 |
| 679 | Ga0307508_10000184 | 3300031616 | Bacteria | 75613 |
| 680 | Ga0307508_10007695 | 3300031616 | Bacteria | 10018 |
| 681 | Ga0307508_10339083 | 3300031616 | Bacteria | 1095 |
| 682 | Ga0307508_10533142 | 3300031616 | Bacteria | 771 |
| 683 | Ga0316575_10000635 | 3300031665 | Bacteria | 10352 |
| 684 | Ga0316575_10023931 | 3300031665 | Bacteria | 2363 |
| 685 | Ga0316579_10015621 | 3300031691 | Bacteria | 3301 |
| 686 | Ga0316576_10080740 | 3300031727 | Bacteria | 2412 |
| 687 | Ga0316578_10035125 | 3300031728 | Bacteria | 2880 |
| 688 | Ga0307516_10007195 | 3300031730 | Bacteria | 12842 |
| 689 | Ga0307516_10022096 | 3300031730 | Bacteria | 6538 |
| 690 | Ga0307516_10101395 | 3300031730 | Bacteria | 2694 |
| 691 | Ga0307405_10415765 | 3300031731 | Bacteria | 1057 |
| 692 | Ga0307406_11198040 | 3300031901 | Bacteria | 659 |
| 693 | Ga0307414_10658123 | 3300032004 | Bacteria | 945 |
| 694 | Ga0307415_100061963 | 3300032126 | Bacteria | 2592 |
| 695 | Ga0316583_10001515 | 3300032133 | Bacteria | 7799 |
| 696 | Ga0316585_10002313 | 3300032137 | Bacteria | 5125 |
| 697 | Ga0316580_10002044 | 3300032139 | Bacteria | 5467 |
| 698 | Ga0316593_10043581 | 3300032168 | Bacteria | 1499 |
| 699 | Ga0307507_10011889 | 3300033179 | Bacteria | 10880 |
| 700 | Ga0307510_10009874 | 3300033180 | Bacteria | 11359 |
| 701 | Ga0307510_10034758 | 3300033180 | Bacteria | 5636 |
| 702 | Ga0307510_10163778 | 3300033180 | Bacteria | 1816 |
| 703 | Ga0307510_10243522 | 3300033180 | Bacteria | 1291 |
| 704 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 705 | Ga0316596_1074199 | 3300033541 | Bacteria | 912 |
| 706 | Ga0373930_0008728 | 3300034816 | Bacteria | 1778 |
| 707 | Ga0373950_0057981 | 3300034818 | Bacteria | 772 |
| 708 | Ga0373934_0084208 | 3300035086 | Bacteria | 1279 |
| 709 | Ga0373923_0079720 | 3300035111 | Bacteria | 1418 |
| 710 | Ga0373932_0064100 | 3300035112 | Bacteria | 1124 |
| 711 | Ga0373936_0032215 | 3300035113 | Bacteria | 2072 |
| 712 | Ga0373939_0295107 | 3300035114 | Bacteria | 645 |
| 713 | Ga0373953_0190987 | 3300035117 | Bacteria | 885 |
| 714 | Ga0373953_0315189 | 3300035117 | Bacteria | 683 |
| 715 | Ga0373954_0000381 | 3300035118 | Bacteria | 16501 |
| 716 | Ga0373954_0036923 | 3300035118 | Bacteria | 2269 |
| 717 | Ga0373956_0203287 | 3300035119 | Bacteria | 939 |
| 718 | Ga0373957_0197119 | 3300035120 | Bacteria | 838 |
| 719 | Ga0373943_0017111 | 3300035170 | Bacteria | 3316 |
| 720 | Ga0373943_0045634 | 3300035170 | Bacteria | 2136 |
| 721 | Ga0373943_0359058 | 3300035170 | Bacteria | 836 |
| 722 | Ga0373946_0373444 | 3300035171 | Bacteria | 716 |
| 723 | Ga0373955_0027515 | 3300035172 | Bacteria | 2940 |
| 724 | Ga0373955_0243811 | 3300035172 | Bacteria | 1077 |
| 725 | Ga0373962_0137919 | 3300035242 | Bacteria | 790 |
| 726 | Ga0316574_0016544 | 3300035398 | Bacteria | 4300 |
| 727 | Ga0373931_0060534 | 3300035691 | Bacteria | 2038 |
| 728 | Ga0373935_0010312 | 3300035692 | Bacteria | 5603 |
| 729 | Ga0373935_0041354 | 3300035692 | Bacteria | 2895 |
| 730 | Ga0373927_0026222 | 3300035695 | Bacteria | 3808 |
| 731 | Ga0373927_0053805 | 3300035695 | Bacteria | 2604 |
| 732 | Ga0373927_0063432 | 3300035695 | Bacteria | 2390 |
| 733 | Ga0373927_0271346 | 3300035695 | Bacteria | 1115 |
| 734 | Ga0373927_0559924 | 3300035695 | Bacteria | 755 |
| 735 | Ga0373933_0002890 | 3300035724 | Bacteria | 9602 |
| 736 | Ga0373933_0068282 | 3300035724 | Bacteria | 2159 |
| 737 | Ga0373947_0005469 | 3300035725 | Bacteria | 7415 |
| 738 | Ga0373947_0079574 | 3300035725 | Bacteria | 2026 |
| 739 | Ga0373947_0128709 | 3300035725 | Bacteria | 1614 |
| 740 | Ga0373937_0151735 | 3300036401 | Bacteria | 2170 |
| 741 | Ga0316584_0019546 | 3300036712 | Bacteria | 4897 |
| 742 | Ga0316584_0054000 | 3300036712 | Bacteria | 3006 |
| 743 | Ga0373925_0003584 | 3300037068 | Bacteria | 11964 |
| 744 | Ga0373925_0060136 | 3300037068 | Bacteria | 2853 |
| 745 | Ga0373925_0467058 | 3300037068 | Bacteria | 1034 |
| 746 | Ga0373925_0590211 | 3300037068 | Bacteria | 915 |
| 747 | Ga0373925_1222464 | 3300037068 | Bacteria | 617 |
| 748 | Ga0395899_0031588 | 3300037312 | Bacteria | 3980 |
| 749 | Ga0395900_0005987 | 3300037418 | Bacteria | 12697 |
| 750 | Ga0395900_0006562 | 3300037418 | Bacteria | 12123 |
| 751 | Ga0395900_0117980 | 3300037418 | Bacteria | 2723 |
| 752 | Ga0395900_0319963 | 3300037418 | Bacteria | 1532 |
| 753 | Ga0395900_0498116 | 3300037418 | Bacteria | 1169 |
| 754 | Ga0395898_0002317 | 3300037466 | Bacteria | 22750 |
| 755 | Ga0395898_0003901 | 3300037466 | Bacteria | 16470 |
| 756 | Ga0395898_0027942 | 3300037466 | Bacteria | 5658 |
| 757 | Ga0395905_0024040 | 3300037471 | Bacteria | 5751 |
| 758 | Ga0395905_0172771 | 3300037471 | Bacteria | 2030 |
| 759 | Ga0395905_0212898 | 3300037471 | Bacteria | 1810 |
| 760 | Ga0395905_0341953 | 3300037471 | Bacteria | 1387 |
| 761 | Ga0395905_0375545 | 3300037471 | Bacteria | 1315 |
| 762 | Ga0395905_0672230 | 3300037471 | Bacteria | 938 |
| 763 | Ga0316581_0100512 | 3300037588 | Bacteria | 890 |
| 764 | Ga0436364_0166995 | 3300037853 | Bacteria | 962 |
| 765 | Ga0436364_0972203 | 3300037853 | Bacteria | 1173 |
| 766 | Ga0395901_0071983 | 3300038443 | Bacteria | 3603 |
| 767 | Ga0395901_0133538 | 3300038443 | Bacteria | 2609 |
| 768 | Ga0395901_0273920 | 3300038443 | Bacteria | 1755 |
| 769 | Ga0395901_0304864 | 3300038443 | Bacteria | 1651 |
| 770 | Ga0395901_0362661 | 3300038443 | Bacteria | 1494 |
| 771 | Ga0395901_0769100 | 3300038443 | Bacteria | 955 |
| 772 | Ga0400483_150976 | 3300039062 | Bacteria | 1419 |
| 773 | Ga0436365_0959977 | 3300039437 | Bacteria | 23998 |
| 774 | Ga0436365_1099024 | 3300039437 | Bacteria | 2833 |
| 775 | Ga0436365_1161464 | 3300039437 | Bacteria | 3810 |
| 776 | Ga0436365_1552255 | 3300039437 | Bacteria | 718 |
| 777 | Ga0436365_1809413 | 3300039437 | Bacteria | 2227 |
| 778 | Ga0436360_0470849 | 3300039438 | Bacteria | 1274 |
| 779 | Ga0436360_0503236 | 3300039438 | Bacteria | 1744 |
| 780 | Ga0436360_0613744 | 3300039438 | Bacteria | 816 |
| 781 | Ga0436360_0727276 | 3300039438 | Bacteria | 680 |
| 782 | Ga0436360_1374083 | 3300039438 | Bacteria | 1146 |
| 783 | Ga0436361_0169041 | 3300039447 | Bacteria | 849 |
| 784 | Ga0436361_0348664 | 3300039447 | Bacteria | 2728 |
| 785 | Ga0436361_0523159 | 3300039447 | Bacteria | 3048 |
| 786 | Ga0436361_0988201 | 3300039447 | Bacteria | 910 |
| 787 | Ga0436361_1003794 | 3300039447 | Bacteria | 602 |
| 788 | Ga0436363_0002469 | 3300039450 | Bacteria | 3179 |
| 789 | Ga0436363_0532944 | 3300039450 | Bacteria | 940 |
| 790 | Ga0436363_0602143 | 3300039450 | Bacteria | 631 |
| 791 | Ga0436363_0914045 | 3300039450 | Bacteria | 580 |
| 792 | Ga0436363_1181528 | 3300039450 | Bacteria | 2136 |
| 793 | Ga0436363_1346086 | 3300039450 | Bacteria | 711 |
| 794 | Ga0436362_0651173 | 3300039453 | Bacteria | 657 |
| 795 | Ga0436362_1003352 | 3300039453 | Bacteria | 3365 |
| 796 | Ga0436362_1058248 | 3300039453 | Bacteria | 3068 |
| 797 | Ga0436362_1162318 | 3300039453 | Bacteria | 772 |
| 798 | Ga0436362_1221089 | 3300039453 | Bacteria | 1116 |
| 799 | Ga0451791_1382345 | 3300041451 | Bacteria | 576 |
| 800 | Ga0451793_1056189 | 3300041452 | Bacteria | 891 |
| 801 | Ga0451797_0711704 | 3300041453 | Bacteria | 2480 |
| 802 | Ga0451800_1299814 | 3300041459 | Bacteria | 946 |
| 803 | Ga0451802_0615921 | 3300041460 | Bacteria | 788 |
| 804 | Ga0451804_0979417 | 3300041463 | Bacteria | 677 |
| 805 | Ga0451841_0229262 | 3300041498 | Bacteria | 629 |
| 806 | Ga0451841_0609926 | 3300041498 | Bacteria | 998 |
| 807 | Ga0451845_0755152 | 3300041501 | Bacteria | 629 |
| 808 | Ga0451843_0518491 | 3300041509 | Bacteria | 1032 |
| 809 | Ga0451853_0618708 | 3300041512 | Bacteria | 1399 |
| 810 | Ga0451853_3679622 | 3300041512 | Bacteria | 740 |
| 811 | Ga0439445_0094604 | 3300042004 | Bacteria | 844 |
| 812 | Ga0439455_0105813 | 3300042012 | Bacteria | 780 |
| 813 | Ga0439456_105182 | 3300042013 | Bacteria | 641 |
| 814 | Ga0466969_0127291 | 3300044656 | Bacteria | 1183 |
| 815 | Ga0466972_0000090 | 3300044658 | Bacteria | 82487 |
| 816 | Ga0466972_0020304 | 3300044658 | Bacteria | 3319 |
| 817 | Ga0466972_0193438 | 3300044658 | Bacteria | 953 |
| 818 | Ga0466965_0178605 | 3300044683 | Bacteria | 1119 |
| 819 | Ga0466966_0000376 | 3300044684 | Bacteria | 29152 |
| 820 | Ga0466961_0001144 | 3300044693 | Bacteria | 16294 |
| 821 | Ga0466963_0097174 | 3300044694 | Bacteria | 2012 |
| 822 | Ga0466964_0026879 | 3300044706 | Bacteria | 2255 |
| 823 | Ga0466964_0485825 | 3300044706 | Bacteria | 661 |
| 824 | Ga0466971_0064851 | 3300044719 | Bacteria | 1654 |
| 825 | Ga0466971_0314109 | 3300044719 | Bacteria | 754 |
| 826 | Ga0466968_0031144 | 3300044735 | Bacteria | 2212 |
| 827 | Ga0466970_0357709 | 3300044765 | Bacteria | 829 |
| 828 | Ga0466957_0102949 | 3300044842 | Bacteria | 1802 |
| 829 | Ga0466957_0110589 | 3300044842 | Bacteria | 1742 |
| 830 | Ga0466957_1021942 | 3300044842 | Bacteria | 594 |
| 831 | Ga0466960_0131830 | 3300044901 | Bacteria | 1320 |
| 832 | Ga0466959_0004580 | 3300045049 | Bacteria | 9281 |
| 833 | Ga0466959_0021227 | 3300045049 | Bacteria | 4788 |
| 834 | Ga0466959_0839640 | 3300045049 | Bacteria | 614 |
| 835 | Ga0466959_0857890 | 3300045049 | Bacteria | 606 |
| 836 | Ga0466958_0238972 | 3300045836 | Bacteria | 1160 |
| 837 | Ga0466958_0709949 | 3300045836 | Bacteria | 655 |
| 838 | Ga0466958_0872087 | 3300045836 | Bacteria | 587 |
| 839 | Ga0466967_0045828 | 3300045976 | Bacteria | 3802 |
| 840 | Ga0466967_0045943 | 3300045976 | Bacteria | 3799 |
| 841 | Ga0466967_0124582 | 3300045976 | Bacteria | 2386 |
| 842 | Ga0466967_0145351 | 3300045976 | Bacteria | 2212 |
| 843 | Ga0466967_0387509 | 3300045976 | Bacteria | 1358 |
| 844 | Ga0466967_0509965 | 3300045976 | Bacteria | 1181 |
| 845 | Ga0466967_0539393 | 3300045976 | Bacteria | 1147 |
| 846 | Ga0466967_0613773 | 3300045976 | Bacteria | 1074 |
| 847 | Ga0466967_0725137 | 3300045976 | Bacteria | 985 |
| 848 | Ga0495592_0021995 | 3300046454 | Bacteria | 4852 |
| 849 | Ga0495592_0043623 | 3300046454 | Bacteria | 3354 |
| 850 | Ga0495592_0140714 | 3300046454 | Bacteria | 1679 |
| 851 | Ga0495592_0271327 | 3300046454 | Bacteria | 1113 |
| 852 | Ga0495603_0001301 | 3300046455 | Bacteria | 14523 |
| 853 | Ga0495603_0268188 | 3300046455 | Bacteria | 982 |
| 854 | Ga0495590_0371023 | 3300046457 | Bacteria | 546 |
| 855 | Ga0495629_0001832 | 3300046459 | Bacteria | 16639 |
| 856 | Ga0495629_0002003 | 3300046459 | Bacteria | 15830 |
| 857 | Ga0495638_0003300 | 3300046460 | Bacteria | 12727 |
| 858 | Ga0495641_0011270 | 3300046461 | Bacteria | 5112 |
| 859 | Ga0495651_0002649 | 3300046462 | Bacteria | 13871 |
| 860 | Ga0495651_0017844 | 3300046462 | Bacteria | 5494 |
| 861 | Ga0495653_0027297 | 3300046463 | Bacteria | 4570 |
| 862 | Ga0495653_0129341 | 3300046463 | Bacteria | 1790 |
| 863 | Ga0495650_0241458 | 3300046471 | Bacteria | 617 |
| 864 | Ga0495580_0000261 | 3300046472 | Bacteria | 42129 |
| 865 | Ga0495580_0033388 | 3300046472 | Bacteria | 3709 |
| 866 | Ga0495580_0348846 | 3300046472 | Bacteria | 1003 |
| 867 | Ga0495582_0078761 | 3300046473 | Bacteria | 1828 |
| 868 | Ga0495582_0657951 | 3300046473 | Bacteria | 606 |
| 869 | Ga0495605_0136661 | 3300046474 | Bacteria | 1102 |
| 870 | Ga0495605_0196966 | 3300046474 | Bacteria | 879 |
| 871 | Ga0495639_0012171 | 3300046475 | Bacteria | 3709 |
| 872 | Ga0495639_0019487 | 3300046475 | Bacteria | 2962 |
| 873 | Ga0495662_0026870 | 3300046476 | Bacteria | 2780 |
| 874 | Ga0495662_0061704 | 3300046476 | Bacteria | 1811 |
| 875 | Ga0495664_0099972 | 3300046477 | Bacteria | 1747 |
| 876 | Ga0495664_0124161 | 3300046477 | Bacteria | 1561 |
| 877 | Ga0495594_0000284 | 3300046499 | Bacteria | 24943 |
| 878 | Ga0495594_0144858 | 3300046499 | Bacteria | 1348 |
| 879 | Ga0495596_0105781 | 3300046500 | Bacteria | 1093 |
| 880 | Ga0495583_0126726 | 3300046506 | Bacteria | 1071 |
| 881 | Ga0495606_0014352 | 3300046507 | Bacteria | 6191 |
| 882 | Ga0495606_0112020 | 3300046507 | Bacteria | 1645 |
| 883 | Ga0495606_0284937 | 3300046507 | Bacteria | 901 |
| 884 | Ga0495608_0009842 | 3300046511 | Bacteria | 6672 |
| 885 | Ga0495610_0076882 | 3300046512 | Bacteria | 1543 |
| 886 | Ga0495616_0168201 | 3300046513 | Bacteria | 982 |
| 887 | Ga0495618_0021240 | 3300046514 | Bacteria | 4002 |
| 888 | Ga0495620_0041665 | 3300046515 | Bacteria | 2012 |
| 889 | Ga0495628_0033573 | 3300046516 | Bacteria | 4134 |
| 890 | Ga0495628_0326223 | 3300046516 | Bacteria | 1132 |
| 891 | Ga0495630_0009739 | 3300046517 | Bacteria | 6913 |
| 892 | Ga0495631_0067298 | 3300046518 | Bacteria | 1550 |
| 893 | Ga0495631_0404203 | 3300046518 | Bacteria | 581 |
| 894 | Ga0495632_0188542 | 3300046519 | Bacteria | 942 |
| 895 | Ga0495643_0022075 | 3300046522 | Bacteria | 3638 |
| 896 | Ga0495648_0298688 | 3300046524 | Bacteria | 755 |
| 897 | Ga0495666_0034048 | 3300046526 | Bacteria | 2487 |
| 898 | Ga0495666_0155359 | 3300046526 | Bacteria | 1062 |
| 899 | Ga0495652_0117980 | 3300046529 | Bacteria | 2121 |
| 900 | Ga0495652_0508205 | 3300046529 | Bacteria | 834 |
| 901 | Ga0495654_0177449 | 3300046530 | Bacteria | 925 |
| 902 | Ga0495654_0373361 | 3300046530 | Bacteria | 570 |
| 903 | Ga0495665_0008036 | 3300046531 | Bacteria | 5722 |
| 904 | Ga0495665_0025604 | 3300046531 | Bacteria | 3169 |
| 905 | Ga0495665_0319665 | 3300046531 | Bacteria | 793 |
| 906 | Ga0495665_0602771 | 3300046531 | Bacteria | 549 |
| 907 | Ga0495640_0024832 | 3300046533 | Bacteria | 4354 |
| 908 | Ga0495640_0027591 | 3300046533 | Bacteria | 4093 |
| 909 | Ga0495586_0608057 | 3300046535 | Bacteria | 632 |
| 910 | Ga0495587_0017270 | 3300046536 | Bacteria | 4486 |
| 911 | Ga0495587_0066722 | 3300046536 | Bacteria | 2098 |
| 912 | Ga0495609_0189078 | 3300046538 | Bacteria | 864 |
| 913 | Ga0495645_0131734 | 3300046543 | Bacteria | 1751 |
| 914 | Ga0495622_0000747 | 3300046557 | Bacteria | 18182 |
| 915 | Ga0495622_0022982 | 3300046557 | Bacteria | 2906 |
| 916 | Ga0495622_0103788 | 3300046557 | Bacteria | 1302 |
| 917 | Ga0495633_0178152 | 3300046558 | Bacteria | 979 |
| 918 | Ga0495667_0009962 | 3300046559 | Bacteria | 6437 |
| 919 | Ga0495667_0085323 | 3300046559 | Bacteria | 2049 |
| 920 | Ga0495667_0383669 | 3300046559 | Bacteria | 886 |
| 921 | Ga0495656_0056585 | 3300046615 | Bacteria | 1695 |
| 922 | Ga0495656_0353838 | 3300046615 | Bacteria | 761 |
| 923 | Ga0495634_0029373 | 3300046642 | Bacteria | 3806 |
| 924 | Ga0495634_0053713 | 3300046642 | Bacteria | 2698 |
| 925 | Ga0495634_0598214 | 3300046642 | Bacteria | 640 |
| 926 | Ga0495634_0628857 | 3300046642 | Bacteria | 621 |
| 927 | Ga0495611_0175257 | 3300046648 | Bacteria | 1002 |
| 928 | Ga0495625_0133608 | 3300046660 | Bacteria | 1679 |
| 929 | Ga0495635_0011899 | 3300046663 | Bacteria | 6098 |
| 930 | Ga0495635_0157775 | 3300046663 | Bacteria | 1544 |
| 931 | Ga0495588_0001508 | 3300046674 | Bacteria | 9973 |
| 932 | Ga0495588_0012476 | 3300046674 | Bacteria | 4018 |
| 933 | Ga0495657_0009271 | 3300046675 | Bacteria | 7469 |
| 934 | Ga0495657_0028992 | 3300046675 | Bacteria | 3885 |
| 935 | Ga0495599_0131157 | 3300046678 | Bacteria | 1556 |
| 936 | Ga0495623_0003419 | 3300046679 | Bacteria | 10507 |
| 937 | Ga0495623_0167521 | 3300046679 | Bacteria | 1286 |
| 938 | Ga0495646_0006337 | 3300046680 | Bacteria | 7504 |
| 939 | Ga0495646_0290397 | 3300046680 | Bacteria | 867 |
| 940 | Ga0495646_0365906 | 3300046680 | Bacteria | 753 |
| 941 | Ga0495647_0197054 | 3300046681 | Bacteria | 882 |
| 942 | Ga0495669_0006057 | 3300046684 | Bacteria | 5048 |
| 943 | Ga0495669_0222864 | 3300046684 | Bacteria | 904 |
| 944 | Ga0495669_0275903 | 3300046684 | Bacteria | 808 |
| 945 | Ga0495613_0009976 | 3300046689 | Bacteria | 7056 |
| 946 | Ga0495613_0020985 | 3300046689 | Bacteria | 4869 |
| 947 | Ga0495613_0116257 | 3300046689 | Bacteria | 1924 |
| 948 | Ga0495624_0109087 | 3300046690 | Bacteria | 1702 |
| 949 | Ga0495624_0141573 | 3300046690 | Bacteria | 1473 |
| 950 | Ga0495624_0175381 | 3300046690 | Bacteria | 1307 |
| 951 | Ga0495670_0235340 | 3300046691 | Bacteria | 974 |
| 952 | Ga0495671_0210415 | 3300046692 | Bacteria | 942 |
| 953 | Ga0495649_0162244 | 3300046694 | Bacteria | 1171 |
| 954 | Ga0495589_0113743 | 3300046794 | Bacteria | 1305 |
| 955 | Ga0495600_0003537 | 3300046809 | Bacteria | 9195 |
| 956 | Ga0495600_0045680 | 3300046809 | Bacteria | 2858 |
| 957 | Ga0495600_0309583 | 3300046809 | Bacteria | 995 |
| 958 | Ga0495660_0158933 | 3300046810 | Bacteria | 1110 |
| 959 | Ga0495581_0000368 | 3300047315 | Bacteria | 22619 |
| 960 | Ga0495581_0020871 | 3300047315 | Bacteria | 3801 |
| 961 | Ga0495581_0075374 | 3300047315 | Bacteria | 1952 |
| 962 | Ga0495581_0238264 | 3300047315 | Bacteria | 1064 |
| 963 | Ga0495604_0002688 | 3300047317 | Bacteria | 14257 |
| 964 | Ga0495604_0003063 | 3300047317 | Bacteria | 13358 |
| 965 | Ga0495674_0012542 | 3300047319 | Bacteria | 7983 |
| 966 | Ga0495674_0039664 | 3300047319 | Bacteria | 4219 |
| 967 | Ga0495674_0331756 | 3300047319 | Bacteria | 1237 |
| 968 | Ga0495674_0387419 | 3300047319 | Bacteria | 1130 |
| 969 | Ga0495676_0013647 | 3300047321 | Bacteria | 7291 |
| 970 | Ga0495676_0033223 | 3300047321 | Bacteria | 4348 |
| 971 | Ga0495676_0128148 | 3300047321 | Bacteria | 1836 |
| 972 | Ga0495680_0001592 | 3300047322 | Bacteria | 24241 |
| 973 | Ga0495680_0033621 | 3300047322 | Bacteria | 4149 |
| 974 | Ga0495683_0088990 | 3300047323 | Bacteria | 1498 |
| 975 | Ga0495687_020883 | 3300047443 | Bacteria | 3182 |
| 976 | Ga0495675_0355771 | 3300047444 | Bacteria | 860 |
| 977 | Ga0495677_0053318 | 3300047445 | Bacteria | 1491 |
| 978 | Ga0495679_070245 | 3300047446 | Bacteria | 1010 |
| 979 | Ga0495673_0027314 | 3300047469 | Bacteria | 2718 |
| 980 | Ga0495684_0003322 | 3300047471 | Bacteria | 12621 |
| 981 | Ga0495684_0275799 | 3300047471 | Bacteria | 1215 |
| 982 | Ga0495686_0045638 | 3300047472 | Bacteria | 2772 |
| 983 | Ga0495686_0055651 | 3300047472 | Bacteria | 2473 |
| 984 | Ga0495686_0350239 | 3300047472 | Bacteria | 803 |
| 985 | Ga0495593_0002554 | 3300047673 | Bacteria | 10923 |
| 986 | Ga0495602_0217160 | 3300048088 | Bacteria | 1446 |
| 987 | Ga0495614_0004726 | 3300048089 | Bacteria | 6141 |
| 988 | Ga0495614_0132890 | 3300048089 | Bacteria | 1102 |
| 989 | Ga0495626_0400195 | 3300048091 | Bacteria | 531 |
| 990 | Ga0496100_0016219 | 3300048903 | Bacteria | 4369 |
| 991 | Ga0496100_0320412 | 3300048903 | Bacteria | 1164 |
| 992 | Ga0496100_0444731 | 3300048903 | Bacteria | 993 |
| 993 | Ga0496100_1020358 | 3300048903 | Bacteria | 651 |
| 994 | Ga0496101_0015897 | 3300048904 | Bacteria | 5078 |
| 995 | Ga0496101_0026707 | 3300048904 | Bacteria | 4015 |
| 996 | Ga0496101_0248359 | 3300048904 | Bacteria | 1386 |
| 997 | Ga0496101_0816414 | 3300048904 | Bacteria | 735 |
| 998 | Ga0496102_0010081 | 3300048905 | Bacteria | 8129 |
| 999 | Ga0496102_0134368 | 3300048905 | Bacteria | 2317 |
| 1000 | Ga0496102_0183628 | 3300048905 | Bacteria | 1971 |
| 1001 | Ga0496102_0908583 | 3300048905 | Bacteria | 802 |
| 1002 | Ga0496102_1439813 | 3300048905 | Bacteria | 608 |
| 1003 | Ga0496103_0021721 | 3300048906 | Bacteria | 3862 |
| 1004 | Ga0496103_0608920 | 3300048906 | Bacteria | 695 |
| 1005 | Ga0496104_0004648 | 3300048907 | Bacteria | 11947 |
| 1006 | Ga0496104_0005053 | 3300048907 | Bacteria | 11507 |
| 1007 | Ga0496104_0026218 | 3300048907 | Bacteria | 5378 |
| 1008 | Ga0496104_0038909 | 3300048907 | Bacteria | 4451 |
| 1009 | Ga0496104_0042550 | 3300048907 | Bacteria | 4263 |
| 1010 | Ga0496104_0102698 | 3300048907 | Bacteria | 2738 |
| 1011 | Ga0496104_0108038 | 3300048907 | Bacteria | 2666 |
| 1012 | Ga0496104_0324293 | 3300048907 | Bacteria | 1453 |
| 1013 | Ga0496104_0598343 | 3300048907 | Bacteria | 1013 |
| 1014 | Ga0496105_0001274 | 3300048908 | Bacteria | 17615 |
| 1015 | Ga0496105_0009624 | 3300048908 | Bacteria | 7564 |
| 1016 | Ga0496105_0015741 | 3300048908 | Bacteria | 6035 |
| 1017 | Ga0496105_0056519 | 3300048908 | Bacteria | 3239 |
| 1018 | Ga0496105_0337044 | 3300048908 | Bacteria | 1206 |
| 1019 | Ga0496106_0002771 | 3300048909 | Bacteria | 12986 |
| 1020 | Ga0496106_0005375 | 3300048909 | Bacteria | 9477 |
| 1021 | Ga0496106_0034118 | 3300048909 | Bacteria | 3799 |
| 1022 | Ga0496106_0334408 | 3300048909 | Bacteria | 1216 |
| 1023 | Ga0496107_0003657 | 3300048910 | Bacteria | 10335 |
| 1024 | Ga0496107_0041511 | 3300048910 | Bacteria | 3303 |
| 1025 | Ga0496107_0045585 | 3300048910 | Bacteria | 3155 |
| 1026 | Ga0496107_0054182 | 3300048910 | Bacteria | 2894 |
| 1027 | Ga0496108_0205237 | 3300048911 | Bacteria | 1710 |
| 1028 | Ga0496108_0260738 | 3300048911 | Bacteria | 1508 |
| 1029 | Ga0496109_0004541 | 3300048912 | Bacteria | 11596 |
| 1030 | Ga0496109_0021306 | 3300048912 | Bacteria | 5731 |
| 1031 | Ga0496109_0129391 | 3300048912 | Bacteria | 2356 |
| 1032 | Ga0496109_0203959 | 3300048912 | Bacteria | 1859 |
| 1033 | Ga0496110_0054167 | 3300048913 | Bacteria | 3528 |
| 1034 | Ga0496110_0059781 | 3300048913 | Bacteria | 3360 |
| 1035 | Ga0496110_0071417 | 3300048913 | Bacteria | 3078 |
| 1036 | Ga0496110_0200072 | 3300048913 | Bacteria | 1815 |
| 1037 | Ga0496111_0015228 | 3300048914 | Bacteria | 5273 |
| 1038 | Ga0496111_0598531 | 3300048914 | Bacteria | 807 |
| 1039 | Ga0496112_0008228 | 3300048915 | Bacteria | 9330 |
| 1040 | Ga0496112_0011780 | 3300048915 | Bacteria | 8006 |
| 1041 | Ga0496112_0093049 | 3300048915 | Bacteria | 2984 |
| 1042 | Ga0496112_0175760 | 3300048915 | Bacteria | 2106 |
| 1043 | Ga0496112_0691036 | 3300048915 | Bacteria | 948 |
| 1044 | Ga0496112_0692481 | 3300048915 | Bacteria | 947 |
| 1045 | Ga0496112_0766181 | 3300048915 | Bacteria | 891 |
| 1046 | Ga0496112_0770462 | 3300048915 | Bacteria | 888 |
| 1047 | Ga0496113_0016555 | 3300048916 | Bacteria | 5096 |
| 1048 | Ga0496113_0035431 | 3300048916 | Bacteria | 3649 |
| 1049 | Ga0496113_1288141 | 3300048916 | Bacteria | 569 |
| 1050 | Ga0496114_0002797 | 3300048917 | Bacteria | 13362 |
| 1051 | Ga0496114_0031727 | 3300048917 | Bacteria | 4346 |
| 1052 | Ga0496114_0039763 | 3300048917 | Bacteria | 3892 |
| 1053 | Ga0496114_0104779 | 3300048917 | Bacteria | 2419 |
| 1054 | Ga0496115_0008294 | 3300048918 | Bacteria | 7680 |
| 1055 | Ga0496115_0056477 | 3300048918 | Bacteria | 3155 |
| 1056 | Ga0496115_0101595 | 3300048918 | Bacteria | 2358 |
| 1057 | Ga0496117_0047639 | 3300048920 | Bacteria | 3071 |
| 1058 | Ga0496117_0467314 | 3300048920 | Bacteria | 620 |
| 1059 | Ga0496118_0003945 | 3300048921 | Bacteria | 18140 |
| 1060 | Ga0496118_0013805 | 3300048921 | Bacteria | 7607 |
| 1061 | Ga0496118_0215472 | 3300048921 | Bacteria | 1123 |
| 1062 | Ga0496118_0352446 | 3300048921 | Bacteria | 784 |
| 1063 | Ga0496119_0035093 | 3300048922 | Bacteria | 3291 |
| 1064 | Ga0496119_0210350 | 3300048922 | Bacteria | 1001 |
| 1065 | Ga0496120_0509034 | 3300048923 | Bacteria | 516 |
| 1066 | Ga0496121_0001276 | 3300048924 | Bacteria | 43353 |
| 1067 | Ga0496121_0013094 | 3300048924 | Bacteria | 8953 |
| 1068 | Ga0496121_0027882 | 3300048924 | Bacteria | 5274 |
| 1069 | Ga0496121_0050417 | 3300048924 | Bacteria | 3517 |
| 1070 | Ga0496121_0051312 | 3300048924 | Bacteria | 3475 |
| 1071 | Ga0496121_0083818 | 3300048924 | Bacteria | 2515 |
| 1072 | Ga0496121_0101077 | 3300048924 | Bacteria | 2225 |
| 1073 | Ga0496121_0110977 | 3300048924 | Bacteria | 2092 |
| 1074 | Ga0496121_0124968 | 3300048924 | Bacteria | 1936 |
| 1075 | Ga0496121_0353228 | 3300048924 | Bacteria | 978 |
| 1076 | Ga0496121_0414292 | 3300048924 | Bacteria | 878 |
| 1077 | Ga0496122_0181486 | 3300048925 | Bacteria | 1255 |
| 1078 | Ga0496124_0002134 | 3300048927 | Bacteria | 26572 |
| 1079 | Ga0496124_0112165 | 3300048927 | Bacteria | 2193 |
| 1080 | Ga0496124_0276745 | 3300048927 | Bacteria | 1226 |
| 1081 | Ga0496125_0025231 | 3300048928 | Bacteria | 5449 |
| 1082 | Ga0496125_0037677 | 3300048928 | Bacteria | 4201 |
| 1083 | Ga0496125_0190064 | 3300048928 | Bacteria | 1357 |
| 1084 | Ga0496126_0011362 | 3300048929 | Bacteria | 9230 |
| 1085 | Ga0496126_0012891 | 3300048929 | Bacteria | 8539 |
| 1086 | Ga0496126_0013093 | 3300048929 | Bacteria | 8462 |
| 1087 | Ga0496126_0029811 | 3300048929 | Bacteria | 5179 |
| 1088 | Ga0496126_0067724 | 3300048929 | Bacteria | 3189 |
| 1089 | Ga0496126_0069802 | 3300048929 | Bacteria | 3132 |
| 1090 | Ga0496126_0091500 | 3300048929 | Bacteria | 2674 |
| 1091 | Ga0496126_0100043 | 3300048929 | Bacteria | 2538 |
| 1092 | Ga0496126_0100224 | 3300048929 | Bacteria | 2536 |
| 1093 | Ga0496126_0135983 | 3300048929 | Bacteria | 2120 |
| 1094 | Ga0496126_0137486 | 3300048929 | Bacteria | 2106 |
| 1095 | Ga0496126_0345989 | 3300048929 | Bacteria | 1217 |
| 1096 | Ga0496126_0475360 | 3300048929 | Bacteria | 1002 |
| 1097 | Ga0496126_0569596 | 3300048929 | Bacteria | 896 |
| 1098 | Ga0496126_0661822 | 3300048929 | Bacteria | 816 |
| 1099 | Ga0495678_179405 | 3300049459 | Bacteria | 665 |
| 1100 | Ga0495682_0084705 | 3300049460 | Bacteria | 1139 |
| 1101 | Ga0501031_0454927 | 3300049568 | Bacteria | 827 |
| 1102 | Ga0501032_0239344 | 3300049569 | Bacteria | 1179 |
| 1103 | Ga0501034_0003588 | 3300049571 | Bacteria | 17615 |
| 1104 | Ga0501036_0004751 | 3300049572 | Bacteria | 10966 |
| 1105 | Ga0501036_0901495 | 3300049572 | Bacteria | 726 |
| 1106 | Ga0501037_0018958 | 3300049573 | Bacteria | 5071 |
| 1107 | Ga0501038_0827655 | 3300049574 | Bacteria | 687 |
| 1108 | Ga0501039_0324632 | 3300049575 | Bacteria | 1210 |
| 1109 | Ga0501039_0328428 | 3300049575 | Bacteria | 1202 |
| 1110 | Ga0501039_0409430 | 3300049575 | Bacteria | 1065 |
| 1111 | Ga0501039_0742493 | 3300049575 | Bacteria | 767 |
| 1112 | Ga0501040_0644236 | 3300049576 | Bacteria | 766 |
| 1113 | Ga0501041_0345755 | 3300049577 | Bacteria | 940 |
| 1114 | Ga0501042_0169984 | 3300049578 | Bacteria | 1573 |
| 1115 | Ga0501042_0983394 | 3300049578 | Bacteria | 615 |
| 1116 | Ga0501043_0075494 | 3300049579 | Bacteria | 2647 |
| 1117 | Ga0501047_0020483 | 3300049581 | Bacteria | 6349 |
| 1118 | Ga0501048_0003860 | 3300049582 | Bacteria | 11418 |
| 1119 | Ga0501070_0017987 | 3300049586 | Bacteria | 5931 |
| 1120 | Ga0501071_0271692 | 3300049587 | Bacteria | 1282 |
| 1121 | Ga0501072_0538532 | 3300049588 | Bacteria | 923 |
| 1122 | Ga0501073_0212651 | 3300049589 | Bacteria | 1336 |
| 1123 | Ga0501073_0650013 | 3300049589 | Bacteria | 728 |
| 1124 | Ga0501074_0001697 | 3300049590 | Bacteria | 15002 |
| 1125 | Ga0501074_0711054 | 3300049590 | Bacteria | 709 |
| 1126 | Ga0501077_0399834 | 3300049593 | Bacteria | 878 |
| 1127 | Ga0501079_0300783 | 3300049741 | Bacteria | 1255 |
| 1128 | Ga0501080_0002496 | 3300049742 | Bacteria | 16104 |
| 1129 | Ga0501080_0034681 | 3300049742 | Bacteria | 4712 |
| 1130 | Ga0501080_0142125 | 3300049742 | Bacteria | 2219 |
| 1131 | Ga0501081_0087063 | 3300049743 | Bacteria | 2194 |
| 1132 | Ga0501083_0007005 | 3300049744 | Bacteria | 8002 |
| 1133 | Ga0501044_0090322 | 3300049823 | Bacteria | 3090 |
| 1134 | Ga0501044_0340448 | 3300049823 | Bacteria | 1421 |
| 1135 | nmdc:mga03683_82299_c1 | 3300050489 | Bacteria | 1392 |
| 1136 | nmdc:mga03n38_112700_c1 | 3300050490 | Bacteria | 1327 |
| 1137 | nmdc:mga03n38_19136_c1 | 3300050490 | Bacteria | 2715 |
| 1138 | nmdc:mga03n38_9425_c1 | 3300050490 | Bacteria | 3553 |
| 1139 | nmdc:mga00v17_101091_c1 | 3300050491 | Bacteria | 1820 |
| 1140 | nmdc:mga00v17_124062_c1 | 3300050491 | Bacteria | 1647 |
| 1141 | nmdc:mga0yw44_165241_c1 | 3300050492 | Bacteria | 1451 |
| 1142 | nmdc:mga0yw44_206342_c1 | 3300050492 | Bacteria | 1299 |
| 1143 | nmdc:mga0yw44_53575_c1 | 3300050492 | Bacteria | 2451 |
| 1144 | nmdc:mga0yw44_70549_c1 | 3300050492 | Bacteria | 2166 |
| 1145 | nmdc:mga0yw44_738623_c1 | 3300050492 | Bacteria | 668 |
| 1146 | nmdc:mga0k408_129854_c1 | 3300050493 | Bacteria | 1496 |
| 1147 | nmdc:mga0k408_213672_c1 | 3300050493 | Bacteria | 1152 |
| 1148 | nmdc:mga0k408_216106_c1 | 3300050493 | Bacteria | 1145 |
| 1149 | nmdc:mga0k408_274258_c1 | 3300050493 | Bacteria | 1007 |
| 1150 | nmdc:mga06z11_101998_c1 | 3300050494 | Bacteria | 1576 |
| 1151 | nmdc:mga06z11_115427_c1 | 3300050494 | Bacteria | 1492 |
| 1152 | nmdc:mga06z11_123511_c1 | 3300050494 | Bacteria | 1447 |
| 1153 | nmdc:mga04h51_39692_c1 | 3300050495 | Bacteria | 1530 |
| 1154 | nmdc:mga07m45_102261_c1 | 3300050496 | Bacteria | 1646 |
| 1155 | nmdc:mga07m45_179015_c1 | 3300050496 | Bacteria | 1233 |
| 1156 | nmdc:mga07m45_205513_c1 | 3300050496 | Bacteria | 1146 |
| 1157 | nmdc:mga07m45_251530_c1 | 3300050496 | Bacteria | 1028 |
| 1158 | nmdc:mga07m45_412426_c1 | 3300050496 | Bacteria | 784 |
| 1159 | nmdc:mga07m45_531111_c1 | 3300050496 | Bacteria | 681 |
| 1160 | nmdc:mga07m45_89977_c1 | 3300050496 | Bacteria | 1758 |
| 1161 | nmdc:mga05p37_474979_c1 | 3300050507 | Bacteria | 1442 |
| 1162 | nmdc:mga05p37_622521_c1 | 3300050507 | Bacteria | 1214 |
| 1163 | nmdc:mga09592_421087_c1 | 3300050508 | Bacteria | 1153 |
| 1164 | nmdc:mga0qj67_68083_c1 | 3300050509 | Bacteria | 2837 |
| 1165 | nmdc:mga08y16_511535_c1 | 3300050511 | Bacteria | 1219 |
| 1166 | nmdc:mga0n895_174471_c1 | 3300050512 | Bacteria | 2181 |
| 1167 | nmdc:mga08x19_160725_c1 | 3300050514 | Bacteria | 1525 |
| 1168 | nmdc:mga0sz30_132270_c1 | 3300050516 | Bacteria | 1100 |
| 1169 | nmdc:mga0sz30_195165_c1 | 3300050516 | Bacteria | 899 |
| 1170 | nmdc:mga0sz30_223271_c1 | 3300050516 | Bacteria | 838 |
| 1171 | nmdc:mga0sz30_230778_c1 | 3300050516 | Bacteria | 823 |
| 1172 | Ga0495601_0001907 | 3300053077 | Bacteria | 11671 |
| 1173 | Ga0495601_0004725 | 3300053077 | Bacteria | 7896 |
| 1174 | Ga0495601_0007199 | 3300053077 | Bacteria | 6527 |
| 1175 | Ga0495601_0097696 | 3300053077 | Bacteria | 1895 |
| 1176 | Ga0495601_0154563 | 3300053077 | Bacteria | 1498 |
| 1177 | Ga0495601_0253112 | 3300053077 | Bacteria | 1150 |
| 1178 | Ga0495612_0038753 | 3300053078 | Bacteria | 1937 |
| 1179 | Ga0495612_0070359 | 3300053078 | Bacteria | 1458 |
| 1180 | Ga0500610_0121034 | 3300053079 | Bacteria | 1338 |
| 1181 | Ga0500635_0008869 | 3300053080 | Bacteria | 2772 |
| 1182 | Ga0500635_0016667 | 3300053080 | Bacteria | 2189 |
| 1183 | Ga0500635_0207927 | 3300053080 | Bacteria | 762 |
| 1184 | Ga0495655_0232282 | 3300053083 | Bacteria | 614 |
| 1185 | Ga0495595_0014577 | 3300053084 | Bacteria | 3339 |
| 1186 | Ga0495595_0042157 | 3300053084 | Bacteria | 2091 |
| 1187 | Ga0495595_0114625 | 3300053084 | Bacteria | 1309 |
| 1188 | Ga0495619_0020759 | 3300053085 | Bacteria | 4189 |
| 1189 | Ga0495619_0041314 | 3300053085 | Bacteria | 3016 |
| 1190 | Ga0495619_0095556 | 3300053085 | Bacteria | 2016 |
| 1191 | Ga0495619_0106544 | 3300053085 | Bacteria | 1912 |
| 1192 | Ga0500643_000057 | 3300053087 | Bacteria | 131401 |
| 1193 | Ga0500643_037143 | 3300053087 | Bacteria | 1452 |
| 1194 | Ga0500581_136541 | 3300053089 | Bacteria | 1167 |
| 1195 | Ga0500647_0023284 | 3300053091 | Bacteria | 2904 |
| 1196 | Ga0500583_0522955 | 3300053092 | Bacteria | 554 |
| 1197 | Ga0500651_0015044 | 3300053093 | Bacteria | 4744 |
| 1198 | Ga0500651_0332479 | 3300053093 | Bacteria | 865 |
| 1199 | Ga0500566_0000782 | 3300053094 | Bacteria | 18024 |
| 1200 | Ga0500566_0013301 | 3300053094 | Bacteria | 4845 |
| 1201 | Ga0500566_0069359 | 3300053094 | Bacteria | 1981 |
| 1202 | Ga0500566_0128497 | 3300053094 | Bacteria | 1359 |
| 1203 | Ga0500640_000202 | 3300053095 | Bacteria | 12821 |
| 1204 | Ga0500641_0009460 | 3300053096 | Bacteria | 3506 |
| 1205 | Ga0500554_002164 | 3300053102 | Bacteria | 3819 |
| 1206 | Ga0500554_136372 | 3300053102 | Bacteria | 829 |
| 1207 | Ga0500555_007068 | 3300053103 | Bacteria | 3191 |
| 1208 | Ga0500557_000166 | 3300053105 | Bacteria | 14367 |
| 1209 | Ga0500562_005331 | 3300053108 | Bacteria | 3228 |
| 1210 | Ga0500569_138904 | 3300053109 | Bacteria | 816 |
| 1211 | Ga0500572_000491 | 3300053111 | Bacteria | 13611 |
| 1212 | Ga0500572_000589 | 3300053111 | Bacteria | 12248 |
| 1213 | Ga0500572_169376 | 3300053111 | Bacteria | 715 |
| 1214 | Ga0500582_017624 | 3300053114 | Bacteria | 1958 |
| 1215 | Ga0500592_009627 | 3300053116 | Bacteria | 1537 |
| 1216 | Ga0500595_000941 | 3300053119 | Bacteria | 16447 |
| 1217 | Ga0500595_006374 | 3300053119 | Bacteria | 5012 |
| 1218 | Ga0500595_007766 | 3300053119 | Bacteria | 4429 |
| 1219 | Ga0500595_010224 | 3300053119 | Bacteria | 3738 |
| 1220 | Ga0500607_037062 | 3300053121 | Bacteria | 2659 |
| 1221 | Ga0500608_004402 | 3300053122 | Bacteria | 5450 |
| 1222 | Ga0500608_124583 | 3300053122 | Bacteria | 1163 |
| 1223 | Ga0500614_000997 | 3300053123 | Bacteria | 7029 |
| 1224 | Ga0500618_019597 | 3300053125 | Bacteria | 1663 |
| 1225 | Ga0500642_0000339 | 3300053130 | Bacteria | 15985 |
| 1226 | Ga0500642_0009945 | 3300053130 | Bacteria | 3330 |
| 1227 | Ga0500655_006563 | 3300053133 | Bacteria | 2094 |
| 1228 | Ga0500655_038742 | 3300053133 | Bacteria | 932 |
| 1229 | Ga0500559_0000685 | 3300053136 | Bacteria | 22515 |
| 1230 | Ga0500559_0004967 | 3300053136 | Bacteria | 6182 |
| 1231 | Ga0500564_049917 | 3300053138 | Bacteria | 1915 |
| 1232 | Ga0500568_0002843 | 3300053139 | Bacteria | 9980 |
| 1233 | Ga0500577_0022124 | 3300053142 | Bacteria | 2105 |
| 1234 | Ga0500577_0167513 | 3300053142 | Bacteria | 938 |
| 1235 | Ga0500585_051361 | 3300053144 | Bacteria | 1473 |
| 1236 | Ga0500585_184063 | 3300053144 | Bacteria | 707 |
| 1237 | Ga0500590_019293 | 3300053148 | Bacteria | 3533 |
| 1238 | Ga0500603_000410 | 3300053150 | Bacteria | 11214 |
| 1239 | Ga0500603_001295 | 3300053150 | Bacteria | 5753 |
| 1240 | Ga0500604_0052467 | 3300053151 | Bacteria | 1262 |
| 1241 | Ga0500616_0022650 | 3300053153 | Bacteria | 3505 |
| 1242 | Ga0500619_022091 | 3300053154 | Bacteria | 1842 |
| 1243 | Ga0500619_145257 | 3300053154 | Bacteria | 808 |
| 1244 | Ga0500622_0137036 | 3300053156 | Bacteria | 1171 |
| 1245 | Ga0500622_0219357 | 3300053156 | Bacteria | 853 |
| 1246 | Ga0500627_0035720 | 3300053158 | Bacteria | 2112 |
| 1247 | Ga0500630_004401 | 3300053159 | Bacteria | 6860 |
| 1248 | Ga0500633_0084953 | 3300053160 | Bacteria | 1150 |
| 1249 | Ga0500633_0145162 | 3300053160 | Bacteria | 889 |
| 1250 | Ga0500634_0080110 | 3300053161 | Bacteria | 1685 |
| 1251 | Ga0500638_000054 | 3300053162 | Bacteria | 23606 |
| 1252 | Ga0500638_006087 | 3300053162 | Bacteria | 4896 |
| 1253 | Ga0500638_039905 | 3300053162 | Bacteria | 2279 |
| 1254 | Ga0500638_153202 | 3300053162 | Bacteria | 1023 |
| 1255 | Ga0500639_000014 | 3300053163 | Bacteria | 122926 |
| 1256 | Ga0500639_019925 | 3300053163 | Bacteria | 3536 |
| 1257 | Ga0500636_0009861 | 3300053177 | Bacteria | 5560 |
| 1258 | Ga0500636_0242554 | 3300053177 | Bacteria | 924 |
| 1259 | Ga0500636_0334024 | 3300053177 | Bacteria | 731 |
| 1260 | Ga0500637_0000775 | 3300053178 | Bacteria | 12832 |
| 1261 | Ga0500637_0359574 | 3300053178 | Bacteria | 771 |
| 1262 | Ga0500576_118601 | 3300053725 | Bacteria | 1047 |
| 1263 | Ga0500657_060034 | 3300053728 | Bacteria | 1703 |
| 1264 | Ga0500625_000205 | 3300053729 | Bacteria | 13352 |
| 1265 | Ga0500625_200884 | 3300053729 | Bacteria | 667 |
| 1266 | Ga0500645_041952 | 3300053730 | Bacteria | 1350 |
| 1267 | Ga0500552_001084 | 3300053733 | Bacteria | 2571 |
| 1268 | Ga0500596_000125 | 3300053735 | Bacteria | 11135 |
| 1269 | Ga0500596_001106 | 3300053735 | Bacteria | 5421 |
| 1270 | Ga0500596_003950 | 3300053735 | Bacteria | 2767 |
| 1271 | Ga0500599_001758 | 3300053736 | Bacteria | 2533 |
| 1272 | Ga0500601_000513 | 3300053737 | Bacteria | 5941 |
| 1273 | Ga0501084_0446612 | 3300054114 | Bacteria | 1093 |
| 1274 | Ga0501084_0578713 | 3300054114 | Bacteria | 949 |
| 1275 | Ga0501084_1243030 | 3300054114 | Bacteria | 625 |
| 1276 | Ga0587084_030140 | 3300059477 | Bacteria | 869 |
| 1277 | Ga0587070_050959 | 3300059491 | Bacteria | 826 |
| 1278 | Ga0587077_138695 | 3300059493 | Bacteria | 624 |
| 1279 | Ga0587085_036960 | 3300059506 | Bacteria | 832 |
| 1280 | Ga0587106_111468 | 3300059605 | Bacteria | 570 |
| 1281 | Ga0587099_035001 | 3300059622 | Bacteria | 624 |
| 1282 | Ga0587115_070856 | 3300059626 | Bacteria | 602 |
| 1283 | Ga0587067_146027 | 3300059640 | Bacteria | 590 |
| 1284 | Ga0587069_107743 | 3300059642 | Bacteria | 577 |
| 1285 | Ga0587071_148886 | 3300060344 | Bacteria | 581 |
| 1286 | Ga0501082_0293842 | 3300060353 | Bacteria | 1415 |
| 1287 | Ga0501082_1140868 | 3300060353 | Bacteria | 681 |
| 1288 | Ga0530510_0289353 | 3300061734 | Bacteria | 1225 |
| 1289 | Ga0530510_0743946 | 3300061734 | Bacteria | 748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100321609 | Ga0070680_1003216092 | 160 |
| 2 | 3300005347 | Ga0070668_100271325 | Ga0070668_1002713251 | 160 |
| 3 | 3300005367 | Ga0070667_100593794 | Ga0070667_1005937942 | 160 |
| 4 | 3300005458 | Ga0070681_10222869 | Ga0070681_102228693 | 160 |
| 5 | 3300005471 | Ga0070698_100066177 | Ga0070698_1000661773 | 160 |
| 6 | 3300005518 | Ga0070699_100002202 | Ga0070699_10000220216 | 160 |
| 7 | 3300005530 | Ga0070679_100155309 | Ga0070679_1001553093 | 160 |
| 8 | 3300005563 | Ga0068855_100265428 | Ga0068855_1002654284 | 160 |
| 9 | 3300005719 | Ga0068861_100886633 | Ga0068861_1008866332 | 160 |
| 10 | 3300005719 | Ga0068861_101145498 | Ga0068861_1011454982 | 160 |
| 11 | 3300006028 | Ga0070717_10023292 | Ga0070717_100232922 | 160 |
| 12 | 3300006042 | Ga0075368_10088245 | Ga0075368_100882452 | 160 |
| 13 | 3300006177 | Ga0075362_10091350 | Ga0075362_100913502 | 160 |
| 14 | 3300006353 | Ga0075370_10351361 | Ga0075370_103513611 | 160 |
| 15 | 3300006914 | Ga0075436_100494498 | Ga0075436_1004944981 | 160 |
| 16 | 3300009148 | Ga0105243_11297237 | Ga0105243_112972371 | 160 |
| 17 | 3300009148 | Ga0105243_11479152 | Ga0105243_114791521 | 160 |
| 18 | 3300009545 | Ga0105237_10826448 | Ga0105237_108264481 | 160 |
| 19 | 3300011119 | Ga0105246_11506098 | Ga0105246_115060981 | 160 |
| 20 | 3300025924 | Ga0207694_10424139 | Ga0207694_104241392 | 160 |
| 21 | 3300026088 | Ga0207641_10315477 | Ga0207641_103154772 | 160 |
| 22 | 3300039450 | Ga0436363_0914045 | Ga0436363_0914045_29_556 | 160 |
| 23 | 3300047319 | Ga0495674_0039664 | Ga0495674_0039664_2026_2598 | 160 |
| 24 | 3300048921 | Ga0496118_0215472 | Ga0496118_0215472_356_859 | 160 |
| 25 | 3300049572 | Ga0501036_0901495 | Ga0501036_0901495_12_497 | 160 |
| 26 | 3300049575 | Ga0501039_0409430 | Ga0501039_0409430_476_961 | 160 |
| 27 | 3300049575 | Ga0501039_0742493 | Ga0501039_0742493_98_583 | 160 |
| 28 | 3300049576 | Ga0501040_0644236 | Ga0501040_0644236_21_506 | 160 |
| 29 | 3300049577 | Ga0501041_0345755 | Ga0501041_0345755_300_800 | 160 |
| 30 | 3300049588 | Ga0501072_0538532 | Ga0501072_0538532_149_634 | 160 |
| 31 | 3300049741 | Ga0501079_0300783 | Ga0501079_0300783_289_849 | 160 |
| 32 | 3300050516 | nmdc:mga0sz30_230778_c1 | nmdc:mga0sz30_230778_c1_218_733 | 160 |
| 33 | 3300061734 | Ga0530510_0743946 | Ga0530510_0743946_26_511 | 160 |
| 34 | 3300002070 | JGI24750J21931_1033713 | JGI24750J21931_10337131 | 161 |
| 35 | 3300002070 | JGI24750J21931_1058225 | JGI24750J21931_10582251 | 161 |
| 36 | 3300002077 | JGI24744J21845_10093490 | JGI24744J21845_100934901 | 161 |
| 37 | 3300002244 | JGI24742J22300_10048405 | JGI24742J22300_100484052 | 161 |
| 38 | 3300003659 | JGI25404J52841_10012459 | JGI25404J52841_100124591 | 161 |
| 39 | 3300003659 | JGI25404J52841_10017379 | JGI25404J52841_100173792 | 161 |
| 40 | 3300003752 | Ga0055539_1008167 | Ga0055539_10081672 | 161 |
| 41 | 3300003763 | Ga0055529_1019281 | Ga0055529_10192811 | 161 |
| 42 | 3300004800 | Ga0058861_11722842 | Ga0058861_117228421 | 161 |
| 43 | 3300005293 | Ga0065715_10347024 | Ga0065715_103470242 | 161 |
| 44 | 3300005329 | Ga0070683_100020536 | Ga0070683_1000205362 | 161 |
| 45 | 3300005329 | Ga0070683_100037099 | Ga0070683_1000370997 | 161 |
| 46 | 3300005330 | Ga0070690_100163112 | Ga0070690_1001631121 | 161 |
| 47 | 3300005330 | Ga0070690_100586341 | Ga0070690_1005863411 | 161 |
| 48 | 3300005334 | Ga0068869_100227656 | Ga0068869_1002276563 | 161 |
| 49 | 3300005334 | Ga0068869_100476503 | Ga0068869_1004765032 | 161 |
| 50 | 3300005335 | Ga0070666_10055910 | Ga0070666_100559101 | 161 |
| 51 | 3300005336 | Ga0070680_100149075 | Ga0070680_1001490751 | 161 |
| 52 | 3300005336 | Ga0070680_100271572 | Ga0070680_1002715722 | 161 |
| 53 | 3300005339 | Ga0070660_100830413 | Ga0070660_1008304131 | 161 |
| 54 | 3300005345 | Ga0070692_10224600 | Ga0070692_102246001 | 161 |
| 55 | 3300005347 | Ga0070668_100103768 | Ga0070668_1001037682 | 161 |
| 56 | 3300005347 | Ga0070668_100170575 | Ga0070668_1001705753 | 161 |
| 57 | 3300005347 | Ga0070668_100416686 | Ga0070668_1004166862 | 161 |
| 58 | 3300005353 | Ga0070669_100407461 | Ga0070669_1004074612 | 161 |
| 59 | 3300005353 | Ga0070669_100438594 | Ga0070669_1004385941 | 161 |
| 60 | 3300005353 | Ga0070669_101025567 | Ga0070669_1010255671 | 161 |
| 61 | 3300005354 | Ga0070675_100963929 | Ga0070675_1009639291 | 161 |
| 62 | 3300005355 | Ga0070671_100267608 | Ga0070671_1002676082 | 161 |
| 63 | 3300005356 | Ga0070674_100660203 | Ga0070674_1006602031 | 161 |
| 64 | 3300005356 | Ga0070674_101694092 | Ga0070674_1016940921 | 161 |
| 65 | 3300005364 | Ga0070673_100041021 | Ga0070673_1000410215 | 161 |
| 66 | 3300005367 | Ga0070667_100080227 | Ga0070667_1000802273 | 161 |
| 67 | 3300005367 | Ga0070667_100151812 | Ga0070667_1001518123 | 161 |
| 68 | 3300005367 | Ga0070667_100797734 | Ga0070667_1007977342 | 161 |
| 69 | 3300005367 | Ga0070667_100857454 | Ga0070667_1008574542 | 161 |
| 70 | 3300005434 | Ga0070709_10008945 | Ga0070709_100089452 | 161 |
| 71 | 3300005434 | Ga0070709_10013521 | Ga0070709_100135212 | 161 |
| 72 | 3300005435 | Ga0070714_100143060 | Ga0070714_1001430604 | 161 |
| 73 | 3300005435 | Ga0070714_100431403 | Ga0070714_1004314031 | 161 |
| 74 | 3300005435 | Ga0070714_100854158 | Ga0070714_1008541581 | 161 |
| 75 | 3300005435 | Ga0070714_101144525 | Ga0070714_1011445251 | 161 |
| 76 | 3300005436 | Ga0070713_100041543 | Ga0070713_1000415431 | 161 |
| 77 | 3300005436 | Ga0070713_100072309 | Ga0070713_1000723092 | 161 |
| 78 | 3300005437 | Ga0070710_10000417 | Ga0070710_1000041714 | 161 |
| 79 | 3300005437 | Ga0070710_10001492 | Ga0070710_100014921 | 161 |
| 80 | 3300005438 | Ga0070701_10059454 | Ga0070701_100594543 | 161 |
| 81 | 3300005438 | Ga0070701_10252452 | Ga0070701_102524521 | 161 |
| 82 | 3300005439 | Ga0070711_100015591 | Ga0070711_1000155915 | 161 |
| 83 | 3300005439 | Ga0070711_100035694 | Ga0070711_1000356945 | 161 |
| 84 | 3300005441 | Ga0070700_100161341 | Ga0070700_1001613412 | 161 |
| 85 | 3300005441 | Ga0070700_100636210 | Ga0070700_1006362102 | 161 |
| 86 | 3300005444 | Ga0070694_100220377 | Ga0070694_1002203773 | 161 |
| 87 | 3300005455 | Ga0070663_100030355 | Ga0070663_1000303553 | 161 |
| 88 | 3300005455 | Ga0070663_100032319 | Ga0070663_1000323191 | 161 |
| 89 | 3300005455 | Ga0070663_100173352 | Ga0070663_1001733523 | 161 |
| 90 | 3300005455 | Ga0070663_100260090 | Ga0070663_1002600902 | 161 |
| 91 | 3300005455 | Ga0070663_101034190 | Ga0070663_1010341901 | 161 |
| 92 | 3300005456 | Ga0070678_100243174 | Ga0070678_1002431743 | 161 |
| 93 | 3300005456 | Ga0070678_100262735 | Ga0070678_1002627352 | 161 |
| 94 | 3300005456 | Ga0070678_100295614 | Ga0070678_1002956142 | 161 |
| 95 | 3300005456 | Ga0070678_100353203 | Ga0070678_1003532032 | 161 |
| 96 | 3300005456 | Ga0070678_100577948 | Ga0070678_1005779482 | 161 |
| 97 | 3300005457 | Ga0070662_100046557 | Ga0070662_1000465572 | 161 |
| 98 | 3300005457 | Ga0070662_100832107 | Ga0070662_1008321071 | 161 |
| 99 | 3300005458 | Ga0070681_10042387 | Ga0070681_100423873 | 161 |
| 100 | 3300005458 | Ga0070681_10170876 | Ga0070681_101708764 | 161 |
| 101 | 3300005459 | Ga0068867_100189445 | Ga0068867_1001894451 | 161 |
| 102 | 3300005466 | Ga0070685_10248771 | Ga0070685_102487711 | 161 |
| 103 | 3300005466 | Ga0070685_10447051 | Ga0070685_104470511 | 161 |
| 104 | 3300005466 | Ga0070685_10579612 | Ga0070685_105796121 | 161 |
| 105 | 3300005467 | Ga0070706_100164814 | Ga0070706_1001648141 | 161 |
| 106 | 3300005467 | Ga0070706_100345420 | Ga0070706_1003454201 | 161 |
| 107 | 3300005467 | Ga0070706_100426768 | Ga0070706_1004267681 | 161 |
| 108 | 3300005471 | Ga0070698_100075398 | Ga0070698_1000753983 | 161 |
| 109 | 3300005471 | Ga0070698_100536799 | Ga0070698_1005367992 | 161 |
| 110 | 3300005518 | Ga0070699_101070924 | Ga0070699_1010709241 | 161 |
| 111 | 3300005530 | Ga0070679_100049981 | Ga0070679_1000499813 | 161 |
| 112 | 3300005530 | Ga0070679_100052225 | Ga0070679_1000522257 | 161 |
| 113 | 3300005530 | Ga0070679_100234569 | Ga0070679_1002345691 | 161 |
| 114 | 3300005530 | Ga0070679_100324814 | Ga0070679_1003248141 | 161 |
| 115 | 3300005530 | Ga0070679_100464047 | Ga0070679_1004640471 | 161 |
| 116 | 3300005530 | Ga0070679_101241476 | Ga0070679_1012414761 | 161 |
| 117 | 3300005535 | Ga0070684_100007976 | Ga0070684_10000797610 | 161 |
| 118 | 3300005535 | Ga0070684_100687489 | Ga0070684_1006874892 | 161 |
| 119 | 3300005539 | Ga0068853_100057591 | Ga0068853_1000575915 | 161 |
| 120 | 3300005539 | Ga0068853_100232537 | Ga0068853_1002325372 | 161 |
| 121 | 3300005539 | Ga0068853_100798726 | Ga0068853_1007987262 | 161 |
| 122 | 3300005539 | Ga0068853_101099154 | Ga0068853_1010991542 | 161 |
| 123 | 3300005543 | Ga0070672_100127896 | Ga0070672_1001278963 | 161 |
| 124 | 3300005544 | Ga0070686_100014022 | Ga0070686_1000140224 | 161 |
| 125 | 3300005547 | Ga0070693_100047860 | Ga0070693_1000478603 | 161 |
| 126 | 3300005547 | Ga0070693_100130209 | Ga0070693_1001302092 | 161 |
| 127 | 3300005548 | Ga0070665_100018194 | Ga0070665_1000181949 | 161 |
| 128 | 3300005548 | Ga0070665_100050420 | Ga0070665_1000504205 | 161 |
| 129 | 3300005548 | Ga0070665_100121319 | Ga0070665_1001213195 | 161 |
| 130 | 3300005548 | Ga0070665_100155157 | Ga0070665_1001551571 | 161 |
| 131 | 3300005548 | Ga0070665_100172127 | Ga0070665_1001721271 | 161 |
| 132 | 3300005548 | Ga0070665_100552691 | Ga0070665_1005526912 | 161 |
| 133 | 3300005549 | Ga0070704_100262773 | Ga0070704_1002627732 | 161 |
| 134 | 3300005563 | Ga0068855_100034049 | Ga0068855_1000340498 | 161 |
| 135 | 3300005564 | Ga0070664_100311921 | Ga0070664_1003119213 | 161 |
| 136 | 3300005564 | Ga0070664_100730249 | Ga0070664_1007302491 | 161 |
| 137 | 3300005564 | Ga0070664_100794547 | Ga0070664_1007945472 | 161 |
| 138 | 3300005577 | Ga0068857_100063620 | Ga0068857_1000636206 | 161 |
| 139 | 3300005577 | Ga0068857_100077936 | Ga0068857_1000779365 | 161 |
| 140 | 3300005577 | Ga0068857_101506179 | Ga0068857_1015061791 | 161 |
| 141 | 3300005578 | Ga0068854_100067757 | Ga0068854_1000677572 | 161 |
| 142 | 3300005614 | Ga0068856_100579133 | Ga0068856_1005791333 | 161 |
| 143 | 3300005615 | Ga0070702_100022746 | Ga0070702_1000227464 | 161 |
| 144 | 3300005616 | Ga0068852_100267549 | Ga0068852_1002675492 | 161 |
| 145 | 3300005616 | Ga0068852_100373699 | Ga0068852_1003736992 | 161 |
| 146 | 3300005616 | Ga0068852_100678265 | Ga0068852_1006782652 | 161 |
| 147 | 3300005616 | Ga0068852_100836352 | Ga0068852_1008363521 | 161 |
| 148 | 3300005616 | Ga0068852_101034107 | Ga0068852_1010341072 | 161 |
| 149 | 3300005617 | Ga0068859_100151021 | Ga0068859_1001510213 | 161 |
| 150 | 3300005618 | Ga0068864_100012746 | Ga0068864_10001274611 | 161 |
| 151 | 3300005618 | Ga0068864_101771802 | Ga0068864_1017718021 | 161 |
| 152 | 3300005718 | Ga0068866_10465704 | Ga0068866_104657041 | 161 |
| 153 | 3300005718 | Ga0068866_11093538 | Ga0068866_110935381 | 161 |
| 154 | 3300005719 | Ga0068861_100170911 | Ga0068861_1001709112 | 161 |
| 155 | 3300005719 | Ga0068861_100336064 | Ga0068861_1003360642 | 161 |
| 156 | 3300005719 | Ga0068861_100599818 | Ga0068861_1005998182 | 161 |
| 157 | 3300005840 | Ga0068870_10039904 | Ga0068870_100399043 | 161 |
| 158 | 3300005840 | Ga0068870_10085321 | Ga0068870_100853212 | 161 |
| 159 | 3300005840 | Ga0068870_10313104 | Ga0068870_103131041 | 161 |
| 160 | 3300005841 | Ga0068863_101140189 | Ga0068863_1011401891 | 161 |
| 161 | 3300005842 | Ga0068858_100173930 | Ga0068858_1001739303 | 161 |
| 162 | 3300005842 | Ga0068858_100255396 | Ga0068858_1002553961 | 161 |
| 163 | 3300005842 | Ga0068858_100555269 | Ga0068858_1005552692 | 161 |
| 164 | 3300005843 | Ga0068860_100004852 | Ga0068860_10000485213 | 161 |
| 165 | 3300005843 | Ga0068860_100049838 | Ga0068860_1000498387 | 161 |
| 166 | 3300005844 | Ga0068862_100022728 | Ga0068862_1000227286 | 161 |
| 167 | 3300005844 | Ga0068862_100084017 | Ga0068862_1000840172 | 161 |
| 168 | 3300005844 | Ga0068862_100107550 | Ga0068862_1001075504 | 161 |
| 169 | 3300005937 | Ga0081455_10423265 | Ga0081455_104232652 | 161 |
| 170 | 3300005981 | Ga0081538_10039714 | Ga0081538_100397142 | 161 |
| 171 | 3300005983 | Ga0081540_1003813 | Ga0081540_100381313 | 161 |
| 172 | 3300005983 | Ga0081540_1008010 | Ga0081540_100801010 | 161 |
| 173 | 3300005983 | Ga0081540_1029677 | Ga0081540_10296773 | 161 |
| 174 | 3300005983 | Ga0081540_1114196 | Ga0081540_11141961 | 161 |
| 175 | 3300006028 | Ga0070717_10019823 | Ga0070717_100198237 | 161 |
| 176 | 3300006028 | Ga0070717_10055976 | Ga0070717_100559761 | 161 |
| 177 | 3300006028 | Ga0070717_10225669 | Ga0070717_102256691 | 161 |
| 178 | 3300006028 | Ga0070717_10308958 | Ga0070717_103089581 | 161 |
| 179 | 3300006028 | Ga0070717_11123073 | Ga0070717_111230731 | 161 |
| 180 | 3300006038 | Ga0075365_10053752 | Ga0075365_100537524 | 161 |
| 181 | 3300006038 | Ga0075365_10064660 | Ga0075365_100646602 | 161 |
| 182 | 3300006038 | Ga0075365_10201427 | Ga0075365_102014271 | 161 |
| 183 | 3300006038 | Ga0075365_10347864 | Ga0075365_103478642 | 161 |
| 184 | 3300006038 | Ga0075365_10567617 | Ga0075365_105676171 | 161 |
| 185 | 3300006042 | Ga0075368_10096868 | Ga0075368_100968683 | 161 |
| 186 | 3300006042 | Ga0075368_10106919 | Ga0075368_101069192 | 161 |
| 187 | 3300006048 | Ga0075363_100007214 | Ga0075363_1000072147 | 161 |
| 188 | 3300006048 | Ga0075363_100016054 | Ga0075363_1000160544 | 161 |
| 189 | 3300006048 | Ga0075363_100026718 | Ga0075363_1000267185 | 161 |
| 190 | 3300006051 | Ga0075364_10249753 | Ga0075364_102497533 | 161 |
| 191 | 3300006051 | Ga0075364_10386584 | Ga0075364_103865842 | 161 |
| 192 | 3300006058 | Ga0075432_10085523 | Ga0075432_100855232 | 161 |
| 193 | 3300006058 | Ga0075432_10090801 | Ga0075432_100908011 | 161 |
| 194 | 3300006163 | Ga0070715_10039691 | Ga0070715_100396912 | 161 |
| 195 | 3300006173 | Ga0070716_100004688 | Ga0070716_1000046887 | 161 |
| 196 | 3300006173 | Ga0070716_100273694 | Ga0070716_1002736941 | 161 |
| 197 | 3300006173 | Ga0070716_100441086 | Ga0070716_1004410861 | 161 |
| 198 | 3300006175 | Ga0070712_100006062 | Ga0070712_1000060629 | 161 |
| 199 | 3300006175 | Ga0070712_100277090 | Ga0070712_1002770903 | 161 |
| 200 | 3300006178 | Ga0075367_10015462 | Ga0075367_100154621 | 161 |
| 201 | 3300006178 | Ga0075367_10042053 | Ga0075367_100420531 | 161 |
| 202 | 3300006178 | Ga0075367_10098545 | Ga0075367_100985453 | 161 |
| 203 | 3300006178 | Ga0075367_10414252 | Ga0075367_104142522 | 161 |
| 204 | 3300006178 | Ga0075367_10590870 | Ga0075367_105908701 | 161 |
| 205 | 3300006186 | Ga0075369_10137562 | Ga0075369_101375621 | 161 |
| 206 | 3300006186 | Ga0075369_10139849 | Ga0075369_101398491 | 161 |
| 207 | 3300006195 | Ga0075366_10399750 | Ga0075366_103997502 | 161 |
| 208 | 3300006237 | Ga0097621_101324606 | Ga0097621_1013246062 | 161 |
| 209 | 3300006353 | Ga0075370_10085553 | Ga0075370_100855532 | 161 |
| 210 | 3300006353 | Ga0075370_10105997 | Ga0075370_101059973 | 161 |
| 211 | 3300006353 | Ga0075370_10384892 | Ga0075370_103848921 | 161 |
| 212 | 3300006358 | Ga0068871_100542323 | Ga0068871_1005423232 | 161 |
| 213 | 3300006358 | Ga0068871_100793371 | Ga0068871_1007933712 | 161 |
| 214 | 3300006844 | Ga0075428_100169960 | Ga0075428_1001699603 | 161 |
| 215 | 3300006844 | Ga0075428_100304419 | Ga0075428_1003044192 | 161 |
| 216 | 3300006847 | Ga0075431_100162195 | Ga0075431_1001621953 | 161 |
| 217 | 3300006847 | Ga0075431_100470328 | Ga0075431_1004703283 | 161 |
| 218 | 3300006881 | Ga0068865_100335948 | Ga0068865_1003359482 | 161 |
| 219 | 3300006881 | Ga0068865_100814137 | Ga0068865_1008141371 | 161 |
| 220 | 3300006931 | Ga0097620_100151018 | Ga0097620_1001510183 | 161 |
| 221 | 3300007265 | Ga0099794_10088487 | Ga0099794_100884873 | 161 |
| 222 | 3300007788 | Ga0099795_10030769 | Ga0099795_100307692 | 161 |
| 223 | 3300009092 | Ga0105250_10216515 | Ga0105250_102165151 | 161 |
| 224 | 3300009094 | Ga0111539_10255977 | Ga0111539_102559775 | 161 |
| 225 | 3300009094 | Ga0111539_11341686 | Ga0111539_113416862 | 161 |
| 226 | 3300009098 | Ga0105245_10329073 | Ga0105245_103290733 | 161 |
| 227 | 3300009101 | Ga0105247_10036878 | Ga0105247_100368782 | 161 |
| 228 | 3300009101 | Ga0105247_10050804 | Ga0105247_100508041 | 161 |
| 229 | 3300009101 | Ga0105247_10327780 | Ga0105247_103277802 | 161 |
| 230 | 3300009101 | Ga0105247_10407371 | Ga0105247_104073711 | 161 |
| 231 | 3300009101 | Ga0105247_10635276 | Ga0105247_106352761 | 161 |
| 232 | 3300009147 | Ga0114129_10083313 | Ga0114129_100833138 | 161 |
| 233 | 3300009148 | Ga0105243_10078293 | Ga0105243_100782933 | 161 |
| 234 | 3300009148 | Ga0105243_10631919 | Ga0105243_106319192 | 161 |
| 235 | 3300009174 | Ga0105241_10412031 | Ga0105241_104120312 | 161 |
| 236 | 3300009176 | Ga0105242_10234784 | Ga0105242_102347841 | 161 |
| 237 | 3300009177 | Ga0105248_10458682 | Ga0105248_104586822 | 161 |
| 238 | 3300009545 | Ga0105237_10013746 | Ga0105237_1001374611 | 161 |
| 239 | 3300009545 | Ga0105237_10064660 | Ga0105237_100646607 | 161 |
| 240 | 3300009545 | Ga0105237_10067924 | Ga0105237_100679246 | 161 |
| 241 | 3300009545 | Ga0105237_10230976 | Ga0105237_102309762 | 161 |
| 242 | 3300009551 | Ga0105238_10054537 | Ga0105238_100545376 | 161 |
| 243 | 3300009551 | Ga0105238_10096074 | Ga0105238_100960743 | 161 |
| 244 | 3300009551 | Ga0105238_10130906 | Ga0105238_101309065 | 161 |
| 245 | 3300009551 | Ga0105238_10315214 | Ga0105238_103152142 | 161 |
| 246 | 3300009551 | Ga0105238_10725723 | Ga0105238_107257232 | 161 |
| 247 | 3300009553 | Ga0105249_10143590 | Ga0105249_101435903 | 161 |
| 248 | 3300009553 | Ga0105249_10536720 | Ga0105249_105367202 | 161 |
| 249 | 3300010375 | Ga0105239_10021794 | Ga0105239_100217942 | 161 |
| 250 | 3300010375 | Ga0105239_10022601 | Ga0105239_100226017 | 161 |
| 251 | 3300010375 | Ga0105239_10688990 | Ga0105239_106889902 | 161 |
| 252 | 3300010375 | Ga0105239_10726438 | Ga0105239_107264381 | 161 |
| 253 | 3300010375 | Ga0105239_11074281 | Ga0105239_110742811 | 161 |
| 254 | 3300010375 | Ga0105239_11150125 | Ga0105239_111501251 | 161 |
| 255 | 3300011119 | Ga0105246_10059706 | Ga0105246_100597065 | 161 |
| 256 | 3300013100 | Ga0157373_10708077 | Ga0157373_107080771 | 161 |
| 257 | 3300013102 | Ga0157371_10786705 | Ga0157371_107867051 | 161 |
| 258 | 3300013104 | Ga0157370_10243254 | Ga0157370_102432543 | 161 |
| 259 | 3300013104 | Ga0157370_10249396 | Ga0157370_102493962 | 161 |
| 260 | 3300013105 | Ga0157369_10034502 | Ga0157369_100345023 | 161 |
| 261 | 3300013296 | Ga0157374_10202003 | Ga0157374_102020031 | 161 |
| 262 | 3300013297 | Ga0157378_10045009 | Ga0157378_100450096 | 161 |
| 263 | 3300013297 | Ga0157378_10340673 | Ga0157378_103406732 | 161 |
| 264 | 3300013297 | Ga0157378_10381656 | Ga0157378_103816563 | 161 |
| 265 | 3300013306 | Ga0163162_10400455 | Ga0163162_104004551 | 161 |
| 266 | 3300013306 | Ga0163162_10591094 | Ga0163162_105910942 | 161 |
| 267 | 3300013307 | Ga0157372_10176783 | Ga0157372_101767835 | 161 |
| 268 | 3300013308 | Ga0157375_10763161 | Ga0157375_107631612 | 161 |
| 269 | 3300014325 | Ga0163163_10675613 | Ga0163163_106756132 | 161 |
| 270 | 3300014326 | Ga0157380_10292763 | Ga0157380_102927633 | 161 |
| 271 | 3300014326 | Ga0157380_10336143 | Ga0157380_103361432 | 161 |
| 272 | 3300014326 | Ga0157380_10599357 | Ga0157380_105993572 | 161 |
| 273 | 3300014326 | Ga0157380_10807635 | Ga0157380_108076352 | 161 |
| 274 | 3300014969 | Ga0157376_11699122 | Ga0157376_116991221 | 161 |
| 275 | 3300017792 | Ga0163161_10525797 | Ga0163161_105257972 | 161 |
| 276 | 3300017792 | Ga0163161_10951154 | Ga0163161_109511541 | 161 |
| 277 | 3300020069 | Ga0197907_10446942 | Ga0197907_104469421 | 161 |
| 278 | 3300020078 | Ga0206352_11046103 | Ga0206352_110461031 | 161 |
| 279 | 3300021358 | Ga0213873_10019785 | Ga0213873_100197852 | 161 |
| 280 | 3300021384 | Ga0213876_10433693 | Ga0213876_104336931 | 161 |
| 281 | 3300022467 | Ga0224712_10147305 | Ga0224712_101473051 | 161 |
| 282 | 3300025253 | Ga0209677_101355 | Ga0209677_10135516 | 161 |
| 283 | 3300025261 | Ga0209233_1000985 | Ga0209233_10009857 | 161 |
| 284 | 3300025272 | Ga0209455_1001420 | Ga0209455_10014203 | 161 |
| 285 | 3300025272 | Ga0209455_1009019 | Ga0209455_10090192 | 161 |
| 286 | 3300025297 | Ga0209758_1028711 | Ga0209758_10287112 | 161 |
| 287 | 3300025297 | Ga0209758_1047293 | Ga0209758_10472933 | 161 |
| 288 | 3300025315 | Ga0207697_10103745 | Ga0207697_101037452 | 161 |
| 289 | 3300025893 | Ga0207682_10113093 | Ga0207682_101130931 | 161 |
| 290 | 3300025898 | Ga0207692_10003364 | Ga0207692_100033646 | 161 |
| 291 | 3300025898 | Ga0207692_10071779 | Ga0207692_100717792 | 161 |
| 292 | 3300025898 | Ga0207692_10395923 | Ga0207692_103959231 | 161 |
| 293 | 3300025900 | Ga0207710_10075792 | Ga0207710_100757922 | 161 |
| 294 | 3300025901 | Ga0207688_10089210 | Ga0207688_100892102 | 161 |
| 295 | 3300025901 | Ga0207688_10089241 | Ga0207688_100892413 | 161 |
| 296 | 3300025901 | Ga0207688_10572607 | Ga0207688_105726071 | 161 |
| 297 | 3300025903 | Ga0207680_10032128 | Ga0207680_100321285 | 161 |
| 298 | 3300025904 | Ga0207647_10459310 | Ga0207647_104593102 | 161 |
| 299 | 3300025905 | Ga0207685_10074739 | Ga0207685_100747392 | 161 |
| 300 | 3300025906 | Ga0207699_10000473 | Ga0207699_100004737 | 161 |
| 301 | 3300025906 | Ga0207699_10121539 | Ga0207699_101215392 | 161 |
| 302 | 3300025907 | Ga0207645_10718127 | Ga0207645_107181271 | 161 |
| 303 | 3300025908 | Ga0207643_10033091 | Ga0207643_100330913 | 161 |
| 304 | 3300025908 | Ga0207643_10683462 | Ga0207643_106834621 | 161 |
| 305 | 3300025910 | Ga0207684_10129852 | Ga0207684_101298524 | 161 |
| 306 | 3300025910 | Ga0207684_10149107 | Ga0207684_101491072 | 161 |
| 307 | 3300025911 | Ga0207654_10656938 | Ga0207654_106569381 | 161 |
| 308 | 3300025912 | Ga0207707_10005928 | Ga0207707_100059284 | 161 |
| 309 | 3300025912 | Ga0207707_10398285 | Ga0207707_103982851 | 161 |
| 310 | 3300025914 | Ga0207671_10027280 | Ga0207671_100272801 | 161 |
| 311 | 3300025914 | Ga0207671_10156859 | Ga0207671_101568591 | 161 |
| 312 | 3300025914 | Ga0207671_10222990 | Ga0207671_102229903 | 161 |
| 313 | 3300025914 | Ga0207671_10246630 | Ga0207671_102466302 | 161 |
| 314 | 3300025914 | Ga0207671_10247594 | Ga0207671_102475942 | 161 |
| 315 | 3300025915 | Ga0207693_10006327 | Ga0207693_1000632714 | 161 |
| 316 | 3300025915 | Ga0207693_10030096 | Ga0207693_100300962 | 161 |
| 317 | 3300025915 | Ga0207693_10069142 | Ga0207693_100691426 | 161 |
| 318 | 3300025916 | Ga0207663_10030431 | Ga0207663_100304313 | 161 |
| 319 | 3300025916 | Ga0207663_10043308 | Ga0207663_100433084 | 161 |
| 320 | 3300025918 | Ga0207662_10070034 | Ga0207662_100700342 | 161 |
| 321 | 3300025921 | Ga0207652_11084181 | Ga0207652_110841811 | 161 |
| 322 | 3300025921 | Ga0207652_11219921 | Ga0207652_112199211 | 161 |
| 323 | 3300025921 | Ga0207652_11341665 | Ga0207652_113416651 | 161 |
| 324 | 3300025923 | Ga0207681_10589821 | Ga0207681_105898212 | 161 |
| 325 | 3300025924 | Ga0207694_10102308 | Ga0207694_101023082 | 161 |
| 326 | 3300025924 | Ga0207694_10411834 | Ga0207694_104118342 | 161 |
| 327 | 3300025924 | Ga0207694_10798445 | Ga0207694_107984451 | 161 |
| 328 | 3300025926 | Ga0207659_11280220 | Ga0207659_112802201 | 161 |
| 329 | 3300025927 | Ga0207687_10345988 | Ga0207687_103459882 | 161 |
| 330 | 3300025928 | Ga0207700_10005697 | Ga0207700_100056977 | 161 |
| 331 | 3300025928 | Ga0207700_10012732 | Ga0207700_100127325 | 161 |
| 332 | 3300025928 | Ga0207700_10029241 | Ga0207700_100292415 | 161 |
| 333 | 3300025929 | Ga0207664_10400900 | Ga0207664_104009001 | 161 |
| 334 | 3300025929 | Ga0207664_10533297 | Ga0207664_105332972 | 161 |
| 335 | 3300025929 | Ga0207664_10742397 | Ga0207664_107423971 | 161 |
| 336 | 3300025933 | Ga0207706_10080045 | Ga0207706_100800455 | 161 |
| 337 | 3300025933 | Ga0207706_10597116 | Ga0207706_105971162 | 161 |
| 338 | 3300025934 | Ga0207686_10089819 | Ga0207686_100898193 | 161 |
| 339 | 3300025934 | Ga0207686_10587154 | Ga0207686_105871542 | 161 |
| 340 | 3300025935 | Ga0207709_10724362 | Ga0207709_107243622 | 161 |
| 341 | 3300025936 | Ga0207670_10570752 | Ga0207670_105707522 | 161 |
| 342 | 3300025938 | Ga0207704_10153434 | Ga0207704_101534342 | 161 |
| 343 | 3300025938 | Ga0207704_10350831 | Ga0207704_103508312 | 161 |
| 344 | 3300025940 | Ga0207691_10553016 | Ga0207691_105530162 | 161 |
| 345 | 3300025940 | Ga0207691_10960546 | Ga0207691_109605461 | 161 |
| 346 | 3300025941 | Ga0207711_10124863 | Ga0207711_101248633 | 161 |
| 347 | 3300025944 | Ga0207661_10013913 | Ga0207661_100139132 | 161 |
| 348 | 3300025944 | Ga0207661_10030242 | Ga0207661_100302427 | 161 |
| 349 | 3300025945 | Ga0207679_10837688 | Ga0207679_108376881 | 161 |
| 350 | 3300025949 | Ga0207667_10041143 | Ga0207667_100411436 | 161 |
| 351 | 3300025949 | Ga0207667_10683171 | Ga0207667_106831711 | 161 |
| 352 | 3300025961 | Ga0207712_10019324 | Ga0207712_100193243 | 161 |
| 353 | 3300025961 | Ga0207712_10345339 | Ga0207712_103453392 | 161 |
| 354 | 3300025972 | Ga0207668_10022383 | Ga0207668_100223831 | 161 |
| 355 | 3300025972 | Ga0207668_10028830 | Ga0207668_100288306 | 161 |
| 356 | 3300025972 | Ga0207668_10168221 | Ga0207668_101682213 | 161 |
| 357 | 3300025981 | Ga0207640_10862722 | Ga0207640_108627221 | 161 |
| 358 | 3300025986 | Ga0207658_10345592 | Ga0207658_103455921 | 161 |
| 359 | 3300025986 | Ga0207658_11038046 | Ga0207658_110380461 | 161 |
| 360 | 3300026023 | Ga0207677_10818622 | Ga0207677_108186221 | 161 |
| 361 | 3300026035 | Ga0207703_10009809 | Ga0207703_100098097 | 161 |
| 362 | 3300026035 | Ga0207703_10130141 | Ga0207703_101301413 | 161 |
| 363 | 3300026035 | Ga0207703_10551496 | Ga0207703_105514961 | 161 |
| 364 | 3300026041 | Ga0207639_10134516 | Ga0207639_101345162 | 161 |
| 365 | 3300026041 | Ga0207639_10234449 | Ga0207639_102344491 | 161 |
| 366 | 3300026067 | Ga0207678_10020238 | Ga0207678_100202383 | 161 |
| 367 | 3300026067 | Ga0207678_10035725 | Ga0207678_100357256 | 161 |
| 368 | 3300026067 | Ga0207678_10045271 | Ga0207678_100452712 | 161 |
| 369 | 3300026067 | Ga0207678_10378862 | Ga0207678_103788621 | 161 |
| 370 | 3300026075 | Ga0207708_10033443 | Ga0207708_100334432 | 161 |
| 371 | 3300026075 | Ga0207708_10301397 | Ga0207708_103013971 | 161 |
| 372 | 3300026089 | Ga0207648_10094412 | Ga0207648_100944123 | 161 |
| 373 | 3300026116 | Ga0207674_10017324 | Ga0207674_100173247 | 161 |
| 374 | 3300026116 | Ga0207674_10326633 | Ga0207674_103266332 | 161 |
| 375 | 3300026118 | Ga0207675_100139003 | Ga0207675_1001390034 | 161 |
| 376 | 3300026118 | Ga0207675_100154819 | Ga0207675_1001548192 | 161 |
| 377 | 3300026121 | Ga0207683_10023560 | Ga0207683_100235606 | 161 |
| 378 | 3300026121 | Ga0207683_10391595 | Ga0207683_103915952 | 161 |
| 379 | 3300026121 | Ga0207683_11309915 | Ga0207683_113099151 | 161 |
| 380 | 3300027671 | Ga0209588_1120750 | Ga0209588_11207501 | 161 |
| 381 | 3300027866 | Ga0209813_10027474 | Ga0209813_100274742 | 161 |
| 382 | 3300028379 | Ga0268266_10000446 | Ga0268266_1000044651 | 161 |
| 383 | 3300028379 | Ga0268266_10017902 | Ga0268266_100179021 | 161 |
| 384 | 3300028379 | Ga0268266_10075473 | Ga0268266_100754734 | 161 |
| 385 | 3300028379 | Ga0268266_10274114 | Ga0268266_102741142 | 161 |
| 386 | 3300028379 | Ga0268266_10760074 | Ga0268266_107600742 | 161 |
| 387 | 3300028380 | Ga0268265_10124097 | Ga0268265_101240972 | 161 |
| 388 | 3300028380 | Ga0268265_10208678 | Ga0268265_102086781 | 161 |
| 389 | 3300028380 | Ga0268265_10636468 | Ga0268265_106364682 | 161 |
| 390 | 3300028381 | Ga0268264_10000158 | Ga0268264_10000158123 | 161 |
| 391 | 3300028381 | Ga0268264_10446924 | Ga0268264_104469242 | 161 |
| 392 | 3300028556 | Ga0265337_1021645 | Ga0265337_10216453 | 161 |
| 393 | 3300028558 | Ga0265326_10001072 | Ga0265326_1000107211 | 161 |
| 394 | 3300028563 | Ga0265319_1018091 | Ga0265319_10180913 | 161 |
| 395 | 3300028573 | Ga0265334_10006784 | Ga0265334_100067844 | 161 |
| 396 | 3300028577 | Ga0265318_10016818 | Ga0265318_100168183 | 161 |
| 397 | 3300028653 | Ga0265323_10000529 | Ga0265323_1000052910 | 161 |
| 398 | 3300028666 | Ga0265336_10000169 | Ga0265336_100001696 | 161 |
| 399 | 3300028786 | Ga0307517_10001444 | Ga0307517_1000144438 | 161 |
| 400 | 3300028786 | Ga0307517_10091019 | Ga0307517_100910192 | 161 |
| 401 | 3300028794 | Ga0307515_10069057 | Ga0307515_100690574 | 161 |
| 402 | 3300028794 | Ga0307515_10555648 | Ga0307515_105556481 | 161 |
| 403 | 3300028800 | Ga0265338_10000624 | Ga0265338_1000062416 | 161 |
| 404 | 3300029957 | Ga0265324_10002965 | Ga0265324_100029656 | 161 |
| 405 | 3300030521 | Ga0307511_10062880 | Ga0307511_100628804 | 161 |
| 406 | 3300031456 | Ga0307513_10517498 | Ga0307513_105174981 | 161 |
| 407 | 3300031507 | Ga0307509_10043981 | Ga0307509_100439816 | 161 |
| 408 | 3300031507 | Ga0307509_10073911 | Ga0307509_100739115 | 161 |
| 409 | 3300031507 | Ga0307509_10384712 | Ga0307509_103847121 | 161 |
| 410 | 3300031616 | Ga0307508_10000184 | Ga0307508_1000018461 | 161 |
| 411 | 3300031616 | Ga0307508_10007695 | Ga0307508_100076957 | 161 |
| 412 | 3300031616 | Ga0307508_10339083 | Ga0307508_103390832 | 161 |
| 413 | 3300031665 | Ga0316575_10023931 | Ga0316575_100239313 | 161 |
| 414 | 3300031730 | Ga0307516_10007195 | Ga0307516_1000719510 | 161 |
| 415 | 3300031730 | Ga0307516_10022096 | Ga0307516_1002209610 | 161 |
| 416 | 3300031730 | Ga0307516_10101395 | Ga0307516_101013953 | 161 |
| 417 | 3300031731 | Ga0307405_10415765 | Ga0307405_104157651 | 161 |
| 418 | 3300031901 | Ga0307406_11198040 | Ga0307406_111980401 | 161 |
| 419 | 3300032004 | Ga0307414_10658123 | Ga0307414_106581231 | 161 |
| 420 | 3300032126 | Ga0307415_100061963 | Ga0307415_1000619632 | 161 |
| 421 | 3300033179 | Ga0307507_10011889 | Ga0307507_100118898 | 161 |
| 422 | 3300033180 | Ga0307510_10009874 | Ga0307510_1000987416 | 161 |
| 423 | 3300033180 | Ga0307510_10163778 | Ga0307510_101637782 | 161 |
| 424 | 3300033180 | Ga0307510_10243522 | Ga0307510_102435221 | 161 |
| 425 | 3300034816 | Ga0373930_0008728 | Ga0373930_0008728_193_678 | 161 |
| 426 | 3300034818 | Ga0373950_0057981 | Ga0373950_0057981_79_564 | 161 |
| 427 | 3300035086 | Ga0373934_0084208 | Ga0373934_0084208_721_1206 | 161 |
| 428 | 3300035111 | Ga0373923_0079720 | Ga0373923_0079720_177_662 | 161 |
| 429 | 3300035112 | Ga0373932_0064100 | Ga0373932_0064100_563_1048 | 161 |
| 430 | 3300035113 | Ga0373936_0032215 | Ga0373936_0032215_888_1373 | 161 |
| 431 | 3300035114 | Ga0373939_0295107 | Ga0373939_0295107_79_564 | 161 |
| 432 | 3300035117 | Ga0373953_0315189 | Ga0373953_0315189_187_672 | 161 |
| 433 | 3300035118 | Ga0373954_0036923 | Ga0373954_0036923_483_968 | 161 |
| 434 | 3300035119 | Ga0373956_0203287 | Ga0373956_0203287_285_770 | 161 |
| 435 | 3300035170 | Ga0373943_0017111 | Ga0373943_0017111_2110_2595 | 161 |
| 436 | 3300035170 | Ga0373943_0359058 | Ga0373943_0359058_268_753 | 161 |
| 437 | 3300035171 | Ga0373946_0373444 | Ga0373946_0373444_131_616 | 161 |
| 438 | 3300035172 | Ga0373955_0027515 | Ga0373955_0027515_998_1483 | 161 |
| 439 | 3300035172 | Ga0373955_0243811 | Ga0373955_0243811_144_629 | 161 |
| 440 | 3300035691 | Ga0373931_0060534 | Ga0373931_0060534_862_1347 | 161 |
| 441 | 3300035692 | Ga0373935_0010312 | Ga0373935_0010312_3229_3714 | 161 |
| 442 | 3300035692 | Ga0373935_0041354 | Ga0373935_0041354_822_1367 | 161 |
| 443 | 3300035695 | Ga0373927_0053805 | Ga0373927_0053805_1260_1745 | 161 |
| 444 | 3300035695 | Ga0373927_0271346 | Ga0373927_0271346_501_1046 | 161 |
| 445 | 3300035695 | Ga0373927_0559924 | Ga0373927_0559924_49_534 | 161 |
| 446 | 3300035724 | Ga0373933_0002890 | Ga0373933_0002890_2387_2872 | 161 |
| 447 | 3300035725 | Ga0373947_0128709 | Ga0373947_0128709_774_1259 | 161 |
| 448 | 3300036712 | Ga0316584_0054000 | Ga0316584_0054000_505_1002 | 161 |
| 449 | 3300037068 | Ga0373925_0060136 | Ga0373925_0060136_2064_2549 | 161 |
| 450 | 3300037068 | Ga0373925_0467058 | Ga0373925_0467058_301_786 | 161 |
| 451 | 3300037068 | Ga0373925_1222464 | Ga0373925_1222464_87_572 | 161 |
| 452 | 3300037418 | Ga0395900_0319963 | Ga0395900_0319963_1008_1505 | 161 |
| 453 | 3300037471 | Ga0395905_0024040 | Ga0395905_0024040_1669_2154 | 161 |
| 454 | 3300037471 | Ga0395905_0172771 | Ga0395905_0172771_495_980 | 161 |
| 455 | 3300037471 | Ga0395905_0212898 | Ga0395905_0212898_394_879 | 161 |
| 456 | 3300037471 | Ga0395905_0375545 | Ga0395905_0375545_763_1248 | 161 |
| 457 | 3300037471 | Ga0395905_0672230 | Ga0395905_0672230_286_771 | 161 |
| 458 | 3300038443 | Ga0395901_0304864 | Ga0395901_0304864_412_909 | 161 |
| 459 | 3300038443 | Ga0395901_0769100 | Ga0395901_0769100_124_609 | 161 |
| 460 | 3300039437 | Ga0436365_0959977 | Ga0436365_0959977_5318_5803 | 161 |
| 461 | 3300039437 | Ga0436365_1809413 | Ga0436365_1809413_689_1174 | 161 |
| 462 | 3300039438 | Ga0436360_0470849 | Ga0436360_0470849_496_981 | 161 |
| 463 | 3300039450 | Ga0436363_0532944 | Ga0436363_0532944_207_692 | 161 |
| 464 | 3300039450 | Ga0436363_0602143 | Ga0436363_0602143_114_599 | 161 |
| 465 | 3300039450 | Ga0436363_1346086 | Ga0436363_1346086_180_665 | 161 |
| 466 | 3300039453 | Ga0436362_0651173 | Ga0436362_0651173_55_540 | 161 |
| 467 | 3300039453 | Ga0436362_1003352 | Ga0436362_1003352_452_937 | 161 |
| 468 | 3300039453 | Ga0436362_1221089 | Ga0436362_1221089_599_1084 | 161 |
| 469 | 3300041451 | Ga0451791_1382345 | Ga0451791_1382345_65_550 | 161 |
| 470 | 3300041453 | Ga0451797_0711704 | Ga0451797_0711704_1950_2435 | 161 |
| 471 | 3300041459 | Ga0451800_1299814 | Ga0451800_1299814_291_776 | 161 |
| 472 | 3300041460 | Ga0451802_0615921 | Ga0451802_0615921_153_638 | 161 |
| 473 | 3300041463 | Ga0451804_0979417 | Ga0451804_0979417_141_626 | 161 |
| 474 | 3300041498 | Ga0451841_0229262 | Ga0451841_0229262_57_542 | 161 |
| 475 | 3300041512 | Ga0451853_3679622 | Ga0451853_3679622_74_559 | 161 |
| 476 | 3300042004 | Ga0439445_0094604 | Ga0439445_0094604_153_638 | 161 |
| 477 | 3300042013 | Ga0439456_105182 | Ga0439456_105182_82_567 | 161 |
| 478 | 3300044694 | Ga0466963_0097174 | Ga0466963_0097174_1308_1793 | 161 |
| 479 | 3300044706 | Ga0466964_0485825 | Ga0466964_0485825_86_571 | 161 |
| 480 | 3300044719 | Ga0466971_0064851 | Ga0466971_0064851_348_833 | 161 |
| 481 | 3300044765 | Ga0466970_0357709 | Ga0466970_0357709_247_732 | 161 |
| 482 | 3300044842 | Ga0466957_0102949 | Ga0466957_0102949_169_654 | 161 |
| 483 | 3300044842 | Ga0466957_0110589 | Ga0466957_0110589_397_882 | 161 |
| 484 | 3300045049 | Ga0466959_0004580 | Ga0466959_0004580_1965_2450 | 161 |
| 485 | 3300045836 | Ga0466958_0238972 | Ga0466958_0238972_582_1067 | 161 |
| 486 | 3300045836 | Ga0466958_0709949 | Ga0466958_0709949_64_552 | 161 |
| 487 | 3300045836 | Ga0466958_0872087 | Ga0466958_0872087_42_527 | 161 |
| 488 | 3300045976 | Ga0466967_0045828 | Ga0466967_0045828_1822_2307 | 161 |
| 489 | 3300045976 | Ga0466967_0045943 | Ga0466967_0045943_1573_2058 | 161 |
| 490 | 3300045976 | Ga0466967_0124582 | Ga0466967_0124582_933_1430 | 161 |
| 491 | 3300045976 | Ga0466967_0145351 | Ga0466967_0145351_1313_1798 | 161 |
| 492 | 3300045976 | Ga0466967_0509965 | Ga0466967_0509965_532_1017 | 161 |
| 493 | 3300046454 | Ga0495592_0271327 | Ga0495592_0271327_55_540 | 161 |
| 494 | 3300046472 | Ga0495580_0348846 | Ga0495580_0348846_189_674 | 161 |
| 495 | 3300046473 | Ga0495582_0657951 | Ga0495582_0657951_102_587 | 161 |
| 496 | 3300046474 | Ga0495605_0196966 | Ga0495605_0196966_262_747 | 161 |
| 497 | 3300046475 | Ga0495639_0012171 | Ga0495639_0012171_1192_1677 | 161 |
| 498 | 3300046477 | Ga0495664_0099972 | Ga0495664_0099972_1099_1584 | 161 |
| 499 | 3300046477 | Ga0495664_0124161 | Ga0495664_0124161_14_499 | 161 |
| 500 | 3300046507 | Ga0495606_0112020 | Ga0495606_0112020_1009_1494 | 161 |
| 501 | 3300046507 | Ga0495606_0284937 | Ga0495606_0284937_296_781 | 161 |
| 502 | 3300046512 | Ga0495610_0076882 | Ga0495610_0076882_317_802 | 161 |
| 503 | 3300046514 | Ga0495618_0021240 | Ga0495618_0021240_2638_3123 | 161 |
| 504 | 3300046516 | Ga0495628_0326223 | Ga0495628_0326223_262_747 | 161 |
| 505 | 3300046517 | Ga0495630_0009739 | Ga0495630_0009739_5506_5991 | 161 |
| 506 | 3300046518 | Ga0495631_0404203 | Ga0495631_0404203_54_539 | 161 |
| 507 | 3300046519 | Ga0495632_0188542 | Ga0495632_0188542_92_577 | 161 |
| 508 | 3300046526 | Ga0495666_0155359 | Ga0495666_0155359_516_1001 | 161 |
| 509 | 3300046530 | Ga0495654_0373361 | Ga0495654_0373361_16_501 | 161 |
| 510 | 3300046531 | Ga0495665_0025604 | Ga0495665_0025604_1940_2425 | 161 |
| 511 | 3300046531 | Ga0495665_0319665 | Ga0495665_0319665_274_759 | 161 |
| 512 | 3300046531 | Ga0495665_0602771 | Ga0495665_0602771_49_534 | 161 |
| 513 | 3300046533 | Ga0495640_0027591 | Ga0495640_0027591_646_1131 | 161 |
| 514 | 3300046535 | Ga0495586_0608057 | Ga0495586_0608057_47_532 | 161 |
| 515 | 3300046536 | Ga0495587_0066722 | Ga0495587_0066722_126_623 | 161 |
| 516 | 3300046557 | Ga0495622_0103788 | Ga0495622_0103788_72_617 | 161 |
| 517 | 3300046558 | Ga0495633_0178152 | Ga0495633_0178152_398_883 | 161 |
| 518 | 3300046615 | Ga0495656_0056585 | Ga0495656_0056585_1147_1677 | 161 |
| 519 | 3300046615 | Ga0495656_0353838 | Ga0495656_0353838_241_726 | 161 |
| 520 | 3300046642 | Ga0495634_0598214 | Ga0495634_0598214_131_616 | 161 |
| 521 | 3300046648 | Ga0495611_0175257 | Ga0495611_0175257_268_753 | 161 |
| 522 | 3300046679 | Ga0495623_0167521 | Ga0495623_0167521_11_496 | 161 |
| 523 | 3300046684 | Ga0495669_0006057 | Ga0495669_0006057_662_1147 | 161 |
| 524 | 3300046684 | Ga0495669_0275903 | Ga0495669_0275903_256_741 | 161 |
| 525 | 3300046689 | Ga0495613_0116257 | Ga0495613_0116257_524_1009 | 161 |
| 526 | 3300046690 | Ga0495624_0141573 | Ga0495624_0141573_198_683 | 161 |
| 527 | 3300046691 | Ga0495670_0235340 | Ga0495670_0235340_325_855 | 161 |
| 528 | 3300046692 | Ga0495671_0210415 | Ga0495671_0210415_303_833 | 161 |
| 529 | 3300046694 | Ga0495649_0162244 | Ga0495649_0162244_612_1097 | 161 |
| 530 | 3300046794 | Ga0495589_0113743 | Ga0495589_0113743_180_665 | 161 |
| 531 | 3300047315 | Ga0495581_0020871 | Ga0495581_0020871_309_794 | 161 |
| 532 | 3300047315 | Ga0495581_0075374 | Ga0495581_0075374_1337_1822 | 161 |
| 533 | 3300047319 | Ga0495674_0331756 | Ga0495674_0331756_531_1016 | 161 |
| 534 | 3300047445 | Ga0495677_0053318 | Ga0495677_0053318_277_807 | 161 |
| 535 | 3300047446 | Ga0495679_070245 | Ga0495679_070245_35_520 | 161 |
| 536 | 3300047472 | Ga0495686_0045638 | Ga0495686_0045638_537_1022 | 161 |
| 537 | 3300047472 | Ga0495686_0350239 | Ga0495686_0350239_197_727 | 161 |
| 538 | 3300048088 | Ga0495602_0217160 | Ga0495602_0217160_567_1052 | 161 |
| 539 | 3300048903 | Ga0496100_0320412 | Ga0496100_0320412_34_519 | 161 |
| 540 | 3300048904 | Ga0496101_0026707 | Ga0496101_0026707_48_533 | 161 |
| 541 | 3300048904 | Ga0496101_0248359 | Ga0496101_0248359_20_550 | 161 |
| 542 | 3300048907 | Ga0496104_0026218 | Ga0496104_0026218_1410_1895 | 161 |
| 543 | 3300048907 | Ga0496104_0324293 | Ga0496104_0324293_879_1364 | 161 |
| 544 | 3300048907 | Ga0496104_0598343 | Ga0496104_0598343_419_904 | 161 |
| 545 | 3300048908 | Ga0496105_0009624 | Ga0496105_0009624_5480_5965 | 161 |
| 546 | 3300048909 | Ga0496106_0002771 | Ga0496106_0002771_8875_9465 | 161 |
| 547 | 3300048910 | Ga0496107_0054182 | Ga0496107_0054182_1353_1880 | 161 |
| 548 | 3300048911 | Ga0496108_0205237 | Ga0496108_0205237_1135_1620 | 161 |
| 549 | 3300048912 | Ga0496109_0021306 | Ga0496109_0021306_2303_2788 | 161 |
| 550 | 3300048913 | Ga0496110_0200072 | Ga0496110_0200072_1017_1502 | 161 |
| 551 | 3300048914 | Ga0496111_0015228 | Ga0496111_0015228_1261_1746 | 161 |
| 552 | 3300048915 | Ga0496112_0691036 | Ga0496112_0691036_69_554 | 161 |
| 553 | 3300048915 | Ga0496112_0692481 | Ga0496112_0692481_129_614 | 161 |
| 554 | 3300048915 | Ga0496112_0770462 | Ga0496112_0770462_41_526 | 161 |
| 555 | 3300048916 | Ga0496113_0035431 | Ga0496113_0035431_105_590 | 161 |
| 556 | 3300048916 | Ga0496113_1288141 | Ga0496113_1288141_62_547 | 161 |
| 557 | 3300048917 | Ga0496114_0031727 | Ga0496114_0031727_2208_2693 | 161 |
| 558 | 3300048918 | Ga0496115_0056477 | Ga0496115_0056477_2116_2601 | 161 |
| 559 | 3300048920 | Ga0496117_0047639 | Ga0496117_0047639_2436_3026 | 161 |
| 560 | 3300048921 | Ga0496118_0003945 | Ga0496118_0003945_6318_6908 | 161 |
| 561 | 3300048921 | Ga0496118_0013805 | Ga0496118_0013805_3638_4123 | 161 |
| 562 | 3300048921 | Ga0496118_0352446 | Ga0496118_0352446_160_645 | 161 |
| 563 | 3300048922 | Ga0496119_0210350 | Ga0496119_0210350_253_783 | 161 |
| 564 | 3300048923 | Ga0496120_0509034 | Ga0496120_0509034_17_502 | 161 |
| 565 | 3300048924 | Ga0496121_0001276 | Ga0496121_0001276_28961_29551 | 161 |
| 566 | 3300048924 | Ga0496121_0013094 | Ga0496121_0013094_4676_5161 | 161 |
| 567 | 3300048924 | Ga0496121_0050417 | Ga0496121_0050417_991_1533 | 161 |
| 568 | 3300048924 | Ga0496121_0051312 | Ga0496121_0051312_1954_2466 | 161 |
| 569 | 3300048924 | Ga0496121_0083818 | Ga0496121_0083818_248_778 | 161 |
| 570 | 3300048924 | Ga0496121_0110977 | Ga0496121_0110977_1468_1998 | 161 |
| 571 | 3300048924 | Ga0496121_0124968 | Ga0496121_0124968_72_557 | 161 |
| 572 | 3300048924 | Ga0496121_0353228 | Ga0496121_0353228_268_753 | 161 |
| 573 | 3300048927 | Ga0496124_0002134 | Ga0496124_0002134_4926_5516 | 161 |
| 574 | 3300048927 | Ga0496124_0112165 | Ga0496124_0112165_453_983 | 161 |
| 575 | 3300048928 | Ga0496125_0025231 | Ga0496125_0025231_4886_5371 | 161 |
| 576 | 3300048928 | Ga0496125_0037677 | Ga0496125_0037677_1732_2217 | 161 |
| 577 | 3300048928 | Ga0496125_0190064 | Ga0496125_0190064_372_902 | 161 |
| 578 | 3300048929 | Ga0496126_0011362 | Ga0496126_0011362_8646_9131 | 161 |
| 579 | 3300048929 | Ga0496126_0012891 | Ga0496126_0012891_1963_2460 | 161 |
| 580 | 3300048929 | Ga0496126_0013093 | Ga0496126_0013093_3484_4074 | 161 |
| 581 | 3300048929 | Ga0496126_0029811 | Ga0496126_0029811_1221_1706 | 161 |
| 582 | 3300048929 | Ga0496126_0069802 | Ga0496126_0069802_2176_2661 | 161 |
| 583 | 3300048929 | Ga0496126_0091500 | Ga0496126_0091500_1847_2332 | 161 |
| 584 | 3300048929 | Ga0496126_0100043 | Ga0496126_0100043_1795_2325 | 161 |
| 585 | 3300048929 | Ga0496126_0135983 | Ga0496126_0135983_334_819 | 161 |
| 586 | 3300048929 | Ga0496126_0345989 | Ga0496126_0345989_540_1082 | 161 |
| 587 | 3300048929 | Ga0496126_0475360 | Ga0496126_0475360_244_729 | 161 |
| 588 | 3300048929 | Ga0496126_0569596 | Ga0496126_0569596_268_780 | 161 |
| 589 | 3300048929 | Ga0496126_0661822 | Ga0496126_0661822_147_632 | 161 |
| 590 | 3300049460 | Ga0495682_0084705 | Ga0495682_0084705_218_703 | 161 |
| 591 | 3300049575 | Ga0501039_0324632 | Ga0501039_0324632_367_891 | 161 |
| 592 | 3300049578 | Ga0501042_0169984 | Ga0501042_0169984_526_1011 | 161 |
| 593 | 3300050490 | nmdc:mga03n38_112700_c1 | nmdc:mga03n38_112700_c1_178_663 | 161 |
| 594 | 3300050490 | nmdc:mga03n38_19136_c1 | nmdc:mga03n38_19136_c1_378_863 | 161 |
| 595 | 3300050490 | nmdc:mga03n38_9425_c1 | nmdc:mga03n38_9425_c1_1796_2281 | 161 |
| 596 | 3300050491 | nmdc:mga00v17_101091_c1 | nmdc:mga00v17_101091_c1_1299_1784 | 161 |
| 597 | 3300050492 | nmdc:mga0yw44_206342_c1 | nmdc:mga0yw44_206342_c1_434_919 | 161 |
| 598 | 3300050492 | nmdc:mga0yw44_53575_c1 | nmdc:mga0yw44_53575_c1_1006_1491 | 161 |
| 599 | 3300050492 | nmdc:mga0yw44_70549_c1 | nmdc:mga0yw44_70549_c1_1435_1920 | 161 |
| 600 | 3300050493 | nmdc:mga0k408_216106_c1 | nmdc:mga0k408_216106_c1_635_1120 | 161 |
| 601 | 3300050493 | nmdc:mga0k408_274258_c1 | nmdc:mga0k408_274258_c1_403_888 | 161 |
| 602 | 3300050494 | nmdc:mga06z11_101998_c1 | nmdc:mga06z11_101998_c1_526_1011 | 161 |
| 603 | 3300050494 | nmdc:mga06z11_115427_c1 | nmdc:mga06z11_115427_c1_591_1121 | 161 |
| 604 | 3300050495 | nmdc:mga04h51_39692_c1 | nmdc:mga04h51_39692_c1_568_1053 | 161 |
| 605 | 3300050496 | nmdc:mga07m45_179015_c1 | nmdc:mga07m45_179015_c1_52_537 | 161 |
| 606 | 3300050496 | nmdc:mga07m45_251530_c1 | nmdc:mga07m45_251530_c1_171_656 | 161 |
| 607 | 3300050496 | nmdc:mga07m45_412426_c1 | nmdc:mga07m45_412426_c1_19_504 | 161 |
| 608 | 3300050496 | nmdc:mga07m45_89977_c1 | nmdc:mga07m45_89977_c1_664_1194 | 161 |
| 609 | 3300050507 | nmdc:mga05p37_474979_c1 | nmdc:mga05p37_474979_c1_615_1145 | 161 |
| 610 | 3300050508 | nmdc:mga09592_421087_c1 | nmdc:mga09592_421087_c1_250_735 | 161 |
| 611 | 3300050509 | nmdc:mga0qj67_68083_c1 | nmdc:mga0qj67_68083_c1_1581_2066 | 161 |
| 612 | 3300050511 | nmdc:mga08y16_511535_c1 | nmdc:mga08y16_511535_c1_623_1153 | 161 |
| 613 | 3300050514 | nmdc:mga08x19_160725_c1 | nmdc:mga08x19_160725_c1_582_1067 | 161 |
| 614 | 3300053077 | Ga0495601_0097696 | Ga0495601_0097696_912_1397 | 161 |
| 615 | 3300053079 | Ga0500610_0121034 | Ga0500610_0121034_685_1170 | 161 |
| 616 | 3300053080 | Ga0500635_0008869 | Ga0500635_0008869_377_922 | 161 |
| 617 | 3300053080 | Ga0500635_0016667 | Ga0500635_0016667_1233_1760 | 161 |
| 618 | 3300053085 | Ga0495619_0106544 | Ga0495619_0106544_845_1330 | 161 |
| 619 | 3300053087 | Ga0500643_037143 | Ga0500643_037143_347_832 | 161 |
| 620 | 3300053089 | Ga0500581_136541 | Ga0500581_136541_646_1131 | 161 |
| 621 | 3300053093 | Ga0500651_0332479 | Ga0500651_0332479_295_780 | 161 |
| 622 | 3300053094 | Ga0500566_0000782 | Ga0500566_0000782_13865_14386 | 161 |
| 623 | 3300053094 | Ga0500566_0069359 | Ga0500566_0069359_946_1431 | 161 |
| 624 | 3300053095 | Ga0500640_000202 | Ga0500640_000202_11567_12088 | 161 |
| 625 | 3300053102 | Ga0500554_002164 | Ga0500554_002164_2347_2832 | 161 |
| 626 | 3300053102 | Ga0500554_136372 | Ga0500554_136372_83_610 | 161 |
| 627 | 3300053111 | Ga0500572_000491 | Ga0500572_000491_8215_8736 | 161 |
| 628 | 3300053111 | Ga0500572_000589 | Ga0500572_000589_8452_8937 | 161 |
| 629 | 3300053111 | Ga0500572_169376 | Ga0500572_169376_130_615 | 161 |
| 630 | 3300053114 | Ga0500582_017624 | Ga0500582_017624_176_661 | 161 |
| 631 | 3300053119 | Ga0500595_000941 | Ga0500595_000941_2396_2881 | 161 |
| 632 | 3300053119 | Ga0500595_010224 | Ga0500595_010224_831_1361 | 161 |
| 633 | 3300053122 | Ga0500608_004402 | Ga0500608_004402_3828_4349 | 161 |
| 634 | 3300053123 | Ga0500614_000997 | Ga0500614_000997_2798_3319 | 161 |
| 635 | 3300053133 | Ga0500655_038742 | Ga0500655_038742_335_820 | 161 |
| 636 | 3300053136 | Ga0500559_0000685 | Ga0500559_0000685_6332_6817 | 161 |
| 637 | 3300053136 | Ga0500559_0004967 | Ga0500559_0004967_3350_3871 | 161 |
| 638 | 3300053142 | Ga0500577_0022124 | Ga0500577_0022124_286_771 | 161 |
| 639 | 3300053144 | Ga0500585_184063 | Ga0500585_184063_147_632 | 161 |
| 640 | 3300053150 | Ga0500603_000410 | Ga0500603_000410_6539_7066 | 161 |
| 641 | 3300053150 | Ga0500603_001295 | Ga0500603_001295_2949_3470 | 161 |
| 642 | 3300053154 | Ga0500619_145257 | Ga0500619_145257_115_600 | 161 |
| 643 | 3300053156 | Ga0500622_0137036 | Ga0500622_0137036_194_679 | 161 |
| 644 | 3300053159 | Ga0500630_004401 | Ga0500630_004401_2910_3431 | 161 |
| 645 | 3300053160 | Ga0500633_0084953 | Ga0500633_0084953_317_802 | 161 |
| 646 | 3300053161 | Ga0500634_0080110 | Ga0500634_0080110_475_960 | 161 |
| 647 | 3300053162 | Ga0500638_000054 | Ga0500638_000054_9866_10351 | 161 |
| 648 | 3300053162 | Ga0500638_006087 | Ga0500638_006087_1823_2344 | 161 |
| 649 | 3300053162 | Ga0500638_153202 | Ga0500638_153202_165_650 | 161 |
| 650 | 3300053163 | Ga0500639_000014 | Ga0500639_000014_101376_101897 | 161 |
| 651 | 3300053163 | Ga0500639_019925 | Ga0500639_019925_692_1177 | 161 |
| 652 | 3300053177 | Ga0500636_0242554 | Ga0500636_0242554_423_908 | 161 |
| 653 | 3300053177 | Ga0500636_0334024 | Ga0500636_0334024_165_650 | 161 |
| 654 | 3300053178 | Ga0500637_0000775 | Ga0500637_0000775_7412_7897 | 161 |
| 655 | 3300053178 | Ga0500637_0359574 | Ga0500637_0359574_93_623 | 161 |
| 656 | 3300053725 | Ga0500576_118601 | Ga0500576_118601_455_976 | 161 |
| 657 | 3300053728 | Ga0500657_060034 | Ga0500657_060034_556_1101 | 161 |
| 658 | 3300053730 | Ga0500645_041952 | Ga0500645_041952_698_1183 | 161 |
| 659 | 3300053733 | Ga0500552_001084 | Ga0500552_001084_1857_2402 | 161 |
| 660 | 3300053735 | Ga0500596_000125 | Ga0500596_000125_10228_10713 | 161 |
| 661 | 3300053735 | Ga0500596_001106 | Ga0500596_001106_1421_1942 | 161 |
| 662 | 3300053735 | Ga0500596_003950 | Ga0500596_003950_1842_2432 | 161 |
| 663 | 3300054114 | Ga0501084_1243030 | Ga0501084_1243030_45_569 | 161 |
| 664 | 3300059640 | Ga0587067_146027 | Ga0587067_146027_73_558 | 161 |
| 665 | 3300001989 | JGI24739J22299_10067365 | JGI24739J22299_100673651 | 162 |
| 666 | 3300002067 | JGI24735J21928_10137208 | JGI24735J21928_101372081 | 162 |
| 667 | 3300002067 | JGI24735J21928_10167818 | JGI24735J21928_101678181 | 162 |
| 668 | 3300003215 | JGI25153J46596_10003464 | JGI25153J46596_100034648 | 162 |
| 669 | 3300003354 | JGI25160J50197_1010655 | JGI25160J50197_10106555 | 162 |
| 670 | 3300003354 | JGI25160J50197_1044824 | JGI25160J50197_10448242 | 162 |
| 671 | 3300003771 | Ga0055526_1035146 | Ga0055526_10351463 | 162 |
| 672 | 3300003771 | Ga0055526_1071174 | Ga0055526_10711741 | 162 |
| 673 | 3300003794 | Ga0055531_10002385 | Ga0055531_1000238516 | 162 |
| 674 | 3300005262 | Ga0065165_1000866 | Ga0065165_100086638 | 162 |
| 675 | 3300005262 | Ga0065165_1027432 | Ga0065165_10274321 | 162 |
| 676 | 3300005262 | Ga0065165_1028002 | Ga0065165_10280023 | 162 |
| 677 | 3300005327 | Ga0070658_10871776 | Ga0070658_108717762 | 162 |
| 678 | 3300005330 | Ga0070690_100304757 | Ga0070690_1003047572 | 162 |
| 679 | 3300005335 | Ga0070666_10066299 | Ga0070666_100662993 | 162 |
| 680 | 3300005336 | Ga0070680_100009562 | Ga0070680_1000095623 | 162 |
| 681 | 3300005337 | Ga0070682_100286069 | Ga0070682_1002860693 | 162 |
| 682 | 3300005340 | Ga0070689_100034015 | Ga0070689_1000340153 | 162 |
| 683 | 3300005347 | Ga0070668_100070419 | Ga0070668_1000704191 | 162 |
| 684 | 3300005347 | Ga0070668_100471584 | Ga0070668_1004715842 | 162 |
| 685 | 3300005354 | Ga0070675_100820351 | Ga0070675_1008203511 | 162 |
| 686 | 3300005355 | Ga0070671_100155706 | Ga0070671_1001557062 | 162 |
| 687 | 3300005355 | Ga0070671_100296056 | Ga0070671_1002960562 | 162 |
| 688 | 3300005356 | Ga0070674_100031897 | Ga0070674_1000318973 | 162 |
| 689 | 3300005356 | Ga0070674_100558501 | Ga0070674_1005585012 | 162 |
| 690 | 3300005365 | Ga0070688_100094709 | Ga0070688_1000947093 | 162 |
| 691 | 3300005365 | Ga0070688_100392323 | Ga0070688_1003923231 | 162 |
| 692 | 3300005366 | Ga0070659_101018122 | Ga0070659_1010181222 | 162 |
| 693 | 3300005367 | Ga0070667_100081492 | Ga0070667_1000814926 | 162 |
| 694 | 3300005367 | Ga0070667_100154449 | Ga0070667_1001544492 | 162 |
| 695 | 3300005434 | Ga0070709_10140877 | Ga0070709_101408772 | 162 |
| 696 | 3300005435 | Ga0070714_100809222 | Ga0070714_1008092221 | 162 |
| 697 | 3300005435 | Ga0070714_101238926 | Ga0070714_1012389261 | 162 |
| 698 | 3300005437 | Ga0070710_10214467 | Ga0070710_102144671 | 162 |
| 699 | 3300005437 | Ga0070710_10400266 | Ga0070710_104002662 | 162 |
| 700 | 3300005438 | Ga0070701_10257512 | Ga0070701_102575122 | 162 |
| 701 | 3300005439 | Ga0070711_100087582 | Ga0070711_1000875823 | 162 |
| 702 | 3300005439 | Ga0070711_100588768 | Ga0070711_1005887682 | 162 |
| 703 | 3300005441 | Ga0070700_100371903 | Ga0070700_1003719031 | 162 |
| 704 | 3300005455 | Ga0070663_100034871 | Ga0070663_1000348713 | 162 |
| 705 | 3300005455 | Ga0070663_100160427 | Ga0070663_1001604273 | 162 |
| 706 | 3300005456 | Ga0070678_100288955 | Ga0070678_1002889551 | 162 |
| 707 | 3300005457 | Ga0070662_100645672 | Ga0070662_1006456721 | 162 |
| 708 | 3300005458 | Ga0070681_10451919 | Ga0070681_104519192 | 162 |
| 709 | 3300005459 | Ga0068867_100601507 | Ga0068867_1006015071 | 162 |
| 710 | 3300005530 | Ga0070679_100019564 | Ga0070679_10001956411 | 162 |
| 711 | 3300005535 | Ga0070684_101000850 | Ga0070684_1010008501 | 162 |
| 712 | 3300005539 | Ga0068853_101008163 | Ga0068853_1010081632 | 162 |
| 713 | 3300005539 | Ga0068853_101079883 | Ga0068853_1010798831 | 162 |
| 714 | 3300005547 | Ga0070693_100371047 | Ga0070693_1003710472 | 162 |
| 715 | 3300005547 | Ga0070693_100456748 | Ga0070693_1004567481 | 162 |
| 716 | 3300005548 | Ga0070665_100016553 | Ga0070665_1000165537 | 162 |
| 717 | 3300005548 | Ga0070665_100173152 | Ga0070665_1001731522 | 162 |
| 718 | 3300005548 | Ga0070665_100593670 | Ga0070665_1005936703 | 162 |
| 719 | 3300005548 | Ga0070665_100608603 | Ga0070665_1006086032 | 162 |
| 720 | 3300005563 | Ga0068855_100429882 | Ga0068855_1004298822 | 162 |
| 721 | 3300005563 | Ga0068855_100664013 | Ga0068855_1006640132 | 162 |
| 722 | 3300005564 | Ga0070664_100220459 | Ga0070664_1002204592 | 162 |
| 723 | 3300005577 | Ga0068857_100532995 | Ga0068857_1005329952 | 162 |
| 724 | 3300005614 | Ga0068856_100107968 | Ga0068856_1001079681 | 162 |
| 725 | 3300005614 | Ga0068856_100128710 | Ga0068856_1001287103 | 162 |
| 726 | 3300005614 | Ga0068856_100717653 | Ga0068856_1007176531 | 162 |
| 727 | 3300005616 | Ga0068852_100004969 | Ga0068852_10000496914 | 162 |
| 728 | 3300005617 | Ga0068859_100335297 | Ga0068859_1003352971 | 162 |
| 729 | 3300005618 | Ga0068864_100327678 | Ga0068864_1003276782 | 162 |
| 730 | 3300005618 | Ga0068864_100489238 | Ga0068864_1004892382 | 162 |
| 731 | 3300005841 | Ga0068863_100460294 | Ga0068863_1004602943 | 162 |
| 732 | 3300005841 | Ga0068863_101720090 | Ga0068863_1017200901 | 162 |
| 733 | 3300005843 | Ga0068860_100055238 | Ga0068860_1000552382 | 162 |
| 734 | 3300005844 | Ga0068862_100427253 | Ga0068862_1004272532 | 162 |
| 735 | 3300005937 | Ga0081455_10014398 | Ga0081455_100143986 | 162 |
| 736 | 3300005937 | Ga0081455_10032136 | Ga0081455_100321363 | 162 |
| 737 | 3300005983 | Ga0081540_1024289 | Ga0081540_10242891 | 162 |
| 738 | 3300005983 | Ga0081540_1210743 | Ga0081540_12107431 | 162 |
| 739 | 3300006028 | Ga0070717_10316938 | Ga0070717_103169383 | 162 |
| 740 | 3300006038 | Ga0075365_10063145 | Ga0075365_100631452 | 162 |
| 741 | 3300006038 | Ga0075365_10106330 | Ga0075365_101063304 | 162 |
| 742 | 3300006038 | Ga0075365_10269772 | Ga0075365_102697722 | 162 |
| 743 | 3300006042 | Ga0075368_10021379 | Ga0075368_100213793 | 162 |
| 744 | 3300006042 | Ga0075368_10038998 | Ga0075368_100389985 | 162 |
| 745 | 3300006042 | Ga0075368_10075771 | Ga0075368_100757712 | 162 |
| 746 | 3300006051 | Ga0075364_10207161 | Ga0075364_102071612 | 162 |
| 747 | 3300006051 | Ga0075364_10338005 | Ga0075364_103380052 | 162 |
| 748 | 3300006163 | Ga0070715_10143542 | Ga0070715_101435421 | 162 |
| 749 | 3300006173 | Ga0070716_100095473 | Ga0070716_1000954734 | 162 |
| 750 | 3300006173 | Ga0070716_100568934 | Ga0070716_1005689341 | 162 |
| 751 | 3300006177 | Ga0075362_10074388 | Ga0075362_100743881 | 162 |
| 752 | 3300006177 | Ga0075362_10098807 | Ga0075362_100988072 | 162 |
| 753 | 3300006178 | Ga0075367_10026029 | Ga0075367_100260294 | 162 |
| 754 | 3300006178 | Ga0075367_10093686 | Ga0075367_100936862 | 162 |
| 755 | 3300006186 | Ga0075369_10254701 | Ga0075369_102547012 | 162 |
| 756 | 3300006195 | Ga0075366_10154003 | Ga0075366_101540032 | 162 |
| 757 | 3300006237 | Ga0097621_100078787 | Ga0097621_1000787874 | 162 |
| 758 | 3300006237 | Ga0097621_100417483 | Ga0097621_1004174832 | 162 |
| 759 | 3300006353 | Ga0075370_10045013 | Ga0075370_100450132 | 162 |
| 760 | 3300006353 | Ga0075370_10143332 | Ga0075370_101433322 | 162 |
| 761 | 3300006358 | Ga0068871_100453465 | Ga0068871_1004534652 | 162 |
| 762 | 3300006358 | Ga0068871_100916798 | Ga0068871_1009167982 | 162 |
| 763 | 3300006871 | Ga0075434_100083977 | Ga0075434_1000839772 | 162 |
| 764 | 3300006881 | Ga0068865_100046207 | Ga0068865_1000462074 | 162 |
| 765 | 3300006914 | Ga0075436_100071375 | Ga0075436_1000713753 | 162 |
| 766 | 3300006931 | Ga0097620_100335321 | Ga0097620_1003353211 | 162 |
| 767 | 3300006942 | Ga0099824_1010822 | Ga0099824_101082216 | 162 |
| 768 | 3300006942 | Ga0099824_1028382 | Ga0099824_10283823 | 162 |
| 769 | 3300006942 | Ga0099824_1049275 | Ga0099824_10492751 | 162 |
| 770 | 3300006943 | Ga0099822_1005057 | Ga0099822_10050573 | 162 |
| 771 | 3300006944 | Ga0099823_1040671 | Ga0099823_10406714 | 162 |
| 772 | 3300007076 | Ga0075435_100082355 | Ga0075435_1000823555 | 162 |
| 773 | 3300007788 | Ga0099795_10088712 | Ga0099795_100887122 | 162 |
| 774 | 3300009093 | Ga0105240_10014591 | Ga0105240_1001459113 | 162 |
| 775 | 3300009093 | Ga0105240_10156831 | Ga0105240_101568313 | 162 |
| 776 | 3300009094 | Ga0111539_11139549 | Ga0111539_111395491 | 162 |
| 777 | 3300009098 | Ga0105245_10068919 | Ga0105245_100689195 | 162 |
| 778 | 3300009098 | Ga0105245_10768895 | Ga0105245_107688951 | 162 |
| 779 | 3300009101 | Ga0105247_10010671 | Ga0105247_100106714 | 162 |
| 780 | 3300009101 | Ga0105247_10604295 | Ga0105247_106042951 | 162 |
| 781 | 3300009101 | Ga0105247_10906325 | Ga0105247_109063251 | 162 |
| 782 | 3300009147 | Ga0114129_10770696 | Ga0114129_107706962 | 162 |
| 783 | 3300009148 | Ga0105243_10324676 | Ga0105243_103246763 | 162 |
| 784 | 3300009174 | Ga0105241_10037810 | Ga0105241_100378102 | 162 |
| 785 | 3300009174 | Ga0105241_10528991 | Ga0105241_105289911 | 162 |
| 786 | 3300009174 | Ga0105241_10594225 | Ga0105241_105942252 | 162 |
| 787 | 3300009174 | Ga0105241_11502248 | Ga0105241_115022481 | 162 |
| 788 | 3300009176 | Ga0105242_10603637 | Ga0105242_106036372 | 162 |
| 789 | 3300009177 | Ga0105248_10032002 | Ga0105248_100320026 | 162 |
| 790 | 3300009177 | Ga0105248_10158583 | Ga0105248_101585835 | 162 |
| 791 | 3300009545 | Ga0105237_10002547 | Ga0105237_1000254715 | 162 |
| 792 | 3300009545 | Ga0105237_10175622 | Ga0105237_101756223 | 162 |
| 793 | 3300009545 | Ga0105237_10506411 | Ga0105237_105064113 | 162 |
| 794 | 3300009551 | Ga0105238_10523929 | Ga0105238_105239292 | 162 |
| 795 | 3300009551 | Ga0105238_10824041 | Ga0105238_108240412 | 162 |
| 796 | 3300009553 | Ga0105249_10207839 | Ga0105249_102078392 | 162 |
| 797 | 3300010159 | Ga0099796_10391085 | Ga0099796_103910851 | 162 |
| 798 | 3300010375 | Ga0105239_10093731 | Ga0105239_100937314 | 162 |
| 799 | 3300010375 | Ga0105239_10099469 | Ga0105239_100994691 | 162 |
| 800 | 3300011119 | Ga0105246_10134639 | Ga0105246_101346394 | 162 |
| 801 | 3300011119 | Ga0105246_10919517 | Ga0105246_109195171 | 162 |
| 802 | 3300013100 | Ga0157373_10431744 | Ga0157373_104317442 | 162 |
| 803 | 3300013105 | Ga0157369_10026489 | Ga0157369_100264893 | 162 |
| 804 | 3300013105 | Ga0157369_10124032 | Ga0157369_101240323 | 162 |
| 805 | 3300013105 | Ga0157369_10932072 | Ga0157369_109320721 | 162 |
| 806 | 3300013105 | Ga0157369_11065831 | Ga0157369_110658311 | 162 |
| 807 | 3300013296 | Ga0157374_10542760 | Ga0157374_105427601 | 162 |
| 808 | 3300013296 | Ga0157374_10748608 | Ga0157374_107486082 | 162 |
| 809 | 3300013297 | Ga0157378_10366542 | Ga0157378_103665422 | 162 |
| 810 | 3300013297 | Ga0157378_11504997 | Ga0157378_115049971 | 162 |
| 811 | 3300013306 | Ga0163162_10144491 | Ga0163162_101444915 | 162 |
| 812 | 3300013306 | Ga0163162_10259131 | Ga0163162_102591313 | 162 |
| 813 | 3300013307 | Ga0157372_10633039 | Ga0157372_106330392 | 162 |
| 814 | 3300013308 | Ga0157375_10089567 | Ga0157375_100895673 | 162 |
| 815 | 3300014325 | Ga0163163_10023107 | Ga0163163_100231078 | 162 |
| 816 | 3300014325 | Ga0163163_10031785 | Ga0163163_100317855 | 162 |
| 817 | 3300014325 | Ga0163163_10067293 | Ga0163163_100672934 | 162 |
| 818 | 3300014326 | Ga0157380_10025361 | Ga0157380_100253617 | 162 |
| 819 | 3300014497 | Ga0182008_10155180 | Ga0182008_101551802 | 162 |
| 820 | 3300014968 | Ga0157379_10028501 | Ga0157379_100285014 | 162 |
| 821 | 3300014969 | Ga0157376_10520707 | Ga0157376_105207072 | 162 |
| 822 | 3300014969 | Ga0157376_10559144 | Ga0157376_105591442 | 162 |
| 823 | 3300014969 | Ga0157376_11655452 | Ga0157376_116554521 | 162 |
| 824 | 3300017792 | Ga0163161_10720792 | Ga0163161_107207922 | 162 |
| 825 | 3300020075 | Ga0206349_1097443 | Ga0206349_10974431 | 162 |
| 826 | 3300020076 | Ga0206355_1264525 | Ga0206355_12645252 | 162 |
| 827 | 3300020077 | Ga0206351_10235379 | Ga0206351_102353792 | 162 |
| 828 | 3300020080 | Ga0206350_10726292 | Ga0206350_107262921 | 162 |
| 829 | 3300020081 | Ga0206354_10827935 | Ga0206354_108279352 | 162 |
| 830 | 3300020082 | Ga0206353_11793332 | Ga0206353_117933321 | 162 |
| 831 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001255 | 162 |
| 832 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005255 | 162 |
| 833 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003509 | 162 |
| 834 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002256 | 162 |
| 835 | 3300021358 | Ga0213873_10161295 | Ga0213873_101612951 | 162 |
| 836 | 3300021358 | Ga0213873_10240959 | Ga0213873_102409591 | 162 |
| 837 | 3300021361 | Ga0213872_10067877 | Ga0213872_100678772 | 162 |
| 838 | 3300021377 | Ga0213874_10003990 | Ga0213874_100039903 | 162 |
| 839 | 3300021377 | Ga0213874_10014556 | Ga0213874_100145562 | 162 |
| 840 | 3300021384 | Ga0213876_10192735 | Ga0213876_101927351 | 162 |
| 841 | 3300021441 | Ga0213871_10076770 | Ga0213871_100767701 | 162 |
| 842 | 3300022467 | Ga0224712_10328636 | Ga0224712_103286361 | 162 |
| 843 | 3300025230 | Ga0209563_101046 | Ga0209563_1010465 | 162 |
| 844 | 3300025253 | Ga0209677_104016 | Ga0209677_1040169 | 162 |
| 845 | 3300025254 | Ga0209148_1000253 | Ga0209148_100025350 | 162 |
| 846 | 3300025258 | Ga0209129_1018292 | Ga0209129_10182921 | 162 |
| 847 | 3300025261 | Ga0209233_1035856 | Ga0209233_10358562 | 162 |
| 848 | 3300025261 | Ga0209233_1054537 | Ga0209233_10545371 | 162 |
| 849 | 3300025272 | Ga0209455_1000873 | Ga0209455_100087312 | 162 |
| 850 | 3300025272 | Ga0209455_1016237 | Ga0209455_10162371 | 162 |
| 851 | 3300025273 | Ga0209673_1067571 | Ga0209673_10675711 | 162 |
| 852 | 3300025295 | Ga0209564_1002453 | Ga0209564_10024539 | 162 |
| 853 | 3300025295 | Ga0209564_1054797 | Ga0209564_10547971 | 162 |
| 854 | 3300025297 | Ga0209758_1000026 | Ga0209758_100002668 | 162 |
| 855 | 3300025297 | Ga0209758_1000318 | Ga0209758_100031858 | 162 |
| 856 | 3300025297 | Ga0209758_1001681 | Ga0209758_100168126 | 162 |
| 857 | 3300025297 | Ga0209758_1001958 | Ga0209758_100195814 | 162 |
| 858 | 3300025297 | Ga0209758_1002426 | Ga0209758_100242625 | 162 |
| 859 | 3300025298 | Ga0209050_1073517 | Ga0209050_10735171 | 162 |
| 860 | 3300025299 | Ga0209256_1005534 | Ga0209256_10055341 | 162 |
| 861 | 3300025302 | Ga0207426_1001230 | Ga0207426_10012309 | 162 |
| 862 | 3300025302 | Ga0207426_1005043 | Ga0207426_10050433 | 162 |
| 863 | 3300025304 | Ga0209257_1002140 | Ga0209257_10021409 | 162 |
| 864 | 3300025315 | Ga0207697_10234688 | Ga0207697_102346881 | 162 |
| 865 | 3300025898 | Ga0207692_10241951 | Ga0207692_102419512 | 162 |
| 866 | 3300025900 | Ga0207710_10480215 | Ga0207710_104802151 | 162 |
| 867 | 3300025904 | Ga0207647_10004054 | Ga0207647_1000405416 | 162 |
| 868 | 3300025904 | Ga0207647_10262084 | Ga0207647_102620842 | 162 |
| 869 | 3300025904 | Ga0207647_10435538 | Ga0207647_104355381 | 162 |
| 870 | 3300025905 | Ga0207685_10370467 | Ga0207685_103704671 | 162 |
| 871 | 3300025906 | Ga0207699_10231449 | Ga0207699_102314492 | 162 |
| 872 | 3300025906 | Ga0207699_10279290 | Ga0207699_102792901 | 162 |
| 873 | 3300025911 | Ga0207654_10047399 | Ga0207654_100473992 | 162 |
| 874 | 3300025911 | Ga0207654_10169941 | Ga0207654_101699412 | 162 |
| 875 | 3300025911 | Ga0207654_10218860 | Ga0207654_102188601 | 162 |
| 876 | 3300025912 | Ga0207707_10001008 | Ga0207707_1000100838 | 162 |
| 877 | 3300025913 | Ga0207695_10000634 | Ga0207695_1000063435 | 162 |
| 878 | 3300025913 | Ga0207695_10043518 | Ga0207695_100435187 | 162 |
| 879 | 3300025914 | Ga0207671_10007760 | Ga0207671_100077605 | 162 |
| 880 | 3300025914 | Ga0207671_10051315 | Ga0207671_100513153 | 162 |
| 881 | 3300025914 | Ga0207671_10927534 | Ga0207671_109275341 | 162 |
| 882 | 3300025916 | Ga0207663_10060300 | Ga0207663_100603002 | 162 |
| 883 | 3300025916 | Ga0207663_10238315 | Ga0207663_102383152 | 162 |
| 884 | 3300025916 | Ga0207663_10275857 | Ga0207663_102758572 | 162 |
| 885 | 3300025917 | Ga0207660_10140017 | Ga0207660_101400172 | 162 |
| 886 | 3300025919 | Ga0207657_10157818 | Ga0207657_101578181 | 162 |
| 887 | 3300025921 | Ga0207652_10026858 | Ga0207652_100268581 | 162 |
| 888 | 3300025924 | Ga0207694_10702348 | Ga0207694_107023482 | 162 |
| 889 | 3300025924 | Ga0207694_10864496 | Ga0207694_108644962 | 162 |
| 890 | 3300025925 | Ga0207650_10505621 | Ga0207650_105056211 | 162 |
| 891 | 3300025926 | Ga0207659_10683660 | Ga0207659_106836601 | 162 |
| 892 | 3300025927 | Ga0207687_10013234 | Ga0207687_100132346 | 162 |
| 893 | 3300025927 | Ga0207687_10324016 | Ga0207687_103240163 | 162 |
| 894 | 3300025929 | Ga0207664_10722934 | Ga0207664_107229342 | 162 |
| 895 | 3300025929 | Ga0207664_10859993 | Ga0207664_108599931 | 162 |
| 896 | 3300025931 | Ga0207644_10234760 | Ga0207644_102347602 | 162 |
| 897 | 3300025934 | Ga0207686_10761154 | Ga0207686_107611541 | 162 |
| 898 | 3300025934 | Ga0207686_11623737 | Ga0207686_116237371 | 162 |
| 899 | 3300025935 | Ga0207709_10328952 | Ga0207709_103289521 | 162 |
| 900 | 3300025936 | Ga0207670_10026987 | Ga0207670_100269873 | 162 |
| 901 | 3300025938 | Ga0207704_10147895 | Ga0207704_101478952 | 162 |
| 902 | 3300025939 | Ga0207665_10054422 | Ga0207665_100544223 | 162 |
| 903 | 3300025939 | Ga0207665_10227011 | Ga0207665_102270111 | 162 |
| 904 | 3300025942 | Ga0207689_10246805 | Ga0207689_102468051 | 162 |
| 905 | 3300025945 | Ga0207679_10702135 | Ga0207679_107021351 | 162 |
| 906 | 3300025949 | Ga0207667_10523500 | Ga0207667_105235002 | 162 |
| 907 | 3300025981 | Ga0207640_10154178 | Ga0207640_101541782 | 162 |
| 908 | 3300025981 | Ga0207640_10335688 | Ga0207640_103356882 | 162 |
| 909 | 3300025986 | Ga0207658_10235007 | Ga0207658_102350074 | 162 |
| 910 | 3300026035 | Ga0207703_10433869 | Ga0207703_104338692 | 162 |
| 911 | 3300026041 | Ga0207639_10490580 | Ga0207639_104905802 | 162 |
| 912 | 3300026041 | Ga0207639_11494625 | Ga0207639_114946251 | 162 |
| 913 | 3300026067 | Ga0207678_10070613 | Ga0207678_100706132 | 162 |
| 914 | 3300026075 | Ga0207708_10234355 | Ga0207708_102343552 | 162 |
| 915 | 3300026078 | Ga0207702_10178192 | Ga0207702_101781921 | 162 |
| 916 | 3300026078 | Ga0207702_10204597 | Ga0207702_102045973 | 162 |
| 917 | 3300026078 | Ga0207702_10302276 | Ga0207702_103022762 | 162 |
| 918 | 3300026078 | Ga0207702_10455912 | Ga0207702_104559123 | 162 |
| 919 | 3300026088 | Ga0207641_10627152 | Ga0207641_106271522 | 162 |
| 920 | 3300026088 | Ga0207641_11509944 | Ga0207641_115099441 | 162 |
| 921 | 3300026089 | Ga0207648_10398043 | Ga0207648_103980432 | 162 |
| 922 | 3300026089 | Ga0207648_10437454 | Ga0207648_104374543 | 162 |
| 923 | 3300026095 | Ga0207676_10176877 | Ga0207676_101768771 | 162 |
| 924 | 3300026095 | Ga0207676_10566698 | Ga0207676_105666982 | 162 |
| 925 | 3300026116 | Ga0207674_10691940 | Ga0207674_106919401 | 162 |
| 926 | 3300026118 | Ga0207675_100631907 | Ga0207675_1006319071 | 162 |
| 927 | 3300026121 | Ga0207683_10249625 | Ga0207683_102496252 | 162 |
| 928 | 3300026142 | Ga0207698_10102271 | Ga0207698_101022711 | 162 |
| 929 | 3300026142 | Ga0207698_10264414 | Ga0207698_102644143 | 162 |
| 930 | 3300027296 | Ga0209389_1000090 | Ga0209389_100009016 | 162 |
| 931 | 3300027296 | Ga0209389_1000119 | Ga0209389_100011962 | 162 |
| 932 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007108 | 162 |
| 933 | 3300027357 | Ga0209589_1000010 | Ga0209589_1000010219 | 162 |
| 934 | 3300027361 | Ga0209489_100008 | Ga0209489_100008108 | 162 |
| 935 | 3300027361 | Ga0209489_100011 | Ga0209489_10001117 | 162 |
| 936 | 3300027361 | Ga0209489_100385 | Ga0209489_10038573 | 162 |
| 937 | 3300027363 | Ga0209700_100009 | Ga0209700_100009108 | 162 |
| 938 | 3300027363 | Ga0209700_100013 | Ga0209700_10001316 | 162 |
| 939 | 3300027424 | Ga0209984_1044705 | Ga0209984_10447051 | 162 |
| 940 | 3300027866 | Ga0209813_10197252 | Ga0209813_101972521 | 162 |
| 941 | 3300028379 | Ga0268266_10014950 | Ga0268266_100149507 | 162 |
| 942 | 3300028379 | Ga0268266_10059310 | Ga0268266_100593105 | 162 |
| 943 | 3300028379 | Ga0268266_11997431 | Ga0268266_119974311 | 162 |
| 944 | 3300031456 | Ga0307513_10585594 | Ga0307513_105855941 | 162 |
| 945 | 3300031595 | Ga0265313_10001400 | Ga0265313_1000140018 | 162 |
| 946 | 3300031616 | Ga0307508_10533142 | Ga0307508_105331421 | 162 |
| 947 | 3300031665 | Ga0316575_10000635 | Ga0316575_1000063515 | 162 |
| 948 | 3300031691 | Ga0316579_10015621 | Ga0316579_100156212 | 162 |
| 949 | 3300031727 | Ga0316576_10080740 | Ga0316576_100807404 | 162 |
| 950 | 3300031728 | Ga0316578_10035125 | Ga0316578_100351251 | 162 |
| 951 | 3300032133 | Ga0316583_10001515 | Ga0316583_1000151510 | 162 |
| 952 | 3300032137 | Ga0316585_10002313 | Ga0316585_100023133 | 162 |
| 953 | 3300032139 | Ga0316580_10002044 | Ga0316580_100020441 | 162 |
| 954 | 3300032168 | Ga0316593_10043581 | Ga0316593_100435813 | 162 |
| 955 | 3300033180 | Ga0307510_10034758 | Ga0307510_100347583 | 162 |
| 956 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004426 | 162 |
| 957 | 3300033541 | Ga0316596_1074199 | Ga0316596_10741992 | 162 |
| 958 | 3300035117 | Ga0373953_0190987 | Ga0373953_0190987_153_656 | 162 |
| 959 | 3300035118 | Ga0373954_0000381 | Ga0373954_0000381_188_676 | 162 |
| 960 | 3300035120 | Ga0373957_0197119 | Ga0373957_0197119_300_788 | 162 |
| 961 | 3300035170 | Ga0373943_0045634 | Ga0373943_0045634_1254_1751 | 162 |
| 962 | 3300035242 | Ga0373962_0137919 | Ga0373962_0137919_57_557 | 162 |
| 963 | 3300035398 | Ga0316574_0016544 | Ga0316574_0016544_3772_4266 | 162 |
| 964 | 3300035695 | Ga0373927_0026222 | Ga0373927_0026222_1894_2391 | 162 |
| 965 | 3300035695 | Ga0373927_0063432 | Ga0373927_0063432_16_594 | 162 |
| 966 | 3300035724 | Ga0373933_0068282 | Ga0373933_0068282_14_517 | 162 |
| 967 | 3300035725 | Ga0373947_0005469 | Ga0373947_0005469_2064_2561 | 162 |
| 968 | 3300035725 | Ga0373947_0079574 | Ga0373947_0079574_953_1531 | 162 |
| 969 | 3300036401 | Ga0373937_0151735 | Ga0373937_0151735_380_877 | 162 |
| 970 | 3300036712 | Ga0316584_0019546 | Ga0316584_0019546_3510_4004 | 162 |
| 971 | 3300037068 | Ga0373925_0003584 | Ga0373925_0003584_6959_7456 | 162 |
| 972 | 3300037068 | Ga0373925_0590211 | Ga0373925_0590211_153_641 | 162 |
| 973 | 3300037312 | Ga0395899_0031588 | Ga0395899_0031588_1902_2390 | 162 |
| 974 | 3300037418 | Ga0395900_0005987 | Ga0395900_0005987_1777_2265 | 162 |
| 975 | 3300037418 | Ga0395900_0006562 | Ga0395900_0006562_362_850 | 162 |
| 976 | 3300037418 | Ga0395900_0117980 | Ga0395900_0117980_2029_2517 | 162 |
| 977 | 3300037418 | Ga0395900_0498116 | Ga0395900_0498116_25_513 | 162 |
| 978 | 3300037466 | Ga0395898_0002317 | Ga0395898_0002317_5611_6174 | 162 |
| 979 | 3300037466 | Ga0395898_0003901 | Ga0395898_0003901_14318_14806 | 162 |
| 980 | 3300037466 | Ga0395898_0027942 | Ga0395898_0027942_3036_3524 | 162 |
| 981 | 3300037471 | Ga0395905_0341953 | Ga0395905_0341953_780_1268 | 162 |
| 982 | 3300037588 | Ga0316581_0100512 | Ga0316581_0100512_135_629 | 162 |
| 983 | 3300037853 | Ga0436364_0166995 | Ga0436364_0166995_233_721 | 162 |
| 984 | 3300037853 | Ga0436364_0972203 | Ga0436364_0972203_319_807 | 162 |
| 985 | 3300038443 | Ga0395901_0071983 | Ga0395901_0071983_1771_2259 | 162 |
| 986 | 3300038443 | Ga0395901_0133538 | Ga0395901_0133538_2044_2532 | 162 |
| 987 | 3300038443 | Ga0395901_0273920 | Ga0395901_0273920_1140_1628 | 162 |
| 988 | 3300038443 | Ga0395901_0362661 | Ga0395901_0362661_219_782 | 162 |
| 989 | 3300039062 | Ga0400483_150976 | Ga0400483_150976_56_544 | 162 |
| 990 | 3300039437 | Ga0436365_1099024 | Ga0436365_1099024_2188_2676 | 162 |
| 991 | 3300039437 | Ga0436365_1161464 | Ga0436365_1161464_984_1472 | 162 |
| 992 | 3300039437 | Ga0436365_1552255 | Ga0436365_1552255_83_571 | 162 |
| 993 | 3300039438 | Ga0436360_0503236 | Ga0436360_0503236_381_869 | 162 |
| 994 | 3300039438 | Ga0436360_0613744 | Ga0436360_0613744_116_604 | 162 |
| 995 | 3300039438 | Ga0436360_0727276 | Ga0436360_0727276_90_581 | 162 |
| 996 | 3300039438 | Ga0436360_1374083 | Ga0436360_1374083_121_609 | 162 |
| 997 | 3300039447 | Ga0436361_0169041 | Ga0436361_0169041_171_659 | 162 |
| 998 | 3300039447 | Ga0436361_0348664 | Ga0436361_0348664_936_1424 | 162 |
| 999 | 3300039447 | Ga0436361_0523159 | Ga0436361_0523159_931_1422 | 162 |
| 1000 | 3300039447 | Ga0436361_0988201 | Ga0436361_0988201_290_781 | 162 |
| 1001 | 3300039447 | Ga0436361_1003794 | Ga0436361_1003794_22_510 | 162 |
| 1002 | 3300039450 | Ga0436363_0002469 | Ga0436363_0002469_1358_1846 | 162 |
| 1003 | 3300039450 | Ga0436363_1181528 | Ga0436363_1181528_869_1357 | 162 |
| 1004 | 3300039453 | Ga0436362_1058248 | Ga0436362_1058248_125_613 | 162 |
| 1005 | 3300039453 | Ga0436362_1162318 | Ga0436362_1162318_21_548 | 162 |
| 1006 | 3300041452 | Ga0451793_1056189 | Ga0451793_1056189_88_576 | 162 |
| 1007 | 3300041498 | Ga0451841_0609926 | Ga0451841_0609926_244_732 | 162 |
| 1008 | 3300041501 | Ga0451845_0755152 | Ga0451845_0755152_79_567 | 162 |
| 1009 | 3300041509 | Ga0451843_0518491 | Ga0451843_0518491_176_664 | 162 |
| 1010 | 3300041512 | Ga0451853_0618708 | Ga0451853_0618708_797_1285 | 162 |
| 1011 | 3300042012 | Ga0439455_0105813 | Ga0439455_0105813_262_750 | 162 |
| 1012 | 3300044656 | Ga0466969_0127291 | Ga0466969_0127291_423_911 | 162 |
| 1013 | 3300044658 | Ga0466972_0000090 | Ga0466972_0000090_47953_48441 | 162 |
| 1014 | 3300044658 | Ga0466972_0020304 | Ga0466972_0020304_1576_2064 | 162 |
| 1015 | 3300044658 | Ga0466972_0193438 | Ga0466972_0193438_384_872 | 162 |
| 1016 | 3300044683 | Ga0466965_0178605 | Ga0466965_0178605_448_936 | 162 |
| 1017 | 3300044684 | Ga0466966_0000376 | Ga0466966_0000376_16042_16530 | 162 |
| 1018 | 3300044693 | Ga0466961_0001144 | Ga0466961_0001144_4804_5292 | 162 |
| 1019 | 3300044706 | Ga0466964_0026879 | Ga0466964_0026879_566_1054 | 162 |
| 1020 | 3300044719 | Ga0466971_0314109 | Ga0466971_0314109_252_740 | 162 |
| 1021 | 3300044735 | Ga0466968_0031144 | Ga0466968_0031144_716_1204 | 162 |
| 1022 | 3300044842 | Ga0466957_1021942 | Ga0466957_1021942_62_550 | 162 |
| 1023 | 3300044901 | Ga0466960_0131830 | Ga0466960_0131830_746_1234 | 162 |
| 1024 | 3300045049 | Ga0466959_0021227 | Ga0466959_0021227_4152_4640 | 162 |
| 1025 | 3300045049 | Ga0466959_0839640 | Ga0466959_0839640_34_522 | 162 |
| 1026 | 3300045049 | Ga0466959_0857890 | Ga0466959_0857890_80_580 | 162 |
| 1027 | 3300045976 | Ga0466967_0387509 | Ga0466967_0387509_837_1325 | 162 |
| 1028 | 3300045976 | Ga0466967_0539393 | Ga0466967_0539393_457_945 | 162 |
| 1029 | 3300045976 | Ga0466967_0613773 | Ga0466967_0613773_452_952 | 162 |
| 1030 | 3300045976 | Ga0466967_0725137 | Ga0466967_0725137_431_919 | 162 |
| 1031 | 3300046454 | Ga0495592_0021995 | Ga0495592_0021995_978_1466 | 162 |
| 1032 | 3300046454 | Ga0495592_0043623 | Ga0495592_0043623_1644_2132 | 162 |
| 1033 | 3300046454 | Ga0495592_0140714 | Ga0495592_0140714_803_1381 | 162 |
| 1034 | 3300046455 | Ga0495603_0001301 | Ga0495603_0001301_2937_3434 | 162 |
| 1035 | 3300046455 | Ga0495603_0268188 | Ga0495603_0268188_40_531 | 162 |
| 1036 | 3300046457 | Ga0495590_0371023 | Ga0495590_0371023_17_505 | 162 |
| 1037 | 3300046459 | Ga0495629_0001832 | Ga0495629_0001832_8214_8711 | 162 |
| 1038 | 3300046459 | Ga0495629_0002003 | Ga0495629_0002003_6850_7338 | 162 |
| 1039 | 3300046460 | Ga0495638_0003300 | Ga0495638_0003300_4475_4963 | 162 |
| 1040 | 3300046461 | Ga0495641_0011270 | Ga0495641_0011270_1909_2406 | 162 |
| 1041 | 3300046462 | Ga0495651_0002649 | Ga0495651_0002649_3956_4444 | 162 |
| 1042 | 3300046462 | Ga0495651_0017844 | Ga0495651_0017844_4016_4504 | 162 |
| 1043 | 3300046463 | Ga0495653_0027297 | Ga0495653_0027297_649_1137 | 162 |
| 1044 | 3300046463 | Ga0495653_0129341 | Ga0495653_0129341_203_700 | 162 |
| 1045 | 3300046471 | Ga0495650_0241458 | Ga0495650_0241458_40_528 | 162 |
| 1046 | 3300046472 | Ga0495580_0000261 | Ga0495580_0000261_17501_17998 | 162 |
| 1047 | 3300046472 | Ga0495580_0033388 | Ga0495580_0033388_498_1076 | 162 |
| 1048 | 3300046473 | Ga0495582_0078761 | Ga0495582_0078761_1297_1794 | 162 |
| 1049 | 3300046474 | Ga0495605_0136661 | Ga0495605_0136661_264_752 | 162 |
| 1050 | 3300046475 | Ga0495639_0019487 | Ga0495639_0019487_701_1198 | 162 |
| 1051 | 3300046476 | Ga0495662_0026870 | Ga0495662_0026870_2222_2710 | 162 |
| 1052 | 3300046476 | Ga0495662_0061704 | Ga0495662_0061704_630_1208 | 162 |
| 1053 | 3300046499 | Ga0495594_0000284 | Ga0495594_0000284_23192_23689 | 162 |
| 1054 | 3300046499 | Ga0495594_0144858 | Ga0495594_0144858_756_1244 | 162 |
| 1055 | 3300046500 | Ga0495596_0105781 | Ga0495596_0105781_543_1031 | 162 |
| 1056 | 3300046506 | Ga0495583_0126726 | Ga0495583_0126726_15_503 | 162 |
| 1057 | 3300046507 | Ga0495606_0014352 | Ga0495606_0014352_1341_1829 | 162 |
| 1058 | 3300046511 | Ga0495608_0009842 | Ga0495608_0009842_3172_3660 | 162 |
| 1059 | 3300046513 | Ga0495616_0168201 | Ga0495616_0168201_20_508 | 162 |
| 1060 | 3300046515 | Ga0495620_0041665 | Ga0495620_0041665_1312_1800 | 162 |
| 1061 | 3300046516 | Ga0495628_0033573 | Ga0495628_0033573_2682_3170 | 162 |
| 1062 | 3300046518 | Ga0495631_0067298 | Ga0495631_0067298_391_879 | 162 |
| 1063 | 3300046522 | Ga0495643_0022075 | Ga0495643_0022075_931_1419 | 162 |
| 1064 | 3300046524 | Ga0495648_0298688 | Ga0495648_0298688_14_502 | 162 |
| 1065 | 3300046526 | Ga0495666_0034048 | Ga0495666_0034048_308_805 | 162 |
| 1066 | 3300046529 | Ga0495652_0117980 | Ga0495652_0117980_210_698 | 162 |
| 1067 | 3300046529 | Ga0495652_0508205 | Ga0495652_0508205_57_545 | 162 |
| 1068 | 3300046530 | Ga0495654_0177449 | Ga0495654_0177449_375_863 | 162 |
| 1069 | 3300046531 | Ga0495665_0008036 | Ga0495665_0008036_3057_3554 | 162 |
| 1070 | 3300046533 | Ga0495640_0024832 | Ga0495640_0024832_1621_2109 | 162 |
| 1071 | 3300046536 | Ga0495587_0017270 | Ga0495587_0017270_3955_4443 | 162 |
| 1072 | 3300046538 | Ga0495609_0189078 | Ga0495609_0189078_240_728 | 162 |
| 1073 | 3300046543 | Ga0495645_0131734 | Ga0495645_0131734_694_1182 | 162 |
| 1074 | 3300046557 | Ga0495622_0000747 | Ga0495622_0000747_14426_14923 | 162 |
| 1075 | 3300046557 | Ga0495622_0022982 | Ga0495622_0022982_296_784 | 162 |
| 1076 | 3300046559 | Ga0495667_0009962 | Ga0495667_0009962_235_723 | 162 |
| 1077 | 3300046559 | Ga0495667_0085323 | Ga0495667_0085323_1508_2005 | 162 |
| 1078 | 3300046559 | Ga0495667_0383669 | Ga0495667_0383669_350_838 | 162 |
| 1079 | 3300046642 | Ga0495634_0029373 | Ga0495634_0029373_11_499 | 162 |
| 1080 | 3300046642 | Ga0495634_0053713 | Ga0495634_0053713_1254_1751 | 162 |
| 1081 | 3300046642 | Ga0495634_0628857 | Ga0495634_0628857_73_561 | 162 |
| 1082 | 3300046660 | Ga0495625_0133608 | Ga0495625_0133608_992_1480 | 162 |
| 1083 | 3300046663 | Ga0495635_0011899 | Ga0495635_0011899_3563_4051 | 162 |
| 1084 | 3300046663 | Ga0495635_0157775 | Ga0495635_0157775_212_709 | 162 |
| 1085 | 3300046674 | Ga0495588_0001508 | Ga0495588_0001508_8473_8970 | 162 |
| 1086 | 3300046674 | Ga0495588_0012476 | Ga0495588_0012476_2432_2920 | 162 |
| 1087 | 3300046675 | Ga0495657_0009271 | Ga0495657_0009271_2568_3056 | 162 |
| 1088 | 3300046675 | Ga0495657_0028992 | Ga0495657_0028992_124_612 | 162 |
| 1089 | 3300046678 | Ga0495599_0131157 | Ga0495599_0131157_1000_1488 | 162 |
| 1090 | 3300046679 | Ga0495623_0003419 | Ga0495623_0003419_3752_4240 | 162 |
| 1091 | 3300046680 | Ga0495646_0006337 | Ga0495646_0006337_425_913 | 162 |
| 1092 | 3300046680 | Ga0495646_0290397 | Ga0495646_0290397_102_680 | 162 |
| 1093 | 3300046680 | Ga0495646_0365906 | Ga0495646_0365906_80_568 | 162 |
| 1094 | 3300046681 | Ga0495647_0197054 | Ga0495647_0197054_33_611 | 162 |
| 1095 | 3300046684 | Ga0495669_0222864 | Ga0495669_0222864_359_847 | 162 |
| 1096 | 3300046689 | Ga0495613_0009976 | Ga0495613_0009976_5300_5797 | 162 |
| 1097 | 3300046689 | Ga0495613_0020985 | Ga0495613_0020985_277_855 | 162 |
| 1098 | 3300046690 | Ga0495624_0109087 | Ga0495624_0109087_1197_1685 | 162 |
| 1099 | 3300046690 | Ga0495624_0175381 | Ga0495624_0175381_334_912 | 162 |
| 1100 | 3300046809 | Ga0495600_0003537 | Ga0495600_0003537_6539_7027 | 162 |
| 1101 | 3300046809 | Ga0495600_0045680 | Ga0495600_0045680_442_930 | 162 |
| 1102 | 3300046809 | Ga0495600_0309583 | Ga0495600_0309583_96_593 | 162 |
| 1103 | 3300046810 | Ga0495660_0158933 | Ga0495660_0158933_462_950 | 162 |
| 1104 | 3300047315 | Ga0495581_0000368 | Ga0495581_0000368_5033_5530 | 162 |
| 1105 | 3300047315 | Ga0495581_0238264 | Ga0495581_0238264_356_847 | 162 |
| 1106 | 3300047317 | Ga0495604_0002688 | Ga0495604_0002688_2302_2790 | 162 |
| 1107 | 3300047317 | Ga0495604_0003063 | Ga0495604_0003063_120_608 | 162 |
| 1108 | 3300047319 | Ga0495674_0012542 | Ga0495674_0012542_6137_6625 | 162 |
| 1109 | 3300047319 | Ga0495674_0387419 | Ga0495674_0387419_426_929 | 162 |
| 1110 | 3300047321 | Ga0495676_0013647 | Ga0495676_0013647_3831_4319 | 162 |
| 1111 | 3300047321 | Ga0495676_0033223 | Ga0495676_0033223_1842_2339 | 162 |
| 1112 | 3300047321 | Ga0495676_0128148 | Ga0495676_0128148_671_1159 | 162 |
| 1113 | 3300047322 | Ga0495680_0001592 | Ga0495680_0001592_14822_15310 | 162 |
| 1114 | 3300047322 | Ga0495680_0033621 | Ga0495680_0033621_604_1101 | 162 |
| 1115 | 3300047323 | Ga0495683_0088990 | Ga0495683_0088990_509_997 | 162 |
| 1116 | 3300047443 | Ga0495687_020883 | Ga0495687_020883_307_795 | 162 |
| 1117 | 3300047444 | Ga0495675_0355771 | Ga0495675_0355771_230_718 | 162 |
| 1118 | 3300047469 | Ga0495673_0027314 | Ga0495673_0027314_397_885 | 162 |
| 1119 | 3300047471 | Ga0495684_0003322 | Ga0495684_0003322_3456_3944 | 162 |
| 1120 | 3300047471 | Ga0495684_0275799 | Ga0495684_0275799_120_617 | 162 |
| 1121 | 3300047472 | Ga0495686_0055651 | Ga0495686_0055651_890_1378 | 162 |
| 1122 | 3300047673 | Ga0495593_0002554 | Ga0495593_0002554_1148_1645 | 162 |
| 1123 | 3300048089 | Ga0495614_0004726 | Ga0495614_0004726_81_578 | 162 |
| 1124 | 3300048089 | Ga0495614_0132890 | Ga0495614_0132890_80_568 | 162 |
| 1125 | 3300048091 | Ga0495626_0400195 | Ga0495626_0400195_16_504 | 162 |
| 1126 | 3300048903 | Ga0496100_0016219 | Ga0496100_0016219_2181_2681 | 162 |
| 1127 | 3300048903 | Ga0496100_0444731 | Ga0496100_0444731_488_976 | 162 |
| 1128 | 3300048903 | Ga0496100_1020358 | Ga0496100_1020358_130_621 | 162 |
| 1129 | 3300048904 | Ga0496101_0015897 | Ga0496101_0015897_3696_4196 | 162 |
| 1130 | 3300048904 | Ga0496101_0816414 | Ga0496101_0816414_135_632 | 162 |
| 1131 | 3300048905 | Ga0496102_0010081 | Ga0496102_0010081_2155_2655 | 162 |
| 1132 | 3300048905 | Ga0496102_0134368 | Ga0496102_0134368_1776_2264 | 162 |
| 1133 | 3300048905 | Ga0496102_0183628 | Ga0496102_0183628_1105_1593 | 162 |
| 1134 | 3300048905 | Ga0496102_0908583 | Ga0496102_0908583_257_745 | 162 |
| 1135 | 3300048905 | Ga0496102_1439813 | Ga0496102_1439813_99_587 | 162 |
| 1136 | 3300048906 | Ga0496103_0021721 | Ga0496103_0021721_230_718 | 162 |
| 1137 | 3300048906 | Ga0496103_0608920 | Ga0496103_0608920_79_567 | 162 |
| 1138 | 3300048907 | Ga0496104_0004648 | Ga0496104_0004648_4393_4881 | 162 |
| 1139 | 3300048907 | Ga0496104_0005053 | Ga0496104_0005053_2210_2698 | 162 |
| 1140 | 3300048907 | Ga0496104_0038909 | Ga0496104_0038909_2065_2553 | 162 |
| 1141 | 3300048907 | Ga0496104_0042550 | Ga0496104_0042550_1219_1719 | 162 |
| 1142 | 3300048907 | Ga0496104_0102698 | Ga0496104_0102698_2196_2684 | 162 |
| 1143 | 3300048907 | Ga0496104_0108038 | Ga0496104_0108038_1082_1579 | 162 |
| 1144 | 3300048908 | Ga0496105_0001274 | Ga0496105_0001274_8713_9201 | 162 |
| 1145 | 3300048908 | Ga0496105_0015741 | Ga0496105_0015741_5271_5771 | 162 |
| 1146 | 3300048908 | Ga0496105_0056519 | Ga0496105_0056519_1602_2090 | 162 |
| 1147 | 3300048908 | Ga0496105_0337044 | Ga0496105_0337044_124_612 | 162 |
| 1148 | 3300048909 | Ga0496106_0005375 | Ga0496106_0005375_6601_7089 | 162 |
| 1149 | 3300048909 | Ga0496106_0034118 | Ga0496106_0034118_145_645 | 162 |
| 1150 | 3300048909 | Ga0496106_0334408 | Ga0496106_0334408_235_723 | 162 |
| 1151 | 3300048910 | Ga0496107_0003657 | Ga0496107_0003657_8020_8520 | 162 |
| 1152 | 3300048910 | Ga0496107_0041511 | Ga0496107_0041511_1267_1755 | 162 |
| 1153 | 3300048910 | Ga0496107_0045585 | Ga0496107_0045585_1256_1744 | 162 |
| 1154 | 3300048911 | Ga0496108_0260738 | Ga0496108_0260738_74_574 | 162 |
| 1155 | 3300048912 | Ga0496109_0004541 | Ga0496109_0004541_9928_10425 | 162 |
| 1156 | 3300048912 | Ga0496109_0129391 | Ga0496109_0129391_518_1015 | 162 |
| 1157 | 3300048912 | Ga0496109_0203959 | Ga0496109_0203959_257_745 | 162 |
| 1158 | 3300048913 | Ga0496110_0054167 | Ga0496110_0054167_771_1259 | 162 |
| 1159 | 3300048913 | Ga0496110_0059781 | Ga0496110_0059781_177_665 | 162 |
| 1160 | 3300048913 | Ga0496110_0071417 | Ga0496110_0071417_1402_1890 | 162 |
| 1161 | 3300048914 | Ga0496111_0598531 | Ga0496111_0598531_247_735 | 162 |
| 1162 | 3300048915 | Ga0496112_0008228 | Ga0496112_0008228_2694_3191 | 162 |
| 1163 | 3300048915 | Ga0496112_0011780 | Ga0496112_0011780_1655_2143 | 162 |
| 1164 | 3300048915 | Ga0496112_0093049 | Ga0496112_0093049_148_636 | 162 |
| 1165 | 3300048915 | Ga0496112_0175760 | Ga0496112_0175760_875_1363 | 162 |
| 1166 | 3300048915 | Ga0496112_0766181 | Ga0496112_0766181_278_856 | 162 |
| 1167 | 3300048916 | Ga0496113_0016555 | Ga0496113_0016555_3068_3556 | 162 |
| 1168 | 3300048917 | Ga0496114_0002797 | Ga0496114_0002797_6830_7330 | 162 |
| 1169 | 3300048917 | Ga0496114_0039763 | Ga0496114_0039763_1132_1620 | 162 |
| 1170 | 3300048917 | Ga0496114_0104779 | Ga0496114_0104779_300_788 | 162 |
| 1171 | 3300048918 | Ga0496115_0008294 | Ga0496115_0008294_4923_5423 | 162 |
| 1172 | 3300048918 | Ga0496115_0101595 | Ga0496115_0101595_1764_2252 | 162 |
| 1173 | 3300048920 | Ga0496117_0467314 | Ga0496117_0467314_56_544 | 162 |
| 1174 | 3300048922 | Ga0496119_0035093 | Ga0496119_0035093_191_679 | 162 |
| 1175 | 3300048924 | Ga0496121_0027882 | Ga0496121_0027882_1944_2432 | 162 |
| 1176 | 3300048924 | Ga0496121_0101077 | Ga0496121_0101077_386_991 | 162 |
| 1177 | 3300048924 | Ga0496121_0414292 | Ga0496121_0414292_361_849 | 162 |
| 1178 | 3300048925 | Ga0496122_0181486 | Ga0496122_0181486_355_843 | 162 |
| 1179 | 3300048927 | Ga0496124_0276745 | Ga0496124_0276745_96_584 | 162 |
| 1180 | 3300048929 | Ga0496126_0067724 | Ga0496126_0067724_433_921 | 162 |
| 1181 | 3300048929 | Ga0496126_0100224 | Ga0496126_0100224_417_905 | 162 |
| 1182 | 3300048929 | Ga0496126_0137486 | Ga0496126_0137486_1524_2027 | 162 |
| 1183 | 3300049459 | Ga0495678_179405 | Ga0495678_179405_134_622 | 162 |
| 1184 | 3300049568 | Ga0501031_0454927 | Ga0501031_0454927_278_781 | 162 |
| 1185 | 3300049569 | Ga0501032_0239344 | Ga0501032_0239344_190_690 | 162 |
| 1186 | 3300049571 | Ga0501034_0003588 | Ga0501034_0003588_15301_15801 | 162 |
| 1187 | 3300049572 | Ga0501036_0004751 | Ga0501036_0004751_8252_8752 | 162 |
| 1188 | 3300049573 | Ga0501037_0018958 | Ga0501037_0018958_1946_2446 | 162 |
| 1189 | 3300049574 | Ga0501038_0827655 | Ga0501038_0827655_73_561 | 162 |
| 1190 | 3300049575 | Ga0501039_0328428 | Ga0501039_0328428_212_718 | 162 |
| 1191 | 3300049578 | Ga0501042_0983394 | Ga0501042_0983394_98_598 | 162 |
| 1192 | 3300049579 | Ga0501043_0075494 | Ga0501043_0075494_1405_1905 | 162 |
| 1193 | 3300049581 | Ga0501047_0020483 | Ga0501047_0020483_1981_2481 | 162 |
| 1194 | 3300049582 | Ga0501048_0003860 | Ga0501048_0003860_8510_9010 | 162 |
| 1195 | 3300049586 | Ga0501070_0017987 | Ga0501070_0017987_3985_4473 | 162 |
| 1196 | 3300049587 | Ga0501071_0271692 | Ga0501071_0271692_422_928 | 162 |
| 1197 | 3300049589 | Ga0501073_0212651 | Ga0501073_0212651_110_610 | 162 |
| 1198 | 3300049589 | Ga0501073_0650013 | Ga0501073_0650013_62_550 | 162 |
| 1199 | 3300049590 | Ga0501074_0001697 | Ga0501074_0001697_383_883 | 162 |
| 1200 | 3300049590 | Ga0501074_0711054 | Ga0501074_0711054_160_663 | 162 |
| 1201 | 3300049593 | Ga0501077_0399834 | Ga0501077_0399834_307_807 | 162 |
| 1202 | 3300049742 | Ga0501080_0002496 | Ga0501080_0002496_6582_7082 | 162 |
| 1203 | 3300049742 | Ga0501080_0034681 | Ga0501080_0034681_3585_4073 | 162 |
| 1204 | 3300049742 | Ga0501080_0142125 | Ga0501080_0142125_617_1111 | 162 |
| 1205 | 3300049743 | Ga0501081_0087063 | Ga0501081_0087063_466_972 | 162 |
| 1206 | 3300049744 | Ga0501083_0007005 | Ga0501083_0007005_4739_5239 | 162 |
| 1207 | 3300049823 | Ga0501044_0090322 | Ga0501044_0090322_1636_2136 | 162 |
| 1208 | 3300049823 | Ga0501044_0340448 | Ga0501044_0340448_470_970 | 162 |
| 1209 | 3300050489 | nmdc:mga03683_82299_c1 | nmdc:mga03683_82299_c1_597_1085 | 162 |
| 1210 | 3300050491 | nmdc:mga00v17_124062_c1 | nmdc:mga00v17_124062_c1_636_1124 | 162 |
| 1211 | 3300050492 | nmdc:mga0yw44_165241_c1 | nmdc:mga0yw44_165241_c1_212_700 | 162 |
| 1212 | 3300050492 | nmdc:mga0yw44_738623_c1 | nmdc:mga0yw44_738623_c1_154_642 | 162 |
| 1213 | 3300050493 | nmdc:mga0k408_129854_c1 | nmdc:mga0k408_129854_c1_609_1097 | 162 |
| 1214 | 3300050493 | nmdc:mga0k408_213672_c1 | nmdc:mga0k408_213672_c1_609_1097 | 162 |
| 1215 | 3300050494 | nmdc:mga06z11_123511_c1 | nmdc:mga06z11_123511_c1_587_1075 | 162 |
| 1216 | 3300050496 | nmdc:mga07m45_102261_c1 | nmdc:mga07m45_102261_c1_664_1152 | 162 |
| 1217 | 3300050496 | nmdc:mga07m45_205513_c1 | nmdc:mga07m45_205513_c1_614_1102 | 162 |
| 1218 | 3300050496 | nmdc:mga07m45_531111_c1 | nmdc:mga07m45_531111_c1_132_620 | 162 |
| 1219 | 3300050507 | nmdc:mga05p37_622521_c1 | nmdc:mga05p37_622521_c1_211_702 | 162 |
| 1220 | 3300050512 | nmdc:mga0n895_174471_c1 | nmdc:mga0n895_174471_c1_731_1219 | 162 |
| 1221 | 3300050516 | nmdc:mga0sz30_132270_c1 | nmdc:mga0sz30_132270_c1_240_728 | 162 |
| 1222 | 3300050516 | nmdc:mga0sz30_195165_c1 | nmdc:mga0sz30_195165_c1_358_846 | 162 |
| 1223 | 3300050516 | nmdc:mga0sz30_223271_c1 | nmdc:mga0sz30_223271_c1_272_760 | 162 |
| 1224 | 3300053077 | Ga0495601_0001907 | Ga0495601_0001907_9243_9821 | 162 |
| 1225 | 3300053077 | Ga0495601_0004725 | Ga0495601_0004725_2995_3483 | 162 |
| 1226 | 3300053077 | Ga0495601_0007199 | Ga0495601_0007199_1368_1871 | 162 |
| 1227 | 3300053077 | Ga0495601_0154563 | Ga0495601_0154563_283_771 | 162 |
| 1228 | 3300053077 | Ga0495601_0253112 | Ga0495601_0253112_365_853 | 162 |
| 1229 | 3300053078 | Ga0495612_0038753 | Ga0495612_0038753_970_1548 | 162 |
| 1230 | 3300053078 | Ga0495612_0070359 | Ga0495612_0070359_891_1379 | 162 |
| 1231 | 3300053080 | Ga0500635_0207927 | Ga0500635_0207927_236_724 | 162 |
| 1232 | 3300053083 | Ga0495655_0232282 | Ga0495655_0232282_40_528 | 162 |
| 1233 | 3300053084 | Ga0495595_0014577 | Ga0495595_0014577_1736_2236 | 162 |
| 1234 | 3300053084 | Ga0495595_0042157 | Ga0495595_0042157_573_1070 | 162 |
| 1235 | 3300053084 | Ga0495595_0114625 | Ga0495595_0114625_213_701 | 162 |
| 1236 | 3300053085 | Ga0495619_0020759 | Ga0495619_0020759_2248_2751 | 162 |
| 1237 | 3300053085 | Ga0495619_0041314 | Ga0495619_0041314_148_636 | 162 |
| 1238 | 3300053085 | Ga0495619_0095556 | Ga0495619_0095556_963_1460 | 162 |
| 1239 | 3300053087 | Ga0500643_000057 | Ga0500643_000057_53246_53734 | 162 |
| 1240 | 3300053091 | Ga0500647_0023284 | Ga0500647_0023284_1344_1832 | 162 |
| 1241 | 3300053092 | Ga0500583_0522955 | Ga0500583_0522955_36_524 | 162 |
| 1242 | 3300053093 | Ga0500651_0015044 | Ga0500651_0015044_2701_3189 | 162 |
| 1243 | 3300053094 | Ga0500566_0013301 | Ga0500566_0013301_3970_4458 | 162 |
| 1244 | 3300053094 | Ga0500566_0128497 | Ga0500566_0128497_251_739 | 162 |
| 1245 | 3300053096 | Ga0500641_0009460 | Ga0500641_0009460_76_564 | 162 |
| 1246 | 3300053103 | Ga0500555_007068 | Ga0500555_007068_692_1180 | 162 |
| 1247 | 3300053105 | Ga0500557_000166 | Ga0500557_000166_12954_13442 | 162 |
| 1248 | 3300053108 | Ga0500562_005331 | Ga0500562_005331_2685_3173 | 162 |
| 1249 | 3300053109 | Ga0500569_138904 | Ga0500569_138904_286_774 | 162 |
| 1250 | 3300053116 | Ga0500592_009627 | Ga0500592_009627_993_1481 | 162 |
| 1251 | 3300053119 | Ga0500595_006374 | Ga0500595_006374_1754_2296 | 162 |
| 1252 | 3300053119 | Ga0500595_007766 | Ga0500595_007766_1991_2479 | 162 |
| 1253 | 3300053121 | Ga0500607_037062 | Ga0500607_037062_365_853 | 162 |
| 1254 | 3300053122 | Ga0500608_124583 | Ga0500608_124583_102_590 | 162 |
| 1255 | 3300053125 | Ga0500618_019597 | Ga0500618_019597_995_1483 | 162 |
| 1256 | 3300053130 | Ga0500642_0000339 | Ga0500642_0000339_2581_3069 | 162 |
| 1257 | 3300053130 | Ga0500642_0009945 | Ga0500642_0009945_1271_1759 | 162 |
| 1258 | 3300053133 | Ga0500655_006563 | Ga0500655_006563_1514_2002 | 162 |
| 1259 | 3300053138 | Ga0500564_049917 | Ga0500564_049917_1016_1504 | 162 |
| 1260 | 3300053139 | Ga0500568_0002843 | Ga0500568_0002843_1012_1500 | 162 |
| 1261 | 3300053142 | Ga0500577_0167513 | Ga0500577_0167513_422_910 | 162 |
| 1262 | 3300053144 | Ga0500585_051361 | Ga0500585_051361_103_591 | 162 |
| 1263 | 3300053148 | Ga0500590_019293 | Ga0500590_019293_230_718 | 162 |
| 1264 | 3300053151 | Ga0500604_0052467 | Ga0500604_0052467_626_1114 | 162 |
| 1265 | 3300053153 | Ga0500616_0022650 | Ga0500616_0022650_2417_2905 | 162 |
| 1266 | 3300053154 | Ga0500619_022091 | Ga0500619_022091_10_498 | 162 |
| 1267 | 3300053156 | Ga0500622_0219357 | Ga0500622_0219357_71_559 | 162 |
| 1268 | 3300053158 | Ga0500627_0035720 | Ga0500627_0035720_162_650 | 162 |
| 1269 | 3300053160 | Ga0500633_0145162 | Ga0500633_0145162_338_826 | 162 |
| 1270 | 3300053162 | Ga0500638_039905 | Ga0500638_039905_1033_1521 | 162 |
| 1271 | 3300053177 | Ga0500636_0009861 | Ga0500636_0009861_4036_4524 | 162 |
| 1272 | 3300053729 | Ga0500625_000205 | Ga0500625_000205_4574_5062 | 162 |
| 1273 | 3300053729 | Ga0500625_200884 | Ga0500625_200884_141_629 | 162 |
| 1274 | 3300053736 | Ga0500599_001758 | Ga0500599_001758_775_1263 | 162 |
| 1275 | 3300053737 | Ga0500601_000513 | Ga0500601_000513_1946_2434 | 162 |
| 1276 | 3300054114 | Ga0501084_0446612 | Ga0501084_0446612_178_672 | 162 |
| 1277 | 3300054114 | Ga0501084_0578713 | Ga0501084_0578713_341_847 | 162 |
| 1278 | 3300059477 | Ga0587084_030140 | Ga0587084_030140_139_627 | 162 |
| 1279 | 3300059491 | Ga0587070_050959 | Ga0587070_050959_164_652 | 162 |
| 1280 | 3300059493 | Ga0587077_138695 | Ga0587077_138695_116_604 | 162 |
| 1281 | 3300059506 | Ga0587085_036960 | Ga0587085_036960_136_624 | 162 |
| 1282 | 3300059605 | Ga0587106_111468 | Ga0587106_111468_33_521 | 162 |
| 1283 | 3300059622 | Ga0587099_035001 | Ga0587099_035001_105_593 | 162 |
| 1284 | 3300059626 | Ga0587115_070856 | Ga0587115_070856_86_574 | 162 |
| 1285 | 3300059642 | Ga0587069_107743 | Ga0587069_107743_26_514 | 162 |
| 1286 | 3300060344 | Ga0587071_148886 | Ga0587071_148886_61_549 | 162 |
| 1287 | 3300060353 | Ga0501082_0293842 | Ga0501082_0293842_768_1274 | 162 |
| 1288 | 3300060353 | Ga0501082_1140868 | Ga0501082_1140868_138_638 | 162 |
| 1289 | 3300061734 | Ga0530510_0289353 | Ga0530510_0289353_245_751 | 162 |
| 1290 | iso_pu_bacteria | 8016613128 | 8016613828 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8sqq-assembly1.cif.gz_A | crystal structure of bacterioferritin (bfr) from brucella abortus (apo cubic form 2, f16l mutant) | 0.9932 | 2 | 153 |
| 3fvb-assembly1.cif.gz_A | crystal structure of ferritin (bacterioferritin) from brucella melitensis | 0.9927 | 2 | 153 |
| 3gvy-assembly1.cif.gz_B | crystal structure of bacterioferritin from r.sphaeroides | 0.9916 | 1 | 153 |
| 3gvy-assembly1.cif.gz_C | crystal structure of bacterioferritin from r.sphaeroides | 0.9901 | 1 | 153 |
| 4to9-assembly1.cif.gz_H | 2.0a resolution structure of bfrb (n148l) from pseudomonas aeruginosa | 0.9893 | 2 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xx9B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.993 | 1 | 153 | 1.20.1260.10 |
| 3fvbA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9927 | 2 | 153 | 1.20.1260.10 |
| 3gvyB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9916 | 1 | 153 | 1.20.1260.10 |
| af_P0ABD3_1_158_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9904 | 1 | 154 | 1.20.1260.10 |
| 3gvyA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9897 | 1 | 153 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258LLL3-F1-model_v4 | Bacterioferritin | 1.003 | 1 | 133 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A258DYD7-F1-model_v4 | Bacterioferritin | 1.002 | 1 | 118 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A7X7R6Y5-F1-model_v4 | Bacterioferritin | 1.001 | 1 | 87 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A167GY78-F1-model_v4 | deleted | 1 | 1 | 139 |
|
| AF-A0A2V9SKB7-F1-model_v4 | Bacterioferritin | 1 | 1 | 108 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar