F492594
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1287 | 487 | 1245 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10222468|Ga0105249_102224682 |
| Length | 303 |
| Sequence | MIRKSGYRFSEKIMLKQNGRTQMKMLTRRLLMAAAASLAFTGCAIAQDKSQEKSILVASTTSTQDSGLFGHILPMFKAKIGIDVKVVAQGTGQALDTARRGDADVVFVHAKPAEEKFLSEGFGVKRYPVMYNDFVLIGPNSDPAGIKGSKDITAALAAIKAKGADFISRGDKSGTHQAELNLWKVAGIDIAKDKGPWYKEIGQGMGAALNTASASNAYVLADRGTWLSFKNRGDLGIAVEGDKRLFNQYGVMLVNPEKHPSVKKDFGRQFIDWLVSSEGQKAIADYKINGEQLFYPNASDSGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 6 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 7 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 8 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 9 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 10 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 11 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 12 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 13 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 14 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 15 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 16 | 2791355199 | |||
| 17 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 18 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 19 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 20 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 21 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 22 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 23 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 24 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 25 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 26 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 27 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 28 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 29 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 30 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 31 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 32 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 33 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 34 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 35 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 131 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 132 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 160 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 161 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 162 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 163 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 241 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 243 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 245 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 248 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 252 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 255 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 256 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 265 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 266 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 271 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 272 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 282 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 294 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 295 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 298 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 299 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 300 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 301 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 303 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 304 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 305 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 306 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 310 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 386 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 387 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 388 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 389 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 390 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 391 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 394 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 395 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 396 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 397 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 398 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 399 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 400 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 401 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 402 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 403 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 404 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 405 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 406 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 407 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 408 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 434 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 439 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 440 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 441 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 442 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 444 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 457 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 461 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 462 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 463 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 464 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 466 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 467 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 468 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 470 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 473 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 474 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 475 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 477 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 479 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 480 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 481 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 482 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 483 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 484 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 485 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 486 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 487 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.81 |
| Metatranscriptomes | 0 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.7 |
| Nodule | 1.94 |
| Rhizoplane | 7.23 |
| Rhizosphere | 75.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1008904 | 3300002987 | Bacteria | 2703 |
| 2 | JGI25165J46597_1000033 | 3300003214 | Bacteria | 293030 |
| 3 | JGI25165J46597_1000087 | 3300003214 | Bacteria | 170335 |
| 4 | JGI25153J46596_10001537 | 3300003215 | Bacteria | 13698 |
| 5 | JGI25404J52841_10003411 | 3300003659 | Bacteria | 3138 |
| 6 | JGI25404J52841_10028431 | 3300003659 | Bacteria | 1200 |
| 7 | Ga0055542_1009052 | 3300003762 | Bacteria | 1901 |
| 8 | Ga0065165_1000209 | 3300005262 | Bacteria | 101834 |
| 9 | Ga0065715_10157741 | 3300005293 | Bacteria | 1660 |
| 10 | Ga0070683_100191712 | 3300005329 | Bacteria | 1941 |
| 11 | Ga0070683_100411014 | 3300005329 | Bacteria | 1291 |
| 12 | Ga0070690_100039011 | 3300005330 | Bacteria | 2999 |
| 13 | Ga0070670_100018595 | 3300005331 | Bacteria | 5955 |
| 14 | Ga0070670_100622686 | 3300005331 | Bacteria | 967 |
| 15 | Ga0068869_100017122 | 3300005334 | Bacteria | 4905 |
| 16 | Ga0068869_100175363 | 3300005334 | Bacteria | 1677 |
| 17 | Ga0070666_10014844 | 3300005335 | Bacteria | 4963 |
| 18 | Ga0070666_10030114 | 3300005335 | Bacteria | 3574 |
| 19 | Ga0070666_10242110 | 3300005335 | Bacteria | 1276 |
| 20 | Ga0070680_100020280 | 3300005336 | Bacteria | 5275 |
| 21 | Ga0070680_100020948 | 3300005336 | Bacteria | 5191 |
| 22 | Ga0070680_100022812 | 3300005336 | Bacteria | 4986 |
| 23 | Ga0070680_100329092 | 3300005336 | Bacteria | 1297 |
| 24 | Ga0070682_100144487 | 3300005337 | Bacteria | 1625 |
| 25 | Ga0070682_100182740 | 3300005337 | Bacteria | 1466 |
| 26 | Ga0068868_100005715 | 3300005338 | Bacteria | 8756 |
| 27 | Ga0068868_100007157 | 3300005338 | Bacteria | 7929 |
| 28 | Ga0068868_100007160 | 3300005338 | Bacteria | 7928 |
| 29 | Ga0070660_100013688 | 3300005339 | Bacteria | 5829 |
| 30 | Ga0070660_100016043 | 3300005339 | Bacteria | 5427 |
| 31 | Ga0070689_100141679 | 3300005340 | Bacteria | 1934 |
| 32 | Ga0070687_100297431 | 3300005343 | Bacteria | 1023 |
| 33 | Ga0070661_100101157 | 3300005344 | Bacteria | 2144 |
| 34 | Ga0070692_10198783 | 3300005345 | Bacteria | 1173 |
| 35 | Ga0070668_100106151 | 3300005347 | Bacteria | 2231 |
| 36 | Ga0070668_100126362 | 3300005347 | Bacteria | 2048 |
| 37 | Ga0070668_100141257 | 3300005347 | Bacteria | 1940 |
| 38 | Ga0070669_100162443 | 3300005353 | Bacteria | 1736 |
| 39 | Ga0070675_100001562 | 3300005354 | Bacteria | 16925 |
| 40 | Ga0070675_100136591 | 3300005354 | Bacteria | 2093 |
| 41 | Ga0070675_100294084 | 3300005354 | Bacteria | 1429 |
| 42 | Ga0070671_100001109 | 3300005355 | Bacteria | 19956 |
| 43 | Ga0070671_100051865 | 3300005355 | Bacteria | 3411 |
| 44 | Ga0070671_100120177 | 3300005355 | Bacteria | 2210 |
| 45 | Ga0070671_100452947 | 3300005355 | Bacteria | 1101 |
| 46 | Ga0070674_100163784 | 3300005356 | Bacteria | 1689 |
| 47 | Ga0070674_100304584 | 3300005356 | Bacteria | 1271 |
| 48 | Ga0070674_100342737 | 3300005356 | Bacteria | 1204 |
| 49 | Ga0070673_100071020 | 3300005364 | Bacteria | 2796 |
| 50 | Ga0070673_100860993 | 3300005364 | Bacteria | 839 |
| 51 | Ga0070688_100010378 | 3300005365 | Bacteria | 5134 |
| 52 | Ga0070688_100089020 | 3300005365 | Bacteria | 2014 |
| 53 | Ga0070688_100201784 | 3300005365 | Bacteria | 1392 |
| 54 | Ga0070659_100055929 | 3300005366 | Bacteria | 3110 |
| 55 | Ga0070703_10004707 | 3300005406 | Bacteria | 3817 |
| 56 | Ga0070714_100080871 | 3300005435 | Bacteria | 2828 |
| 57 | Ga0070714_100130067 | 3300005435 | Bacteria | 2249 |
| 58 | Ga0070713_100007640 | 3300005436 | Bacteria | 7610 |
| 59 | Ga0070713_100289289 | 3300005436 | Bacteria | 1505 |
| 60 | Ga0070713_100339479 | 3300005436 | Bacteria | 1391 |
| 61 | Ga0070710_10038211 | 3300005437 | Bacteria | 2635 |
| 62 | Ga0070701_10076488 | 3300005438 | Bacteria | 1802 |
| 63 | Ga0070711_100245935 | 3300005439 | Bacteria | 1401 |
| 64 | Ga0070711_100404754 | 3300005439 | Bacteria | 1108 |
| 65 | Ga0070705_100000025 | 3300005440 | Bacteria | 79976 |
| 66 | Ga0070705_100075186 | 3300005440 | Bacteria | 2056 |
| 67 | Ga0070694_100002659 | 3300005444 | Bacteria | 10574 |
| 68 | Ga0070694_100039128 | 3300005444 | Bacteria | 3155 |
| 69 | Ga0070694_100096498 | 3300005444 | Bacteria | 2084 |
| 70 | Ga0070663_100021199 | 3300005455 | Bacteria | 4318 |
| 71 | Ga0070663_100028448 | 3300005455 | Bacteria | 3805 |
| 72 | Ga0070663_100048448 | 3300005455 | Bacteria | 3013 |
| 73 | Ga0070663_100116047 | 3300005455 | Bacteria | 2017 |
| 74 | Ga0070663_100263241 | 3300005455 | Bacteria | 1368 |
| 75 | Ga0070678_100001839 | 3300005456 | Bacteria | 11456 |
| 76 | Ga0070678_100020180 | 3300005456 | Bacteria | 4367 |
| 77 | Ga0070678_100116621 | 3300005456 | Bacteria | 2098 |
| 78 | Ga0070678_100390470 | 3300005456 | Bacteria | 1206 |
| 79 | Ga0070662_100041616 | 3300005457 | Bacteria | 3279 |
| 80 | Ga0070662_100158126 | 3300005457 | Bacteria | 1770 |
| 81 | Ga0070662_100271656 | 3300005457 | Bacteria | 1369 |
| 82 | Ga0070681_10003583 | 3300005458 | Bacteria | 14563 |
| 83 | Ga0070681_10019283 | 3300005458 | Bacteria | 6824 |
| 84 | Ga0070681_10020454 | 3300005458 | Bacteria | 6634 |
| 85 | Ga0070706_100065025 | 3300005467 | Bacteria | 3372 |
| 86 | Ga0070706_100129470 | 3300005467 | Bacteria | 2355 |
| 87 | Ga0070707_100181967 | 3300005468 | Bacteria | 2049 |
| 88 | Ga0070698_100081539 | 3300005471 | Bacteria | 3229 |
| 89 | Ga0070698_100355433 | 3300005471 | Bacteria | 1397 |
| 90 | Ga0070698_100627416 | 3300005471 | Bacteria | 1016 |
| 91 | Ga0070699_100005455 | 3300005518 | Bacteria | 11149 |
| 92 | Ga0070679_100017206 | 3300005530 | Bacteria | 6992 |
| 93 | Ga0070679_100055345 | 3300005530 | Bacteria | 3950 |
| 94 | Ga0070679_100091499 | 3300005530 | Bacteria | 3030 |
| 95 | Ga0070679_100151366 | 3300005530 | Bacteria | 2296 |
| 96 | Ga0070679_100497797 | 3300005530 | Bacteria | 1163 |
| 97 | Ga0070684_100502230 | 3300005535 | Bacteria | 1123 |
| 98 | Ga0070697_100039826 | 3300005536 | Bacteria | 3801 |
| 99 | Ga0068853_100040297 | 3300005539 | Bacteria | 3985 |
| 100 | Ga0068853_100078703 | 3300005539 | Bacteria | 2881 |
| 101 | Ga0070686_100029775 | 3300005544 | Bacteria | 3325 |
| 102 | Ga0070686_100067129 | 3300005544 | Bacteria | 2335 |
| 103 | Ga0070695_100001562 | 3300005545 | Bacteria | 12784 |
| 104 | Ga0070695_100002588 | 3300005545 | Bacteria | 10446 |
| 105 | Ga0070695_100042426 | 3300005545 | Bacteria | 2888 |
| 106 | Ga0070696_100006938 | 3300005546 | Bacteria | 7562 |
| 107 | Ga0070696_100269342 | 3300005546 | Bacteria | 1294 |
| 108 | Ga0070693_100015729 | 3300005547 | Bacteria | 3901 |
| 109 | Ga0070693_100164039 | 3300005547 | Bacteria | 1418 |
| 110 | Ga0070665_100017279 | 3300005548 | Bacteria | 7239 |
| 111 | Ga0070665_100036690 | 3300005548 | Bacteria | 4929 |
| 112 | Ga0070665_100060269 | 3300005548 | Bacteria | 3804 |
| 113 | Ga0070665_100060631 | 3300005548 | Bacteria | 3792 |
| 114 | Ga0070665_100089787 | 3300005548 | Bacteria | 3079 |
| 115 | Ga0070665_100105910 | 3300005548 | Bacteria | 2814 |
| 116 | Ga0070665_100115492 | 3300005548 | Bacteria | 2687 |
| 117 | Ga0070665_100136512 | 3300005548 | Bacteria | 2456 |
| 118 | Ga0068855_100021611 | 3300005563 | Bacteria | 7718 |
| 119 | Ga0068855_100154201 | 3300005563 | Bacteria | 2611 |
| 120 | Ga0068855_100342016 | 3300005563 | Bacteria | 1649 |
| 121 | Ga0068855_100837186 | 3300005563 | Bacteria | 976 |
| 122 | Ga0070664_100176017 | 3300005564 | Bacteria | 1899 |
| 123 | Ga0070664_100298355 | 3300005564 | Bacteria | 1456 |
| 124 | Ga0068857_100019837 | 3300005577 | Bacteria | 5907 |
| 125 | Ga0068857_100055694 | 3300005577 | Bacteria | 3509 |
| 126 | Ga0068857_100063891 | 3300005577 | Bacteria | 3272 |
| 127 | Ga0068857_100182900 | 3300005577 | Bacteria | 1908 |
| 128 | Ga0068857_100264315 | 3300005577 | Bacteria | 1580 |
| 129 | Ga0068856_100021308 | 3300005614 | Bacteria | 6298 |
| 130 | Ga0068856_100381812 | 3300005614 | Bacteria | 1428 |
| 131 | Ga0068856_100670610 | 3300005614 | Bacteria | 1057 |
| 132 | Ga0068852_100027942 | 3300005616 | Bacteria | 4607 |
| 133 | Ga0068852_100040460 | 3300005616 | Bacteria | 3933 |
| 134 | Ga0068852_100053703 | 3300005616 | Bacteria | 3470 |
| 135 | Ga0068859_100001168 | 3300005617 | Bacteria | 26848 |
| 136 | Ga0068859_100004047 | 3300005617 | Bacteria | 14944 |
| 137 | Ga0068859_100241285 | 3300005617 | Bacteria | 1896 |
| 138 | Ga0068859_100264911 | 3300005617 | Bacteria | 1810 |
| 139 | Ga0068864_100002145 | 3300005618 | Bacteria | 16304 |
| 140 | Ga0068864_100013439 | 3300005618 | Bacteria | 6788 |
| 141 | Ga0068864_100025263 | 3300005618 | Bacteria | 5001 |
| 142 | Ga0068864_100209501 | 3300005618 | Bacteria | 1794 |
| 143 | Ga0068864_100298750 | 3300005618 | Bacteria | 1507 |
| 144 | Ga0068866_10092115 | 3300005718 | Bacteria | 1653 |
| 145 | Ga0068861_100013208 | 3300005719 | Bacteria | 5777 |
| 146 | Ga0068861_100322267 | 3300005719 | Bacteria | 1346 |
| 147 | Ga0068851_10011125 | 3300005834 | Bacteria | 4214 |
| 148 | Ga0068851_10013505 | 3300005834 | Bacteria | 3866 |
| 149 | Ga0068870_10030478 | 3300005840 | Bacteria | 2726 |
| 150 | Ga0068870_10072449 | 3300005840 | Bacteria | 1882 |
| 151 | Ga0068863_100021798 | 3300005841 | Bacteria | 6114 |
| 152 | Ga0068863_100844381 | 3300005841 | Bacteria | 914 |
| 153 | Ga0068858_100001027 | 3300005842 | Bacteria | 28804 |
| 154 | Ga0068858_100079726 | 3300005842 | Bacteria | 3042 |
| 155 | Ga0068858_100232239 | 3300005842 | Bacteria | 1749 |
| 156 | Ga0068858_100581983 | 3300005842 | Bacteria | 1085 |
| 157 | Ga0068860_100000277 | 3300005843 | Bacteria | 73951 |
| 158 | Ga0068860_100125995 | 3300005843 | Bacteria | 2455 |
| 159 | Ga0068860_100202794 | 3300005843 | Bacteria | 1922 |
| 160 | Ga0068862_100002691 | 3300005844 | Bacteria | 15621 |
| 161 | Ga0068862_100034967 | 3300005844 | Bacteria | 4253 |
| 162 | Ga0068862_100062761 | 3300005844 | Bacteria | 3196 |
| 163 | Ga0068862_100191733 | 3300005844 | Bacteria | 1839 |
| 164 | Ga0068862_100668954 | 3300005844 | Bacteria | 1003 |
| 165 | Ga0081455_10006927 | 3300005937 | Bacteria | 12057 |
| 166 | Ga0081455_10010133 | 3300005937 | Bacteria | 9603 |
| 167 | Ga0081455_10048471 | 3300005937 | Bacteria | 3670 |
| 168 | Ga0081455_10067232 | 3300005937 | Bacteria | 2987 |
| 169 | Ga0081455_10074531 | 3300005937 | Bacteria | 2803 |
| 170 | Ga0081455_10173848 | 3300005937 | Bacteria | 1637 |
| 171 | Ga0081538_10011066 | 3300005981 | Bacteria | 7336 |
| 172 | Ga0081538_10013652 | 3300005981 | Bacteria | 6421 |
| 173 | Ga0081540_1000948 | 3300005983 | Bacteria | 26149 |
| 174 | Ga0081540_1001030 | 3300005983 | Bacteria | 24972 |
| 175 | Ga0081540_1001133 | 3300005983 | Bacteria | 23567 |
| 176 | Ga0081540_1004138 | 3300005983 | Bacteria | 11189 |
| 177 | Ga0081540_1007687 | 3300005983 | Bacteria | 7643 |
| 178 | Ga0081540_1009201 | 3300005983 | Bacteria | 6815 |
| 179 | Ga0081540_1013951 | 3300005983 | Bacteria | 5186 |
| 180 | Ga0081540_1035627 | 3300005983 | Bacteria | 2665 |
| 181 | Ga0081540_1090369 | 3300005983 | Bacteria | 1348 |
| 182 | Ga0081540_1098779 | 3300005983 | Bacteria | 1263 |
| 183 | Ga0081539_10089918 | 3300005985 | Bacteria | 1589 |
| 184 | Ga0070717_10055084 | 3300006028 | Bacteria | 3280 |
| 185 | Ga0070717_10075229 | 3300006028 | Bacteria | 2824 |
| 186 | Ga0070717_10573725 | 3300006028 | Bacteria | 1022 |
| 187 | Ga0075365_10037210 | 3300006038 | Bacteria | 3158 |
| 188 | Ga0075365_10081986 | 3300006038 | Bacteria | 2186 |
| 189 | Ga0075365_10097868 | 3300006038 | Bacteria | 2006 |
| 190 | Ga0075365_10289724 | 3300006038 | Bacteria | 1152 |
| 191 | Ga0075368_10007748 | 3300006042 | Bacteria | 3803 |
| 192 | Ga0075368_10008930 | 3300006042 | Bacteria | 3593 |
| 193 | Ga0075368_10011042 | 3300006042 | Bacteria | 3280 |
| 194 | Ga0075363_100000141 | 3300006048 | Bacteria | 17707 |
| 195 | Ga0075363_100010581 | 3300006048 | Bacteria | 4388 |
| 196 | Ga0075363_100017455 | 3300006048 | Bacteria | 3560 |
| 197 | Ga0075363_100018089 | 3300006048 | Bacteria | 3505 |
| 198 | Ga0075363_100085720 | 3300006048 | Bacteria | 1728 |
| 199 | Ga0075363_100117604 | 3300006048 | Bacteria | 1482 |
| 200 | Ga0075364_10014811 | 3300006051 | Bacteria | 4824 |
| 201 | Ga0075364_10149608 | 3300006051 | Bacteria | 1573 |
| 202 | Ga0075364_10300634 | 3300006051 | Bacteria | 1092 |
| 203 | Ga0075364_10306092 | 3300006051 | Bacteria | 1082 |
| 204 | Ga0070716_100073068 | 3300006173 | Bacteria | 2022 |
| 205 | Ga0070712_100035165 | 3300006175 | Bacteria | 3400 |
| 206 | Ga0070712_100073137 | 3300006175 | Bacteria | 2458 |
| 207 | Ga0070712_100097031 | 3300006175 | Bacteria | 2171 |
| 208 | Ga0070712_100105268 | 3300006175 | Bacteria | 2095 |
| 209 | Ga0070712_100136565 | 3300006175 | Bacteria | 1865 |
| 210 | Ga0075362_10017898 | 3300006177 | Bacteria | 2926 |
| 211 | Ga0075362_10022640 | 3300006177 | Bacteria | 2650 |
| 212 | Ga0075362_10024000 | 3300006177 | Bacteria | 2584 |
| 213 | Ga0075362_10035038 | 3300006177 | Bacteria | 2190 |
| 214 | Ga0075362_10035505 | 3300006177 | Bacteria | 2176 |
| 215 | Ga0075362_10049476 | 3300006177 | Bacteria | 1877 |
| 216 | Ga0075362_10157868 | 3300006177 | Bacteria | 1091 |
| 217 | Ga0075367_10001014 | 3300006178 | Bacteria | 11543 |
| 218 | Ga0075367_10021428 | 3300006178 | Bacteria | 3611 |
| 219 | Ga0075367_10054935 | 3300006178 | Bacteria | 2362 |
| 220 | Ga0075367_10070956 | 3300006178 | Bacteria | 2095 |
| 221 | Ga0075369_10015863 | 3300006186 | Bacteria | 3031 |
| 222 | Ga0075369_10058565 | 3300006186 | Bacteria | 1677 |
| 223 | Ga0075366_10001716 | 3300006195 | Bacteria | 11020 |
| 224 | Ga0075366_10012370 | 3300006195 | Bacteria | 4840 |
| 225 | Ga0075366_10035333 | 3300006195 | Bacteria | 2946 |
| 226 | Ga0075366_10041040 | 3300006195 | Bacteria | 2738 |
| 227 | Ga0075366_10143419 | 3300006195 | Bacteria | 1445 |
| 228 | Ga0097621_100006676 | 3300006237 | Bacteria | 8199 |
| 229 | Ga0097621_100079744 | 3300006237 | Bacteria | 2722 |
| 230 | Ga0097621_100174536 | 3300006237 | Bacteria | 1854 |
| 231 | Ga0097621_100402810 | 3300006237 | Bacteria | 1225 |
| 232 | Ga0075370_10016088 | 3300006353 | Bacteria | 4020 |
| 233 | Ga0075370_10020374 | 3300006353 | Bacteria | 3624 |
| 234 | Ga0075370_10025265 | 3300006353 | Bacteria | 3284 |
| 235 | Ga0075370_10029757 | 3300006353 | Bacteria | 3043 |
| 236 | Ga0075370_10032929 | 3300006353 | Bacteria | 2900 |
| 237 | Ga0068871_100001655 | 3300006358 | Bacteria | 14988 |
| 238 | Ga0075428_100013546 | 3300006844 | Bacteria | 9079 |
| 239 | Ga0075428_100029097 | 3300006844 | Bacteria | 6113 |
| 240 | Ga0075428_100043811 | 3300006844 | Bacteria | 4919 |
| 241 | Ga0075428_100129570 | 3300006844 | Bacteria | 2745 |
| 242 | Ga0075430_100189206 | 3300006846 | Bacteria | 1711 |
| 243 | Ga0075430_100247339 | 3300006846 | Bacteria | 1478 |
| 244 | Ga0075431_100060089 | 3300006847 | Bacteria | 3922 |
| 245 | Ga0075431_100098882 | 3300006847 | Bacteria | 3011 |
| 246 | Ga0075431_100531924 | 3300006847 | Bacteria | 1164 |
| 247 | Ga0075433_10055263 | 3300006852 | Bacteria | 3465 |
| 248 | Ga0075433_10378537 | 3300006852 | Bacteria | 1250 |
| 249 | Ga0075434_100028848 | 3300006871 | Bacteria | 5458 |
| 250 | Ga0075434_100113871 | 3300006871 | Bacteria | 2717 |
| 251 | Ga0075434_100149486 | 3300006871 | Bacteria | 2356 |
| 252 | Ga0075429_100008549 | 3300006880 | Bacteria | 8904 |
| 253 | Ga0075429_100573423 | 3300006880 | Bacteria | 989 |
| 254 | Ga0068865_100121251 | 3300006881 | Bacteria | 1945 |
| 255 | Ga0097620_100001168 | 3300006931 | Bacteria | 26848 |
| 256 | Ga0097620_100004047 | 3300006931 | Bacteria | 14944 |
| 257 | Ga0097620_100241287 | 3300006931 | Bacteria | 1896 |
| 258 | Ga0097620_100264898 | 3300006931 | Bacteria | 1810 |
| 259 | Ga0075435_100265293 | 3300007076 | Bacteria | 1464 |
| 260 | Ga0099794_10003694 | 3300007265 | Bacteria | 5888 |
| 261 | Ga0099794_10026848 | 3300007265 | Bacteria | 2665 |
| 262 | Ga0099795_10009230 | 3300007788 | Bacteria | 2852 |
| 263 | Ga0099795_10009692 | 3300007788 | Bacteria | 2805 |
| 264 | Ga0099795_10010883 | 3300007788 | Bacteria | 2697 |
| 265 | Ga0099795_10074455 | 3300007788 | Bacteria | 1287 |
| 266 | Ga0105250_10089165 | 3300009092 | Bacteria | 1253 |
| 267 | Ga0105240_10093755 | 3300009093 | Bacteria | 3664 |
| 268 | Ga0105240_10236287 | 3300009093 | Bacteria | 2121 |
| 269 | Ga0111539_10032652 | 3300009094 | Bacteria | 6321 |
| 270 | Ga0111539_10037824 | 3300009094 | Bacteria | 5823 |
| 271 | Ga0111539_10059271 | 3300009094 | Bacteria | 4540 |
| 272 | Ga0111539_10468757 | 3300009094 | Bacteria | 1466 |
| 273 | Ga0105245_10008002 | 3300009098 | Bacteria | 9245 |
| 274 | Ga0105245_10101824 | 3300009098 | Bacteria | 2659 |
| 275 | Ga0105245_10136801 | 3300009098 | Bacteria | 2303 |
| 276 | Ga0105245_10214103 | 3300009098 | Bacteria | 1856 |
| 277 | Ga0105245_10388880 | 3300009098 | Bacteria | 1391 |
| 278 | Ga0105245_10879512 | 3300009098 | Bacteria | 937 |
| 279 | Ga0105247_10043195 | 3300009101 | Bacteria | 2761 |
| 280 | Ga0105247_10252945 | 3300009101 | Bacteria | 1205 |
| 281 | Ga0114129_10061881 | 3300009147 | Bacteria | 5231 |
| 282 | Ga0114129_10079079 | 3300009147 | Bacteria | 4572 |
| 283 | Ga0114129_10104178 | 3300009147 | Bacteria | 3921 |
| 284 | Ga0114129_10220299 | 3300009147 | Bacteria | 2560 |
| 285 | Ga0114129_10390310 | 3300009147 | Bacteria | 1836 |
| 286 | Ga0114129_10525711 | 3300009147 | Bacteria | 1542 |
| 287 | Ga0105243_10773495 | 3300009148 | Bacteria | 943 |
| 288 | Ga0105241_10188416 | 3300009174 | Bacteria | 1716 |
| 289 | Ga0105242_10035577 | 3300009176 | Bacteria | 3993 |
| 290 | Ga0105242_10246244 | 3300009176 | Bacteria | 1609 |
| 291 | Ga0105248_10009206 | 3300009177 | Bacteria | 10865 |
| 292 | Ga0105248_10155990 | 3300009177 | Bacteria | 2576 |
| 293 | Ga0105248_10356426 | 3300009177 | Bacteria | 1647 |
| 294 | Ga0105237_10008069 | 3300009545 | Bacteria | 11447 |
| 295 | Ga0105237_10028364 | 3300009545 | Bacteria | 5703 |
| 296 | Ga0105237_10141503 | 3300009545 | Bacteria | 2400 |
| 297 | Ga0105238_10048532 | 3300009551 | Bacteria | 4278 |
| 298 | Ga0105238_10059815 | 3300009551 | Bacteria | 3816 |
| 299 | Ga0105238_10082285 | 3300009551 | Bacteria | 3209 |
| 300 | Ga0105249_10000605 | 3300009553 | Bacteria | 32703 |
| 301 | Ga0105249_10003429 | 3300009553 | Bacteria | 13728 |
| 302 | Ga0105249_10222468 | 3300009553 | Bacteria | 1858 |
| 303 | Ga0105249_10519592 | 3300009553 | Bacteria | 1238 |
| 304 | Ga0099796_10051530 | 3300010159 | Bacteria | 1430 |
| 305 | Ga0105239_10038265 | 3300010375 | Bacteria | 5257 |
| 306 | Ga0105239_10151061 | 3300010375 | Bacteria | 2592 |
| 307 | Ga0105239_10216339 | 3300010375 | Bacteria | 2148 |
| 308 | Ga0105239_10236387 | 3300010375 | Bacteria | 2051 |
| 309 | Ga0105239_10331930 | 3300010375 | Bacteria | 1715 |
| 310 | Ga0105239_10342245 | 3300010375 | Bacteria | 1688 |
| 311 | Ga0105239_10432352 | 3300010375 | Bacteria | 1492 |
| 312 | Ga0105246_10010454 | 3300011119 | Bacteria | 5744 |
| 313 | Ga0157371_10032500 | 3300013102 | Bacteria | 3754 |
| 314 | Ga0157370_10206548 | 3300013104 | Bacteria | 1821 |
| 315 | Ga0157370_10222583 | 3300013104 | Bacteria | 1748 |
| 316 | Ga0157370_10346516 | 3300013104 | Bacteria | 1369 |
| 317 | Ga0157369_10036010 | 3300013105 | Bacteria | 5425 |
| 318 | Ga0157374_10009863 | 3300013296 | Bacteria | 8198 |
| 319 | Ga0157374_10075314 | 3300013296 | Bacteria | 3189 |
| 320 | Ga0157374_10159069 | 3300013296 | Bacteria | 2200 |
| 321 | Ga0157378_10083134 | 3300013297 | Bacteria | 2897 |
| 322 | Ga0157378_10224932 | 3300013297 | Bacteria | 1785 |
| 323 | Ga0157378_10312879 | 3300013297 | Bacteria | 1523 |
| 324 | Ga0157378_10328021 | 3300013297 | Bacteria | 1489 |
| 325 | Ga0163162_10050519 | 3300013306 | Bacteria | 4170 |
| 326 | Ga0163162_10279533 | 3300013306 | Bacteria | 1801 |
| 327 | Ga0157375_10006361 | 3300013308 | Bacteria | 10295 |
| 328 | Ga0157375_10342272 | 3300013308 | Bacteria | 1661 |
| 329 | Ga0157375_10809922 | 3300013308 | Bacteria | 1085 |
| 330 | Ga0163163_10010304 | 3300014325 | Bacteria | 8401 |
| 331 | Ga0163163_10052924 | 3300014325 | Bacteria | 4007 |
| 332 | Ga0163163_10079530 | 3300014325 | Bacteria | 3277 |
| 333 | Ga0157379_10594393 | 3300014968 | Bacteria | 1033 |
| 334 | Ga0157376_10006589 | 3300014969 | Bacteria | 8217 |
| 335 | Ga0157376_10147314 | 3300014969 | Bacteria | 2119 |
| 336 | Ga0163161_10174938 | 3300017792 | Bacteria | 1643 |
| 337 | Ga0163161_10269997 | 3300017792 | Bacteria | 1331 |
| 338 | Ga0213872_10012811 | 3300021361 | Bacteria | 3936 |
| 339 | Ga0213872_10045180 | 3300021361 | Bacteria | 2004 |
| 340 | Ga0213874_10039268 | 3300021377 | Bacteria | 1409 |
| 341 | Ga0213876_10075200 | 3300021384 | Bacteria | 1784 |
| 342 | Ga0213875_10007330 | 3300021388 | Bacteria | 5703 |
| 343 | Ga0209677_100384 | 3300025253 | Bacteria | 27031 |
| 344 | Ga0209148_1000634 | 3300025254 | Bacteria | 30929 |
| 345 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 346 | Ga0209233_1000823 | 3300025261 | Bacteria | 13758 |
| 347 | Ga0209455_1001165 | 3300025272 | Bacteria | 12657 |
| 348 | Ga0209130_1000080 | 3300025284 | Bacteria | 166684 |
| 349 | Ga0209758_1000257 | 3300025297 | Bacteria | 106321 |
| 350 | Ga0209758_1020356 | 3300025297 | Bacteria | 3143 |
| 351 | Ga0209758_1029534 | 3300025297 | Bacteria | 2290 |
| 352 | Ga0209256_1000282 | 3300025299 | Bacteria | 89402 |
| 353 | Ga0207426_1005450 | 3300025302 | Bacteria | 5804 |
| 354 | Ga0207426_1017876 | 3300025302 | Bacteria | 2511 |
| 355 | Ga0207697_10055877 | 3300025315 | Bacteria | 1637 |
| 356 | Ga0207656_10034197 | 3300025321 | Bacteria | 2121 |
| 357 | Ga0207653_10007423 | 3300025885 | Bacteria | 3418 |
| 358 | Ga0207692_10012694 | 3300025898 | Bacteria | 3626 |
| 359 | Ga0207692_10050940 | 3300025898 | Bacteria | 2096 |
| 360 | Ga0207710_10053772 | 3300025900 | Bacteria | 1812 |
| 361 | Ga0207688_10006216 | 3300025901 | Bacteria | 6495 |
| 362 | Ga0207688_10031618 | 3300025901 | Bacteria | 2923 |
| 363 | Ga0207688_10141219 | 3300025901 | Bacteria | 1417 |
| 364 | Ga0207680_10004135 | 3300025903 | Bacteria | 6869 |
| 365 | Ga0207680_10062751 | 3300025903 | Bacteria | 2272 |
| 366 | Ga0207699_10010856 | 3300025906 | Bacteria | 4587 |
| 367 | Ga0207643_10005792 | 3300025908 | Bacteria | 6604 |
| 368 | Ga0207643_10183727 | 3300025908 | Bacteria | 1266 |
| 369 | Ga0207684_10065073 | 3300025910 | Bacteria | 3096 |
| 370 | Ga0207684_10094446 | 3300025910 | Bacteria | 2551 |
| 371 | Ga0207654_10008079 | 3300025911 | Bacteria | 5304 |
| 372 | Ga0207654_10092864 | 3300025911 | Bacteria | 1844 |
| 373 | Ga0207707_10000173 | 3300025912 | Bacteria | 67122 |
| 374 | Ga0207707_10013854 | 3300025912 | Bacteria | 7032 |
| 375 | Ga0207707_10017551 | 3300025912 | Bacteria | 6242 |
| 376 | Ga0207695_10017137 | 3300025913 | Bacteria | 8444 |
| 377 | Ga0207671_10008698 | 3300025914 | Bacteria | 8568 |
| 378 | Ga0207671_10031634 | 3300025914 | Bacteria | 3943 |
| 379 | Ga0207671_10031871 | 3300025914 | Bacteria | 3925 |
| 380 | Ga0207671_10616011 | 3300025914 | Bacteria | 865 |
| 381 | Ga0207693_10024429 | 3300025915 | Bacteria | 4795 |
| 382 | Ga0207693_10029456 | 3300025915 | Bacteria | 4336 |
| 383 | Ga0207693_10052868 | 3300025915 | Bacteria | 3186 |
| 384 | Ga0207693_10072525 | 3300025915 | Bacteria | 2695 |
| 385 | Ga0207693_10147439 | 3300025915 | Bacteria | 1850 |
| 386 | Ga0207693_10160657 | 3300025915 | Bacteria | 1767 |
| 387 | Ga0207693_10189600 | 3300025915 | Bacteria | 1618 |
| 388 | Ga0207693_10286642 | 3300025915 | Bacteria | 1290 |
| 389 | Ga0207660_10001377 | 3300025917 | Bacteria | 16302 |
| 390 | Ga0207660_10026034 | 3300025917 | Bacteria | 3979 |
| 391 | Ga0207660_10084621 | 3300025917 | Bacteria | 2338 |
| 392 | Ga0207657_10001946 | 3300025919 | Bacteria | 22297 |
| 393 | Ga0207657_10093213 | 3300025919 | Bacteria | 2509 |
| 394 | Ga0207657_10131176 | 3300025919 | Bacteria | 2054 |
| 395 | Ga0207649_10162341 | 3300025920 | Bacteria | 1549 |
| 396 | Ga0207649_10263469 | 3300025920 | Bacteria | 1246 |
| 397 | Ga0207652_10015359 | 3300025921 | Bacteria | 6218 |
| 398 | Ga0207652_10026152 | 3300025921 | Bacteria | 4858 |
| 399 | Ga0207652_10067896 | 3300025921 | Bacteria | 3092 |
| 400 | Ga0207652_10139651 | 3300025921 | Bacteria | 2166 |
| 401 | Ga0207652_10297946 | 3300025921 | Bacteria | 1455 |
| 402 | Ga0207652_10321879 | 3300025921 | Bacteria | 1396 |
| 403 | Ga0207646_10064179 | 3300025922 | Bacteria | 3278 |
| 404 | Ga0207646_10151434 | 3300025922 | Bacteria | 2092 |
| 405 | Ga0207694_10195681 | 3300025924 | Bacteria | 1644 |
| 406 | Ga0207650_10042538 | 3300025925 | Bacteria | 3333 |
| 407 | Ga0207650_10293599 | 3300025925 | Bacteria | 1326 |
| 408 | Ga0207659_10001153 | 3300025926 | Bacteria | 15743 |
| 409 | Ga0207659_10097093 | 3300025926 | Bacteria | 2213 |
| 410 | Ga0207659_10256933 | 3300025926 | Bacteria | 1420 |
| 411 | Ga0207687_10005525 | 3300025927 | Bacteria | 8362 |
| 412 | Ga0207687_10048589 | 3300025927 | Bacteria | 2947 |
| 413 | Ga0207687_10359117 | 3300025927 | Bacteria | 1189 |
| 414 | Ga0207700_10026543 | 3300025928 | Bacteria | 4040 |
| 415 | Ga0207700_10123458 | 3300025928 | Bacteria | 2103 |
| 416 | Ga0207700_10154525 | 3300025928 | Bacteria | 1900 |
| 417 | Ga0207700_10159266 | 3300025928 | Bacteria | 1873 |
| 418 | Ga0207700_10183102 | 3300025928 | Bacteria | 1756 |
| 419 | Ga0207664_10004269 | 3300025929 | Bacteria | 9672 |
| 420 | Ga0207664_10216863 | 3300025929 | Bacteria | 1658 |
| 421 | Ga0207644_10002964 | 3300025931 | Bacteria | 10935 |
| 422 | Ga0207644_10275051 | 3300025931 | Bacteria | 1351 |
| 423 | Ga0207690_10032618 | 3300025932 | Bacteria | 3343 |
| 424 | Ga0207690_10244041 | 3300025932 | Bacteria | 1385 |
| 425 | Ga0207706_10475257 | 3300025933 | Bacteria | 1080 |
| 426 | Ga0207686_10023414 | 3300025934 | Bacteria | 3568 |
| 427 | Ga0207686_10054687 | 3300025934 | Bacteria | 2501 |
| 428 | Ga0207686_10218937 | 3300025934 | Bacteria | 1373 |
| 429 | Ga0207709_10041560 | 3300025935 | Bacteria | 2760 |
| 430 | Ga0207670_10207029 | 3300025936 | Bacteria | 1493 |
| 431 | Ga0207669_10028432 | 3300025937 | Bacteria | 3076 |
| 432 | Ga0207669_10129051 | 3300025937 | Bacteria | 1733 |
| 433 | Ga0207669_10196220 | 3300025937 | Bacteria | 1461 |
| 434 | Ga0207669_10429201 | 3300025937 | Bacteria | 1042 |
| 435 | Ga0207704_10009866 | 3300025938 | Bacteria | 4628 |
| 436 | Ga0207665_10015911 | 3300025939 | Bacteria | 4938 |
| 437 | Ga0207665_10086816 | 3300025939 | Bacteria | 2162 |
| 438 | Ga0207665_10173940 | 3300025939 | Bacteria | 1556 |
| 439 | Ga0207665_10240936 | 3300025939 | Bacteria | 1332 |
| 440 | Ga0207691_10021052 | 3300025940 | Bacteria | 6162 |
| 441 | Ga0207691_10061758 | 3300025940 | Bacteria | 3403 |
| 442 | Ga0207711_10188461 | 3300025941 | Bacteria | 1879 |
| 443 | Ga0207689_10004088 | 3300025942 | Bacteria | 13269 |
| 444 | Ga0207689_10019078 | 3300025942 | Bacteria | 5783 |
| 445 | Ga0207689_10214602 | 3300025942 | Bacteria | 1590 |
| 446 | Ga0207689_10299982 | 3300025942 | Bacteria | 1332 |
| 447 | Ga0207661_10357003 | 3300025944 | Bacteria | 1320 |
| 448 | Ga0207661_10449207 | 3300025944 | Bacteria | 1174 |
| 449 | Ga0207679_10083188 | 3300025945 | Bacteria | 2452 |
| 450 | Ga0207679_10113597 | 3300025945 | Bacteria | 2143 |
| 451 | Ga0207679_10212311 | 3300025945 | Bacteria | 1624 |
| 452 | Ga0207667_10115539 | 3300025949 | Bacteria | 2766 |
| 453 | Ga0207667_10290568 | 3300025949 | Bacteria | 1670 |
| 454 | Ga0207667_10688512 | 3300025949 | Bacteria | 1025 |
| 455 | Ga0207651_10000597 | 3300025960 | Bacteria | 15239 |
| 456 | Ga0207651_10154455 | 3300025960 | Bacteria | 1791 |
| 457 | Ga0207712_10004527 | 3300025961 | Bacteria | 8777 |
| 458 | Ga0207712_10005753 | 3300025961 | Bacteria | 7814 |
| 459 | Ga0207712_10248874 | 3300025961 | Bacteria | 1435 |
| 460 | Ga0207668_10016019 | 3300025972 | Bacteria | 4669 |
| 461 | Ga0207668_10067863 | 3300025972 | Bacteria | 2533 |
| 462 | Ga0207668_10084839 | 3300025972 | Bacteria | 2309 |
| 463 | Ga0207668_10160443 | 3300025972 | Bacteria | 1751 |
| 464 | Ga0207640_10118085 | 3300025981 | Bacteria | 1894 |
| 465 | Ga0207658_10329026 | 3300025986 | Bacteria | 1325 |
| 466 | Ga0207677_10003770 | 3300026023 | Bacteria | 8048 |
| 467 | Ga0207677_10045320 | 3300026023 | Bacteria | 2936 |
| 468 | Ga0207703_10002610 | 3300026035 | Bacteria | 15552 |
| 469 | Ga0207703_10008823 | 3300026035 | Bacteria | 7949 |
| 470 | Ga0207703_10324855 | 3300026035 | Bacteria | 1410 |
| 471 | Ga0207639_10094992 | 3300026041 | Bacteria | 2395 |
| 472 | Ga0207639_10146440 | 3300026041 | Bacteria | 1973 |
| 473 | Ga0207639_10312492 | 3300026041 | Bacteria | 1392 |
| 474 | Ga0207678_10015210 | 3300026067 | Bacteria | 6769 |
| 475 | Ga0207678_10150533 | 3300026067 | Bacteria | 1987 |
| 476 | Ga0207678_10190578 | 3300026067 | Bacteria | 1752 |
| 477 | Ga0207708_10012241 | 3300026075 | Bacteria | 6396 |
| 478 | Ga0207708_10120515 | 3300026075 | Bacteria | 2044 |
| 479 | Ga0207702_10047126 | 3300026078 | Bacteria | 3630 |
| 480 | Ga0207702_10143155 | 3300026078 | Bacteria | 2166 |
| 481 | Ga0207641_10002468 | 3300026088 | Bacteria | 17079 |
| 482 | Ga0207641_10457066 | 3300026088 | Bacteria | 1235 |
| 483 | Ga0207648_10118805 | 3300026089 | Bacteria | 2324 |
| 484 | Ga0207648_10353402 | 3300026089 | Bacteria | 1325 |
| 485 | Ga0207676_10000580 | 3300026095 | Bacteria | 30116 |
| 486 | Ga0207676_10036976 | 3300026095 | Bacteria | 3717 |
| 487 | Ga0207676_10166238 | 3300026095 | Bacteria | 1917 |
| 488 | Ga0207676_10303254 | 3300026095 | Bacteria | 1459 |
| 489 | Ga0207676_10367455 | 3300026095 | Bacteria | 1335 |
| 490 | Ga0207676_10403062 | 3300026095 | Bacteria | 1279 |
| 491 | Ga0207674_10015659 | 3300026116 | Bacteria | 8325 |
| 492 | Ga0207674_10034697 | 3300026116 | Bacteria | 5271 |
| 493 | Ga0207674_10114721 | 3300026116 | Bacteria | 2666 |
| 494 | Ga0207674_10277373 | 3300026116 | Bacteria | 1624 |
| 495 | Ga0207675_100013083 | 3300026118 | Bacteria | 7745 |
| 496 | Ga0207675_100024197 | 3300026118 | Bacteria | 5647 |
| 497 | Ga0207675_100035075 | 3300026118 | Bacteria | 4679 |
| 498 | Ga0207675_100042614 | 3300026118 | Bacteria | 4238 |
| 499 | Ga0207675_100078878 | 3300026118 | Bacteria | 3086 |
| 500 | Ga0207675_100101089 | 3300026118 | Bacteria | 2716 |
| 501 | Ga0207675_100248702 | 3300026118 | Bacteria | 1720 |
| 502 | Ga0207683_10001023 | 3300026121 | Bacteria | 25517 |
| 503 | Ga0207683_10023737 | 3300026121 | Bacteria | 5276 |
| 504 | Ga0207683_10244365 | 3300026121 | Bacteria | 1637 |
| 505 | Ga0207683_10284911 | 3300026121 | Bacteria | 1510 |
| 506 | Ga0207698_10012412 | 3300026142 | Bacteria | 5573 |
| 507 | Ga0207698_10064654 | 3300026142 | Bacteria | 2868 |
| 508 | Ga0207698_10318835 | 3300026142 | Bacteria | 1455 |
| 509 | Ga0209969_1002713 | 3300027360 | Bacteria | 2452 |
| 510 | Ga0210000_1001181 | 3300027462 | Bacteria | 3668 |
| 511 | Ga0209995_1006663 | 3300027471 | Bacteria | 1857 |
| 512 | Ga0209588_1051665 | 3300027671 | Bacteria | 1329 |
| 513 | Ga0209813_10002641 | 3300027866 | Bacteria | 4120 |
| 514 | Ga0209813_10008917 | 3300027866 | Bacteria | 2548 |
| 515 | Ga0209974_10004365 | 3300027876 | Bacteria | 5027 |
| 516 | Ga0268266_10000638 | 3300028379 | Bacteria | 47680 |
| 517 | Ga0268266_10000807 | 3300028379 | Bacteria | 41568 |
| 518 | Ga0268266_10006312 | 3300028379 | Bacteria | 10862 |
| 519 | Ga0268266_10014067 | 3300028379 | Bacteria | 6887 |
| 520 | Ga0268266_10026691 | 3300028379 | Bacteria | 4914 |
| 521 | Ga0268266_10044321 | 3300028379 | Bacteria | 3803 |
| 522 | Ga0268266_10077532 | 3300028379 | Bacteria | 2889 |
| 523 | Ga0268266_10083302 | 3300028379 | Bacteria | 2792 |
| 524 | Ga0268266_10192756 | 3300028379 | Bacteria | 1861 |
| 525 | Ga0268266_10276362 | 3300028379 | Bacteria | 1561 |
| 526 | Ga0268266_10315468 | 3300028379 | Bacteria | 1462 |
| 527 | Ga0268265_10012069 | 3300028380 | Bacteria | 5850 |
| 528 | Ga0268265_10053120 | 3300028380 | Bacteria | 3068 |
| 529 | Ga0268265_10150499 | 3300028380 | Bacteria | 1962 |
| 530 | Ga0268265_10533308 | 3300028380 | Bacteria | 1111 |
| 531 | Ga0268264_10000153 | 3300028381 | Bacteria | 157298 |
| 532 | Ga0268264_10006067 | 3300028381 | Bacteria | 10212 |
| 533 | Ga0268264_10036845 | 3300028381 | Bacteria | 4030 |
| 534 | Ga0268264_10050796 | 3300028381 | Bacteria | 3454 |
| 535 | Ga0268264_10118856 | 3300028381 | Bacteria | 2326 |
| 536 | Ga0268264_10172214 | 3300028381 | Bacteria | 1959 |
| 537 | Ga0268264_10363491 | 3300028381 | Bacteria | 1381 |
| 538 | Ga0265334_10011486 | 3300028573 | Bacteria | 3729 |
| 539 | Ga0265334_10086967 | 3300028573 | Bacteria | 1145 |
| 540 | Ga0265318_10064691 | 3300028577 | Bacteria | 1360 |
| 541 | Ga0265336_10002438 | 3300028666 | Bacteria | 7676 |
| 542 | Ga0265336_10030507 | 3300028666 | Bacteria | 1679 |
| 543 | Ga0307515_10069488 | 3300028794 | Bacteria | 4813 |
| 544 | Ga0307515_10112145 | 3300028794 | Bacteria | 3174 |
| 545 | Ga0307515_10280587 | 3300028794 | Bacteria | 1374 |
| 546 | Ga0307515_10438062 | 3300028794 | Bacteria | 924 |
| 547 | Ga0265324_10000005 | 3300029957 | Bacteria | 347038 |
| 548 | Ga0265324_10030827 | 3300029957 | Bacteria | 1880 |
| 549 | Ga0307512_10134930 | 3300030522 | Bacteria | 1533 |
| 550 | Ga0265330_10030697 | 3300031235 | Bacteria | 2411 |
| 551 | Ga0265330_10043044 | 3300031235 | Bacteria | 1999 |
| 552 | Ga0265332_10003501 | 3300031238 | Bacteria | 7553 |
| 553 | Ga0265332_10043296 | 3300031238 | Bacteria | 1944 |
| 554 | Ga0265325_10000275 | 3300031241 | Bacteria | 36614 |
| 555 | Ga0265325_10035066 | 3300031241 | Bacteria | 2666 |
| 556 | Ga0265325_10105730 | 3300031241 | Bacteria | 1373 |
| 557 | Ga0265340_10016232 | 3300031247 | Bacteria | 3859 |
| 558 | Ga0265340_10061619 | 3300031247 | Bacteria | 1794 |
| 559 | Ga0265340_10111774 | 3300031247 | Bacteria | 1262 |
| 560 | Ga0265339_10012668 | 3300031249 | Bacteria | 5134 |
| 561 | Ga0265331_10058615 | 3300031250 | Bacteria | 1823 |
| 562 | Ga0265331_10070769 | 3300031250 | Bacteria | 1632 |
| 563 | Ga0265316_10133838 | 3300031344 | Bacteria | 1866 |
| 564 | Ga0265316_10315350 | 3300031344 | Bacteria | 1137 |
| 565 | Ga0307513_10334704 | 3300031456 | Bacteria | 1267 |
| 566 | Ga0307509_10052324 | 3300031507 | Bacteria | 4360 |
| 567 | Ga0307509_10101091 | 3300031507 | Bacteria | 2919 |
| 568 | Ga0307509_10314743 | 3300031507 | Bacteria | 1305 |
| 569 | Ga0307509_10345484 | 3300031507 | Bacteria | 1213 |
| 570 | Ga0307508_10000013 | 3300031616 | Bacteria | 242867 |
| 571 | Ga0307508_10108370 | 3300031616 | Bacteria | 2377 |
| 572 | Ga0307508_10221025 | 3300031616 | Bacteria | 1494 |
| 573 | Ga0307508_10234257 | 3300031616 | Bacteria | 1434 |
| 574 | Ga0316575_10033914 | 3300031665 | Bacteria | 2004 |
| 575 | Ga0265314_10018722 | 3300031711 | Bacteria | 5388 |
| 576 | Ga0265314_10063589 | 3300031711 | Bacteria | 2503 |
| 577 | Ga0265314_10103425 | 3300031711 | Bacteria | 1826 |
| 578 | Ga0265314_10123483 | 3300031711 | Bacteria | 1626 |
| 579 | Ga0265342_10001629 | 3300031712 | Bacteria | 20703 |
| 580 | Ga0265342_10046005 | 3300031712 | Bacteria | 2624 |
| 581 | Ga0316578_10044206 | 3300031728 | Bacteria | 2590 |
| 582 | Ga0307516_10006924 | 3300031730 | Bacteria | 13165 |
| 583 | Ga0307516_10030289 | 3300031730 | Bacteria | 5462 |
| 584 | Ga0307516_10083279 | 3300031730 | Bacteria | 3040 |
| 585 | Ga0307516_10106088 | 3300031730 | Bacteria | 2620 |
| 586 | Ga0307516_10144560 | 3300031730 | Bacteria | 2145 |
| 587 | Ga0307409_100081192 | 3300031995 | Bacteria | 2620 |
| 588 | Ga0307409_100155964 | 3300031995 | Bacteria | 1989 |
| 589 | Ga0307409_100657687 | 3300031995 | Bacteria | 1042 |
| 590 | Ga0307416_100404360 | 3300032002 | Bacteria | 1404 |
| 591 | Ga0307411_10098383 | 3300032005 | Bacteria | 2062 |
| 592 | Ga0307415_100188368 | 3300032126 | Bacteria | 1626 |
| 593 | Ga0307507_10037332 | 3300033179 | Bacteria | 4946 |
| 594 | Ga0307510_10003040 | 3300033180 | Bacteria | 19361 |
| 595 | Ga0307510_10185499 | 3300033180 | Bacteria | 1636 |
| 596 | Ga0373930_0031559 | 3300034816 | Bacteria | 1093 |
| 597 | Ga0373926_0028931 | 3300035083 | Bacteria | 1946 |
| 598 | Ga0373926_0043877 | 3300035083 | Bacteria | 1601 |
| 599 | Ga0373949_0020562 | 3300035090 | Bacteria | 1512 |
| 600 | Ga0373923_0010398 | 3300035111 | Bacteria | 3383 |
| 601 | Ga0373923_0020855 | 3300035111 | Bacteria | 2552 |
| 602 | Ga0373936_0000188 | 3300035113 | Bacteria | 20582 |
| 603 | Ga0373936_0016640 | 3300035113 | Bacteria | 2830 |
| 604 | Ga0373936_0019068 | 3300035113 | Bacteria | 2656 |
| 605 | Ga0373936_0047360 | 3300035113 | Bacteria | 1734 |
| 606 | Ga0373936_0053141 | 3300035113 | Bacteria | 1642 |
| 607 | Ga0373939_0002169 | 3300035114 | Bacteria | 4660 |
| 608 | Ga0373941_0000271 | 3300035115 | Bacteria | 9970 |
| 609 | Ga0373941_0050861 | 3300035115 | Bacteria | 1317 |
| 610 | Ga0373945_0026901 | 3300035116 | Bacteria | 2006 |
| 611 | Ga0373945_0053145 | 3300035116 | Bacteria | 1495 |
| 612 | Ga0373953_0001135 | 3300035117 | Bacteria | 7559 |
| 613 | Ga0373953_0004237 | 3300035117 | Bacteria | 4553 |
| 614 | Ga0373953_0030172 | 3300035117 | Bacteria | 2101 |
| 615 | Ga0373954_0000659 | 3300035118 | Bacteria | 13205 |
| 616 | Ga0373954_0001716 | 3300035118 | Bacteria | 8978 |
| 617 | Ga0373954_0014721 | 3300035118 | Bacteria | 3490 |
| 618 | Ga0373954_0049410 | 3300035118 | Bacteria | 1972 |
| 619 | Ga0373956_0008072 | 3300035119 | Bacteria | 4257 |
| 620 | Ga0373957_0002330 | 3300035120 | Bacteria | 5392 |
| 621 | Ga0373943_0003598 | 3300035170 | Bacteria | 7051 |
| 622 | Ga0373943_0004594 | 3300035170 | Bacteria | 6239 |
| 623 | Ga0373943_0032326 | 3300035170 | Bacteria | 2487 |
| 624 | Ga0373946_0004585 | 3300035171 | Bacteria | 4952 |
| 625 | Ga0373946_0008437 | 3300035171 | Bacteria | 3779 |
| 626 | Ga0373946_0021251 | 3300035171 | Bacteria | 2515 |
| 627 | Ga0373955_0000335 | 3300035172 | Bacteria | 19651 |
| 628 | Ga0373955_0000706 | 3300035172 | Bacteria | 14388 |
| 629 | Ga0373955_0017724 | 3300035172 | Bacteria | 3528 |
| 630 | Ga0316574_0001571 | 3300035398 | Bacteria | 10911 |
| 631 | Ga0373924_0000657 | 3300035410 | Bacteria | 10762 |
| 632 | Ga0373924_0003203 | 3300035410 | Bacteria | 5596 |
| 633 | Ga0373924_0049158 | 3300035410 | Bacteria | 1744 |
| 634 | Ga0373931_0046874 | 3300035691 | Bacteria | 2286 |
| 635 | Ga0373931_0130431 | 3300035691 | Bacteria | 1446 |
| 636 | Ga0373931_0169218 | 3300035691 | Bacteria | 1286 |
| 637 | Ga0373935_0000021 | 3300035692 | Bacteria | 65504 |
| 638 | Ga0373935_0001283 | 3300035692 | Bacteria | 13847 |
| 639 | Ga0373935_0024891 | 3300035692 | Bacteria | 3687 |
| 640 | Ga0373935_0061578 | 3300035692 | Bacteria | 2402 |
| 641 | Ga0373935_0140586 | 3300035692 | Bacteria | 1631 |
| 642 | Ga0373935_0279099 | 3300035692 | Bacteria | 1176 |
| 643 | Ga0373935_0465570 | 3300035692 | Bacteria | 914 |
| 644 | Ga0373927_0000515 | 3300035695 | Bacteria | 29473 |
| 645 | Ga0373927_0006658 | 3300035695 | Bacteria | 7862 |
| 646 | Ga0373927_0009946 | 3300035695 | Bacteria | 6373 |
| 647 | Ga0373927_0021530 | 3300035695 | Bacteria | 4226 |
| 648 | Ga0373927_0026143 | 3300035695 | Bacteria | 3814 |
| 649 | Ga0373927_0114196 | 3300035695 | Bacteria | 1760 |
| 650 | Ga0373927_0195453 | 3300035695 | Bacteria | 1327 |
| 651 | Ga0373933_0011288 | 3300035724 | Bacteria | 4919 |
| 652 | Ga0373933_0092462 | 3300035724 | Bacteria | 1868 |
| 653 | Ga0373947_0000479 | 3300035725 | Bacteria | 22951 |
| 654 | Ga0373947_0003063 | 3300035725 | Bacteria | 9948 |
| 655 | Ga0373947_0013284 | 3300035725 | Bacteria | 4717 |
| 656 | Ga0373947_0063774 | 3300035725 | Bacteria | 2245 |
| 657 | Ga0373947_0164456 | 3300035725 | Bacteria | 1436 |
| 658 | Ga0373937_0000003 | 3300036401 | Bacteria | 235408 |
| 659 | Ga0373937_0005938 | 3300036401 | Bacteria | 10508 |
| 660 | Ga0373937_0254715 | 3300036401 | Bacteria | 1655 |
| 661 | Ga0373937_0400365 | 3300036401 | Bacteria | 1302 |
| 662 | Ga0316584_0014288 | 3300036712 | Bacteria | 5647 |
| 663 | Ga0373925_0000118 | 3300037068 | Bacteria | 85072 |
| 664 | Ga0373925_0007182 | 3300037068 | Bacteria | 8141 |
| 665 | Ga0373925_0027532 | 3300037068 | Bacteria | 4159 |
| 666 | Ga0373925_0042097 | 3300037068 | Bacteria | 3388 |
| 667 | Ga0373925_0088194 | 3300037068 | Bacteria | 2369 |
| 668 | Ga0373925_0126535 | 3300037068 | Bacteria | 1988 |
| 669 | Ga0395900_0009415 | 3300037418 | Bacteria | 10015 |
| 670 | Ga0395898_0016882 | 3300037466 | Bacteria | 7455 |
| 671 | Ga0395898_0024634 | 3300037466 | Bacteria | 6070 |
| 672 | Ga0395898_0346845 | 3300037466 | Bacteria | 1416 |
| 673 | Ga0395898_0358675 | 3300037466 | Bacteria | 1390 |
| 674 | Ga0395905_0051168 | 3300037471 | Bacteria | 3869 |
| 675 | Ga0395905_0447005 | 3300037471 | Bacteria | 1190 |
| 676 | Ga0436364_0304115 | 3300037853 | Bacteria | 2055 |
| 677 | Ga0436364_1355688 | 3300037853 | Bacteria | 33586 |
| 678 | Ga0395901_0009062 | 3300038443 | Bacteria | 10077 |
| 679 | Ga0436365_0079213 | 3300039437 | Bacteria | 2443 |
| 680 | Ga0436365_0356953 | 3300039437 | Bacteria | 1177 |
| 681 | Ga0436365_0669858 | 3300039437 | Bacteria | 1956 |
| 682 | Ga0436365_1233769 | 3300039437 | Bacteria | 10406 |
| 683 | Ga0436365_1447372 | 3300039437 | Bacteria | 1544 |
| 684 | Ga0436365_1891193 | 3300039437 | Bacteria | 2267 |
| 685 | Ga0436360_0853720 | 3300039438 | Bacteria | 4705 |
| 686 | Ga0436361_0283608 | 3300039447 | Bacteria | 13248 |
| 687 | Ga0436361_0331296 | 3300039447 | Bacteria | 1685 |
| 688 | Ga0436361_0337036 | 3300039447 | Bacteria | 7219 |
| 689 | Ga0436361_0696146 | 3300039447 | Bacteria | 2411 |
| 690 | Ga0436361_1007450 | 3300039447 | Bacteria | 3195 |
| 691 | Ga0436361_1011773 | 3300039447 | Bacteria | 1307 |
| 692 | Ga0436363_0800492 | 3300039450 | Bacteria | 1687 |
| 693 | Ga0439453_0000298 | 3300041408 | Bacteria | 5152 |
| 694 | Ga0451791_0758265 | 3300041451 | Bacteria | 1487 |
| 695 | Ga0451853_2143278 | 3300041512 | Bacteria | 1469 |
| 696 | Ga0439443_006608 | 3300042003 | Bacteria | 1590 |
| 697 | Ga0450911_000463 | 3300042115 | Bacteria | 13062 |
| 698 | Ga0439458_0006605 | 3300042157 | Bacteria | 2586 |
| 699 | Ga0439435_0097964 | 3300042436 | Bacteria | 898 |
| 700 | Ga0451577_0235541 | 3300042876 | Bacteria | 1656 |
| 701 | Ga0466963_0159422 | 3300044694 | Bacteria | 1570 |
| 702 | Ga0453684_0009414 | 3300044712 | Bacteria | 17086 |
| 703 | Ga0453684_0869795 | 3300044712 | Bacteria | 967 |
| 704 | Ga0466968_0114564 | 3300044735 | Bacteria | 1215 |
| 705 | Ga0466959_0196160 | 3300045049 | Bacteria | 1407 |
| 706 | Ga0466967_0078248 | 3300045976 | Bacteria | 2979 |
| 707 | Ga0495592_0000215 | 3300046454 | Bacteria | 49510 |
| 708 | Ga0495592_0004136 | 3300046454 | Bacteria | 10571 |
| 709 | Ga0495592_0023188 | 3300046454 | Bacteria | 4721 |
| 710 | Ga0495592_0225482 | 3300046454 | Bacteria | 1250 |
| 711 | Ga0495603_0000156 | 3300046455 | Bacteria | 34369 |
| 712 | Ga0495603_0002154 | 3300046455 | Bacteria | 11584 |
| 713 | Ga0495603_0046248 | 3300046455 | Bacteria | 2594 |
| 714 | Ga0495603_0120284 | 3300046455 | Bacteria | 1530 |
| 715 | Ga0495603_0131595 | 3300046455 | Bacteria | 1456 |
| 716 | Ga0495603_0271863 | 3300046455 | Bacteria | 975 |
| 717 | Ga0495629_0000297 | 3300046459 | Bacteria | 42433 |
| 718 | Ga0495629_0002353 | 3300046459 | Bacteria | 14564 |
| 719 | Ga0495629_0012373 | 3300046459 | Bacteria | 6179 |
| 720 | Ga0495629_0024099 | 3300046459 | Bacteria | 4333 |
| 721 | Ga0495629_0108670 | 3300046459 | Bacteria | 1934 |
| 722 | Ga0495629_0179028 | 3300046459 | Bacteria | 1470 |
| 723 | Ga0495641_0003033 | 3300046461 | Bacteria | 12847 |
| 724 | Ga0495641_0031993 | 3300046461 | Bacteria | 2508 |
| 725 | Ga0495651_0000371 | 3300046462 | Bacteria | 34639 |
| 726 | Ga0495651_0034356 | 3300046462 | Bacteria | 3952 |
| 727 | Ga0495651_0049838 | 3300046462 | Bacteria | 3232 |
| 728 | Ga0495653_0000039 | 3300046463 | Bacteria | 119840 |
| 729 | Ga0495653_0007683 | 3300046463 | Bacteria | 8825 |
| 730 | Ga0495653_0047555 | 3300046463 | Bacteria | 3318 |
| 731 | Ga0495653_0059547 | 3300046463 | Bacteria | 2897 |
| 732 | Ga0495653_0108612 | 3300046463 | Bacteria | 1998 |
| 733 | Ga0495653_0184286 | 3300046463 | Bacteria | 1430 |
| 734 | Ga0495580_0004950 | 3300046472 | Bacteria | 11137 |
| 735 | Ga0495580_0013227 | 3300046472 | Bacteria | 6308 |
| 736 | Ga0495580_0057855 | 3300046472 | Bacteria | 2728 |
| 737 | Ga0495580_0060558 | 3300046472 | Bacteria | 2659 |
| 738 | Ga0495580_0161460 | 3300046472 | Bacteria | 1551 |
| 739 | Ga0495582_0000087 | 3300046473 | Bacteria | 47529 |
| 740 | Ga0495582_0018146 | 3300046473 | Bacteria | 3850 |
| 741 | Ga0495639_0000153 | 3300046475 | Bacteria | 35461 |
| 742 | Ga0495639_0013941 | 3300046475 | Bacteria | 3477 |
| 743 | Ga0495662_0002873 | 3300046476 | Bacteria | 8714 |
| 744 | Ga0495662_0002946 | 3300046476 | Bacteria | 8591 |
| 745 | Ga0495662_0007383 | 3300046476 | Bacteria | 5430 |
| 746 | Ga0495664_0000015 | 3300046477 | Bacteria | 192569 |
| 747 | Ga0495664_0004879 | 3300046477 | Bacteria | 7338 |
| 748 | Ga0495664_0019627 | 3300046477 | Bacteria | 3889 |
| 749 | Ga0495664_0035984 | 3300046477 | Bacteria | 2917 |
| 750 | Ga0495664_0092439 | 3300046477 | Bacteria | 1820 |
| 751 | Ga0495584_0062710 | 3300046491 | Bacteria | 1868 |
| 752 | Ga0495584_0149564 | 3300046491 | Bacteria | 1186 |
| 753 | Ga0495594_0001275 | 3300046499 | Bacteria | 13162 |
| 754 | Ga0495594_0044076 | 3300046499 | Bacteria | 2446 |
| 755 | Ga0495594_0068933 | 3300046499 | Bacteria | 1964 |
| 756 | Ga0495594_0142820 | 3300046499 | Bacteria | 1358 |
| 757 | Ga0495596_0084630 | 3300046500 | Bacteria | 1231 |
| 758 | Ga0495607_0071269 | 3300046501 | Bacteria | 1938 |
| 759 | Ga0495606_0044078 | 3300046507 | Bacteria | 2969 |
| 760 | Ga0495608_0000025 | 3300046511 | Bacteria | 158132 |
| 761 | Ga0495608_0002817 | 3300046511 | Bacteria | 12470 |
| 762 | Ga0495608_0031065 | 3300046511 | Bacteria | 3613 |
| 763 | Ga0495608_0061472 | 3300046511 | Bacteria | 2470 |
| 764 | Ga0495608_0066690 | 3300046511 | Bacteria | 2356 |
| 765 | Ga0495610_0042191 | 3300046512 | Bacteria | 2284 |
| 766 | Ga0495618_0000040 | 3300046514 | Bacteria | 98012 |
| 767 | Ga0495618_0105972 | 3300046514 | Bacteria | 1800 |
| 768 | Ga0495618_0175840 | 3300046514 | Bacteria | 1361 |
| 769 | Ga0495618_0206114 | 3300046514 | Bacteria | 1244 |
| 770 | Ga0495628_0000011 | 3300046516 | Bacteria | 225267 |
| 771 | Ga0495628_0006351 | 3300046516 | Bacteria | 10331 |
| 772 | Ga0495628_0006427 | 3300046516 | Bacteria | 10268 |
| 773 | Ga0495630_0000735 | 3300046517 | Bacteria | 23119 |
| 774 | Ga0495630_0001070 | 3300046517 | Bacteria | 18897 |
| 775 | Ga0495630_0119190 | 3300046517 | Bacteria | 2002 |
| 776 | Ga0495630_0147017 | 3300046517 | Bacteria | 1792 |
| 777 | Ga0495631_0083667 | 3300046518 | Bacteria | 1375 |
| 778 | Ga0495632_0041392 | 3300046519 | Bacteria | 2315 |
| 779 | Ga0495637_0069026 | 3300046520 | Bacteria | 1431 |
| 780 | Ga0495644_0054123 | 3300046523 | Bacteria | 1507 |
| 781 | Ga0495648_0010886 | 3300046524 | Bacteria | 6898 |
| 782 | Ga0495648_0071673 | 3300046524 | Bacteria | 2007 |
| 783 | Ga0495666_0119220 | 3300046526 | Bacteria | 1236 |
| 784 | Ga0495666_0163414 | 3300046526 | Bacteria | 1032 |
| 785 | Ga0495652_0000014 | 3300046529 | Bacteria | 225484 |
| 786 | Ga0495652_0003411 | 3300046529 | Bacteria | 15714 |
| 787 | Ga0495652_0021093 | 3300046529 | Bacteria | 5790 |
| 788 | Ga0495652_0056860 | 3300046529 | Bacteria | 3320 |
| 789 | Ga0495652_0141972 | 3300046529 | Bacteria | 1888 |
| 790 | Ga0495652_0181442 | 3300046529 | Bacteria | 1615 |
| 791 | Ga0495665_0000117 | 3300046531 | Bacteria | 37802 |
| 792 | Ga0495665_0018416 | 3300046531 | Bacteria | 3753 |
| 793 | Ga0495665_0029046 | 3300046531 | Bacteria | 2963 |
| 794 | Ga0495665_0144892 | 3300046531 | Bacteria | 1240 |
| 795 | Ga0495640_0000008 | 3300046533 | Bacteria | 220320 |
| 796 | Ga0495640_0002597 | 3300046533 | Bacteria | 14524 |
| 797 | Ga0495640_0004127 | 3300046533 | Bacteria | 11621 |
| 798 | Ga0495640_0006608 | 3300046533 | Bacteria | 9148 |
| 799 | Ga0495640_0029328 | 3300046533 | Bacteria | 3951 |
| 800 | Ga0495640_0033546 | 3300046533 | Bacteria | 3645 |
| 801 | Ga0495586_0066111 | 3300046535 | Bacteria | 1971 |
| 802 | Ga0495587_0000015 | 3300046536 | Bacteria | 187415 |
| 803 | Ga0495587_0105210 | 3300046536 | Bacteria | 1624 |
| 804 | Ga0495587_0148235 | 3300046536 | Bacteria | 1337 |
| 805 | Ga0495598_0067311 | 3300046537 | Bacteria | 1119 |
| 806 | Ga0495645_0000205 | 3300046543 | Bacteria | 42289 |
| 807 | Ga0495645_0015634 | 3300046543 | Bacteria | 5398 |
| 808 | Ga0495645_0212503 | 3300046543 | Bacteria | 1305 |
| 809 | Ga0495622_0001116 | 3300046557 | Bacteria | 14039 |
| 810 | Ga0495622_0012790 | 3300046557 | Bacteria | 3892 |
| 811 | Ga0495622_0022552 | 3300046557 | Bacteria | 2934 |
| 812 | Ga0495633_0012232 | 3300046558 | Bacteria | 4576 |
| 813 | Ga0495633_0018062 | 3300046558 | Bacteria | 3588 |
| 814 | Ga0495633_0241681 | 3300046558 | Bacteria | 825 |
| 815 | Ga0495667_0000013 | 3300046559 | Bacteria | 220294 |
| 816 | Ga0495667_0003186 | 3300046559 | Bacteria | 11002 |
| 817 | Ga0495667_0009440 | 3300046559 | Bacteria | 6609 |
| 818 | Ga0495667_0035701 | 3300046559 | Bacteria | 3321 |
| 819 | Ga0495667_0048193 | 3300046559 | Bacteria | 2813 |
| 820 | Ga0495656_0038466 | 3300046615 | Bacteria | 1982 |
| 821 | Ga0495656_0050802 | 3300046615 | Bacteria | 1772 |
| 822 | Ga0495656_0080625 | 3300046615 | Bacteria | 1468 |
| 823 | Ga0495656_0090492 | 3300046615 | Bacteria | 1398 |
| 824 | Ga0495656_0113401 | 3300046615 | Bacteria | 1271 |
| 825 | Ga0495656_0132881 | 3300046615 | Bacteria | 1186 |
| 826 | Ga0495668_0061227 | 3300046616 | Bacteria | 2076 |
| 827 | Ga0495634_0000397 | 3300046642 | Bacteria | 42705 |
| 828 | Ga0495634_0020673 | 3300046642 | Bacteria | 4664 |
| 829 | Ga0495634_0035244 | 3300046642 | Bacteria | 3428 |
| 830 | Ga0495634_0085555 | 3300046642 | Bacteria | 2054 |
| 831 | Ga0495634_0087759 | 3300046642 | Bacteria | 2024 |
| 832 | Ga0495634_0163526 | 3300046642 | Bacteria | 1402 |
| 833 | Ga0495634_0256832 | 3300046642 | Bacteria | 1067 |
| 834 | Ga0495611_0164424 | 3300046648 | Bacteria | 1037 |
| 835 | Ga0495635_0000012 | 3300046663 | Bacteria | 225271 |
| 836 | Ga0495635_0004107 | 3300046663 | Bacteria | 10098 |
| 837 | Ga0495635_0004151 | 3300046663 | Bacteria | 10047 |
| 838 | Ga0495635_0018107 | 3300046663 | Bacteria | 4919 |
| 839 | Ga0495635_0123512 | 3300046663 | Bacteria | 1765 |
| 840 | Ga0495635_0231983 | 3300046663 | Bacteria | 1247 |
| 841 | Ga0495659_0040529 | 3300046664 | Bacteria | 1660 |
| 842 | Ga0495588_0015743 | 3300046674 | Bacteria | 3646 |
| 843 | Ga0495588_0180414 | 3300046674 | Bacteria | 1116 |
| 844 | Ga0495657_0000392 | 3300046675 | Bacteria | 40698 |
| 845 | Ga0495657_0022202 | 3300046675 | Bacteria | 4549 |
| 846 | Ga0495657_0029999 | 3300046675 | Bacteria | 3811 |
| 847 | Ga0495657_0110574 | 3300046675 | Bacteria | 1741 |
| 848 | Ga0495599_0000008 | 3300046678 | Bacteria | 225534 |
| 849 | Ga0495599_0002862 | 3300046678 | Bacteria | 10060 |
| 850 | Ga0495599_0011481 | 3300046678 | Bacteria | 5444 |
| 851 | Ga0495599_0085231 | 3300046678 | Unclassified | 1973 |
| 852 | Ga0495623_0000002 | 3300046679 | Bacteria | 166669 |
| 853 | Ga0495623_0004294 | 3300046679 | Bacteria | 9381 |
| 854 | Ga0495646_0000004 | 3300046680 | Bacteria | 268993 |
| 855 | Ga0495646_0007517 | 3300046680 | Bacteria | 6923 |
| 856 | Ga0495646_0012394 | 3300046680 | Bacteria | 5419 |
| 857 | Ga0495646_0068396 | 3300046680 | Bacteria | 2097 |
| 858 | Ga0495647_0000365 | 3300046681 | Bacteria | 12760 |
| 859 | Ga0495647_0030887 | 3300046681 | Bacteria | 1990 |
| 860 | Ga0495647_0092453 | 3300046681 | Bacteria | 1242 |
| 861 | Ga0495658_0000644 | 3300046683 | Bacteria | 18891 |
| 862 | Ga0495658_0005335 | 3300046683 | Bacteria | 6324 |
| 863 | Ga0495658_0010016 | 3300046683 | Bacteria | 4732 |
| 864 | Ga0495658_0067118 | 3300046683 | Bacteria | 2074 |
| 865 | Ga0495658_0333745 | 3300046683 | Bacteria | 962 |
| 866 | Ga0495669_0001797 | 3300046684 | Bacteria | 8765 |
| 867 | Ga0495669_0235895 | 3300046684 | Bacteria | 878 |
| 868 | Ga0495613_0005220 | 3300046689 | Bacteria | 9755 |
| 869 | Ga0495613_0025843 | 3300046689 | Bacteria | 4375 |
| 870 | Ga0495613_0092092 | 3300046689 | Bacteria | 2195 |
| 871 | Ga0495613_0096248 | 3300046689 | Bacteria | 2141 |
| 872 | Ga0495613_0133652 | 3300046689 | Bacteria | 1776 |
| 873 | Ga0495613_0172601 | 3300046689 | Bacteria | 1534 |
| 874 | Ga0495613_0176962 | 3300046689 | Bacteria | 1512 |
| 875 | Ga0495624_0000668 | 3300046690 | Bacteria | 26801 |
| 876 | Ga0495624_0010384 | 3300046690 | Bacteria | 6419 |
| 877 | Ga0495624_0031831 | 3300046690 | Bacteria | 3425 |
| 878 | Ga0495624_0053173 | 3300046690 | Bacteria | 2557 |
| 879 | Ga0495624_0088047 | 3300046690 | Bacteria | 1917 |
| 880 | Ga0495670_0029534 | 3300046691 | Bacteria | 2721 |
| 881 | Ga0495649_0014605 | 3300046694 | Bacteria | 4493 |
| 882 | Ga0495589_0215883 | 3300046794 | Bacteria | 902 |
| 883 | Ga0495600_0000164 | 3300046809 | Bacteria | 38938 |
| 884 | Ga0495600_0054313 | 3300046809 | Bacteria | 2616 |
| 885 | Ga0495600_0067583 | 3300046809 | Bacteria | 2336 |
| 886 | Ga0495600_0079839 | 3300046809 | Bacteria | 2136 |
| 887 | Ga0495600_0121829 | 3300046809 | Bacteria | 1696 |
| 888 | Ga0495581_0042306 | 3300047315 | Bacteria | 2636 |
| 889 | Ga0495581_0050644 | 3300047315 | Bacteria | 2398 |
| 890 | Ga0495581_0170545 | 3300047315 | Bacteria | 1273 |
| 891 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 892 | Ga0495604_0005885 | 3300047317 | Bacteria | 9724 |
| 893 | Ga0495604_0013618 | 3300047317 | Bacteria | 6486 |
| 894 | Ga0495604_0067701 | 3300047317 | Bacteria | 2712 |
| 895 | Ga0495674_0000023 | 3300047319 | Bacteria | 157443 |
| 896 | Ga0495674_0000177 | 3300047319 | Bacteria | 50030 |
| 897 | Ga0495674_0019813 | 3300047319 | Bacteria | 6237 |
| 898 | Ga0495674_0045558 | 3300047319 | Bacteria | 3894 |
| 899 | Ga0495674_0727625 | 3300047319 | Bacteria | 777 |
| 900 | Ga0495672_0103149 | 3300047320 | Bacteria | 1543 |
| 901 | Ga0495672_0103306 | 3300047320 | Bacteria | 1542 |
| 902 | Ga0495676_0034415 | 3300047321 | Bacteria | 4252 |
| 903 | Ga0495676_0072783 | 3300047321 | Bacteria | 2638 |
| 904 | Ga0495676_0080274 | 3300047321 | Bacteria | 2478 |
| 905 | Ga0495676_0084451 | 3300047321 | Bacteria | 2396 |
| 906 | Ga0495676_0086527 | 3300047321 | Bacteria | 2358 |
| 907 | Ga0495676_0088281 | 3300047321 | Bacteria | 2326 |
| 908 | Ga0495680_0000341 | 3300047322 | Bacteria | 51840 |
| 909 | Ga0495680_0015838 | 3300047322 | Bacteria | 6490 |
| 910 | Ga0495680_0027227 | 3300047322 | Bacteria | 4699 |
| 911 | Ga0495675_0000315 | 3300047444 | Bacteria | 34499 |
| 912 | Ga0495675_0003409 | 3300047444 | Bacteria | 9576 |
| 913 | Ga0495675_0084439 | 3300047444 | Bacteria | 1998 |
| 914 | Ga0495673_0127309 | 3300047469 | Bacteria | 1003 |
| 915 | Ga0495684_0000007 | 3300047471 | Bacteria | 225614 |
| 916 | Ga0495684_0002187 | 3300047471 | Bacteria | 15656 |
| 917 | Ga0495684_0008299 | 3300047471 | Bacteria | 8045 |
| 918 | Ga0495684_0015335 | 3300047471 | Bacteria | 5898 |
| 919 | Ga0495684_0032231 | 3300047471 | Bacteria | 4022 |
| 920 | Ga0495684_0186385 | 3300047471 | Bacteria | 1536 |
| 921 | Ga0495684_0388659 | 3300047471 | Bacteria | 982 |
| 922 | Ga0495686_0037232 | 3300047472 | Bacteria | 3118 |
| 923 | Ga0495686_0082579 | 3300047472 | Bacteria | 1961 |
| 924 | Ga0495593_0000156 | 3300047673 | Bacteria | 34308 |
| 925 | Ga0495593_0000806 | 3300047673 | Bacteria | 18126 |
| 926 | Ga0495593_0001736 | 3300047673 | Bacteria | 12917 |
| 927 | Ga0495593_0048014 | 3300047673 | Bacteria | 2269 |
| 928 | Ga0495602_0000157 | 3300048088 | Bacteria | 63001 |
| 929 | Ga0495602_0063338 | 3300048088 | Bacteria | 3204 |
| 930 | Ga0495602_0101775 | 3300048088 | Bacteria | 2356 |
| 931 | Ga0495602_0141854 | 3300048088 | Bacteria | 1901 |
| 932 | Ga0495614_0015188 | 3300048089 | Bacteria | 3359 |
| 933 | Ga0495614_0053533 | 3300048089 | Bacteria | 1731 |
| 934 | Ga0496100_0030002 | 3300048903 | Bacteria | 3369 |
| 935 | Ga0496100_0050336 | 3300048903 | Bacteria | 2699 |
| 936 | Ga0496100_0120303 | 3300048903 | Bacteria | 1836 |
| 937 | Ga0496100_0160883 | 3300048903 | Bacteria | 1609 |
| 938 | Ga0496100_0250974 | 3300048903 | Bacteria | 1309 |
| 939 | Ga0496101_0005444 | 3300048904 | Bacteria | 8116 |
| 940 | Ga0496101_0047905 | 3300048904 | Bacteria | 3070 |
| 941 | Ga0496101_0177057 | 3300048904 | Bacteria | 1641 |
| 942 | Ga0496101_0229894 | 3300048904 | Bacteria | 1441 |
| 943 | Ga0496101_0372334 | 3300048904 | Bacteria | 1123 |
| 944 | Ga0496102_0001321 | 3300048905 | Bacteria | 22246 |
| 945 | Ga0496102_0009948 | 3300048905 | Bacteria | 8179 |
| 946 | Ga0496102_0072817 | 3300048905 | Bacteria | 3158 |
| 947 | Ga0496102_0082283 | 3300048905 | Bacteria | 2969 |
| 948 | Ga0496102_0170653 | 3300048905 | Bacteria | 2048 |
| 949 | Ga0496102_0275217 | 3300048905 | Bacteria | 1587 |
| 950 | Ga0496102_0342705 | 3300048905 | Bacteria | 1407 |
| 951 | Ga0496103_0004098 | 3300048906 | Bacteria | 8857 |
| 952 | Ga0496103_0021611 | 3300048906 | Bacteria | 3871 |
| 953 | Ga0496103_0031466 | 3300048906 | Bacteria | 3233 |
| 954 | Ga0496103_0189523 | 3300048906 | Bacteria | 1322 |
| 955 | Ga0496104_0001524 | 3300048907 | Bacteria | 19975 |
| 956 | Ga0496104_0018835 | 3300048907 | Bacteria | 6306 |
| 957 | Ga0496104_0104086 | 3300048907 | Bacteria | 2719 |
| 958 | Ga0496104_0361717 | 3300048907 | Bacteria | 1363 |
| 959 | Ga0496104_0520828 | 3300048907 | Bacteria | 1100 |
| 960 | Ga0496104_0632991 | 3300048907 | Bacteria | 979 |
| 961 | Ga0496105_0001515 | 3300048908 | Bacteria | 16423 |
| 962 | Ga0496105_0008435 | 3300048908 | Bacteria | 8009 |
| 963 | Ga0496105_0015352 | 3300048908 | Bacteria | 6102 |
| 964 | Ga0496105_0021910 | 3300048908 | Bacteria | 5172 |
| 965 | Ga0496105_0067767 | 3300048908 | Bacteria | 2947 |
| 966 | Ga0496106_0001932 | 3300048909 | Bacteria | 15544 |
| 967 | Ga0496106_0003944 | 3300048909 | Bacteria | 11084 |
| 968 | Ga0496106_0122573 | 3300048909 | Bacteria | 2033 |
| 969 | Ga0496106_0266501 | 3300048909 | Bacteria | 1371 |
| 970 | Ga0496106_0286344 | 3300048909 | Bacteria | 1320 |
| 971 | Ga0496106_0468090 | 3300048909 | Bacteria | 1012 |
| 972 | Ga0496107_0003324 | 3300048910 | Bacteria | 10749 |
| 973 | Ga0496107_0033724 | 3300048910 | Bacteria | 3664 |
| 974 | Ga0496107_0107623 | 3300048910 | Bacteria | 2048 |
| 975 | Ga0496107_0116329 | 3300048910 | Bacteria | 1968 |
| 976 | Ga0496107_0206472 | 3300048910 | Bacteria | 1460 |
| 977 | Ga0496108_0001028 | 3300048911 | Bacteria | 21742 |
| 978 | Ga0496108_0038439 | 3300048911 | Bacteria | 3987 |
| 979 | Ga0496108_0102747 | 3300048911 | Bacteria | 2439 |
| 980 | Ga0496108_0157273 | 3300048911 | Bacteria | 1963 |
| 981 | Ga0496108_0168537 | 3300048911 | Bacteria | 1894 |
| 982 | Ga0496108_0326572 | 3300048911 | Bacteria | 1338 |
| 983 | Ga0496109_0002430 | 3300048912 | Bacteria | 15588 |
| 984 | Ga0496109_0018985 | 3300048912 | Bacteria | 6055 |
| 985 | Ga0496109_0047987 | 3300048912 | Bacteria | 3884 |
| 986 | Ga0496109_0059126 | 3300048912 | Bacteria | 3502 |
| 987 | Ga0496109_0088619 | 3300048912 | Bacteria | 2860 |
| 988 | Ga0496109_0107195 | 3300048912 | Bacteria | 2595 |
| 989 | Ga0496109_0395015 | 3300048912 | Bacteria | 1306 |
| 990 | Ga0496110_0040479 | 3300048913 | Bacteria | 4061 |
| 991 | Ga0496110_0044959 | 3300048913 | Bacteria | 3857 |
| 992 | Ga0496110_0109178 | 3300048913 | Bacteria | 2485 |
| 993 | Ga0496110_0184059 | 3300048913 | Bacteria | 1897 |
| 994 | Ga0496110_0347488 | 3300048913 | Bacteria | 1351 |
| 995 | Ga0496111_0000436 | 3300048914 | Bacteria | 21122 |
| 996 | Ga0496111_0051596 | 3300048914 | Bacteria | 2969 |
| 997 | Ga0496112_0000009 | 3300048915 | Bacteria | 299708 |
| 998 | Ga0496112_0004518 | 3300048915 | Bacteria | 11815 |
| 999 | Ga0496112_0022204 | 3300048915 | Bacteria | 6048 |
| 1000 | Ga0496112_0060849 | 3300048915 | Bacteria | 3721 |
| 1001 | Ga0496112_0109906 | 3300048915 | Bacteria | 2727 |
| 1002 | Ga0496112_0154474 | 3300048915 | Bacteria | 2262 |
| 1003 | Ga0496112_0198310 | 3300048915 | Bacteria | 1967 |
| 1004 | Ga0496112_0359328 | 3300048915 | Bacteria | 1398 |
| 1005 | Ga0496113_0001905 | 3300048916 | Bacteria | 11913 |
| 1006 | Ga0496113_0041523 | 3300048916 | Bacteria | 3395 |
| 1007 | Ga0496113_0056320 | 3300048916 | Bacteria | 2951 |
| 1008 | Ga0496113_0059668 | 3300048916 | Bacteria | 2874 |
| 1009 | Ga0496113_0085190 | 3300048916 | Bacteria | 2427 |
| 1010 | Ga0496113_0200118 | 3300048916 | Bacteria | 1588 |
| 1011 | Ga0496113_0233762 | 3300048916 | Bacteria | 1466 |
| 1012 | Ga0496113_0369931 | 3300048916 | Bacteria | 1150 |
| 1013 | Ga0496114_0054940 | 3300048917 | Bacteria | 3320 |
| 1014 | Ga0496114_0101111 | 3300048917 | Bacteria | 2461 |
| 1015 | Ga0496114_0102814 | 3300048917 | Bacteria | 2441 |
| 1016 | Ga0496114_0112915 | 3300048917 | Bacteria | 2329 |
| 1017 | Ga0496114_0253607 | 3300048917 | Bacteria | 1548 |
| 1018 | Ga0496114_0545555 | 3300048917 | Bacteria | 1025 |
| 1019 | Ga0496115_0028337 | 3300048918 | Bacteria | 4389 |
| 1020 | Ga0496115_0066112 | 3300048918 | Bacteria | 2921 |
| 1021 | Ga0496115_0073654 | 3300048918 | Bacteria | 2772 |
| 1022 | Ga0496115_0112310 | 3300048918 | Bacteria | 2239 |
| 1023 | Ga0496115_0126754 | 3300048918 | Bacteria | 2103 |
| 1024 | Ga0496115_0157970 | 3300048918 | Bacteria | 1873 |
| 1025 | Ga0496115_0313612 | 3300048918 | Bacteria | 1284 |
| 1026 | Ga0496117_0004621 | 3300048920 | Bacteria | 15000 |
| 1027 | Ga0496118_0001262 | 3300048921 | Bacteria | 38805 |
| 1028 | Ga0496118_0076571 | 3300048921 | Bacteria | 2378 |
| 1029 | Ga0496118_0083141 | 3300048921 | Bacteria | 2240 |
| 1030 | Ga0496118_0109041 | 3300048921 | Bacteria | 1844 |
| 1031 | Ga0496119_0024084 | 3300048922 | Bacteria | 4294 |
| 1032 | Ga0496119_0115828 | 3300048922 | Bacteria | 1480 |
| 1033 | Ga0496120_0039344 | 3300048923 | Bacteria | 2790 |
| 1034 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 1035 | Ga0496121_0000689 | 3300048924 | Bacteria | 62997 |
| 1036 | Ga0496121_0030703 | 3300048924 | Bacteria | 4930 |
| 1037 | Ga0496121_0056005 | 3300048924 | Bacteria | 3279 |
| 1038 | Ga0496121_0056015 | 3300048924 | Bacteria | 3279 |
| 1039 | Ga0496121_0058249 | 3300048924 | Bacteria | 3195 |
| 1040 | Ga0496121_0222243 | 3300048924 | Bacteria | 1329 |
| 1041 | Ga0496121_0295982 | 3300048924 | Bacteria | 1100 |
| 1042 | Ga0496121_0395981 | 3300048924 | Bacteria | 906 |
| 1043 | Ga0496122_0044469 | 3300048925 | Bacteria | 3465 |
| 1044 | Ga0496124_0005646 | 3300048927 | Bacteria | 13982 |
| 1045 | Ga0496124_0014474 | 3300048927 | Bacteria | 7627 |
| 1046 | Ga0496124_0051872 | 3300048927 | Bacteria | 3488 |
| 1047 | Ga0496124_0056243 | 3300048927 | Bacteria | 3319 |
| 1048 | Ga0496124_0231029 | 3300048927 | Bacteria | 1383 |
| 1049 | Ga0496125_0000654 | 3300048928 | Bacteria | 57851 |
| 1050 | Ga0496125_0002454 | 3300048928 | Bacteria | 24086 |
| 1051 | Ga0496125_0065286 | 3300048928 | Bacteria | 2885 |
| 1052 | Ga0496125_0074940 | 3300048928 | Bacteria | 2621 |
| 1053 | Ga0496126_0003243 | 3300048929 | Bacteria | 20798 |
| 1054 | Ga0496126_0004862 | 3300048929 | Bacteria | 15734 |
| 1055 | Ga0496126_0012552 | 3300048929 | Bacteria | 8671 |
| 1056 | Ga0496126_0014034 | 3300048929 | Bacteria | 8117 |
| 1057 | Ga0496126_0020591 | 3300048929 | Bacteria | 6460 |
| 1058 | Ga0496126_0030165 | 3300048929 | Bacteria | 5141 |
| 1059 | Ga0496126_0037854 | 3300048929 | Bacteria | 4494 |
| 1060 | Ga0496126_0044004 | 3300048929 | Bacteria | 4114 |
| 1061 | Ga0496126_0049099 | 3300048929 | Bacteria | 3854 |
| 1062 | Ga0496126_0072937 | 3300048929 | Bacteria | 3053 |
| 1063 | Ga0496126_0297859 | 3300048929 | Bacteria | 1332 |
| 1064 | Ga0496126_0428315 | 3300048929 | Bacteria | 1068 |
| 1065 | Ga0495678_088405 | 3300049459 | Bacteria | 1097 |
| 1066 | Ga0501031_0012910 | 3300049568 | Bacteria | 5455 |
| 1067 | Ga0501032_0000055 | 3300049569 | Bacteria | 99207 |
| 1068 | Ga0501032_0158590 | 3300049569 | Bacteria | 1486 |
| 1069 | Ga0501033_0001478 | 3300049570 | Bacteria | 20801 |
| 1070 | Ga0501033_0018756 | 3300049570 | Bacteria | 5229 |
| 1071 | Ga0501033_0079101 | 3300049570 | Bacteria | 2413 |
| 1072 | Ga0501034_0000933 | 3300049571 | Bacteria | 42599 |
| 1073 | Ga0501034_0001822 | 3300049571 | Bacteria | 27090 |
| 1074 | Ga0501034_0002182 | 3300049571 | Bacteria | 24239 |
| 1075 | Ga0501034_0070974 | 3300049571 | Bacteria | 3493 |
| 1076 | Ga0501034_0096343 | 3300049571 | Bacteria | 2955 |
| 1077 | Ga0501034_0331436 | 3300049571 | Bacteria | 1453 |
| 1078 | Ga0501034_0373781 | 3300049571 | Bacteria | 1351 |
| 1079 | Ga0501034_0520334 | 3300049571 | Bacteria | 1101 |
| 1080 | Ga0501036_0000021 | 3300049572 | Bacteria | 114136 |
| 1081 | Ga0501036_0000242 | 3300049572 | Bacteria | 36845 |
| 1082 | Ga0501036_0120809 | 3300049572 | Bacteria | 2213 |
| 1083 | Ga0501036_0262974 | 3300049572 | Bacteria | 1445 |
| 1084 | Ga0501037_0001418 | 3300049573 | Bacteria | 17590 |
| 1085 | Ga0501037_0030614 | 3300049573 | Bacteria | 3976 |
| 1086 | Ga0501038_0000070 | 3300049574 | Bacteria | 84371 |
| 1087 | Ga0501038_0246525 | 3300049574 | Bacteria | 1416 |
| 1088 | Ga0501038_0269272 | 3300049574 | Bacteria | 1344 |
| 1089 | Ga0501038_0285424 | 3300049574 | Bacteria | 1298 |
| 1090 | Ga0501038_0362468 | 3300049574 | Bacteria | 1127 |
| 1091 | Ga0501039_0001437 | 3300049575 | Bacteria | 17545 |
| 1092 | Ga0501039_0033778 | 3300049575 | Bacteria | 3946 |
| 1093 | Ga0501039_0415761 | 3300049575 | Bacteria | 1056 |
| 1094 | Ga0501040_0195246 | 3300049576 | Bacteria | 1437 |
| 1095 | Ga0501043_0000078 | 3300049579 | Bacteria | 85968 |
| 1096 | Ga0501043_0004230 | 3300049579 | Bacteria | 11701 |
| 1097 | Ga0501046_0000627 | 3300049580 | Bacteria | 34652 |
| 1098 | Ga0501046_0031030 | 3300049580 | Bacteria | 4336 |
| 1099 | Ga0501047_0000073 | 3300049581 | Bacteria | 125990 |
| 1100 | Ga0501047_0000810 | 3300049581 | Bacteria | 32588 |
| 1101 | Ga0501047_0011598 | 3300049581 | Bacteria | 8340 |
| 1102 | Ga0501047_0023017 | 3300049581 | Bacteria | 5981 |
| 1103 | Ga0501047_0093548 | 3300049581 | Bacteria | 2885 |
| 1104 | Ga0501047_0112279 | 3300049581 | Bacteria | 2608 |
| 1105 | Ga0501047_0416859 | 3300049581 | Bacteria | 1174 |
| 1106 | Ga0501048_0000014 | 3300049582 | Bacteria | 75001 |
| 1107 | Ga0501048_0001060 | 3300049582 | Bacteria | 20590 |
| 1108 | Ga0501067_0000177 | 3300049583 | Bacteria | 35936 |
| 1109 | Ga0501067_0084754 | 3300049583 | Bacteria | 1758 |
| 1110 | Ga0501068_0007168 | 3300049584 | Bacteria | 6174 |
| 1111 | Ga0501068_0010646 | 3300049584 | Bacteria | 5173 |
| 1112 | Ga0501069_0098344 | 3300049585 | Bacteria | 1660 |
| 1113 | Ga0501070_0001227 | 3300049586 | Bacteria | 22954 |
| 1114 | Ga0501070_0009345 | 3300049586 | Bacteria | 8291 |
| 1115 | Ga0501070_0036782 | 3300049586 | Bacteria | 4088 |
| 1116 | Ga0501070_0051653 | 3300049586 | Bacteria | 3412 |
| 1117 | Ga0501070_0284209 | 3300049586 | Bacteria | 1349 |
| 1118 | Ga0501071_0193364 | 3300049587 | Bacteria | 1526 |
| 1119 | Ga0501072_0001047 | 3300049588 | Bacteria | 20473 |
| 1120 | Ga0501072_0004769 | 3300049588 | Bacteria | 10323 |
| 1121 | Ga0501072_0023276 | 3300049588 | Bacteria | 4811 |
| 1122 | Ga0501073_0000039 | 3300049589 | Bacteria | 86080 |
| 1123 | Ga0501074_0000019 | 3300049590 | Bacteria | 72385 |
| 1124 | Ga0501074_0272855 | 3300049590 | Bacteria | 1202 |
| 1125 | Ga0501077_0239881 | 3300049593 | Bacteria | 1152 |
| 1126 | Ga0501077_0270992 | 3300049593 | Bacteria | 1080 |
| 1127 | Ga0501080_0000187 | 3300049742 | Bacteria | 45224 |
| 1128 | Ga0501080_0000827 | 3300049742 | Bacteria | 25307 |
| 1129 | Ga0501080_0044354 | 3300049742 | Bacteria | 4140 |
| 1130 | Ga0501080_0264120 | 3300049742 | Bacteria | 1567 |
| 1131 | Ga0501083_0000242 | 3300049744 | Bacteria | 35191 |
| 1132 | Ga0501083_0000398 | 3300049744 | Bacteria | 27675 |
| 1133 | Ga0501083_0158048 | 3300049744 | Bacteria | 1483 |
| 1134 | Ga0501083_0188169 | 3300049744 | Bacteria | 1347 |
| 1135 | Ga0501280_008804 | 3300049776 | Bacteria | 1405 |
| 1136 | Ga0501035_0001565 | 3300049822 | Bacteria | 23271 |
| 1137 | Ga0501035_0002405 | 3300049822 | Bacteria | 18344 |
| 1138 | Ga0501035_0015977 | 3300049822 | Bacteria | 6928 |
| 1139 | Ga0501035_0046011 | 3300049822 | Bacteria | 3925 |
| 1140 | Ga0501044_0000179 | 3300049823 | Bacteria | 78633 |
| 1141 | Ga0501044_0000760 | 3300049823 | Bacteria | 39010 |
| 1142 | Ga0501044_0007764 | 3300049823 | Bacteria | 11795 |
| 1143 | Ga0501044_0011580 | 3300049823 | Bacteria | 9560 |
| 1144 | Ga0501044_0030537 | 3300049823 | Bacteria | 5678 |
| 1145 | Ga0501044_0175676 | 3300049823 | Bacteria | 2111 |
| 1146 | Ga0501044_0196826 | 3300049823 | Bacteria | 1975 |
| 1147 | Ga0501044_0239108 | 3300049823 | Bacteria | 1760 |
| 1148 | Ga0501044_0258782 | 3300049823 | Bacteria | 1679 |
| 1149 | Ga0501045_0003829 | 3300049824 | Bacteria | 10352 |
| 1150 | nmdc:mga03683_21967_c1 | 3300050489 | Bacteria | 2468 |
| 1151 | nmdc:mga03683_38137_c1 | 3300050489 | Bacteria | 1961 |
| 1152 | nmdc:mga03n38_1330_c1 | 3300050490 | Bacteria | 6995 |
| 1153 | nmdc:mga03n38_2665_c1 | 3300050490 | Bacteria | 5572 |
| 1154 | nmdc:mga03n38_35453_c1 | 3300050490 | Bacteria | 2137 |
| 1155 | nmdc:mga00v17_11637_c1 | 3300050491 | Bacteria | 4837 |
| 1156 | nmdc:mga00v17_23514_c1 | 3300050491 | Bacteria | 3564 |
| 1157 | nmdc:mga00v17_299054_c1 | 3300050491 | Bacteria | 1045 |
| 1158 | nmdc:mga00v17_391929_c1 | 3300050491 | Bacteria | 903 |
| 1159 | nmdc:mga0yw44_154217_c1 | 3300050492 | Bacteria | 1500 |
| 1160 | nmdc:mga0yw44_18489_c1 | 3300050492 | Bacteria | 3819 |
| 1161 | nmdc:mga0yw44_35656_c1 | 3300050492 | Bacteria | 2925 |
| 1162 | nmdc:mga0yw44_9147_c1 | 3300050492 | Bacteria | 4985 |
| 1163 | nmdc:mga0k408_153136_c1 | 3300050493 | Bacteria | 1373 |
| 1164 | nmdc:mga0k408_15360_c1 | 3300050493 | Bacteria | 4233 |
| 1165 | nmdc:mga0k408_3608_c1 | 3300050493 | Bacteria | 8187 |
| 1166 | nmdc:mga06z11_127234_c1 | 3300050494 | Bacteria | 1427 |
| 1167 | nmdc:mga06z11_13614_c1 | 3300050494 | Bacteria | 3579 |
| 1168 | nmdc:mga06z11_186_c1 | 3300050494 | Bacteria | 24841 |
| 1169 | nmdc:mga06z11_76491_c1 | 3300050494 | Bacteria | 1785 |
| 1170 | nmdc:mga04h51_21675_c1 | 3300050495 | Bacteria | 1936 |
| 1171 | nmdc:mga04h51_28517_c1 | 3300050495 | Bacteria | 1742 |
| 1172 | nmdc:mga04h51_58354_c1 | 3300050495 | Bacteria | 1316 |
| 1173 | nmdc:mga04h51_778_c1 | 3300050495 | Bacteria | 7378 |
| 1174 | nmdc:mga07m45_117688_c1 | 3300050496 | Bacteria | 1533 |
| 1175 | nmdc:mga07m45_21937_c1 | 3300050496 | Bacteria | 3483 |
| 1176 | nmdc:mga07m45_5521_c1 | 3300050496 | Bacteria | 6303 |
| 1177 | nmdc:mga07m45_78381_c1 | 3300050496 | Bacteria | 1885 |
| 1178 | nmdc:mga05p37_40622_c1 | 3300050507 | Bacteria | 5713 |
| 1179 | nmdc:mga05p37_42327_c1 | 3300050507 | Bacteria | 5595 |
| 1180 | nmdc:mga05p37_50505_c1 | 3300050507 | Bacteria | 5115 |
| 1181 | nmdc:mga09592_253527_c1 | 3300050508 | Bacteria | 1525 |
| 1182 | nmdc:mga0qj67_124016_c1 | 3300050509 | Bacteria | 2090 |
| 1183 | nmdc:mga0qj67_135166_c1 | 3300050509 | Bacteria | 1998 |
| 1184 | nmdc:mga0qj67_299408_c1 | 3300050509 | Bacteria | 1303 |
| 1185 | nmdc:mga0qj67_358758_c1 | 3300050509 | Bacteria | 1178 |
| 1186 | nmdc:mga06r32_151936_c1 | 3300050510 | Bacteria | 2294 |
| 1187 | nmdc:mga06r32_33861_c1 | 3300050510 | Bacteria | 4814 |
| 1188 | nmdc:mga06r32_620656_c1 | 3300050510 | Bacteria | 1051 |
| 1189 | nmdc:mga08y16_126369_c1 | 3300050511 | Bacteria | 2660 |
| 1190 | nmdc:mga08y16_66137_c1 | 3300050511 | Bacteria | 3773 |
| 1191 | nmdc:mga0n895_108270_c1 | 3300050512 | Bacteria | 2793 |
| 1192 | nmdc:mga0n895_13911_c1 | 3300050512 | Bacteria | 7285 |
| 1193 | nmdc:mga0n895_19291_c1 | 3300050512 | Bacteria | 6335 |
| 1194 | nmdc:mga0rr50_20477_c1 | 3300050513 | Bacteria | 4494 |
| 1195 | nmdc:mga08x19_22_c1 | 3300050514 | Bacteria | 297462 |
| 1196 | nmdc:mga08x19_249656_c1 | 3300050514 | Bacteria | 1225 |
| 1197 | nmdc:mga08x19_31667_c1 | 3300050514 | Bacteria | 3329 |
| 1198 | nmdc:mga0a205_240939_c2 | 3300050515 | Bacteria | 1257 |
| 1199 | nmdc:mga0a205_4562_c1 | 3300050515 | Bacteria | 12428 |
| 1200 | Ga0495601_0000014 | 3300053077 | Bacteria | 220318 |
| 1201 | Ga0495601_0014089 | 3300053077 | Bacteria | 4816 |
| 1202 | Ga0495601_0049720 | 3300053077 | Bacteria | 2644 |
| 1203 | Ga0495601_0205583 | 3300053077 | Bacteria | 1286 |
| 1204 | Ga0495612_0000014 | 3300053078 | Bacteria | 187444 |
| 1205 | Ga0495612_0004468 | 3300053078 | Bacteria | 5803 |
| 1206 | Ga0495612_0005662 | 3300053078 | Bacteria | 5161 |
| 1207 | Ga0500635_0135741 | 3300053080 | Bacteria | 930 |
| 1208 | Ga0495595_0000182 | 3300053084 | Bacteria | 25199 |
| 1209 | Ga0495595_0014994 | 3300053084 | Bacteria | 3298 |
| 1210 | Ga0495595_0025675 | 3300053084 | Bacteria | 2613 |
| 1211 | Ga0495619_0000006 | 3300053085 | Bacteria | 384835 |
| 1212 | Ga0495619_0002975 | 3300053085 | Bacteria | 10999 |
| 1213 | Ga0495619_0014309 | 3300053085 | Bacteria | 5013 |
| 1214 | Ga0495619_0036592 | 3300053085 | Bacteria | 3197 |
| 1215 | Ga0495619_0094549 | 3300053085 | Bacteria | 2027 |
| 1216 | Ga0495619_0148166 | 3300053085 | Bacteria | 1618 |
| 1217 | Ga0495619_0273788 | 3300053085 | Bacteria | 1170 |
| 1218 | Ga0500566_0031352 | 3300053094 | Bacteria | 3100 |
| 1219 | Ga0500641_0024369 | 3300053096 | Bacteria | 2333 |
| 1220 | Ga0500641_0078732 | 3300053096 | Bacteria | 1396 |
| 1221 | Ga0500641_0088013 | 3300053096 | Bacteria | 1324 |
| 1222 | Ga0500554_034185 | 3300053102 | Bacteria | 1520 |
| 1223 | Ga0500562_008917 | 3300053108 | Bacteria | 2534 |
| 1224 | Ga0500595_003184 | 3300053119 | Bacteria | 7768 |
| 1225 | Ga0500595_007594 | 3300053119 | Bacteria | 4491 |
| 1226 | Ga0500595_008592 | 3300053119 | Bacteria | 4167 |
| 1227 | Ga0500595_035637 | 3300053119 | Bacteria | 1636 |
| 1228 | Ga0500658_0073284 | 3300053134 | Bacteria | 1449 |
| 1229 | Ga0500658_0093262 | 3300053134 | Bacteria | 1305 |
| 1230 | Ga0500568_0051490 | 3300053139 | Bacteria | 1619 |
| 1231 | Ga0500589_054344 | 3300053147 | Bacteria | 1851 |
| 1232 | Ga0500590_077094 | 3300053148 | Bacteria | 1645 |
| 1233 | Ga0500603_021041 | 3300053150 | Bacteria | 1600 |
| 1234 | Ga0500616_0000036 | 3300053153 | Bacteria | 390769 |
| 1235 | Ga0500627_0017660 | 3300053158 | Bacteria | 2808 |
| 1236 | Ga0500638_000448 | 3300053162 | Bacteria | 9923 |
| 1237 | Ga0500639_121992 | 3300053163 | Bacteria | 1250 |
| 1238 | Ga0500637_0003908 | 3300053178 | Bacteria | 6954 |
| 1239 | Ga0500645_053793 | 3300053730 | Bacteria | 1171 |
| 1240 | Ga0501084_0088702 | 3300054114 | Bacteria | 2596 |
| 1241 | Ga0501084_0460880 | 3300054114 | Bacteria | 1075 |
| 1242 | Ga0500661_000254 | 3300055283 | Bacteria | 9618 |
| 1243 | Ga0501082_0004803 | 3300060353 | Bacteria | 11786 |
| 1244 | Ga0466962_0119973 | 3300061719 | Bacteria | 1269 |
| 1245 | Ga0530510_0354842 | 3300061734 | Bacteria | 1102 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005535 | Ga0070684_100502230 | Ga0070684_1005022302 | 210 |
| 2 | 3300025945 | Ga0207679_10083188 | Ga0207679_100831883 | 210 |
| 3 | 3300047319 | Ga0495674_0727625 | Ga0495674_0727625_34_741 | 235 |
| 4 | 3300047471 | Ga0495684_0388659 | Ga0495684_0388659_63_770 | 235 |
| 5 | 3300046491 | Ga0495584_0062710 | Ga0495584_0062710_189_1067 | 236 |
| 6 | 3300044712 | Ga0453684_0869795 | Ga0453684_0869795_45_857 | 241 |
| 7 | 3300048927 | Ga0496124_0231029 | Ga0496124_0231029_304_1122 | 241 |
| 8 | 3300048929 | Ga0496126_0020591 | Ga0496126_0020591_4295_5113 | 241 |
| 9 | 3300028666 | Ga0265336_10030507 | Ga0265336_100305072 | 242 |
| 10 | 3300031344 | Ga0265316_10315350 | Ga0265316_103153502 | 242 |
| 11 | 3300010159 | Ga0099796_10051530 | Ga0099796_100515301 | 243 |
| 12 | 3300025921 | Ga0207652_10139651 | Ga0207652_101396513 | 244 |
| 13 | 3300042115 | Ga0450911_000463 | Ga0450911_000463_6461_7279 | 244 |
| 14 | 3300048915 | Ga0496112_0359328 | Ga0496112_0359328_190_1014 | 244 |
| 15 | 3300048918 | Ga0496115_0126754 | Ga0496115_0126754_400_1143 | 244 |
| 16 | 3300049581 | Ga0501047_0112279 | Ga0501047_0112279_885_1718 | 244 |
| 17 | 3300049586 | Ga0501070_0051653 | Ga0501070_0051653_2184_3011 | 244 |
| 18 | 3300049593 | Ga0501077_0239881 | Ga0501077_0239881_301_1134 | 244 |
| 19 | 3300049822 | Ga0501035_0002405 | Ga0501035_0002405_13667_14494 | 244 |
| 20 | 3300050509 | nmdc:mga0qj67_135166_c1 | nmdc:mga0qj67_135166_c1_82_912 | 244 |
| 21 | 3300061734 | Ga0530510_0354842 | Ga0530510_0354842_133_966 | 244 |
| 22 | 3300006237 | Ga0097621_100402810 | Ga0097621_1004028102 | 246 |
| 23 | 3300046455 | Ga0495603_0120284 | Ga0495603_0120284_74_898 | 246 |
| 24 | 3300046472 | Ga0495580_0161460 | Ga0495580_0161460_240_1064 | 246 |
| 25 | 3300046499 | Ga0495594_0142820 | Ga0495594_0142820_52_882 | 246 |
| 26 | 3300046500 | Ga0495596_0084630 | Ga0495596_0084630_263_1093 | 246 |
| 27 | 3300046615 | Ga0495656_0090492 | Ga0495656_0090492_48_878 | 246 |
| 28 | 3300003214 | JGI25165J46597_1000033 | JGI25165J46597_1000033246 | 247 |
| 29 | 3300003214 | JGI25165J46597_1000087 | JGI25165J46597_1000087161 | 247 |
| 30 | 3300006177 | Ga0075362_10017898 | Ga0075362_100178984 | 247 |
| 31 | 3300025261 | Ga0209233_1000027 | Ga0209233_1000027419 | 247 |
| 32 | 3300048917 | Ga0496114_0545555 | Ga0496114_0545555_24_767 | 247 |
| 33 | 3300049574 | Ga0501038_0269272 | Ga0501038_0269272_363_1199 | 247 |
| 34 | 3300049823 | Ga0501044_0258782 | Ga0501044_0258782_163_999 | 247 |
| 35 | 3300003659 | JGI25404J52841_10028431 | JGI25404J52841_100284312 | 248 |
| 36 | 3300005983 | Ga0081540_1007687 | Ga0081540_10076874 | 248 |
| 37 | 3300046455 | Ga0495603_0131595 | Ga0495603_0131595_22_768 | 248 |
| 38 | 3300048917 | Ga0496114_0101111 | Ga0496114_0101111_1158_1904 | 248 |
| 39 | 3300049569 | Ga0501032_0158590 | Ga0501032_0158590_549_1385 | 248 |
| 40 | 3300049572 | Ga0501036_0262974 | Ga0501036_0262974_79_915 | 248 |
| 41 | 3300049581 | Ga0501047_0011598 | Ga0501047_0011598_4896_5732 | 248 |
| 42 | 3300049586 | Ga0501070_0036782 | Ga0501070_0036782_577_1413 | 248 |
| 43 | 3300049742 | Ga0501080_0044354 | Ga0501080_0044354_3104_3940 | 248 |
| 44 | 3300049822 | Ga0501035_0046011 | Ga0501035_0046011_1261_2097 | 248 |
| 45 | 3300049823 | Ga0501044_0011580 | Ga0501044_0011580_3985_4821 | 248 |
| 46 | 3300021361 | Ga0213872_10012811 | Ga0213872_100128114 | 249 |
| 47 | 3300039447 | Ga0436361_0337036 | Ga0436361_0337036_3766_4599 | 249 |
| 48 | 3300050492 | nmdc:mga0yw44_154217_c1 | nmdc:mga0yw44_154217_c1_433_1260 | 250 |
| 49 | 3300035113 | Ga0373936_0019068 | Ga0373936_0019068_1081_1983 | 252 |
| 50 | 3300035118 | Ga0373954_0049410 | Ga0373954_0049410_84_986 | 252 |
| 51 | 3300046663 | Ga0495635_0123512 | Ga0495635_0123512_249_1082 | 252 |
| 52 | 3300046690 | Ga0495624_0088047 | Ga0495624_0088047_820_1722 | 252 |
| 53 | 3300047319 | Ga0495674_0045558 | Ga0495674_0045558_1782_2684 | 252 |
| 54 | 3300049571 | Ga0501034_0070974 | Ga0501034_0070974_2673_3440 | 252 |
| 55 | 3300049571 | Ga0501034_0520334 | Ga0501034_0520334_54_821 | 252 |
| 56 | 3300049587 | Ga0501071_0193364 | Ga0501071_0193364_54_821 | 252 |
| 57 | 3300049823 | Ga0501044_0000760 | Ga0501044_0000760_16622_17455 | 252 |
| 58 | 3300048907 | Ga0496104_0001524 | Ga0496104_0001524_17444_18340 | 253 |
| 59 | 3300048908 | Ga0496105_0067767 | Ga0496105_0067767_1324_2220 | 253 |
| 60 | 3300048911 | Ga0496108_0102747 | Ga0496108_0102747_1527_2423 | 253 |
| 61 | 3300048912 | Ga0496109_0059126 | Ga0496109_0059126_1082_1978 | 253 |
| 62 | 3300048916 | Ga0496113_0041523 | Ga0496113_0041523_2347_3243 | 253 |
| 63 | 3300048924 | Ga0496121_0030703 | Ga0496121_0030703_2918_3757 | 254 |
| 64 | 3300048925 | Ga0496122_0044469 | Ga0496122_0044469_2357_3130 | 254 |
| 65 | 3300048929 | Ga0496126_0004862 | Ga0496126_0004862_3212_3985 | 254 |
| 66 | 3300032005 | Ga0307411_10098383 | Ga0307411_100983832 | 255 |
| 67 | 3300061719 | Ga0466962_0119973 | Ga0466962_0119973_464_1240 | 255 |
| 68 | 3300006175 | Ga0070712_100035165 | Ga0070712_1000351653 | 256 |
| 69 | 3300009098 | Ga0105245_10136801 | Ga0105245_101368013 | 256 |
| 70 | 3300025915 | Ga0207693_10052868 | Ga0207693_100528683 | 256 |
| 71 | 3300028794 | Ga0307515_10112145 | Ga0307515_101121452 | 256 |
| 72 | 3300047472 | Ga0495686_0082579 | Ga0495686_0082579_925_1761 | 256 |
| 73 | 3300053108 | Ga0500562_008917 | Ga0500562_008917_1247_2083 | 256 |
| 74 | 3300049571 | Ga0501034_0002182 | Ga0501034_0002182_15352_16173 | 257 |
| 75 | 3300049572 | Ga0501036_0000242 | Ga0501036_0000242_23889_24701 | 257 |
| 76 | 3300049574 | Ga0501038_0285424 | Ga0501038_0285424_343_1155 | 257 |
| 77 | 3300049584 | Ga0501068_0007168 | Ga0501068_0007168_2624_3445 | 257 |
| 78 | 3300049586 | Ga0501070_0009345 | Ga0501070_0009345_1278_2090 | 257 |
| 79 | 3300049823 | Ga0501044_0007764 | Ga0501044_0007764_1993_2814 | 257 |
| 80 | 3300053119 | Ga0500595_008592 | Ga0500595_008592_241_1068 | 257 |
| 81 | 3300053153 | Ga0500616_0000036 | Ga0500616_0000036_349354_350193 | 257 |
| 82 | 3300054114 | Ga0501084_0460880 | Ga0501084_0460880_245_1057 | 257 |
| 83 | 3300035725 | Ga0373947_0063774 | Ga0373947_0063774_611_1513 | 258 |
| 84 | 3300047320 | Ga0495672_0103149 | Ga0495672_0103149_158_985 | 258 |
| 85 | 3300047321 | Ga0495676_0084451 | Ga0495676_0084451_280_1182 | 258 |
| 86 | 3300005337 | Ga0070682_100144487 | Ga0070682_1001444872 | 259 |
| 87 | 3300005458 | Ga0070681_10003583 | Ga0070681_100035834 | 259 |
| 88 | 3300005530 | Ga0070679_100017206 | Ga0070679_1000172064 | 259 |
| 89 | 3300010375 | Ga0105239_10216339 | Ga0105239_102163392 | 259 |
| 90 | 3300025912 | Ga0207707_10000173 | Ga0207707_1000017348 | 259 |
| 91 | 3300025917 | Ga0207660_10026034 | Ga0207660_100260344 | 259 |
| 92 | 3300026095 | Ga0207676_10403062 | Ga0207676_104030622 | 259 |
| 93 | 3300028794 | Ga0307515_10280587 | Ga0307515_102805872 | 259 |
| 94 | 3300041451 | Ga0451791_0758265 | Ga0451791_0758265_304_1146 | 259 |
| 95 | 3300042876 | Ga0451577_0235541 | Ga0451577_0235541_745_1557 | 259 |
| 96 | 3300044712 | Ga0453684_0009414 | Ga0453684_0009414_9253_10065 | 259 |
| 97 | 3300046558 | Ga0495633_0241681 | Ga0495633_0241681_27_815 | 259 |
| 98 | 3300046674 | Ga0495588_0180414 | Ga0495588_0180414_17_805 | 259 |
| 99 | 3300048909 | Ga0496106_0286344 | Ga0496106_0286344_520_1308 | 259 |
| 100 | 3300053085 | Ga0495619_0273788 | Ga0495619_0273788_142_942 | 259 |
| 101 | 3300053139 | Ga0500568_0051490 | Ga0500568_0051490_300_1127 | 259 |
| 102 | 3300031238 | Ga0265332_10003501 | Ga0265332_100035013 | 260 |
| 103 | 3300031247 | Ga0265340_10016232 | Ga0265340_100162324 | 260 |
| 104 | 3300031250 | Ga0265331_10070769 | Ga0265331_100707692 | 260 |
| 105 | 3300031711 | Ga0265314_10063589 | Ga0265314_100635893 | 260 |
| 106 | 3300031712 | Ga0265342_10001629 | Ga0265342_100016295 | 260 |
| 107 | 3300039447 | Ga0436361_0696146 | Ga0436361_0696146_539_1405 | 260 |
| 108 | 3300005842 | Ga0068858_100079726 | Ga0068858_1000797262 | 261 |
| 109 | 3300009098 | Ga0105245_10008002 | Ga0105245_100080027 | 261 |
| 110 | 3300009177 | Ga0105248_10356426 | Ga0105248_103564262 | 261 |
| 111 | 3300025927 | Ga0207687_10005525 | Ga0207687_100055252 | 261 |
| 112 | 3300025941 | Ga0207711_10188461 | Ga0207711_101884612 | 261 |
| 113 | 3300025942 | Ga0207689_10299982 | Ga0207689_102999822 | 261 |
| 114 | 3300026095 | Ga0207676_10367455 | Ga0207676_103674552 | 261 |
| 115 | 3300031730 | Ga0307516_10106088 | Ga0307516_101060883 | 261 |
| 116 | 3300039437 | Ga0436365_0356953 | Ga0436365_0356953_51_845 | 261 |
| 117 | iso_pu_bacteria | 2513237098 | 2513673673 | 261 |
| 118 | iso_pu_bacteria | 2524023210 | 2524470658 | 261 |
| 119 | iso_pu_bacteria | 2885383462 | 2885389434 | 261 |
| 120 | iso_pu_bacteria | 2903768456 | 2903775045 | 261 |
| 121 | iso_pu_bacteria | 8056681323 | 8056683975 | 261 |
| 122 | 3300005844 | Ga0068862_100191733 | Ga0068862_1001917333 | 262 |
| 123 | 3300025940 | Ga0207691_10061758 | Ga0207691_100617582 | 262 |
| 124 | 3300026118 | Ga0207675_100078878 | Ga0207675_1000788783 | 262 |
| 125 | 3300037466 | Ga0395898_0358675 | Ga0395898_0358675_333_1133 | 263 |
| 126 | 3300044694 | Ga0466963_0159422 | Ga0466963_0159422_431_1270 | 263 |
| 127 | 3300006177 | Ga0075362_10157868 | Ga0075362_101578681 | 264 |
| 128 | 3300035171 | Ga0373946_0008437 | Ga0373946_0008437_847_1749 | 264 |
| 129 | 3300037068 | Ga0373925_0027532 | Ga0373925_0027532_1421_2323 | 264 |
| 130 | 3300046472 | Ga0495580_0013227 | Ga0495580_0013227_1586_2488 | 264 |
| 131 | 3300046529 | Ga0495652_0181442 | Ga0495652_0181442_262_1164 | 264 |
| 132 | 3300046531 | Ga0495665_0029046 | Ga0495665_0029046_1025_1927 | 264 |
| 133 | 3300046533 | Ga0495640_0006608 | Ga0495640_0006608_752_1654 | 264 |
| 134 | 3300046559 | Ga0495667_0035701 | Ga0495667_0035701_1605_2507 | 264 |
| 135 | 3300046642 | Ga0495634_0020673 | Ga0495634_0020673_1586_2488 | 264 |
| 136 | 3300046681 | Ga0495647_0092453 | Ga0495647_0092453_180_1082 | 264 |
| 137 | 3300047471 | Ga0495684_0015335 | Ga0495684_0015335_1044_1946 | 264 |
| 138 | 3300047472 | Ga0495686_0037232 | Ga0495686_0037232_2013_2846 | 264 |
| 139 | 3300048911 | Ga0496108_0326572 | Ga0496108_0326572_437_1240 | 264 |
| 140 | 3300048929 | Ga0496126_0428315 | Ga0496126_0428315_220_1053 | 264 |
| 141 | 3300049571 | Ga0501034_0000933 | Ga0501034_0000933_39226_40059 | 264 |
| 142 | 3300049575 | Ga0501039_0415761 | Ga0501039_0415761_140_973 | 264 |
| 143 | 3300049579 | Ga0501043_0004230 | Ga0501043_0004230_5417_6250 | 264 |
| 144 | 3300049581 | Ga0501047_0000073 | Ga0501047_0000073_50541_51374 | 264 |
| 145 | 3300049582 | Ga0501048_0000014 | Ga0501048_0000014_42049_42882 | 264 |
| 146 | 3300049742 | Ga0501080_0000187 | Ga0501080_0000187_18989_19822 | 264 |
| 147 | 3300049744 | Ga0501083_0000398 | Ga0501083_0000398_20333_21166 | 264 |
| 148 | 3300049823 | Ga0501044_0030537 | Ga0501044_0030537_1774_2607 | 264 |
| 149 | 3300053085 | Ga0495619_0036592 | Ga0495619_0036592_1248_2150 | 264 |
| 150 | 3300005842 | Ga0068858_100581983 | Ga0068858_1005819832 | 265 |
| 151 | 3300026088 | Ga0207641_10457066 | Ga0207641_104570661 | 265 |
| 152 | 3300028666 | Ga0265336_10002438 | Ga0265336_100024386 | 265 |
| 153 | 3300029957 | Ga0265324_10000005 | Ga0265324_10000005317 | 265 |
| 154 | 3300029957 | Ga0265324_10030827 | Ga0265324_100308271 | 265 |
| 155 | 3300031241 | Ga0265325_10000275 | Ga0265325_100002758 | 265 |
| 156 | 3300031616 | Ga0307508_10221025 | Ga0307508_102210252 | 265 |
| 157 | 3300031711 | Ga0265314_10018722 | Ga0265314_100187222 | 265 |
| 158 | 3300037068 | Ga0373925_0007182 | Ga0373925_0007182_7104_7931 | 265 |
| 159 | iso_pu_bacteria | 8056689827 | 8056690838 | 265 |
| 160 | 3300005329 | Ga0070683_100191712 | Ga0070683_1001917123 | 266 |
| 161 | 3300005338 | Ga0068868_100007160 | Ga0068868_1000071602 | 266 |
| 162 | 3300005364 | Ga0070673_100860993 | Ga0070673_1008609931 | 266 |
| 163 | 3300005981 | Ga0081538_10011066 | Ga0081538_100110667 | 266 |
| 164 | 3300006237 | Ga0097621_100079744 | Ga0097621_1000797444 | 266 |
| 165 | 3300011119 | Ga0105246_10010454 | Ga0105246_100104544 | 266 |
| 166 | 3300013296 | Ga0157374_10075314 | Ga0157374_100753144 | 266 |
| 167 | 3300013308 | Ga0157375_10006361 | Ga0157375_100063617 | 266 |
| 168 | 3300014968 | Ga0157379_10594393 | Ga0157379_105943932 | 266 |
| 169 | 3300025915 | Ga0207693_10024429 | Ga0207693_100244292 | 266 |
| 170 | 3300025944 | Ga0207661_10357003 | Ga0207661_103570032 | 266 |
| 171 | 3300031711 | Ga0265314_10103425 | Ga0265314_101034253 | 266 |
| 172 | 3300041512 | Ga0451853_2143278 | Ga0451853_2143278_514_1323 | 266 |
| 173 | 3300046517 | Ga0495630_0119190 | Ga0495630_0119190_524_1339 | 266 |
| 174 | 3300046529 | Ga0495652_0141972 | Ga0495652_0141972_154_963 | 266 |
| 175 | 3300046689 | Ga0495613_0133652 | Ga0495613_0133652_49_864 | 266 |
| 176 | 3300048903 | Ga0496100_0050336 | Ga0496100_0050336_1278_2087 | 266 |
| 177 | 3300048904 | Ga0496101_0005444 | Ga0496101_0005444_2456_3265 | 266 |
| 178 | 3300048906 | Ga0496103_0031466 | Ga0496103_0031466_75_884 | 266 |
| 179 | 3300048907 | Ga0496104_0361717 | Ga0496104_0361717_165_974 | 266 |
| 180 | 3300048908 | Ga0496105_0021910 | Ga0496105_0021910_103_912 | 266 |
| 181 | 3300048912 | Ga0496109_0047987 | Ga0496109_0047987_893_1702 | 266 |
| 182 | 3300048913 | Ga0496110_0044959 | Ga0496110_0044959_398_1207 | 266 |
| 183 | 3300048916 | Ga0496113_0369931 | Ga0496113_0369931_76_885 | 266 |
| 184 | 3300048918 | Ga0496115_0313612 | Ga0496115_0313612_53_862 | 266 |
| 185 | 3300048929 | Ga0496126_0030165 | Ga0496126_0030165_397_1206 | 266 |
| 186 | 3300049570 | Ga0501033_0018756 | Ga0501033_0018756_2719_3555 | 266 |
| 187 | iso_pu_bacteria | 2508501128 | 2509154168 | 266 |
| 188 | 3300009101 | Ga0105247_10043195 | Ga0105247_100431951 | 267 |
| 189 | 3300013297 | Ga0157378_10328021 | Ga0157378_103280212 | 267 |
| 190 | 3300025933 | Ga0207706_10475257 | Ga0207706_104752571 | 267 |
| 191 | 3300031995 | Ga0307409_100155964 | Ga0307409_1001559642 | 267 |
| 192 | 3300035695 | Ga0373927_0114196 | Ga0373927_0114196_38_868 | 267 |
| 193 | 3300039437 | Ga0436365_1447372 | Ga0436365_1447372_137_949 | 267 |
| 194 | 3300039437 | Ga0436365_1891193 | Ga0436365_1891193_50_871 | 267 |
| 195 | 3300046455 | Ga0495603_0046248 | Ga0495603_0046248_1510_2322 | 267 |
| 196 | 3300046512 | Ga0495610_0042191 | Ga0495610_0042191_156_968 | 267 |
| 197 | 3300046519 | Ga0495632_0041392 | Ga0495632_0041392_28_840 | 267 |
| 198 | 3300046557 | Ga0495622_0022552 | Ga0495622_0022552_367_1179 | 267 |
| 199 | 3300046615 | Ga0495656_0113401 | Ga0495656_0113401_219_1031 | 267 |
| 200 | 3300046615 | Ga0495656_0132881 | Ga0495656_0132881_336_1148 | 267 |
| 201 | 3300046616 | Ga0495668_0061227 | Ga0495668_0061227_826_1638 | 267 |
| 202 | 3300048924 | Ga0496121_0295982 | Ga0496121_0295982_192_1004 | 267 |
| 203 | 3300048929 | Ga0496126_0014034 | Ga0496126_0014034_4428_5240 | 267 |
| 204 | 3300048929 | Ga0496126_0049099 | Ga0496126_0049099_2734_3546 | 267 |
| 205 | 3300053119 | Ga0500595_035637 | Ga0500595_035637_610_1422 | 267 |
| 206 | 3300053148 | Ga0500590_077094 | Ga0500590_077094_788_1600 | 267 |
| 207 | 3300005467 | Ga0070706_100129470 | Ga0070706_1001294703 | 268 |
| 208 | 3300005471 | Ga0070698_100627416 | Ga0070698_1006274161 | 268 |
| 209 | 3300005530 | Ga0070679_100497797 | Ga0070679_1004977971 | 268 |
| 210 | 3300005983 | Ga0081540_1013951 | Ga0081540_10139515 | 268 |
| 211 | 3300006028 | Ga0070717_10573725 | Ga0070717_105737251 | 268 |
| 212 | 3300006048 | Ga0075363_100017455 | Ga0075363_1000174553 | 268 |
| 213 | 3300006195 | Ga0075366_10041040 | Ga0075366_100410402 | 268 |
| 214 | 3300007076 | Ga0075435_100265293 | Ga0075435_1002652932 | 268 |
| 215 | 3300009147 | Ga0114129_10525711 | Ga0114129_105257111 | 268 |
| 216 | 3300025253 | Ga0209677_100384 | Ga0209677_10038413 | 268 |
| 217 | 3300025261 | Ga0209233_1000823 | Ga0209233_10008239 | 268 |
| 218 | 3300025921 | Ga0207652_10297946 | Ga0207652_102979461 | 268 |
| 219 | 3300028794 | Ga0307515_10438062 | Ga0307515_104380622 | 268 |
| 220 | 3300031665 | Ga0316575_10033914 | Ga0316575_100339142 | 268 |
| 221 | 3300031728 | Ga0316578_10044206 | Ga0316578_100442062 | 268 |
| 222 | 3300035113 | Ga0373936_0047360 | Ga0373936_0047360_485_1300 | 268 |
| 223 | 3300035398 | Ga0316574_0001571 | Ga0316574_0001571_7028_7852 | 268 |
| 224 | 3300036712 | Ga0316584_0014288 | Ga0316584_0014288_2477_3301 | 268 |
| 225 | 3300037466 | Ga0395898_0024634 | Ga0395898_0024634_991_1809 | 268 |
| 226 | 3300037466 | Ga0395898_0346845 | Ga0395898_0346845_516_1355 | 268 |
| 227 | 3300037471 | Ga0395905_0051168 | Ga0395905_0051168_283_1122 | 268 |
| 228 | 3300045049 | Ga0466959_0196160 | Ga0466959_0196160_554_1369 | 268 |
| 229 | 3300045976 | Ga0466967_0078248 | Ga0466967_0078248_2060_2875 | 268 |
| 230 | 3300046455 | Ga0495603_0271863 | Ga0495603_0271863_62_904 | 268 |
| 231 | 3300047320 | Ga0495672_0103306 | Ga0495672_0103306_557_1438 | 268 |
| 232 | 3300048915 | Ga0496112_0109906 | Ga0496112_0109906_509_1327 | 268 |
| 233 | 3300048921 | Ga0496118_0076571 | Ga0496118_0076571_187_1002 | 268 |
| 234 | 3300048924 | Ga0496121_0395981 | Ga0496121_0395981_66_881 | 268 |
| 235 | 3300050490 | nmdc:mga03n38_35453_c1 | nmdc:mga03n38_35453_c1_694_1509 | 268 |
| 236 | 3300050491 | nmdc:mga00v17_299054_c1 | nmdc:mga00v17_299054_c1_162_995 | 268 |
| 237 | 3300050510 | nmdc:mga06r32_620656_c1 | nmdc:mga06r32_620656_c1_50_883 | 268 |
| 238 | 3300005444 | Ga0070694_100096498 | Ga0070694_1000964982 | 269 |
| 239 | 3300005563 | Ga0068855_100837186 | Ga0068855_1008371862 | 269 |
| 240 | 3300025302 | Ga0207426_1017876 | Ga0207426_10178764 | 269 |
| 241 | 3300025925 | Ga0207650_10042538 | Ga0207650_100425383 | 269 |
| 242 | 3300025937 | Ga0207669_10196220 | Ga0207669_101962202 | 269 |
| 243 | 3300025960 | Ga0207651_10154455 | Ga0207651_101544552 | 269 |
| 244 | 3300027360 | Ga0209969_1002713 | Ga0209969_10027132 | 269 |
| 245 | 3300027462 | Ga0210000_1001181 | Ga0210000_10011814 | 269 |
| 246 | 3300027471 | Ga0209995_1006663 | Ga0209995_10066631 | 269 |
| 247 | 3300027876 | Ga0209974_10004365 | Ga0209974_100043652 | 269 |
| 248 | 3300039437 | Ga0436365_0669858 | Ga0436365_0669858_709_1527 | 269 |
| 249 | 3300049588 | Ga0501072_0001047 | Ga0501072_0001047_14891_15709 | 269 |
| 250 | 3300050494 | nmdc:mga06z11_76491_c1 | nmdc:mga06z11_76491_c1_27_860 | 269 |
| 251 | iso_pu_bacteria | 2643221595 | 2643985075 | 269 |
| 252 | iso_pu_bacteria | 2728368998 | 2728750428 | 269 |
| 253 | iso_pu_bacteria | 3005710791 | 3005713221 | 269 |
| 254 | 3300005354 | Ga0070675_100294084 | Ga0070675_1002940843 | 270 |
| 255 | 3300005365 | Ga0070688_100089020 | Ga0070688_1000890202 | 270 |
| 256 | 3300005844 | Ga0068862_100668954 | Ga0068862_1006689542 | 270 |
| 257 | 3300009098 | Ga0105245_10879512 | Ga0105245_108795121 | 270 |
| 258 | 3300021388 | Ga0213875_10007330 | Ga0213875_100073306 | 270 |
| 259 | 3300025926 | Ga0207659_10256933 | Ga0207659_102569333 | 270 |
| 260 | 3300025936 | Ga0207670_10207029 | Ga0207670_102070293 | 270 |
| 261 | 3300025939 | Ga0207665_10086816 | Ga0207665_100868162 | 270 |
| 262 | 3300028379 | Ga0268266_10276362 | Ga0268266_102763622 | 270 |
| 263 | 3300037853 | Ga0436364_1355688 | Ga0436364_1355688_19766_20614 | 270 |
| 264 | 3300041408 | Ga0439453_0000298 | Ga0439453_0000298_3321_4145 | 270 |
| 265 | 3300042003 | Ga0439443_006608 | Ga0439443_006608_737_1561 | 270 |
| 266 | 3300042436 | Ga0439435_0097964 | Ga0439435_0097964_56_880 | 270 |
| 267 | 3300046477 | Ga0495664_0004879 | Ga0495664_0004879_5059_5907 | 270 |
| 268 | 3300046543 | Ga0495645_0015634 | Ga0495645_0015634_1946_2794 | 270 |
| 269 | 3300046678 | Ga0495599_0011481 | Ga0495599_0011481_3604_4452 | 270 |
| 270 | 3300048929 | Ga0496126_0072937 | Ga0496126_0072937_2085_2906 | 270 |
| 271 | 3300049571 | Ga0501034_0001822 | Ga0501034_0001822_11662_12483 | 270 |
| 272 | 3300049571 | Ga0501034_0096343 | Ga0501034_0096343_1884_2720 | 270 |
| 273 | 3300049776 | Ga0501280_008804 | Ga0501280_008804_298_1131 | 270 |
| 274 | 3300053078 | Ga0495612_0005662 | Ga0495612_0005662_2777_3625 | 270 |
| 275 | iso_pu_bacteria | 2513237101 | 2513694561 | 270 |
| 276 | iso_pu_bacteria | 2513237104 | 2513720124 | 270 |
| 277 | iso_pu_bacteria | 2524023205 | 2524439386 | 270 |
| 278 | iso_pu_bacteria | 2643221550 | 2643770908 | 270 |
| 279 | iso_pu_bacteria | 2643221651 | 2644287479 | 270 |
| 280 | iso_pu_bacteria | 2721755755 | 2723842372 | 270 |
| 281 | iso_pu_bacteria | 2744054633 | 2745078098 | 270 |
| 282 | iso_pu_bacteria | 2791355199 | 2793079002 | 270 |
| 283 | iso_pu_bacteria | 2874604998 | 2874608936 | 270 |
| 284 | iso_pu_bacteria | 2876808645 | 2876810096 | 270 |
| 285 | iso_pu_bacteria | 2879110137 | 2879112393 | 270 |
| 286 | iso_pu_bacteria | 2889033259 | 2889034713 | 270 |
| 287 | iso_pu_bacteria | 2908739725 | 2908739835 | 270 |
| 288 | iso_pu_bacteria | 2922361189 | 2922364819 | 270 |
| 289 | iso_pu_bacteria | 2922386360 | 2922391725 | 270 |
| 290 | iso_pu_bacteria | 2996336353 | 2996340832 | 270 |
| 291 | iso_pu_bacteria | 3005474847 | 3005476187 | 270 |
| 292 | iso_pu_bacteria | 8006926726 | 8006929699 | 270 |
| 293 | iso_pu_bacteria | 8006964411 | 8006965155 | 270 |
| 294 | iso_pu_bacteria | 8006984368 | 8006987248 | 270 |
| 295 | iso_pu_bacteria | 8006994254 | 8006995401 | 270 |
| 296 | iso_pu_bacteria | 8056673599 | 8056679090 | 270 |
| 297 | 3300005339 | Ga0070660_100016043 | Ga0070660_1000160432 | 271 |
| 298 | 3300005355 | Ga0070671_100120177 | Ga0070671_1001201772 | 271 |
| 299 | 3300005456 | Ga0070678_100390470 | Ga0070678_1003904701 | 271 |
| 300 | 3300005458 | Ga0070681_10019283 | Ga0070681_100192832 | 271 |
| 301 | 3300005467 | Ga0070706_100065025 | Ga0070706_1000650255 | 271 |
| 302 | 3300005468 | Ga0070707_100181967 | Ga0070707_1001819672 | 271 |
| 303 | 3300005471 | Ga0070698_100081539 | Ga0070698_1000815393 | 271 |
| 304 | 3300005530 | Ga0070679_100151366 | Ga0070679_1001513662 | 271 |
| 305 | 3300005544 | Ga0070686_100029775 | Ga0070686_1000297752 | 271 |
| 306 | 3300005718 | Ga0068866_10092115 | Ga0068866_100921152 | 271 |
| 307 | 3300005937 | Ga0081455_10048471 | Ga0081455_100484712 | 271 |
| 308 | 3300006195 | Ga0075366_10035333 | Ga0075366_100353333 | 271 |
| 309 | 3300009177 | Ga0105248_10155990 | Ga0105248_101559902 | 271 |
| 310 | 3300009551 | Ga0105238_10082285 | Ga0105238_100822855 | 271 |
| 311 | 3300013308 | Ga0157375_10809922 | Ga0157375_108099222 | 271 |
| 312 | 3300025297 | Ga0209758_1000257 | Ga0209758_100025715 | 271 |
| 313 | 3300025910 | Ga0207684_10094446 | Ga0207684_100944463 | 271 |
| 314 | 3300025915 | Ga0207693_10029456 | Ga0207693_100294563 | 271 |
| 315 | 3300025917 | Ga0207660_10084621 | Ga0207660_100846211 | 271 |
| 316 | 3300025919 | Ga0207657_10093213 | Ga0207657_100932133 | 271 |
| 317 | 3300025921 | Ga0207652_10067896 | Ga0207652_100678965 | 271 |
| 318 | 3300025922 | Ga0207646_10151434 | Ga0207646_101514342 | 271 |
| 319 | 3300025928 | Ga0207700_10123458 | Ga0207700_101234582 | 271 |
| 320 | 3300025928 | Ga0207700_10183102 | Ga0207700_101831022 | 271 |
| 321 | 3300025939 | Ga0207665_10173940 | Ga0207665_101739402 | 271 |
| 322 | 3300025942 | Ga0207689_10214602 | Ga0207689_102146022 | 271 |
| 323 | 3300026078 | Ga0207702_10047126 | Ga0207702_100471262 | 271 |
| 324 | 3300026121 | Ga0207683_10284911 | Ga0207683_102849113 | 271 |
| 325 | 3300028379 | Ga0268266_10315468 | Ga0268266_103154682 | 271 |
| 326 | 3300028381 | Ga0268264_10050796 | Ga0268264_100507964 | 271 |
| 327 | 3300034816 | Ga0373930_0031559 | Ga0373930_0031559_73_897 | 271 |
| 328 | 3300035410 | Ga0373924_0003203 | Ga0373924_0003203_4526_5428 | 271 |
| 329 | 3300035691 | Ga0373931_0169218 | Ga0373931_0169218_350_1174 | 271 |
| 330 | 3300035692 | Ga0373935_0465570 | Ga0373935_0465570_79_903 | 271 |
| 331 | 3300035695 | Ga0373927_0006658 | Ga0373927_0006658_5272_6102 | 271 |
| 332 | 3300035695 | Ga0373927_0026143 | Ga0373927_0026143_374_1276 | 271 |
| 333 | 3300037068 | Ga0373925_0088194 | Ga0373925_0088194_213_1043 | 271 |
| 334 | 3300039437 | Ga0436365_0079213 | Ga0436365_0079213_1210_2037 | 271 |
| 335 | 3300046473 | Ga0495582_0018146 | Ga0495582_0018146_2349_3251 | 271 |
| 336 | 3300046475 | Ga0495639_0013941 | Ga0495639_0013941_514_1416 | 271 |
| 337 | 3300046477 | Ga0495664_0019627 | Ga0495664_0019627_2363_3265 | 271 |
| 338 | 3300046536 | Ga0495587_0105210 | Ga0495587_0105210_130_954 | 271 |
| 339 | 3300046683 | Ga0495658_0333745 | Ga0495658_0333745_50_880 | 271 |
| 340 | 3300046809 | Ga0495600_0067583 | Ga0495600_0067583_342_1244 | 271 |
| 341 | 3300047315 | Ga0495581_0170545 | Ga0495581_0170545_365_1195 | 271 |
| 342 | 3300047673 | Ga0495593_0048014 | Ga0495593_0048014_170_1072 | 271 |
| 343 | 3300048089 | Ga0495614_0053533 | Ga0495614_0053533_374_1204 | 271 |
| 344 | 3300048903 | Ga0496100_0160883 | Ga0496100_0160883_85_909 | 271 |
| 345 | 3300048905 | Ga0496102_0072817 | Ga0496102_0072817_2164_2988 | 271 |
| 346 | 3300048907 | Ga0496104_0104086 | Ga0496104_0104086_1714_2538 | 271 |
| 347 | 3300048908 | Ga0496105_0015352 | Ga0496105_0015352_3019_3843 | 271 |
| 348 | 3300048913 | Ga0496110_0184059 | Ga0496110_0184059_455_1291 | 271 |
| 349 | 3300048914 | Ga0496111_0051596 | Ga0496111_0051596_2131_2955 | 271 |
| 350 | 3300048915 | Ga0496112_0154474 | Ga0496112_0154474_899_1735 | 271 |
| 351 | 3300048916 | Ga0496113_0059668 | Ga0496113_0059668_111_947 | 271 |
| 352 | 3300048916 | Ga0496113_0233762 | Ga0496113_0233762_54_878 | 271 |
| 353 | 3300048917 | Ga0496114_0054940 | Ga0496114_0054940_275_1099 | 271 |
| 354 | 3300048918 | Ga0496115_0066112 | Ga0496115_0066112_637_1461 | 271 |
| 355 | 3300048924 | Ga0496121_0058249 | Ga0496121_0058249_224_1048 | 271 |
| 356 | 3300049593 | Ga0501077_0270992 | Ga0501077_0270992_194_1030 | 271 |
| 357 | 3300050491 | nmdc:mga00v17_23514_c1 | nmdc:mga00v17_23514_c1_2630_3502 | 271 |
| 358 | 3300050492 | nmdc:mga0yw44_18489_c1 | nmdc:mga0yw44_18489_c1_84_956 | 271 |
| 359 | 3300050493 | nmdc:mga0k408_15360_c1 | nmdc:mga0k408_15360_c1_53_877 | 271 |
| 360 | 3300050514 | nmdc:mga08x19_249656_c1 | nmdc:mga08x19_249656_c1_63_899 | 271 |
| 361 | 3300053084 | Ga0495595_0025675 | Ga0495595_0025675_1448_2272 | 271 |
| 362 | 3300053085 | Ga0495619_0094549 | Ga0495619_0094549_329_1153 | 271 |
| 363 | 3300053094 | Ga0500566_0031352 | Ga0500566_0031352_1646_2470 | 271 |
| 364 | 3300053102 | Ga0500554_034185 | Ga0500554_034185_353_1177 | 271 |
| 365 | 3300053119 | Ga0500595_003184 | Ga0500595_003184_3491_4315 | 271 |
| 366 | 3300053119 | Ga0500595_007594 | Ga0500595_007594_852_1676 | 271 |
| 367 | 3300053150 | Ga0500603_021041 | Ga0500603_021041_57_881 | 271 |
| 368 | 3300053162 | Ga0500638_000448 | Ga0500638_000448_8134_8958 | 271 |
| 369 | 3300053178 | Ga0500637_0003908 | Ga0500637_0003908_1331_2155 | 271 |
| 370 | 3300055283 | Ga0500661_000254 | Ga0500661_000254_3592_4416 | 271 |
| 371 | iso_pu_bacteria | 2523231067 | 2523469108 | 271 |
| 372 | iso_pu_bacteria | 2643221564 | 2643838212 | 271 |
| 373 | iso_pu_bacteria | 2738543031 | 2739351953 | 271 |
| 374 | iso_pu_bacteria | 2857524615 | 2857529787 | 271 |
| 375 | 3300003659 | JGI25404J52841_10003411 | JGI25404J52841_100034111 | 272 |
| 376 | 3300003762 | Ga0055542_1009052 | Ga0055542_10090522 | 272 |
| 377 | 3300005336 | Ga0070680_100020280 | Ga0070680_1000202803 | 272 |
| 378 | 3300005336 | Ga0070680_100022812 | Ga0070680_1000228125 | 272 |
| 379 | 3300005406 | Ga0070703_10004707 | Ga0070703_100047074 | 272 |
| 380 | 3300005435 | Ga0070714_100130067 | Ga0070714_1001300672 | 272 |
| 381 | 3300005436 | Ga0070713_100289289 | Ga0070713_1002892892 | 272 |
| 382 | 3300005436 | Ga0070713_100339479 | Ga0070713_1003394791 | 272 |
| 383 | 3300005437 | Ga0070710_10038211 | Ga0070710_100382112 | 272 |
| 384 | 3300005438 | Ga0070701_10076488 | Ga0070701_100764882 | 272 |
| 385 | 3300005439 | Ga0070711_100245935 | Ga0070711_1002459351 | 272 |
| 386 | 3300005439 | Ga0070711_100404754 | Ga0070711_1004047541 | 272 |
| 387 | 3300005440 | Ga0070705_100000025 | Ga0070705_10000002560 | 272 |
| 388 | 3300005444 | Ga0070694_100002659 | Ga0070694_1000026597 | 272 |
| 389 | 3300005444 | Ga0070694_100039128 | Ga0070694_1000391283 | 272 |
| 390 | 3300005457 | Ga0070662_100271656 | Ga0070662_1002716562 | 272 |
| 391 | 3300005458 | Ga0070681_10020454 | Ga0070681_100204544 | 272 |
| 392 | 3300005518 | Ga0070699_100005455 | Ga0070699_1000054556 | 272 |
| 393 | 3300005530 | Ga0070679_100055345 | Ga0070679_1000553454 | 272 |
| 394 | 3300005530 | Ga0070679_100091499 | Ga0070679_1000914992 | 272 |
| 395 | 3300005536 | Ga0070697_100039826 | Ga0070697_1000398263 | 272 |
| 396 | 3300005539 | Ga0068853_100040297 | Ga0068853_1000402975 | 272 |
| 397 | 3300005545 | Ga0070695_100001562 | Ga0070695_1000015628 | 272 |
| 398 | 3300005545 | Ga0070695_100042426 | Ga0070695_1000424262 | 272 |
| 399 | 3300005546 | Ga0070696_100006938 | Ga0070696_1000069382 | 272 |
| 400 | 3300005546 | Ga0070696_100269342 | Ga0070696_1002693422 | 272 |
| 401 | 3300005547 | Ga0070693_100015729 | Ga0070693_1000157292 | 272 |
| 402 | 3300005548 | Ga0070665_100017279 | Ga0070665_1000172793 | 272 |
| 403 | 3300005548 | Ga0070665_100105910 | Ga0070665_1001059102 | 272 |
| 404 | 3300005563 | Ga0068855_100342016 | Ga0068855_1003420162 | 272 |
| 405 | 3300005577 | Ga0068857_100019837 | Ga0068857_1000198372 | 272 |
| 406 | 3300005577 | Ga0068857_100264315 | Ga0068857_1002643151 | 272 |
| 407 | 3300005614 | Ga0068856_100670610 | Ga0068856_1006706102 | 272 |
| 408 | 3300005617 | Ga0068859_100001168 | Ga0068859_10000116824 | 272 |
| 409 | 3300005618 | Ga0068864_100298750 | Ga0068864_1002987502 | 272 |
| 410 | 3300005844 | Ga0068862_100002691 | Ga0068862_1000026914 | 272 |
| 411 | 3300005937 | Ga0081455_10067232 | Ga0081455_100672323 | 272 |
| 412 | 3300005983 | Ga0081540_1001030 | Ga0081540_100103017 | 272 |
| 413 | 3300005983 | Ga0081540_1001133 | Ga0081540_100113313 | 272 |
| 414 | 3300005983 | Ga0081540_1035627 | Ga0081540_10356272 | 272 |
| 415 | 3300005983 | Ga0081540_1098779 | Ga0081540_10987792 | 272 |
| 416 | 3300006028 | Ga0070717_10075229 | Ga0070717_100752292 | 272 |
| 417 | 3300006038 | Ga0075365_10289724 | Ga0075365_102897241 | 272 |
| 418 | 3300006048 | Ga0075363_100117604 | Ga0075363_1001176042 | 272 |
| 419 | 3300006173 | Ga0070716_100073068 | Ga0070716_1000730683 | 272 |
| 420 | 3300006175 | Ga0070712_100073137 | Ga0070712_1000731372 | 272 |
| 421 | 3300006175 | Ga0070712_100097031 | Ga0070712_1000970312 | 272 |
| 422 | 3300006175 | Ga0070712_100136565 | Ga0070712_1001365652 | 272 |
| 423 | 3300006178 | Ga0075367_10054935 | Ga0075367_100549353 | 272 |
| 424 | 3300006195 | Ga0075366_10001716 | Ga0075366_1000171611 | 272 |
| 425 | 3300006844 | Ga0075428_100129570 | Ga0075428_1001295703 | 272 |
| 426 | 3300006847 | Ga0075431_100060089 | Ga0075431_1000600896 | 272 |
| 427 | 3300006871 | Ga0075434_100149486 | Ga0075434_1001494863 | 272 |
| 428 | 3300006880 | Ga0075429_100008549 | Ga0075429_1000085494 | 272 |
| 429 | 3300006931 | Ga0097620_100001168 | Ga0097620_1000011683 | 272 |
| 430 | 3300007788 | Ga0099795_10010883 | Ga0099795_100108833 | 272 |
| 431 | 3300009098 | Ga0105245_10388880 | Ga0105245_103888802 | 272 |
| 432 | 3300009147 | Ga0114129_10104178 | Ga0114129_101041781 | 272 |
| 433 | 3300009148 | Ga0105243_10773495 | Ga0105243_107734951 | 272 |
| 434 | 3300009553 | Ga0105249_10000605 | Ga0105249_1000060518 | 272 |
| 435 | 3300009553 | Ga0105249_10003429 | Ga0105249_100034294 | 272 |
| 436 | 3300010375 | Ga0105239_10432352 | Ga0105239_104323522 | 272 |
| 437 | 3300013104 | Ga0157370_10346516 | Ga0157370_103465162 | 272 |
| 438 | 3300013297 | Ga0157378_10083134 | Ga0157378_100831342 | 272 |
| 439 | 3300025254 | Ga0209148_1000634 | Ga0209148_100063423 | 272 |
| 440 | 3300025272 | Ga0209455_1001165 | Ga0209455_100116510 | 272 |
| 441 | 3300025885 | Ga0207653_10007423 | Ga0207653_100074234 | 272 |
| 442 | 3300025898 | Ga0207692_10012694 | Ga0207692_100126943 | 272 |
| 443 | 3300025906 | Ga0207699_10010856 | Ga0207699_100108565 | 272 |
| 444 | 3300025912 | Ga0207707_10017551 | Ga0207707_100175514 | 272 |
| 445 | 3300025915 | Ga0207693_10072525 | Ga0207693_100725254 | 272 |
| 446 | 3300025915 | Ga0207693_10147439 | Ga0207693_101474391 | 272 |
| 447 | 3300025915 | Ga0207693_10286642 | Ga0207693_102866421 | 272 |
| 448 | 3300025917 | Ga0207660_10001377 | Ga0207660_1000137712 | 272 |
| 449 | 3300025921 | Ga0207652_10015359 | Ga0207652_100153597 | 272 |
| 450 | 3300025921 | Ga0207652_10321879 | Ga0207652_103218792 | 272 |
| 451 | 3300025925 | Ga0207650_10293599 | Ga0207650_102935991 | 272 |
| 452 | 3300025927 | Ga0207687_10359117 | Ga0207687_103591172 | 272 |
| 453 | 3300025928 | Ga0207700_10154525 | Ga0207700_101545251 | 272 |
| 454 | 3300025928 | Ga0207700_10159266 | Ga0207700_101592662 | 272 |
| 455 | 3300025929 | Ga0207664_10004269 | Ga0207664_100042693 | 272 |
| 456 | 3300025939 | Ga0207665_10015911 | Ga0207665_100159115 | 272 |
| 457 | 3300025961 | Ga0207712_10004527 | Ga0207712_100045276 | 272 |
| 458 | 3300025961 | Ga0207712_10005753 | Ga0207712_100057535 | 272 |
| 459 | 3300025986 | Ga0207658_10329026 | Ga0207658_103290261 | 272 |
| 460 | 3300026041 | Ga0207639_10312492 | Ga0207639_103124921 | 272 |
| 461 | 3300026075 | Ga0207708_10012241 | Ga0207708_100122412 | 272 |
| 462 | 3300026095 | Ga0207676_10303254 | Ga0207676_103032542 | 272 |
| 463 | 3300026116 | Ga0207674_10015659 | Ga0207674_100156592 | 272 |
| 464 | 3300026118 | Ga0207675_100042614 | Ga0207675_1000426142 | 272 |
| 465 | 3300026142 | Ga0207698_10064654 | Ga0207698_100646543 | 272 |
| 466 | 3300028379 | Ga0268266_10077532 | Ga0268266_100775322 | 272 |
| 467 | 3300028380 | Ga0268265_10012069 | Ga0268265_100120694 | 272 |
| 468 | 3300028381 | Ga0268264_10006067 | Ga0268264_100060677 | 272 |
| 469 | 3300028381 | Ga0268264_10172214 | Ga0268264_101722143 | 272 |
| 470 | 3300028573 | Ga0265334_10011486 | Ga0265334_100114864 | 272 |
| 471 | 3300028577 | Ga0265318_10064691 | Ga0265318_100646912 | 272 |
| 472 | 3300031235 | Ga0265330_10030697 | Ga0265330_100306972 | 272 |
| 473 | 3300031241 | Ga0265325_10105730 | Ga0265325_101057302 | 272 |
| 474 | 3300031247 | Ga0265340_10111774 | Ga0265340_101117741 | 272 |
| 475 | 3300031250 | Ga0265331_10058615 | Ga0265331_100586152 | 272 |
| 476 | 3300031712 | Ga0265342_10046005 | Ga0265342_100460053 | 272 |
| 477 | 3300032002 | Ga0307416_100404360 | Ga0307416_1004043602 | 272 |
| 478 | 3300035113 | Ga0373936_0000188 | Ga0373936_0000188_12817_13644 | 272 |
| 479 | 3300035117 | Ga0373953_0001135 | Ga0373953_0001135_2461_3288 | 272 |
| 480 | 3300035118 | Ga0373954_0001716 | Ga0373954_0001716_3167_3994 | 272 |
| 481 | 3300035170 | Ga0373943_0003598 | Ga0373943_0003598_4083_4910 | 272 |
| 482 | 3300035171 | Ga0373946_0004585 | Ga0373946_0004585_2042_2869 | 272 |
| 483 | 3300035172 | Ga0373955_0000706 | Ga0373955_0000706_2046_2873 | 272 |
| 484 | 3300035410 | Ga0373924_0000657 | Ga0373924_0000657_6089_6916 | 272 |
| 485 | 3300035692 | Ga0373935_0000021 | Ga0373935_0000021_31620_32447 | 272 |
| 486 | 3300035695 | Ga0373927_0009946 | Ga0373927_0009946_3657_4484 | 272 |
| 487 | 3300035724 | Ga0373933_0011288 | Ga0373933_0011288_1225_2052 | 272 |
| 488 | 3300035725 | Ga0373947_0000479 | Ga0373947_0000479_10210_11037 | 272 |
| 489 | 3300036401 | Ga0373937_0000003 | Ga0373937_0000003_48229_49056 | 272 |
| 490 | 3300036401 | Ga0373937_0254715 | Ga0373937_0254715_512_1339 | 272 |
| 491 | 3300037068 | Ga0373925_0000118 | Ga0373925_0000118_24494_25321 | 272 |
| 492 | 3300046454 | Ga0495592_0000215 | Ga0495592_0000215_35685_36512 | 272 |
| 493 | 3300046462 | Ga0495651_0000371 | Ga0495651_0000371_21811_22638 | 272 |
| 494 | 3300046463 | Ga0495653_0000039 | Ga0495653_0000039_33138_33965 | 272 |
| 495 | 3300046476 | Ga0495662_0002873 | Ga0495662_0002873_4721_5548 | 272 |
| 496 | 3300046477 | Ga0495664_0000015 | Ga0495664_0000015_153606_154433 | 272 |
| 497 | 3300046511 | Ga0495608_0000025 | Ga0495608_0000025_147131_147958 | 272 |
| 498 | 3300046511 | Ga0495608_0066690 | Ga0495608_0066690_130_957 | 272 |
| 499 | 3300046514 | Ga0495618_0000040 | Ga0495618_0000040_58958_59785 | 272 |
| 500 | 3300046514 | Ga0495618_0206114 | Ga0495618_0206114_297_1124 | 272 |
| 501 | 3300046516 | Ga0495628_0000011 | Ga0495628_0000011_186353_187180 | 272 |
| 502 | 3300046517 | Ga0495630_0001070 | Ga0495630_0001070_15359_16186 | 272 |
| 503 | 3300046529 | Ga0495652_0000014 | Ga0495652_0000014_38305_39132 | 272 |
| 504 | 3300046531 | Ga0495665_0018416 | Ga0495665_0018416_698_1525 | 272 |
| 505 | 3300046533 | Ga0495640_0000008 | Ga0495640_0000008_186353_187180 | 272 |
| 506 | 3300046536 | Ga0495587_0000015 | Ga0495587_0000015_33111_33938 | 272 |
| 507 | 3300046543 | Ga0495645_0000205 | Ga0495645_0000205_3194_4021 | 272 |
| 508 | 3300046559 | Ga0495667_0000013 | Ga0495667_0000013_186339_187166 | 272 |
| 509 | 3300046642 | Ga0495634_0000397 | Ga0495634_0000397_23663_24490 | 272 |
| 510 | 3300046663 | Ga0495635_0000012 | Ga0495635_0000012_38092_38919 | 272 |
| 511 | 3300046663 | Ga0495635_0231983 | Ga0495635_0231983_15_842 | 272 |
| 512 | 3300046675 | Ga0495657_0000392 | Ga0495657_0000392_28485_29312 | 272 |
| 513 | 3300046678 | Ga0495599_0000008 | Ga0495599_0000008_38355_39182 | 272 |
| 514 | 3300046679 | Ga0495623_0000002 | Ga0495623_0000002_160537_161364 | 272 |
| 515 | 3300046680 | Ga0495646_0000004 | Ga0495646_0000004_235007_235834 | 272 |
| 516 | 3300046683 | Ga0495658_0067118 | Ga0495658_0067118_95_922 | 272 |
| 517 | 3300046689 | Ga0495613_0092092 | Ga0495613_0092092_284_1111 | 272 |
| 518 | 3300046690 | Ga0495624_0010384 | Ga0495624_0010384_1465_2292 | 272 |
| 519 | 3300046809 | Ga0495600_0000164 | Ga0495600_0000164_25664_26491 | 272 |
| 520 | 3300047317 | Ga0495604_0000001 | Ga0495604_0000001_470946_471773 | 272 |
| 521 | 3300047319 | Ga0495674_0000023 | Ga0495674_0000023_123395_124222 | 272 |
| 522 | 3300047321 | Ga0495676_0080274 | Ga0495676_0080274_471_1298 | 272 |
| 523 | 3300047322 | Ga0495680_0000341 | Ga0495680_0000341_26524_27351 | 272 |
| 524 | 3300047444 | Ga0495675_0000315 | Ga0495675_0000315_31763_32590 | 272 |
| 525 | 3300047471 | Ga0495684_0000007 | Ga0495684_0000007_38165_38992 | 272 |
| 526 | 3300047673 | Ga0495593_0000806 | Ga0495593_0000806_2840_3667 | 272 |
| 527 | 3300048088 | Ga0495602_0000157 | Ga0495602_0000157_29024_29851 | 272 |
| 528 | 3300048088 | Ga0495602_0101775 | Ga0495602_0101775_12_839 | 272 |
| 529 | 3300048905 | Ga0496102_0001321 | Ga0496102_0001321_4025_4852 | 272 |
| 530 | 3300048905 | Ga0496102_0275217 | Ga0496102_0275217_397_1224 | 272 |
| 531 | 3300048907 | Ga0496104_0632991 | Ga0496104_0632991_27_854 | 272 |
| 532 | 3300048909 | Ga0496106_0003944 | Ga0496106_0003944_295_1122 | 272 |
| 533 | 3300048909 | Ga0496106_0468090 | Ga0496106_0468090_168_995 | 272 |
| 534 | 3300048910 | Ga0496107_0003324 | Ga0496107_0003324_3792_4619 | 272 |
| 535 | 3300048910 | Ga0496107_0107623 | Ga0496107_0107623_744_1571 | 272 |
| 536 | 3300048913 | Ga0496110_0040479 | Ga0496110_0040479_2426_3253 | 272 |
| 537 | 3300048915 | Ga0496112_0000009 | Ga0496112_0000009_195812_196648 | 272 |
| 538 | 3300048915 | Ga0496112_0022204 | Ga0496112_0022204_4784_5611 | 272 |
| 539 | 3300048918 | Ga0496115_0157970 | Ga0496115_0157970_228_1055 | 272 |
| 540 | 3300048924 | Ga0496121_0000091 | Ga0496121_0000091_62812_63639 | 272 |
| 541 | 3300049572 | Ga0501036_0120809 | Ga0501036_0120809_1046_1873 | 272 |
| 542 | 3300049580 | Ga0501046_0031030 | Ga0501046_0031030_2455_3282 | 272 |
| 543 | 3300049581 | Ga0501047_0093548 | Ga0501047_0093548_1761_2588 | 272 |
| 544 | 3300049823 | Ga0501044_0175676 | Ga0501044_0175676_417_1244 | 272 |
| 545 | 3300050490 | nmdc:mga03n38_2665_c1 | nmdc:mga03n38_2665_c1_2811_3638 | 272 |
| 546 | 3300050492 | nmdc:mga0yw44_35656_c1 | nmdc:mga0yw44_35656_c1_1324_2151 | 272 |
| 547 | 3300050493 | nmdc:mga0k408_153136_c1 | nmdc:mga0k408_153136_c1_112_939 | 272 |
| 548 | 3300050493 | nmdc:mga0k408_3608_c1 | nmdc:mga0k408_3608_c1_1276_2118 | 272 |
| 549 | 3300050495 | nmdc:mga04h51_28517_c1 | nmdc:mga04h51_28517_c1_597_1424 | 272 |
| 550 | 3300050496 | nmdc:mga07m45_5521_c1 | nmdc:mga07m45_5521_c1_3716_4543 | 272 |
| 551 | 3300050509 | nmdc:mga0qj67_299408_c1 | nmdc:mga0qj67_299408_c1_45_875 | 272 |
| 552 | 3300050513 | nmdc:mga0rr50_20477_c1 | nmdc:mga0rr50_20477_c1_3368_4195 | 272 |
| 553 | 3300053077 | Ga0495601_0000014 | Ga0495601_0000014_33139_33966 | 272 |
| 554 | 3300053078 | Ga0495612_0000014 | Ga0495612_0000014_33117_33944 | 272 |
| 555 | 3300053084 | Ga0495595_0000182 | Ga0495595_0000182_9080_9907 | 272 |
| 556 | 3300053085 | Ga0495619_0000006 | Ga0495619_0000006_186353_187180 | 272 |
| 557 | 3300053096 | Ga0500641_0078732 | Ga0500641_0078732_261_1088 | 272 |
| 558 | 3300053147 | Ga0500589_054344 | Ga0500589_054344_413_1240 | 272 |
| 559 | 3300005293 | Ga0065715_10157741 | Ga0065715_101577412 | 273 |
| 560 | 3300005330 | Ga0070690_100039011 | Ga0070690_1000390113 | 273 |
| 561 | 3300005335 | Ga0070666_10014844 | Ga0070666_100148442 | 273 |
| 562 | 3300005338 | Ga0068868_100005715 | Ga0068868_1000057152 | 273 |
| 563 | 3300005345 | Ga0070692_10198783 | Ga0070692_101987832 | 273 |
| 564 | 3300005354 | Ga0070675_100001562 | Ga0070675_10000156210 | 273 |
| 565 | 3300005355 | Ga0070671_100001109 | Ga0070671_10000110910 | 273 |
| 566 | 3300005364 | Ga0070673_100071020 | Ga0070673_1000710203 | 273 |
| 567 | 3300005365 | Ga0070688_100010378 | Ga0070688_1000103783 | 273 |
| 568 | 3300005456 | Ga0070678_100001839 | Ga0070678_10000183910 | 273 |
| 569 | 3300005614 | Ga0068856_100381812 | Ga0068856_1003818122 | 273 |
| 570 | 3300005616 | Ga0068852_100027942 | Ga0068852_1000279423 | 273 |
| 571 | 3300005616 | Ga0068852_100053703 | Ga0068852_1000537033 | 273 |
| 572 | 3300005617 | Ga0068859_100004047 | Ga0068859_10000404710 | 273 |
| 573 | 3300005618 | Ga0068864_100002145 | Ga0068864_10000214515 | 273 |
| 574 | 3300005719 | Ga0068861_100322267 | Ga0068861_1003222672 | 273 |
| 575 | 3300005834 | Ga0068851_10013505 | Ga0068851_100135052 | 273 |
| 576 | 3300005840 | Ga0068870_10030478 | Ga0068870_100304785 | 273 |
| 577 | 3300005841 | Ga0068863_100021798 | Ga0068863_1000217982 | 273 |
| 578 | 3300005842 | Ga0068858_100001027 | Ga0068858_10000102720 | 273 |
| 579 | 3300005937 | Ga0081455_10006927 | Ga0081455_100069276 | 273 |
| 580 | 3300005937 | Ga0081455_10010133 | Ga0081455_100101335 | 273 |
| 581 | 3300005983 | Ga0081540_1090369 | Ga0081540_10903692 | 273 |
| 582 | 3300006237 | Ga0097621_100006676 | Ga0097621_10000667610 | 273 |
| 583 | 3300006358 | Ga0068871_100001655 | Ga0068871_10000165510 | 273 |
| 584 | 3300006846 | Ga0075430_100247339 | Ga0075430_1002473392 | 273 |
| 585 | 3300006880 | Ga0075429_100573423 | Ga0075429_1005734231 | 273 |
| 586 | 3300006931 | Ga0097620_100004047 | Ga0097620_10000404710 | 273 |
| 587 | 3300009147 | Ga0114129_10390310 | Ga0114129_103903102 | 273 |
| 588 | 3300009177 | Ga0105248_10009206 | Ga0105248_100092063 | 273 |
| 589 | 3300009553 | Ga0105249_10519592 | Ga0105249_105195922 | 273 |
| 590 | 3300013102 | Ga0157371_10032500 | Ga0157371_100325004 | 273 |
| 591 | 3300013104 | Ga0157370_10222583 | Ga0157370_102225832 | 273 |
| 592 | 3300013296 | Ga0157374_10159069 | Ga0157374_101590692 | 273 |
| 593 | 3300013306 | Ga0163162_10050519 | Ga0163162_100505192 | 273 |
| 594 | 3300013308 | Ga0157375_10342272 | Ga0157375_103422722 | 273 |
| 595 | 3300014325 | Ga0163163_10052924 | Ga0163163_100529241 | 273 |
| 596 | 3300014969 | Ga0157376_10006589 | Ga0157376_100065894 | 273 |
| 597 | 3300017792 | Ga0163161_10174938 | Ga0163161_101749382 | 273 |
| 598 | 3300025299 | Ga0209256_1000282 | Ga0209256_100028229 | 273 |
| 599 | 3300025321 | Ga0207656_10034197 | Ga0207656_100341972 | 273 |
| 600 | 3300025903 | Ga0207680_10004135 | Ga0207680_100041356 | 273 |
| 601 | 3300025908 | Ga0207643_10183727 | Ga0207643_101837272 | 273 |
| 602 | 3300025926 | Ga0207659_10001153 | Ga0207659_100011531 | 273 |
| 603 | 3300025929 | Ga0207664_10216863 | Ga0207664_102168632 | 273 |
| 604 | 3300025931 | Ga0207644_10002964 | Ga0207644_100029642 | 273 |
| 605 | 3300025937 | Ga0207669_10129051 | Ga0207669_101290512 | 273 |
| 606 | 3300025942 | Ga0207689_10004088 | Ga0207689_1000408813 | 273 |
| 607 | 3300025960 | Ga0207651_10000597 | Ga0207651_100005979 | 273 |
| 608 | 3300025981 | Ga0207640_10118085 | Ga0207640_101180852 | 273 |
| 609 | 3300026023 | Ga0207677_10003770 | Ga0207677_100037706 | 273 |
| 610 | 3300026035 | Ga0207703_10002610 | Ga0207703_100026108 | 273 |
| 611 | 3300026088 | Ga0207641_10002468 | Ga0207641_100024688 | 273 |
| 612 | 3300026095 | Ga0207676_10000580 | Ga0207676_100005808 | 273 |
| 613 | 3300026118 | Ga0207675_100248702 | Ga0207675_1002487022 | 273 |
| 614 | 3300026121 | Ga0207683_10001023 | Ga0207683_1000102310 | 273 |
| 615 | 3300026142 | Ga0207698_10012412 | Ga0207698_100124125 | 273 |
| 616 | 3300028381 | Ga0268264_10118856 | Ga0268264_101188562 | 273 |
| 617 | 3300028794 | Ga0307515_10069488 | Ga0307515_100694885 | 273 |
| 618 | 3300031730 | Ga0307516_10144560 | Ga0307516_101445602 | 273 |
| 619 | 3300033180 | Ga0307510_10185499 | Ga0307510_101854992 | 273 |
| 620 | 3300035115 | Ga0373941_0000271 | Ga0373941_0000271_756_1589 | 273 |
| 621 | 3300035117 | Ga0373953_0004237 | Ga0373953_0004237_940_1770 | 273 |
| 622 | 3300046459 | Ga0495629_0108670 | Ga0495629_0108670_1073_1906 | 273 |
| 623 | 3300046462 | Ga0495651_0034356 | Ga0495651_0034356_2746_3579 | 273 |
| 624 | 3300046463 | Ga0495653_0007683 | Ga0495653_0007683_6998_7828 | 273 |
| 625 | 3300046507 | Ga0495606_0044078 | Ga0495606_0044078_1530_2363 | 273 |
| 626 | 3300046524 | Ga0495648_0071673 | Ga0495648_0071673_763_1596 | 273 |
| 627 | 3300046526 | Ga0495666_0163414 | Ga0495666_0163414_79_909 | 273 |
| 628 | 3300046533 | Ga0495640_0029328 | Ga0495640_0029328_724_1557 | 273 |
| 629 | 3300046642 | Ga0495634_0163526 | Ga0495634_0163526_476_1309 | 273 |
| 630 | 3300046642 | Ga0495634_0256832 | Ga0495634_0256832_23_853 | 273 |
| 631 | 3300046663 | Ga0495635_0018107 | Ga0495635_0018107_3146_3979 | 273 |
| 632 | 3300046675 | Ga0495657_0029999 | Ga0495657_0029999_2029_2862 | 273 |
| 633 | 3300046680 | Ga0495646_0068396 | Ga0495646_0068396_997_1830 | 273 |
| 634 | 3300046681 | Ga0495647_0030887 | Ga0495647_0030887_943_1773 | 273 |
| 635 | 3300046689 | Ga0495613_0096248 | Ga0495613_0096248_886_1719 | 273 |
| 636 | 3300046689 | Ga0495613_0176962 | Ga0495613_0176962_120_950 | 273 |
| 637 | 3300046690 | Ga0495624_0053173 | Ga0495624_0053173_310_1143 | 273 |
| 638 | 3300046691 | Ga0495670_0029534 | Ga0495670_0029534_1851_2681 | 273 |
| 639 | 3300046694 | Ga0495649_0014605 | Ga0495649_0014605_2176_3009 | 273 |
| 640 | 3300047317 | Ga0495604_0013618 | Ga0495604_0013618_4606_5439 | 273 |
| 641 | 3300047321 | Ga0495676_0088281 | Ga0495676_0088281_553_1386 | 273 |
| 642 | 3300047444 | Ga0495675_0003409 | Ga0495675_0003409_2304_3134 | 273 |
| 643 | 3300047469 | Ga0495673_0127309 | Ga0495673_0127309_26_859 | 273 |
| 644 | 3300048088 | Ga0495602_0063338 | Ga0495602_0063338_199_1029 | 273 |
| 645 | 3300048088 | Ga0495602_0141854 | Ga0495602_0141854_1022_1855 | 273 |
| 646 | 3300048904 | Ga0496101_0177057 | Ga0496101_0177057_312_1145 | 273 |
| 647 | 3300048908 | Ga0496105_0008435 | Ga0496105_0008435_5671_6504 | 273 |
| 648 | 3300048911 | Ga0496108_0157273 | Ga0496108_0157273_237_1079 | 273 |
| 649 | 3300048912 | Ga0496109_0018985 | Ga0496109_0018985_2081_2923 | 273 |
| 650 | 3300048912 | Ga0496109_0395015 | Ga0496109_0395015_20_850 | 273 |
| 651 | 3300048916 | Ga0496113_0085190 | Ga0496113_0085190_167_1000 | 273 |
| 652 | 3300048922 | Ga0496119_0024084 | Ga0496119_0024084_2353_3186 | 273 |
| 653 | 3300048923 | Ga0496120_0039344 | Ga0496120_0039344_976_1809 | 273 |
| 654 | 3300048924 | Ga0496121_0056015 | Ga0496121_0056015_1451_2284 | 273 |
| 655 | 3300048927 | Ga0496124_0056243 | Ga0496124_0056243_772_1605 | 273 |
| 656 | 3300048928 | Ga0496125_0074940 | Ga0496125_0074940_1528_2361 | 273 |
| 657 | 3300048929 | Ga0496126_0012552 | Ga0496126_0012552_3119_3952 | 273 |
| 658 | 3300048929 | Ga0496126_0297859 | Ga0496126_0297859_28_858 | 273 |
| 659 | 3300049568 | Ga0501031_0012910 | Ga0501031_0012910_776_1609 | 273 |
| 660 | 3300049569 | Ga0501032_0000055 | Ga0501032_0000055_43151_43984 | 273 |
| 661 | 3300049570 | Ga0501033_0001478 | Ga0501033_0001478_18900_19733 | 273 |
| 662 | 3300049571 | Ga0501034_0331436 | Ga0501034_0331436_590_1423 | 273 |
| 663 | 3300049572 | Ga0501036_0000021 | Ga0501036_0000021_73831_74664 | 273 |
| 664 | 3300049573 | Ga0501037_0001418 | Ga0501037_0001418_5041_5874 | 273 |
| 665 | 3300049573 | Ga0501037_0030614 | Ga0501037_0030614_946_1779 | 273 |
| 666 | 3300049574 | Ga0501038_0000070 | Ga0501038_0000070_39013_39846 | 273 |
| 667 | 3300049574 | Ga0501038_0246525 | Ga0501038_0246525_513_1346 | 273 |
| 668 | 3300049575 | Ga0501039_0001437 | Ga0501039_0001437_14547_15380 | 273 |
| 669 | 3300049575 | Ga0501039_0033778 | Ga0501039_0033778_2190_3023 | 273 |
| 670 | 3300049579 | Ga0501043_0000078 | Ga0501043_0000078_66890_67723 | 273 |
| 671 | 3300049580 | Ga0501046_0000627 | Ga0501046_0000627_5653_6486 | 273 |
| 672 | 3300049581 | Ga0501047_0000810 | Ga0501047_0000810_7434_8267 | 273 |
| 673 | 3300049581 | Ga0501047_0023017 | Ga0501047_0023017_4332_5165 | 273 |
| 674 | 3300049581 | Ga0501047_0416859 | Ga0501047_0416859_308_1141 | 273 |
| 675 | 3300049582 | Ga0501048_0001060 | Ga0501048_0001060_2902_3735 | 273 |
| 676 | 3300049583 | Ga0501067_0000177 | Ga0501067_0000177_32356_33189 | 273 |
| 677 | 3300049583 | Ga0501067_0084754 | Ga0501067_0084754_243_1076 | 273 |
| 678 | 3300049584 | Ga0501068_0010646 | Ga0501068_0010646_157_990 | 273 |
| 679 | 3300049585 | Ga0501069_0098344 | Ga0501069_0098344_261_1094 | 273 |
| 680 | 3300049586 | Ga0501070_0001227 | Ga0501070_0001227_12657_13490 | 273 |
| 681 | 3300049586 | Ga0501070_0284209 | Ga0501070_0284209_413_1246 | 273 |
| 682 | 3300049588 | Ga0501072_0004769 | Ga0501072_0004769_2837_3670 | 273 |
| 683 | 3300049588 | Ga0501072_0023276 | Ga0501072_0023276_151_984 | 273 |
| 684 | 3300049589 | Ga0501073_0000039 | Ga0501073_0000039_69933_70766 | 273 |
| 685 | 3300049590 | Ga0501074_0000019 | Ga0501074_0000019_42605_43438 | 273 |
| 686 | 3300049742 | Ga0501080_0000827 | Ga0501080_0000827_20289_21122 | 273 |
| 687 | 3300049744 | Ga0501083_0000242 | Ga0501083_0000242_3057_3890 | 273 |
| 688 | 3300049744 | Ga0501083_0158048 | Ga0501083_0158048_490_1323 | 273 |
| 689 | 3300049744 | Ga0501083_0188169 | Ga0501083_0188169_238_1071 | 273 |
| 690 | 3300049822 | Ga0501035_0001565 | Ga0501035_0001565_8916_9749 | 273 |
| 691 | 3300049823 | Ga0501044_0000179 | Ga0501044_0000179_16342_17175 | 273 |
| 692 | 3300049823 | Ga0501044_0239108 | Ga0501044_0239108_168_1001 | 273 |
| 693 | 3300049824 | Ga0501045_0003829 | Ga0501045_0003829_2956_3789 | 273 |
| 694 | 3300050507 | nmdc:mga05p37_40622_c1 | nmdc:mga05p37_40622_c1_2230_3060 | 273 |
| 695 | 3300050508 | nmdc:mga09592_253527_c1 | nmdc:mga09592_253527_c1_572_1402 | 273 |
| 696 | 3300050510 | nmdc:mga06r32_151936_c1 | nmdc:mga06r32_151936_c1_65_895 | 273 |
| 697 | 3300053077 | Ga0495601_0205583 | Ga0495601_0205583_141_971 | 273 |
| 698 | 3300053730 | Ga0500645_053793 | Ga0500645_053793_197_1027 | 273 |
| 699 | 3300054114 | Ga0501084_0088702 | Ga0501084_0088702_88_921 | 273 |
| 700 | 3300060353 | Ga0501082_0004803 | Ga0501082_0004803_1423_2256 | 273 |
| 701 | 3300003215 | JGI25153J46596_10001537 | JGI25153J46596_100015373 | 274 |
| 702 | 3300005329 | Ga0070683_100411014 | Ga0070683_1004110142 | 274 |
| 703 | 3300005331 | Ga0070670_100018595 | Ga0070670_1000185957 | 274 |
| 704 | 3300005331 | Ga0070670_100622686 | Ga0070670_1006226861 | 274 |
| 705 | 3300005334 | Ga0068869_100017122 | Ga0068869_1000171225 | 274 |
| 706 | 3300005334 | Ga0068869_100175363 | Ga0068869_1001753632 | 274 |
| 707 | 3300005335 | Ga0070666_10030114 | Ga0070666_100301144 | 274 |
| 708 | 3300005335 | Ga0070666_10242110 | Ga0070666_102421101 | 274 |
| 709 | 3300005336 | Ga0070680_100020948 | Ga0070680_1000209482 | 274 |
| 710 | 3300005336 | Ga0070680_100329092 | Ga0070680_1003290921 | 274 |
| 711 | 3300005337 | Ga0070682_100182740 | Ga0070682_1001827401 | 274 |
| 712 | 3300005338 | Ga0068868_100007157 | Ga0068868_1000071577 | 274 |
| 713 | 3300005339 | Ga0070660_100013688 | Ga0070660_1000136884 | 274 |
| 714 | 3300005340 | Ga0070689_100141679 | Ga0070689_1001416792 | 274 |
| 715 | 3300005343 | Ga0070687_100297431 | Ga0070687_1002974311 | 274 |
| 716 | 3300005344 | Ga0070661_100101157 | Ga0070661_1001011571 | 274 |
| 717 | 3300005347 | Ga0070668_100106151 | Ga0070668_1001061513 | 274 |
| 718 | 3300005347 | Ga0070668_100126362 | Ga0070668_1001263623 | 274 |
| 719 | 3300005347 | Ga0070668_100141257 | Ga0070668_1001412572 | 274 |
| 720 | 3300005353 | Ga0070669_100162443 | Ga0070669_1001624431 | 274 |
| 721 | 3300005354 | Ga0070675_100136591 | Ga0070675_1001365912 | 274 |
| 722 | 3300005355 | Ga0070671_100051865 | Ga0070671_1000518654 | 274 |
| 723 | 3300005355 | Ga0070671_100452947 | Ga0070671_1004529472 | 274 |
| 724 | 3300005356 | Ga0070674_100163784 | Ga0070674_1001637842 | 274 |
| 725 | 3300005356 | Ga0070674_100304584 | Ga0070674_1003045842 | 274 |
| 726 | 3300005356 | Ga0070674_100342737 | Ga0070674_1003427372 | 274 |
| 727 | 3300005365 | Ga0070688_100201784 | Ga0070688_1002017842 | 274 |
| 728 | 3300005366 | Ga0070659_100055929 | Ga0070659_1000559292 | 274 |
| 729 | 3300005435 | Ga0070714_100080871 | Ga0070714_1000808711 | 274 |
| 730 | 3300005436 | Ga0070713_100007640 | Ga0070713_1000076404 | 274 |
| 731 | 3300005440 | Ga0070705_100075186 | Ga0070705_1000751863 | 274 |
| 732 | 3300005455 | Ga0070663_100021199 | Ga0070663_1000211995 | 274 |
| 733 | 3300005455 | Ga0070663_100028448 | Ga0070663_1000284481 | 274 |
| 734 | 3300005455 | Ga0070663_100048448 | Ga0070663_1000484484 | 274 |
| 735 | 3300005455 | Ga0070663_100116047 | Ga0070663_1001160472 | 274 |
| 736 | 3300005455 | Ga0070663_100263241 | Ga0070663_1002632412 | 274 |
| 737 | 3300005456 | Ga0070678_100020180 | Ga0070678_1000201805 | 274 |
| 738 | 3300005456 | Ga0070678_100116621 | Ga0070678_1001166212 | 274 |
| 739 | 3300005457 | Ga0070662_100041616 | Ga0070662_1000416162 | 274 |
| 740 | 3300005457 | Ga0070662_100158126 | Ga0070662_1001581262 | 274 |
| 741 | 3300005471 | Ga0070698_100355433 | Ga0070698_1003554332 | 274 |
| 742 | 3300005539 | Ga0068853_100078703 | Ga0068853_1000787034 | 274 |
| 743 | 3300005544 | Ga0070686_100067129 | Ga0070686_1000671293 | 274 |
| 744 | 3300005547 | Ga0070693_100164039 | Ga0070693_1001640391 | 274 |
| 745 | 3300005548 | Ga0070665_100036690 | Ga0070665_1000366903 | 274 |
| 746 | 3300005548 | Ga0070665_100060269 | Ga0070665_1000602695 | 274 |
| 747 | 3300005548 | Ga0070665_100060631 | Ga0070665_1000606314 | 274 |
| 748 | 3300005548 | Ga0070665_100115492 | Ga0070665_1001154923 | 274 |
| 749 | 3300005548 | Ga0070665_100136512 | Ga0070665_1001365122 | 274 |
| 750 | 3300005563 | Ga0068855_100021611 | Ga0068855_1000216117 | 274 |
| 751 | 3300005563 | Ga0068855_100154201 | Ga0068855_1001542012 | 274 |
| 752 | 3300005564 | Ga0070664_100176017 | Ga0070664_1001760172 | 274 |
| 753 | 3300005564 | Ga0070664_100298355 | Ga0070664_1002983551 | 274 |
| 754 | 3300005577 | Ga0068857_100055694 | Ga0068857_1000556943 | 274 |
| 755 | 3300005577 | Ga0068857_100063891 | Ga0068857_1000638914 | 274 |
| 756 | 3300005577 | Ga0068857_100182900 | Ga0068857_1001829002 | 274 |
| 757 | 3300005614 | Ga0068856_100021308 | Ga0068856_1000213087 | 274 |
| 758 | 3300005616 | Ga0068852_100040460 | Ga0068852_1000404605 | 274 |
| 759 | 3300005617 | Ga0068859_100241285 | Ga0068859_1002412852 | 274 |
| 760 | 3300005617 | Ga0068859_100264911 | Ga0068859_1002649112 | 274 |
| 761 | 3300005618 | Ga0068864_100013439 | Ga0068864_1000134397 | 274 |
| 762 | 3300005618 | Ga0068864_100025263 | Ga0068864_1000252634 | 274 |
| 763 | 3300005618 | Ga0068864_100209501 | Ga0068864_1002095012 | 274 |
| 764 | 3300005719 | Ga0068861_100013208 | Ga0068861_1000132084 | 274 |
| 765 | 3300005834 | Ga0068851_10011125 | Ga0068851_100111253 | 274 |
| 766 | 3300005840 | Ga0068870_10072449 | Ga0068870_100724492 | 274 |
| 767 | 3300005841 | Ga0068863_100844381 | Ga0068863_1008443811 | 274 |
| 768 | 3300005842 | Ga0068858_100232239 | Ga0068858_1002322391 | 274 |
| 769 | 3300005843 | Ga0068860_100000277 | Ga0068860_1000002775 | 274 |
| 770 | 3300005843 | Ga0068860_100125995 | Ga0068860_1001259953 | 274 |
| 771 | 3300005843 | Ga0068860_100202794 | Ga0068860_1002027942 | 274 |
| 772 | 3300005844 | Ga0068862_100034967 | Ga0068862_1000349675 | 274 |
| 773 | 3300005844 | Ga0068862_100062761 | Ga0068862_1000627614 | 274 |
| 774 | 3300005937 | Ga0081455_10074531 | Ga0081455_100745313 | 274 |
| 775 | 3300005937 | Ga0081455_10173848 | Ga0081455_101738482 | 274 |
| 776 | 3300005981 | Ga0081538_10013652 | Ga0081538_100136525 | 274 |
| 777 | 3300005983 | Ga0081540_1000948 | Ga0081540_100094811 | 274 |
| 778 | 3300005983 | Ga0081540_1004138 | Ga0081540_10041387 | 274 |
| 779 | 3300005983 | Ga0081540_1009201 | Ga0081540_10092013 | 274 |
| 780 | 3300005985 | Ga0081539_10089918 | Ga0081539_100899182 | 274 |
| 781 | 3300006028 | Ga0070717_10055084 | Ga0070717_100550843 | 274 |
| 782 | 3300006038 | Ga0075365_10081986 | Ga0075365_100819862 | 274 |
| 783 | 3300006038 | Ga0075365_10097868 | Ga0075365_100978682 | 274 |
| 784 | 3300006042 | Ga0075368_10007748 | Ga0075368_100077482 | 274 |
| 785 | 3300006042 | Ga0075368_10011042 | Ga0075368_100110422 | 274 |
| 786 | 3300006048 | Ga0075363_100000141 | Ga0075363_10000014119 | 274 |
| 787 | 3300006048 | Ga0075363_100010581 | Ga0075363_1000105817 | 274 |
| 788 | 3300006048 | Ga0075363_100018089 | Ga0075363_1000180893 | 274 |
| 789 | 3300006051 | Ga0075364_10014811 | Ga0075364_100148115 | 274 |
| 790 | 3300006051 | Ga0075364_10149608 | Ga0075364_101496082 | 274 |
| 791 | 3300006051 | Ga0075364_10306092 | Ga0075364_103060921 | 274 |
| 792 | 3300006175 | Ga0070712_100105268 | Ga0070712_1001052682 | 274 |
| 793 | 3300006177 | Ga0075362_10022640 | Ga0075362_100226404 | 274 |
| 794 | 3300006177 | Ga0075362_10024000 | Ga0075362_100240003 | 274 |
| 795 | 3300006177 | Ga0075362_10035505 | Ga0075362_100355053 | 274 |
| 796 | 3300006177 | Ga0075362_10049476 | Ga0075362_100494763 | 274 |
| 797 | 3300006178 | Ga0075367_10001014 | Ga0075367_100010142 | 274 |
| 798 | 3300006178 | Ga0075367_10021428 | Ga0075367_100214282 | 274 |
| 799 | 3300006178 | Ga0075367_10070956 | Ga0075367_100709561 | 274 |
| 800 | 3300006186 | Ga0075369_10015863 | Ga0075369_100158633 | 274 |
| 801 | 3300006186 | Ga0075369_10058565 | Ga0075369_100585652 | 274 |
| 802 | 3300006195 | Ga0075366_10012370 | Ga0075366_100123704 | 274 |
| 803 | 3300006195 | Ga0075366_10143419 | Ga0075366_101434192 | 274 |
| 804 | 3300006237 | Ga0097621_100174536 | Ga0097621_1001745362 | 274 |
| 805 | 3300006353 | Ga0075370_10016088 | Ga0075370_100160883 | 274 |
| 806 | 3300006353 | Ga0075370_10020374 | Ga0075370_100203744 | 274 |
| 807 | 3300006353 | Ga0075370_10025265 | Ga0075370_100252653 | 274 |
| 808 | 3300006353 | Ga0075370_10032929 | Ga0075370_100329294 | 274 |
| 809 | 3300006844 | Ga0075428_100013546 | Ga0075428_1000135462 | 274 |
| 810 | 3300006844 | Ga0075428_100029097 | Ga0075428_1000290977 | 274 |
| 811 | 3300006844 | Ga0075428_100043811 | Ga0075428_1000438114 | 274 |
| 812 | 3300006846 | Ga0075430_100189206 | Ga0075430_1001892062 | 274 |
| 813 | 3300006847 | Ga0075431_100098882 | Ga0075431_1000988821 | 274 |
| 814 | 3300006847 | Ga0075431_100531924 | Ga0075431_1005319242 | 274 |
| 815 | 3300006852 | Ga0075433_10378537 | Ga0075433_103785372 | 274 |
| 816 | 3300006871 | Ga0075434_100028848 | Ga0075434_1000288484 | 274 |
| 817 | 3300006881 | Ga0068865_100121251 | Ga0068865_1001212512 | 274 |
| 818 | 3300006931 | Ga0097620_100241287 | Ga0097620_1002412872 | 274 |
| 819 | 3300006931 | Ga0097620_100264898 | Ga0097620_1002648982 | 274 |
| 820 | 3300007265 | Ga0099794_10003694 | Ga0099794_100036943 | 274 |
| 821 | 3300007265 | Ga0099794_10026848 | Ga0099794_100268481 | 274 |
| 822 | 3300007788 | Ga0099795_10009230 | Ga0099795_100092303 | 274 |
| 823 | 3300007788 | Ga0099795_10074455 | Ga0099795_100744552 | 274 |
| 824 | 3300009092 | Ga0105250_10089165 | Ga0105250_100891651 | 274 |
| 825 | 3300009093 | Ga0105240_10093755 | Ga0105240_100937552 | 274 |
| 826 | 3300009094 | Ga0111539_10032652 | Ga0111539_100326523 | 274 |
| 827 | 3300009094 | Ga0111539_10059271 | Ga0111539_100592712 | 274 |
| 828 | 3300009094 | Ga0111539_10468757 | Ga0111539_104687572 | 274 |
| 829 | 3300009098 | Ga0105245_10101824 | Ga0105245_101018242 | 274 |
| 830 | 3300009098 | Ga0105245_10214103 | Ga0105245_102141032 | 274 |
| 831 | 3300009101 | Ga0105247_10252945 | Ga0105247_102529451 | 274 |
| 832 | 3300009147 | Ga0114129_10061881 | Ga0114129_100618815 | 274 |
| 833 | 3300009147 | Ga0114129_10079079 | Ga0114129_100790793 | 274 |
| 834 | 3300009147 | Ga0114129_10220299 | Ga0114129_102202992 | 274 |
| 835 | 3300009174 | Ga0105241_10188416 | Ga0105241_101884162 | 274 |
| 836 | 3300009176 | Ga0105242_10035577 | Ga0105242_100355774 | 274 |
| 837 | 3300009176 | Ga0105242_10246244 | Ga0105242_102462442 | 274 |
| 838 | 3300009545 | Ga0105237_10008069 | Ga0105237_100080696 | 274 |
| 839 | 3300009545 | Ga0105237_10028364 | Ga0105237_100283643 | 274 |
| 840 | 3300009551 | Ga0105238_10048532 | Ga0105238_100485322 | 274 |
| 841 | 3300009551 | Ga0105238_10059815 | Ga0105238_100598152 | 274 |
| 842 | 3300009553 | Ga0105249_10222468 | Ga0105249_102224682 | 274 |
| 843 | 3300010375 | Ga0105239_10038265 | Ga0105239_100382654 | 274 |
| 844 | 3300010375 | Ga0105239_10236387 | Ga0105239_102363872 | 274 |
| 845 | 3300010375 | Ga0105239_10331930 | Ga0105239_103319302 | 274 |
| 846 | 3300010375 | Ga0105239_10342245 | Ga0105239_103422451 | 274 |
| 847 | 3300013104 | Ga0157370_10206548 | Ga0157370_102065482 | 274 |
| 848 | 3300013105 | Ga0157369_10036010 | Ga0157369_100360104 | 274 |
| 849 | 3300013296 | Ga0157374_10009863 | Ga0157374_100098637 | 274 |
| 850 | 3300013297 | Ga0157378_10224932 | Ga0157378_102249322 | 274 |
| 851 | 3300013297 | Ga0157378_10312879 | Ga0157378_103128792 | 274 |
| 852 | 3300013306 | Ga0163162_10279533 | Ga0163162_102795332 | 274 |
| 853 | 3300014325 | Ga0163163_10010304 | Ga0163163_1001030410 | 274 |
| 854 | 3300014325 | Ga0163163_10079530 | Ga0163163_100795304 | 274 |
| 855 | 3300014969 | Ga0157376_10147314 | Ga0157376_101473142 | 274 |
| 856 | 3300021361 | Ga0213872_10045180 | Ga0213872_100451802 | 274 |
| 857 | 3300021377 | Ga0213874_10039268 | Ga0213874_100392682 | 274 |
| 858 | 3300021384 | Ga0213876_10075200 | Ga0213876_100752002 | 274 |
| 859 | 3300025297 | Ga0209758_1020356 | Ga0209758_10203564 | 274 |
| 860 | 3300025297 | Ga0209758_1029534 | Ga0209758_10295343 | 274 |
| 861 | 3300025315 | Ga0207697_10055877 | Ga0207697_100558772 | 274 |
| 862 | 3300025898 | Ga0207692_10050940 | Ga0207692_100509403 | 274 |
| 863 | 3300025900 | Ga0207710_10053772 | Ga0207710_100537723 | 274 |
| 864 | 3300025901 | Ga0207688_10006216 | Ga0207688_100062165 | 274 |
| 865 | 3300025901 | Ga0207688_10031618 | Ga0207688_100316183 | 274 |
| 866 | 3300025901 | Ga0207688_10141219 | Ga0207688_101412192 | 274 |
| 867 | 3300025903 | Ga0207680_10062751 | Ga0207680_100627513 | 274 |
| 868 | 3300025908 | Ga0207643_10005792 | Ga0207643_100057927 | 274 |
| 869 | 3300025910 | Ga0207684_10065073 | Ga0207684_100650733 | 274 |
| 870 | 3300025911 | Ga0207654_10008079 | Ga0207654_100080795 | 274 |
| 871 | 3300025911 | Ga0207654_10092864 | Ga0207654_100928642 | 274 |
| 872 | 3300025912 | Ga0207707_10013854 | Ga0207707_100138546 | 274 |
| 873 | 3300025914 | Ga0207671_10008698 | Ga0207671_100086984 | 274 |
| 874 | 3300025914 | Ga0207671_10031634 | Ga0207671_100316343 | 274 |
| 875 | 3300025914 | Ga0207671_10031871 | Ga0207671_100318713 | 274 |
| 876 | 3300025914 | Ga0207671_10616011 | Ga0207671_106160111 | 274 |
| 877 | 3300025915 | Ga0207693_10160657 | Ga0207693_101606572 | 274 |
| 878 | 3300025915 | Ga0207693_10189600 | Ga0207693_101896002 | 274 |
| 879 | 3300025919 | Ga0207657_10001946 | Ga0207657_1000194615 | 274 |
| 880 | 3300025919 | Ga0207657_10131176 | Ga0207657_101311762 | 274 |
| 881 | 3300025920 | Ga0207649_10162341 | Ga0207649_101623412 | 274 |
| 882 | 3300025920 | Ga0207649_10263469 | Ga0207649_102634692 | 274 |
| 883 | 3300025921 | Ga0207652_10026152 | Ga0207652_100261525 | 274 |
| 884 | 3300025922 | Ga0207646_10064179 | Ga0207646_100641792 | 274 |
| 885 | 3300025924 | Ga0207694_10195681 | Ga0207694_101956812 | 274 |
| 886 | 3300025926 | Ga0207659_10097093 | Ga0207659_100970933 | 274 |
| 887 | 3300025927 | Ga0207687_10048589 | Ga0207687_100485893 | 274 |
| 888 | 3300025928 | Ga0207700_10026543 | Ga0207700_100265433 | 274 |
| 889 | 3300025931 | Ga0207644_10275051 | Ga0207644_102750512 | 274 |
| 890 | 3300025932 | Ga0207690_10032618 | Ga0207690_100326184 | 274 |
| 891 | 3300025932 | Ga0207690_10244041 | Ga0207690_102440412 | 274 |
| 892 | 3300025934 | Ga0207686_10023414 | Ga0207686_100234142 | 274 |
| 893 | 3300025934 | Ga0207686_10054687 | Ga0207686_100546873 | 274 |
| 894 | 3300025934 | Ga0207686_10218937 | Ga0207686_102189372 | 274 |
| 895 | 3300025935 | Ga0207709_10041560 | Ga0207709_100415602 | 274 |
| 896 | 3300025937 | Ga0207669_10028432 | Ga0207669_100284323 | 274 |
| 897 | 3300025937 | Ga0207669_10429201 | Ga0207669_104292011 | 274 |
| 898 | 3300025938 | Ga0207704_10009866 | Ga0207704_100098663 | 274 |
| 899 | 3300025939 | Ga0207665_10240936 | Ga0207665_102409362 | 274 |
| 900 | 3300025940 | Ga0207691_10021052 | Ga0207691_100210523 | 274 |
| 901 | 3300025942 | Ga0207689_10019078 | Ga0207689_100190782 | 274 |
| 902 | 3300025944 | Ga0207661_10449207 | Ga0207661_104492072 | 274 |
| 903 | 3300025945 | Ga0207679_10113597 | Ga0207679_101135972 | 274 |
| 904 | 3300025945 | Ga0207679_10212311 | Ga0207679_102123112 | 274 |
| 905 | 3300025949 | Ga0207667_10115539 | Ga0207667_101155393 | 274 |
| 906 | 3300025949 | Ga0207667_10290568 | Ga0207667_102905682 | 274 |
| 907 | 3300025949 | Ga0207667_10688512 | Ga0207667_106885122 | 274 |
| 908 | 3300025961 | Ga0207712_10248874 | Ga0207712_102488742 | 274 |
| 909 | 3300025972 | Ga0207668_10016019 | Ga0207668_100160195 | 274 |
| 910 | 3300025972 | Ga0207668_10067863 | Ga0207668_100678632 | 274 |
| 911 | 3300025972 | Ga0207668_10084839 | Ga0207668_100848392 | 274 |
| 912 | 3300025972 | Ga0207668_10160443 | Ga0207668_101604431 | 274 |
| 913 | 3300026023 | Ga0207677_10045320 | Ga0207677_100453203 | 274 |
| 914 | 3300026035 | Ga0207703_10008823 | Ga0207703_100088233 | 274 |
| 915 | 3300026035 | Ga0207703_10324855 | Ga0207703_103248552 | 274 |
| 916 | 3300026041 | Ga0207639_10094992 | Ga0207639_100949922 | 274 |
| 917 | 3300026041 | Ga0207639_10146440 | Ga0207639_101464403 | 274 |
| 918 | 3300026067 | Ga0207678_10015210 | Ga0207678_100152108 | 274 |
| 919 | 3300026067 | Ga0207678_10150533 | Ga0207678_101505333 | 274 |
| 920 | 3300026067 | Ga0207678_10190578 | Ga0207678_101905782 | 274 |
| 921 | 3300026075 | Ga0207708_10120515 | Ga0207708_101205153 | 274 |
| 922 | 3300026078 | Ga0207702_10143155 | Ga0207702_101431551 | 274 |
| 923 | 3300026089 | Ga0207648_10118805 | Ga0207648_101188053 | 274 |
| 924 | 3300026089 | Ga0207648_10353402 | Ga0207648_103534021 | 274 |
| 925 | 3300026095 | Ga0207676_10036976 | Ga0207676_100369765 | 274 |
| 926 | 3300026095 | Ga0207676_10166238 | Ga0207676_101662382 | 274 |
| 927 | 3300026116 | Ga0207674_10034697 | Ga0207674_100346975 | 274 |
| 928 | 3300026116 | Ga0207674_10114721 | Ga0207674_101147212 | 274 |
| 929 | 3300026116 | Ga0207674_10277373 | Ga0207674_102773732 | 274 |
| 930 | 3300026118 | Ga0207675_100013083 | Ga0207675_1000130832 | 274 |
| 931 | 3300026118 | Ga0207675_100024197 | Ga0207675_1000241977 | 274 |
| 932 | 3300026118 | Ga0207675_100035075 | Ga0207675_1000350753 | 274 |
| 933 | 3300026118 | Ga0207675_100101089 | Ga0207675_1001010892 | 274 |
| 934 | 3300026121 | Ga0207683_10023737 | Ga0207683_100237376 | 274 |
| 935 | 3300026121 | Ga0207683_10244365 | Ga0207683_102443652 | 274 |
| 936 | 3300026142 | Ga0207698_10318835 | Ga0207698_103188352 | 274 |
| 937 | 3300027671 | Ga0209588_1051665 | Ga0209588_10516652 | 274 |
| 938 | 3300027866 | Ga0209813_10002641 | Ga0209813_100026412 | 274 |
| 939 | 3300027866 | Ga0209813_10008917 | Ga0209813_100089172 | 274 |
| 940 | 3300028379 | Ga0268266_10000638 | Ga0268266_1000063829 | 274 |
| 941 | 3300028379 | Ga0268266_10000807 | Ga0268266_1000080731 | 274 |
| 942 | 3300028379 | Ga0268266_10006312 | Ga0268266_100063125 | 274 |
| 943 | 3300028379 | Ga0268266_10014067 | Ga0268266_100140678 | 274 |
| 944 | 3300028379 | Ga0268266_10026691 | Ga0268266_100266913 | 274 |
| 945 | 3300028379 | Ga0268266_10044321 | Ga0268266_100443213 | 274 |
| 946 | 3300028379 | Ga0268266_10083302 | Ga0268266_100833021 | 274 |
| 947 | 3300028380 | Ga0268265_10053120 | Ga0268265_100531202 | 274 |
| 948 | 3300028380 | Ga0268265_10150499 | Ga0268265_101504991 | 274 |
| 949 | 3300028380 | Ga0268265_10533308 | Ga0268265_105333082 | 274 |
| 950 | 3300028381 | Ga0268264_10000153 | Ga0268264_10000153152 | 274 |
| 951 | 3300028381 | Ga0268264_10036845 | Ga0268264_100368452 | 274 |
| 952 | 3300028381 | Ga0268264_10363491 | Ga0268264_103634912 | 274 |
| 953 | 3300028573 | Ga0265334_10086967 | Ga0265334_100869672 | 274 |
| 954 | 3300030522 | Ga0307512_10134930 | Ga0307512_101349302 | 274 |
| 955 | 3300031235 | Ga0265330_10043044 | Ga0265330_100430442 | 274 |
| 956 | 3300031238 | Ga0265332_10043296 | Ga0265332_100432962 | 274 |
| 957 | 3300031241 | Ga0265325_10035066 | Ga0265325_100350662 | 274 |
| 958 | 3300031344 | Ga0265316_10133838 | Ga0265316_101338383 | 274 |
| 959 | 3300031456 | Ga0307513_10334704 | Ga0307513_103347041 | 274 |
| 960 | 3300031507 | Ga0307509_10052324 | Ga0307509_100523243 | 274 |
| 961 | 3300031507 | Ga0307509_10101091 | Ga0307509_101010912 | 274 |
| 962 | 3300031507 | Ga0307509_10314743 | Ga0307509_103147431 | 274 |
| 963 | 3300031507 | Ga0307509_10345484 | Ga0307509_103454841 | 274 |
| 964 | 3300031616 | Ga0307508_10000013 | Ga0307508_1000001373 | 274 |
| 965 | 3300031616 | Ga0307508_10108370 | Ga0307508_101083702 | 274 |
| 966 | 3300031616 | Ga0307508_10234257 | Ga0307508_102342571 | 274 |
| 967 | 3300031711 | Ga0265314_10123483 | Ga0265314_101234831 | 274 |
| 968 | 3300031730 | Ga0307516_10006924 | Ga0307516_100069243 | 274 |
| 969 | 3300031730 | Ga0307516_10030289 | Ga0307516_100302892 | 274 |
| 970 | 3300031730 | Ga0307516_10083279 | Ga0307516_100832792 | 274 |
| 971 | 3300031995 | Ga0307409_100081192 | Ga0307409_1000811922 | 274 |
| 972 | 3300031995 | Ga0307409_100657687 | Ga0307409_1006576872 | 274 |
| 973 | 3300032126 | Ga0307415_100188368 | Ga0307415_1001883682 | 274 |
| 974 | 3300033179 | Ga0307507_10037332 | Ga0307507_100373322 | 274 |
| 975 | 3300033180 | Ga0307510_10003040 | Ga0307510_100030407 | 274 |
| 976 | 3300035083 | Ga0373926_0028931 | Ga0373926_0028931_369_1202 | 274 |
| 977 | 3300035083 | Ga0373926_0043877 | Ga0373926_0043877_64_897 | 274 |
| 978 | 3300035090 | Ga0373949_0020562 | Ga0373949_0020562_483_1316 | 274 |
| 979 | 3300035111 | Ga0373923_0020855 | Ga0373923_0020855_708_1541 | 274 |
| 980 | 3300035113 | Ga0373936_0053141 | Ga0373936_0053141_446_1279 | 274 |
| 981 | 3300035115 | Ga0373941_0050861 | Ga0373941_0050861_426_1259 | 274 |
| 982 | 3300035116 | Ga0373945_0053145 | Ga0373945_0053145_120_953 | 274 |
| 983 | 3300035117 | Ga0373953_0030172 | Ga0373953_0030172_114_947 | 274 |
| 984 | 3300035170 | Ga0373943_0032326 | Ga0373943_0032326_876_1709 | 274 |
| 985 | 3300035171 | Ga0373946_0021251 | Ga0373946_0021251_662_1495 | 274 |
| 986 | 3300035410 | Ga0373924_0049158 | Ga0373924_0049158_606_1439 | 274 |
| 987 | 3300035691 | Ga0373931_0130431 | Ga0373931_0130431_320_1153 | 274 |
| 988 | 3300035692 | Ga0373935_0024891 | Ga0373935_0024891_171_1004 | 274 |
| 989 | 3300035692 | Ga0373935_0061578 | Ga0373935_0061578_1539_2372 | 274 |
| 990 | 3300035692 | Ga0373935_0140586 | Ga0373935_0140586_722_1555 | 274 |
| 991 | 3300035692 | Ga0373935_0279099 | Ga0373935_0279099_330_1163 | 274 |
| 992 | 3300035695 | Ga0373927_0021530 | Ga0373927_0021530_2086_2919 | 274 |
| 993 | 3300035695 | Ga0373927_0195453 | Ga0373927_0195453_289_1122 | 274 |
| 994 | 3300035724 | Ga0373933_0092462 | Ga0373933_0092462_636_1469 | 274 |
| 995 | 3300035725 | Ga0373947_0013284 | Ga0373947_0013284_2512_3345 | 274 |
| 996 | 3300035725 | Ga0373947_0164456 | Ga0373947_0164456_65_898 | 274 |
| 997 | 3300036401 | Ga0373937_0400365 | Ga0373937_0400365_105_938 | 274 |
| 998 | 3300037068 | Ga0373925_0042097 | Ga0373925_0042097_2454_3287 | 274 |
| 999 | 3300037068 | Ga0373925_0126535 | Ga0373925_0126535_43_876 | 274 |
| 1000 | 3300037418 | Ga0395900_0009415 | Ga0395900_0009415_5930_6763 | 274 |
| 1001 | 3300037466 | Ga0395898_0016882 | Ga0395898_0016882_5786_6619 | 274 |
| 1002 | 3300037471 | Ga0395905_0447005 | Ga0395905_0447005_254_1087 | 274 |
| 1003 | 3300037853 | Ga0436364_0304115 | Ga0436364_0304115_1073_1918 | 274 |
| 1004 | 3300038443 | Ga0395901_0009062 | Ga0395901_0009062_5743_6576 | 274 |
| 1005 | 3300039437 | Ga0436365_1233769 | Ga0436365_1233769_9289_10134 | 274 |
| 1006 | 3300039438 | Ga0436360_0853720 | Ga0436360_0853720_3480_4328 | 274 |
| 1007 | 3300039447 | Ga0436361_0283608 | Ga0436361_0283608_5125_5982 | 274 |
| 1008 | 3300039447 | Ga0436361_0331296 | Ga0436361_0331296_519_1364 | 274 |
| 1009 | 3300039447 | Ga0436361_1007450 | Ga0436361_1007450_12_860 | 274 |
| 1010 | 3300039447 | Ga0436361_1011773 | Ga0436361_1011773_304_1158 | 274 |
| 1011 | 3300039450 | Ga0436363_0800492 | Ga0436363_0800492_748_1593 | 274 |
| 1012 | 3300042157 | Ga0439458_0006605 | Ga0439458_0006605_1597_2442 | 274 |
| 1013 | 3300044735 | Ga0466968_0114564 | Ga0466968_0114564_243_1091 | 274 |
| 1014 | 3300046454 | Ga0495592_0225482 | Ga0495592_0225482_158_991 | 274 |
| 1015 | 3300046455 | Ga0495603_0002154 | Ga0495603_0002154_6195_7028 | 274 |
| 1016 | 3300046459 | Ga0495629_0012373 | Ga0495629_0012373_4160_4993 | 274 |
| 1017 | 3300046459 | Ga0495629_0024099 | Ga0495629_0024099_2724_3557 | 274 |
| 1018 | 3300046459 | Ga0495629_0179028 | Ga0495629_0179028_420_1253 | 274 |
| 1019 | 3300046462 | Ga0495651_0049838 | Ga0495651_0049838_1258_2091 | 274 |
| 1020 | 3300046463 | Ga0495653_0047555 | Ga0495653_0047555_813_1646 | 274 |
| 1021 | 3300046463 | Ga0495653_0108612 | Ga0495653_0108612_99_944 | 274 |
| 1022 | 3300046463 | Ga0495653_0184286 | Ga0495653_0184286_155_988 | 274 |
| 1023 | 3300046472 | Ga0495580_0057855 | Ga0495580_0057855_1742_2575 | 274 |
| 1024 | 3300046472 | Ga0495580_0060558 | Ga0495580_0060558_1592_2425 | 274 |
| 1025 | 3300046476 | Ga0495662_0007383 | Ga0495662_0007383_537_1370 | 274 |
| 1026 | 3300046477 | Ga0495664_0092439 | Ga0495664_0092439_612_1445 | 274 |
| 1027 | 3300046491 | Ga0495584_0149564 | Ga0495584_0149564_152_985 | 274 |
| 1028 | 3300046499 | Ga0495594_0068933 | Ga0495594_0068933_355_1188 | 274 |
| 1029 | 3300046501 | Ga0495607_0071269 | Ga0495607_0071269_397_1230 | 274 |
| 1030 | 3300046511 | Ga0495608_0031065 | Ga0495608_0031065_793_1626 | 274 |
| 1031 | 3300046511 | Ga0495608_0061472 | Ga0495608_0061472_582_1427 | 274 |
| 1032 | 3300046514 | Ga0495618_0175840 | Ga0495618_0175840_354_1187 | 274 |
| 1033 | 3300046517 | Ga0495630_0147017 | Ga0495630_0147017_194_1027 | 274 |
| 1034 | 3300046523 | Ga0495644_0054123 | Ga0495644_0054123_122_955 | 274 |
| 1035 | 3300046524 | Ga0495648_0010886 | Ga0495648_0010886_2973_3806 | 274 |
| 1036 | 3300046526 | Ga0495666_0119220 | Ga0495666_0119220_178_1011 | 274 |
| 1037 | 3300046529 | Ga0495652_0056860 | Ga0495652_0056860_1533_2366 | 274 |
| 1038 | 3300046531 | Ga0495665_0144892 | Ga0495665_0144892_154_987 | 274 |
| 1039 | 3300046533 | Ga0495640_0033546 | Ga0495640_0033546_710_1543 | 274 |
| 1040 | 3300046535 | Ga0495586_0066111 | Ga0495586_0066111_445_1278 | 274 |
| 1041 | 3300046536 | Ga0495587_0148235 | Ga0495587_0148235_39_872 | 274 |
| 1042 | 3300046543 | Ga0495645_0212503 | Ga0495645_0212503_127_960 | 274 |
| 1043 | 3300046557 | Ga0495622_0012790 | Ga0495622_0012790_100_933 | 274 |
| 1044 | 3300046558 | Ga0495633_0012232 | Ga0495633_0012232_3712_4545 | 274 |
| 1045 | 3300046559 | Ga0495667_0048193 | Ga0495667_0048193_911_1744 | 274 |
| 1046 | 3300046615 | Ga0495656_0038466 | Ga0495656_0038466_399_1232 | 274 |
| 1047 | 3300046615 | Ga0495656_0050802 | Ga0495656_0050802_691_1566 | 274 |
| 1048 | 3300046615 | Ga0495656_0080625 | Ga0495656_0080625_365_1198 | 274 |
| 1049 | 3300046642 | Ga0495634_0085555 | Ga0495634_0085555_1047_1880 | 274 |
| 1050 | 3300046642 | Ga0495634_0087759 | Ga0495634_0087759_112_945 | 274 |
| 1051 | 3300046648 | Ga0495611_0164424 | Ga0495611_0164424_140_973 | 274 |
| 1052 | 3300046664 | Ga0495659_0040529 | Ga0495659_0040529_274_1107 | 274 |
| 1053 | 3300046675 | Ga0495657_0110574 | Ga0495657_0110574_535_1368 | 274 |
| 1054 | 3300046678 | Ga0495599_0085231 | Ga0495599_0085231_361_1194 | 274 |
| 1055 | 3300046683 | Ga0495658_0005335 | Ga0495658_0005335_3405_4238 | 274 |
| 1056 | 3300046684 | Ga0495669_0001797 | Ga0495669_0001797_2051_2962 | 274 |
| 1057 | 3300046684 | Ga0495669_0235895 | Ga0495669_0235895_11_844 | 274 |
| 1058 | 3300046689 | Ga0495613_0172601 | Ga0495613_0172601_179_1012 | 274 |
| 1059 | 3300046690 | Ga0495624_0031831 | Ga0495624_0031831_1043_1876 | 274 |
| 1060 | 3300046794 | Ga0495589_0215883 | Ga0495589_0215883_14_847 | 274 |
| 1061 | 3300046809 | Ga0495600_0054313 | Ga0495600_0054313_711_1544 | 274 |
| 1062 | 3300046809 | Ga0495600_0079839 | Ga0495600_0079839_413_1246 | 274 |
| 1063 | 3300047315 | Ga0495581_0050644 | Ga0495581_0050644_624_1457 | 274 |
| 1064 | 3300047317 | Ga0495604_0067701 | Ga0495604_0067701_372_1205 | 274 |
| 1065 | 3300047321 | Ga0495676_0072783 | Ga0495676_0072783_27_860 | 274 |
| 1066 | 3300047321 | Ga0495676_0086527 | Ga0495676_0086527_508_1341 | 274 |
| 1067 | 3300047322 | Ga0495680_0015838 | Ga0495680_0015838_572_1405 | 274 |
| 1068 | 3300047444 | Ga0495675_0084439 | Ga0495675_0084439_615_1448 | 274 |
| 1069 | 3300047471 | Ga0495684_0032231 | Ga0495684_0032231_2378_3211 | 274 |
| 1070 | 3300047471 | Ga0495684_0186385 | Ga0495684_0186385_382_1215 | 274 |
| 1071 | 3300048903 | Ga0496100_0120303 | Ga0496100_0120303_595_1506 | 274 |
| 1072 | 3300048903 | Ga0496100_0250974 | Ga0496100_0250974_28_861 | 274 |
| 1073 | 3300048904 | Ga0496101_0047905 | Ga0496101_0047905_2064_2897 | 274 |
| 1074 | 3300048904 | Ga0496101_0229894 | Ga0496101_0229894_279_1190 | 274 |
| 1075 | 3300048904 | Ga0496101_0372334 | Ga0496101_0372334_19_864 | 274 |
| 1076 | 3300048905 | Ga0496102_0009948 | Ga0496102_0009948_4686_5519 | 274 |
| 1077 | 3300048905 | Ga0496102_0082283 | Ga0496102_0082283_722_1555 | 274 |
| 1078 | 3300048905 | Ga0496102_0170653 | Ga0496102_0170653_186_1031 | 274 |
| 1079 | 3300048905 | Ga0496102_0342705 | Ga0496102_0342705_439_1272 | 274 |
| 1080 | 3300048906 | Ga0496103_0004098 | Ga0496103_0004098_3083_3916 | 274 |
| 1081 | 3300048906 | Ga0496103_0021611 | Ga0496103_0021611_584_1417 | 274 |
| 1082 | 3300048906 | Ga0496103_0189523 | Ga0496103_0189523_36_869 | 274 |
| 1083 | 3300048907 | Ga0496104_0018835 | Ga0496104_0018835_3861_4694 | 274 |
| 1084 | 3300048908 | Ga0496105_0001515 | Ga0496105_0001515_3585_4418 | 274 |
| 1085 | 3300048909 | Ga0496106_0001932 | Ga0496106_0001932_3778_4611 | 274 |
| 1086 | 3300048909 | Ga0496106_0122573 | Ga0496106_0122573_473_1318 | 274 |
| 1087 | 3300048909 | Ga0496106_0266501 | Ga0496106_0266501_417_1316 | 274 |
| 1088 | 3300048910 | Ga0496107_0033724 | Ga0496107_0033724_1672_2505 | 274 |
| 1089 | 3300048910 | Ga0496107_0116329 | Ga0496107_0116329_254_1099 | 274 |
| 1090 | 3300048910 | Ga0496107_0206472 | Ga0496107_0206472_396_1229 | 274 |
| 1091 | 3300048911 | Ga0496108_0001028 | Ga0496108_0001028_17037_17870 | 274 |
| 1092 | 3300048911 | Ga0496108_0038439 | Ga0496108_0038439_1858_2691 | 274 |
| 1093 | 3300048911 | Ga0496108_0168537 | Ga0496108_0168537_626_1471 | 274 |
| 1094 | 3300048912 | Ga0496109_0002430 | Ga0496109_0002430_12136_12969 | 274 |
| 1095 | 3300048912 | Ga0496109_0088619 | Ga0496109_0088619_797_1630 | 274 |
| 1096 | 3300048912 | Ga0496109_0107195 | Ga0496109_0107195_373_1206 | 274 |
| 1097 | 3300048913 | Ga0496110_0347488 | Ga0496110_0347488_129_962 | 274 |
| 1098 | 3300048914 | Ga0496111_0000436 | Ga0496111_0000436_6599_7432 | 274 |
| 1099 | 3300048915 | Ga0496112_0004518 | Ga0496112_0004518_473_1306 | 274 |
| 1100 | 3300048915 | Ga0496112_0060849 | Ga0496112_0060849_2225_3058 | 274 |
| 1101 | 3300048915 | Ga0496112_0198310 | Ga0496112_0198310_612_1457 | 274 |
| 1102 | 3300048916 | Ga0496113_0001905 | Ga0496113_0001905_4853_5686 | 274 |
| 1103 | 3300048916 | Ga0496113_0056320 | Ga0496113_0056320_1593_2426 | 274 |
| 1104 | 3300048916 | Ga0496113_0200118 | Ga0496113_0200118_485_1318 | 274 |
| 1105 | 3300048917 | Ga0496114_0102814 | Ga0496114_0102814_1065_1898 | 274 |
| 1106 | 3300048917 | Ga0496114_0112915 | Ga0496114_0112915_627_1460 | 274 |
| 1107 | 3300048917 | Ga0496114_0253607 | Ga0496114_0253607_100_1011 | 274 |
| 1108 | 3300048918 | Ga0496115_0073654 | Ga0496115_0073654_160_993 | 274 |
| 1109 | 3300048918 | Ga0496115_0112310 | Ga0496115_0112310_712_1623 | 274 |
| 1110 | 3300048920 | Ga0496117_0004621 | Ga0496117_0004621_799_1632 | 274 |
| 1111 | 3300048921 | Ga0496118_0001262 | Ga0496118_0001262_509_1342 | 274 |
| 1112 | 3300048921 | Ga0496118_0083141 | Ga0496118_0083141_883_1716 | 274 |
| 1113 | 3300048921 | Ga0496118_0109041 | Ga0496118_0109041_738_1571 | 274 |
| 1114 | 3300048922 | Ga0496119_0115828 | Ga0496119_0115828_611_1444 | 274 |
| 1115 | 3300048924 | Ga0496121_0000689 | Ga0496121_0000689_48781_49614 | 274 |
| 1116 | 3300048924 | Ga0496121_0056005 | Ga0496121_0056005_472_1305 | 274 |
| 1117 | 3300048924 | Ga0496121_0222243 | Ga0496121_0222243_218_1051 | 274 |
| 1118 | 3300048927 | Ga0496124_0005646 | Ga0496124_0005646_10242_11075 | 274 |
| 1119 | 3300048927 | Ga0496124_0014474 | Ga0496124_0014474_399_1232 | 274 |
| 1120 | 3300048927 | Ga0496124_0051872 | Ga0496124_0051872_1803_2636 | 274 |
| 1121 | 3300048928 | Ga0496125_0065286 | Ga0496125_0065286_1085_1918 | 274 |
| 1122 | 3300048929 | Ga0496126_0003243 | Ga0496126_0003243_13020_13853 | 274 |
| 1123 | 3300048929 | Ga0496126_0044004 | Ga0496126_0044004_3269_4102 | 274 |
| 1124 | 3300049459 | Ga0495678_088405 | Ga0495678_088405_25_858 | 274 |
| 1125 | 3300049570 | Ga0501033_0079101 | Ga0501033_0079101_302_1135 | 274 |
| 1126 | 3300049571 | Ga0501034_0373781 | Ga0501034_0373781_202_1035 | 274 |
| 1127 | 3300049574 | Ga0501038_0362468 | Ga0501038_0362468_13_846 | 274 |
| 1128 | 3300049576 | Ga0501040_0195246 | Ga0501040_0195246_524_1372 | 274 |
| 1129 | 3300049822 | Ga0501035_0015977 | Ga0501035_0015977_497_1330 | 274 |
| 1130 | 3300049823 | Ga0501044_0196826 | Ga0501044_0196826_799_1632 | 274 |
| 1131 | 3300050489 | nmdc:mga03683_21967_c1 | nmdc:mga03683_21967_c1_780_1628 | 274 |
| 1132 | 3300050489 | nmdc:mga03683_38137_c1 | nmdc:mga03683_38137_c1_88_921 | 274 |
| 1133 | 3300050490 | nmdc:mga03n38_1330_c1 | nmdc:mga03n38_1330_c1_6048_6881 | 274 |
| 1134 | 3300050491 | nmdc:mga00v17_11637_c1 | nmdc:mga00v17_11637_c1_1974_2807 | 274 |
| 1135 | 3300050491 | nmdc:mga00v17_391929_c1 | nmdc:mga00v17_391929_c1_17_850 | 274 |
| 1136 | 3300050492 | nmdc:mga0yw44_9147_c1 | nmdc:mga0yw44_9147_c1_2459_3292 | 274 |
| 1137 | 3300050494 | nmdc:mga06z11_13614_c1 | nmdc:mga06z11_13614_c1_2128_2961 | 274 |
| 1138 | 3300050494 | nmdc:mga06z11_186_c1 | nmdc:mga06z11_186_c1_4679_5512 | 274 |
| 1139 | 3300050495 | nmdc:mga04h51_58354_c1 | nmdc:mga04h51_58354_c1_13_846 | 274 |
| 1140 | 3300050495 | nmdc:mga04h51_778_c1 | nmdc:mga04h51_778_c1_5286_6119 | 274 |
| 1141 | 3300050496 | nmdc:mga07m45_117688_c1 | nmdc:mga07m45_117688_c1_272_1105 | 274 |
| 1142 | 3300050496 | nmdc:mga07m45_78381_c1 | nmdc:mga07m45_78381_c1_213_1046 | 274 |
| 1143 | 3300050507 | nmdc:mga05p37_42327_c1 | nmdc:mga05p37_42327_c1_1849_2694 | 274 |
| 1144 | 3300050507 | nmdc:mga05p37_50505_c1 | nmdc:mga05p37_50505_c1_2975_3808 | 274 |
| 1145 | 3300050509 | nmdc:mga0qj67_358758_c1 | nmdc:mga0qj67_358758_c1_281_1126 | 274 |
| 1146 | 3300050510 | nmdc:mga06r32_33861_c1 | nmdc:mga06r32_33861_c1_2149_2994 | 274 |
| 1147 | 3300050511 | nmdc:mga08y16_126369_c1 | nmdc:mga08y16_126369_c1_1643_2542 | 274 |
| 1148 | 3300050511 | nmdc:mga08y16_66137_c1 | nmdc:mga08y16_66137_c1_2906_3739 | 274 |
| 1149 | 3300050512 | nmdc:mga0n895_108270_c1 | nmdc:mga0n895_108270_c1_144_977 | 274 |
| 1150 | 3300050512 | nmdc:mga0n895_13911_c1 | nmdc:mga0n895_13911_c1_4816_5649 | 274 |
| 1151 | 3300050514 | nmdc:mga08x19_31667_c1 | nmdc:mga08x19_31667_c1_2005_2913 | 274 |
| 1152 | 3300050515 | nmdc:mga0a205_240939_c2 | nmdc:mga0a205_240939_c2_357_1190 | 274 |
| 1153 | 3300053077 | Ga0495601_0014089 | Ga0495601_0014089_1646_2479 | 274 |
| 1154 | 3300053077 | Ga0495601_0049720 | Ga0495601_0049720_482_1315 | 274 |
| 1155 | 3300053078 | Ga0495612_0004468 | Ga0495612_0004468_2033_2866 | 274 |
| 1156 | 3300053080 | Ga0500635_0135741 | Ga0500635_0135741_29_862 | 274 |
| 1157 | 3300053084 | Ga0495595_0014994 | Ga0495595_0014994_1555_2388 | 274 |
| 1158 | 3300053085 | Ga0495619_0014309 | Ga0495619_0014309_1431_2264 | 274 |
| 1159 | 3300053085 | Ga0495619_0148166 | Ga0495619_0148166_128_973 | 274 |
| 1160 | 3300053096 | Ga0500641_0024369 | Ga0500641_0024369_456_1358 | 274 |
| 1161 | 3300053096 | Ga0500641_0088013 | Ga0500641_0088013_370_1203 | 274 |
| 1162 | 3300053134 | Ga0500658_0073284 | Ga0500658_0073284_393_1226 | 274 |
| 1163 | 3300053134 | Ga0500658_0093262 | Ga0500658_0093262_46_879 | 274 |
| 1164 | 3300053163 | Ga0500639_121992 | Ga0500639_121992_16_849 | 274 |
| 1165 | 3300005545 | Ga0070695_100002588 | Ga0070695_1000025888 | 275 |
| 1166 | 3300005548 | Ga0070665_100089787 | Ga0070665_1000897875 | 275 |
| 1167 | 3300006177 | Ga0075362_10035038 | Ga0075362_100350383 | 275 |
| 1168 | 3300006353 | Ga0075370_10029757 | Ga0075370_100297572 | 275 |
| 1169 | 3300006852 | Ga0075433_10055263 | Ga0075433_100552634 | 275 |
| 1170 | 3300006871 | Ga0075434_100113871 | Ga0075434_1001138712 | 275 |
| 1171 | 3300009093 | Ga0105240_10236287 | Ga0105240_102362872 | 275 |
| 1172 | 3300009094 | Ga0111539_10037824 | Ga0111539_100378246 | 275 |
| 1173 | 3300009545 | Ga0105237_10141503 | Ga0105237_101415033 | 275 |
| 1174 | 3300010375 | Ga0105239_10151061 | Ga0105239_101510612 | 275 |
| 1175 | 3300017792 | Ga0163161_10269997 | Ga0163161_102699972 | 275 |
| 1176 | 3300025913 | Ga0207695_10017137 | Ga0207695_100171376 | 275 |
| 1177 | 3300028379 | Ga0268266_10192756 | Ga0268266_101927562 | 275 |
| 1178 | 3300035111 | Ga0373923_0010398 | Ga0373923_0010398_1979_2827 | 275 |
| 1179 | 3300035113 | Ga0373936_0016640 | Ga0373936_0016640_711_1547 | 275 |
| 1180 | 3300035116 | Ga0373945_0026901 | Ga0373945_0026901_1023_1859 | 275 |
| 1181 | 3300035118 | Ga0373954_0000659 | Ga0373954_0000659_7220_8068 | 275 |
| 1182 | 3300035118 | Ga0373954_0014721 | Ga0373954_0014721_2126_2962 | 275 |
| 1183 | 3300035119 | Ga0373956_0008072 | Ga0373956_0008072_2285_3133 | 275 |
| 1184 | 3300035120 | Ga0373957_0002330 | Ga0373957_0002330_3776_4624 | 275 |
| 1185 | 3300035170 | Ga0373943_0004594 | Ga0373943_0004594_1359_2195 | 275 |
| 1186 | 3300035172 | Ga0373955_0000335 | Ga0373955_0000335_7155_8003 | 275 |
| 1187 | 3300035172 | Ga0373955_0017724 | Ga0373955_0017724_94_930 | 275 |
| 1188 | 3300035692 | Ga0373935_0001283 | Ga0373935_0001283_3807_4643 | 275 |
| 1189 | 3300035695 | Ga0373927_0000515 | Ga0373927_0000515_3589_4425 | 275 |
| 1190 | 3300035725 | Ga0373947_0003063 | Ga0373947_0003063_4839_5675 | 275 |
| 1191 | 3300036401 | Ga0373937_0005938 | Ga0373937_0005938_8457_9305 | 275 |
| 1192 | 3300046454 | Ga0495592_0004136 | Ga0495592_0004136_588_1436 | 275 |
| 1193 | 3300046454 | Ga0495592_0023188 | Ga0495592_0023188_1583_2419 | 275 |
| 1194 | 3300046455 | Ga0495603_0000156 | Ga0495603_0000156_20949_21785 | 275 |
| 1195 | 3300046459 | Ga0495629_0000297 | Ga0495629_0000297_24209_25045 | 275 |
| 1196 | 3300046459 | Ga0495629_0002353 | Ga0495629_0002353_9977_10825 | 275 |
| 1197 | 3300046461 | Ga0495641_0003033 | Ga0495641_0003033_5538_6374 | 275 |
| 1198 | 3300046461 | Ga0495641_0031993 | Ga0495641_0031993_756_1634 | 275 |
| 1199 | 3300046463 | Ga0495653_0059547 | Ga0495653_0059547_447_1283 | 275 |
| 1200 | 3300046472 | Ga0495580_0004950 | Ga0495580_0004950_510_1346 | 275 |
| 1201 | 3300046473 | Ga0495582_0000087 | Ga0495582_0000087_22483_23319 | 275 |
| 1202 | 3300046475 | Ga0495639_0000153 | Ga0495639_0000153_24409_25245 | 275 |
| 1203 | 3300046476 | Ga0495662_0002946 | Ga0495662_0002946_3948_4784 | 275 |
| 1204 | 3300046477 | Ga0495664_0035984 | Ga0495664_0035984_1251_2087 | 275 |
| 1205 | 3300046499 | Ga0495594_0001275 | Ga0495594_0001275_5423_6259 | 275 |
| 1206 | 3300046499 | Ga0495594_0044076 | Ga0495594_0044076_1511_2389 | 275 |
| 1207 | 3300046511 | Ga0495608_0002817 | Ga0495608_0002817_10498_11346 | 275 |
| 1208 | 3300046514 | Ga0495618_0105972 | Ga0495618_0105972_86_922 | 275 |
| 1209 | 3300046516 | Ga0495628_0006351 | Ga0495628_0006351_2265_3113 | 275 |
| 1210 | 3300046516 | Ga0495628_0006427 | Ga0495628_0006427_815_1651 | 275 |
| 1211 | 3300046517 | Ga0495630_0000735 | Ga0495630_0000735_11937_12773 | 275 |
| 1212 | 3300046518 | Ga0495631_0083667 | Ga0495631_0083667_365_1243 | 275 |
| 1213 | 3300046520 | Ga0495637_0069026 | Ga0495637_0069026_238_1116 | 275 |
| 1214 | 3300046529 | Ga0495652_0003411 | Ga0495652_0003411_10239_11075 | 275 |
| 1215 | 3300046529 | Ga0495652_0021093 | Ga0495652_0021093_3056_3904 | 275 |
| 1216 | 3300046531 | Ga0495665_0000117 | Ga0495665_0000117_25118_25954 | 275 |
| 1217 | 3300046533 | Ga0495640_0002597 | Ga0495640_0002597_4612_5448 | 275 |
| 1218 | 3300046533 | Ga0495640_0004127 | Ga0495640_0004127_6046_6894 | 275 |
| 1219 | 3300046537 | Ga0495598_0067311 | Ga0495598_0067311_73_951 | 275 |
| 1220 | 3300046557 | Ga0495622_0001116 | Ga0495622_0001116_5959_6795 | 275 |
| 1221 | 3300046558 | Ga0495633_0018062 | Ga0495633_0018062_2577_3455 | 275 |
| 1222 | 3300046559 | Ga0495667_0003186 | Ga0495667_0003186_7197_8045 | 275 |
| 1223 | 3300046559 | Ga0495667_0009440 | Ga0495667_0009440_1335_2171 | 275 |
| 1224 | 3300046642 | Ga0495634_0035244 | Ga0495634_0035244_1301_2137 | 275 |
| 1225 | 3300046663 | Ga0495635_0004107 | Ga0495635_0004107_3906_4742 | 275 |
| 1226 | 3300046663 | Ga0495635_0004151 | Ga0495635_0004151_2078_2926 | 275 |
| 1227 | 3300046674 | Ga0495588_0015743 | Ga0495588_0015743_558_1394 | 275 |
| 1228 | 3300046675 | Ga0495657_0022202 | Ga0495657_0022202_848_1696 | 275 |
| 1229 | 3300046678 | Ga0495599_0002862 | Ga0495599_0002862_1381_2229 | 275 |
| 1230 | 3300046679 | Ga0495623_0004294 | Ga0495623_0004294_7686_8534 | 275 |
| 1231 | 3300046680 | Ga0495646_0007517 | Ga0495646_0007517_3777_4625 | 275 |
| 1232 | 3300046680 | Ga0495646_0012394 | Ga0495646_0012394_914_1750 | 275 |
| 1233 | 3300046681 | Ga0495647_0000365 | Ga0495647_0000365_10769_11605 | 275 |
| 1234 | 3300046683 | Ga0495658_0000644 | Ga0495658_0000644_3943_4779 | 275 |
| 1235 | 3300046683 | Ga0495658_0010016 | Ga0495658_0010016_3584_4462 | 275 |
| 1236 | 3300046689 | Ga0495613_0005220 | Ga0495613_0005220_3817_4653 | 275 |
| 1237 | 3300046689 | Ga0495613_0025843 | Ga0495613_0025843_1467_2315 | 275 |
| 1238 | 3300046690 | Ga0495624_0000668 | Ga0495624_0000668_1759_2595 | 275 |
| 1239 | 3300046809 | Ga0495600_0121829 | Ga0495600_0121829_220_1056 | 275 |
| 1240 | 3300047315 | Ga0495581_0042306 | Ga0495581_0042306_1029_1865 | 275 |
| 1241 | 3300047317 | Ga0495604_0005885 | Ga0495604_0005885_7545_8393 | 275 |
| 1242 | 3300047319 | Ga0495674_0000177 | Ga0495674_0000177_24217_25053 | 275 |
| 1243 | 3300047319 | Ga0495674_0019813 | Ga0495674_0019813_1900_2748 | 275 |
| 1244 | 3300047321 | Ga0495676_0034415 | Ga0495676_0034415_3275_4111 | 275 |
| 1245 | 3300047322 | Ga0495680_0027227 | Ga0495680_0027227_998_1846 | 275 |
| 1246 | 3300047471 | Ga0495684_0002187 | Ga0495684_0002187_9284_10120 | 275 |
| 1247 | 3300047471 | Ga0495684_0008299 | Ga0495684_0008299_720_1568 | 275 |
| 1248 | 3300047673 | Ga0495593_0000156 | Ga0495593_0000156_21039_21875 | 275 |
| 1249 | 3300047673 | Ga0495593_0001736 | Ga0495593_0001736_7146_7994 | 275 |
| 1250 | 3300048089 | Ga0495614_0015188 | Ga0495614_0015188_2448_3284 | 275 |
| 1251 | 3300048907 | Ga0496104_0520828 | Ga0496104_0520828_69_917 | 275 |
| 1252 | 3300048928 | Ga0496125_0000654 | Ga0496125_0000654_18024_18860 | 275 |
| 1253 | 3300048928 | Ga0496125_0002454 | Ga0496125_0002454_23003_23839 | 275 |
| 1254 | 3300048929 | Ga0496126_0037854 | Ga0496126_0037854_2220_3056 | 275 |
| 1255 | 3300049590 | Ga0501074_0272855 | Ga0501074_0272855_37_882 | 275 |
| 1256 | 3300049742 | Ga0501080_0264120 | Ga0501080_0264120_692_1537 | 275 |
| 1257 | 3300050496 | nmdc:mga07m45_21937_c1 | nmdc:mga07m45_21937_c1_1446_2288 | 275 |
| 1258 | 3300050509 | nmdc:mga0qj67_124016_c1 | nmdc:mga0qj67_124016_c1_413_1255 | 275 |
| 1259 | 3300050512 | nmdc:mga0n895_19291_c1 | nmdc:mga0n895_19291_c1_3569_4417 | 275 |
| 1260 | 3300050514 | nmdc:mga08x19_22_c1 | nmdc:mga08x19_22_c1_275093_275929 | 275 |
| 1261 | 3300050515 | nmdc:mga0a205_4562_c1 | nmdc:mga0a205_4562_c1_7709_8557 | 275 |
| 1262 | 3300053085 | Ga0495619_0002975 | Ga0495619_0002975_2960_3808 | 275 |
| 1263 | 3300006038 | Ga0075365_10037210 | Ga0075365_100372102 | 276 |
| 1264 | 3300006042 | Ga0075368_10008930 | Ga0075368_100089301 | 276 |
| 1265 | 3300006048 | Ga0075363_100085720 | Ga0075363_1000857202 | 276 |
| 1266 | 3300006051 | Ga0075364_10300634 | Ga0075364_103006342 | 276 |
| 1267 | 3300007788 | Ga0099795_10009692 | Ga0099795_100096922 | 276 |
| 1268 | 3300048903 | Ga0496100_0030002 | Ga0496100_0030002_667_1509 | 276 |
| 1269 | 3300048913 | Ga0496110_0109178 | Ga0496110_0109178_851_1693 | 276 |
| 1270 | 3300048918 | Ga0496115_0028337 | Ga0496115_0028337_2179_3021 | 276 |
| 1271 | 3300050494 | nmdc:mga06z11_127234_c1 | nmdc:mga06z11_127234_c1_103_951 | 276 |
| 1272 | 3300050495 | nmdc:mga04h51_21675_c1 | nmdc:mga04h51_21675_c1_920_1774 | 276 |
| 1273 | 3300053158 | Ga0500627_0017660 | Ga0500627_0017660_1595_2443 | 276 |
| 1274 | 3300031247 | Ga0265340_10061619 | Ga0265340_100616192 | 277 |
| 1275 | 3300031249 | Ga0265339_10012668 | Ga0265339_100126684 | 277 |
| 1276 | 3300035114 | Ga0373939_0002169 | Ga0373939_0002169_952_1860 | 277 |
| 1277 | 3300035691 | Ga0373931_0046874 | Ga0373931_0046874_1001_1909 | 277 |
| 1278 | iso_pu_bacteria | 2841760612 | 2841765951 | 277 |
| 1279 | iso_pu_bacteria | 2841911363 | 2841912404 | 277 |
| 1280 | iso_pu_bacteria | 2841917233 | 2841918159 | 277 |
| 1281 | iso_pu_bacteria | 2844104063 | 2844105717 | 277 |
| 1282 | iso_pu_bacteria | 2851246043 | 2851246073 | 277 |
| 1283 | iso_pu_bacteria | 8057529695 | 8057531723 | 277 |
| 1284 | 3300002987 | JGI25159J45721_1008904 | JGI25159J45721_10089044 | 281 |
| 1285 | 3300005262 | Ga0065165_1000209 | Ga0065165_1000209100 | 281 |
| 1286 | 3300025284 | Ga0209130_1000080 | Ga0209130_100008055 | 281 |
| 1287 | 3300025302 | Ga0207426_1005450 | Ga0207426_10054504 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5my5-assembly1.cif.gz_A | tungstate binding protein - tupa - from desulfovibrio alaskensis g20 | 0.9477 | 31 | 275 |
| 5my5-assembly1.cif.gz_A | tungstate binding protein - tupa - from desulfovibrio alaskensis g20 | 0.9256 | 31 | 275 |
| 3cvg-assembly1.cif.gz_A | crystal structure of a periplasmic putative metal binding protein | 0.8554 | 29 | 274 |
| 3cvg-assembly5.cif.gz_C | crystal structure of a periplasmic putative metal binding protein | 0.8542 | 87 | 274 |
| 3lr1-assembly1.cif.gz_A | the crystal structure of the tungstate abc transporter from geobacter sulfurreducens | 0.8192 | 30 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5my5A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9724 | 31 | 275 | 3.40.190.10 |
| 3muqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9625 | 31 | 260 | 3.40.190.10 |
| 3kn3C01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9587 | 32 | 107 | 3.40.190.10 |
| 5my5A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9448 | 31 | 275 | 3.40.190.10 |
| 3muqB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9273 | 110 | 225 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y5EAF9-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9797 | 33 | 275 |
|
| AF-A0A3B8SWU7-F1-model_v4 | Sulfate transporter | 0.9786 | 45 | 275 |
|
| AF-A0A2D7SJZ4-F1-model_v4 | Sulfate transporter | 0.9753 | 28 | 275 |
|
| AF-C0N6B9-F1-model_v4 | PBP domain-containing protein | 0.9715 | 31 | 278 |
|
| AF-A0A3B0RCL9-F1-model_v4 | Tungstate ABC transporter, substrate-binding protein | 0.9697 | 23 | 247 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar