F492594

General Info

Members Datasets Scaffolds Average Seq Length
1287 487 1245 275

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10222468|Ga0105249_102224682
Length 303
Sequence MIRKSGYRFSEKIMLKQNGRTQMKMLTRRLLMAAAASLAFTGCAIAQDKSQEKSILVASTTSTQDSGLFGHILPMFKAKIGIDVKVVAQGTGQALDTARRGDADVVFVHAKPAEEKFLSEGFGVKRYPVMYNDFVLIGPNSDPAGIKGSKDITAALAAIKAKGADFISRGDKSGTHQAELNLWKVAGIDIAKDKGPWYKEIGQGMGAALNTASASNAYVLADRGTWLSFKNRGDLGIAVEGDKRLFNQYGVMLVNPEKHPSVKKDFGRQFIDWLVSSEGQKAIADYKINGEQLFYPNASDSGA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
9 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
10 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
11 2643221651 Afipia sp. Root123D2 Isolate Unclassified
12 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
13 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
14 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
15 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
16 2791355199
17 2841760612 Bosea sp. Tri-49 Isolate Nodule
18 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
19 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
20 2844104063 Bosea sp. Tri-39 Isolate Nodule
21 2851246043 Bosea sp. Tri-54 Isolate Nodule
22 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
23 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
24 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
25 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
26 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
27 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
28 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
29 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
30 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
31 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
32 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
33 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
34 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
35 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
160 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
240 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
241 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
244 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
248 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
249 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
266 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
269 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
272 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
273 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
300 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
301 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
302 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
303 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
304 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
305 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
306 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
317 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
318 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
319 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
320 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
338 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
348 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
349 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
350 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
366 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
367 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
368 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
369 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
370 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
371 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
372 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
373 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
374 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
375 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
379 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
380 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
381 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
382 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
383 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
384 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
385 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
386 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
390 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
391 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
392 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
393 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
394 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
395 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
400 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
401 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
402 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
406 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
407 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
408 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
423 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
429 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
430 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
431 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
434 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
437 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
438 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
439 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
440 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
441 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
442 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
443 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
444 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
445 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
446 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
447 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
448 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
449 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
450 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
451 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
452 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
453 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
454 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
455 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
456 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
457 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
458 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
459 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
460 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
461 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
464 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
467 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
468 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
469 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
470 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
471 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
472 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
473 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
474 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
475 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
476 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
477 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
478 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
479 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
480 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
481 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
482 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
483 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
484 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
485 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
486 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
487 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 0
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.7
Nodule 1.94
Rhizoplane 7.23
Rhizosphere 75.06
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1008904 3300002987 Bacteria 2703
2 JGI25165J46597_1000033 3300003214 Bacteria 293030
3 JGI25165J46597_1000087 3300003214 Bacteria 170335
4 JGI25153J46596_10001537 3300003215 Bacteria 13698
5 JGI25404J52841_10003411 3300003659 Bacteria 3138
6 JGI25404J52841_10028431 3300003659 Bacteria 1200
7 Ga0055542_1009052 3300003762 Bacteria 1901
8 Ga0065165_1000209 3300005262 Bacteria 101834
9 Ga0065715_10157741 3300005293 Bacteria 1660
10 Ga0070683_100191712 3300005329 Bacteria 1941
11 Ga0070683_100411014 3300005329 Bacteria 1291
12 Ga0070690_100039011 3300005330 Bacteria 2999
13 Ga0070670_100018595 3300005331 Bacteria 5955
14 Ga0070670_100622686 3300005331 Bacteria 967
15 Ga0068869_100017122 3300005334 Bacteria 4905
16 Ga0068869_100175363 3300005334 Bacteria 1677
17 Ga0070666_10014844 3300005335 Bacteria 4963
18 Ga0070666_10030114 3300005335 Bacteria 3574
19 Ga0070666_10242110 3300005335 Bacteria 1276
20 Ga0070680_100020280 3300005336 Bacteria 5275
21 Ga0070680_100020948 3300005336 Bacteria 5191
22 Ga0070680_100022812 3300005336 Bacteria 4986
23 Ga0070680_100329092 3300005336 Bacteria 1297
24 Ga0070682_100144487 3300005337 Bacteria 1625
25 Ga0070682_100182740 3300005337 Bacteria 1466
26 Ga0068868_100005715 3300005338 Bacteria 8756
27 Ga0068868_100007157 3300005338 Bacteria 7929
28 Ga0068868_100007160 3300005338 Bacteria 7928
29 Ga0070660_100013688 3300005339 Bacteria 5829
30 Ga0070660_100016043 3300005339 Bacteria 5427
31 Ga0070689_100141679 3300005340 Bacteria 1934
32 Ga0070687_100297431 3300005343 Bacteria 1023
33 Ga0070661_100101157 3300005344 Bacteria 2144
34 Ga0070692_10198783 3300005345 Bacteria 1173
35 Ga0070668_100106151 3300005347 Bacteria 2231
36 Ga0070668_100126362 3300005347 Bacteria 2048
37 Ga0070668_100141257 3300005347 Bacteria 1940
38 Ga0070669_100162443 3300005353 Bacteria 1736
39 Ga0070675_100001562 3300005354 Bacteria 16925
40 Ga0070675_100136591 3300005354 Bacteria 2093
41 Ga0070675_100294084 3300005354 Bacteria 1429
42 Ga0070671_100001109 3300005355 Bacteria 19956
43 Ga0070671_100051865 3300005355 Bacteria 3411
44 Ga0070671_100120177 3300005355 Bacteria 2210
45 Ga0070671_100452947 3300005355 Bacteria 1101
46 Ga0070674_100163784 3300005356 Bacteria 1689
47 Ga0070674_100304584 3300005356 Bacteria 1271
48 Ga0070674_100342737 3300005356 Bacteria 1204
49 Ga0070673_100071020 3300005364 Bacteria 2796
50 Ga0070673_100860993 3300005364 Bacteria 839
51 Ga0070688_100010378 3300005365 Bacteria 5134
52 Ga0070688_100089020 3300005365 Bacteria 2014
53 Ga0070688_100201784 3300005365 Bacteria 1392
54 Ga0070659_100055929 3300005366 Bacteria 3110
55 Ga0070703_10004707 3300005406 Bacteria 3817
56 Ga0070714_100080871 3300005435 Bacteria 2828
57 Ga0070714_100130067 3300005435 Bacteria 2249
58 Ga0070713_100007640 3300005436 Bacteria 7610
59 Ga0070713_100289289 3300005436 Bacteria 1505
60 Ga0070713_100339479 3300005436 Bacteria 1391
61 Ga0070710_10038211 3300005437 Bacteria 2635
62 Ga0070701_10076488 3300005438 Bacteria 1802
63 Ga0070711_100245935 3300005439 Bacteria 1401
64 Ga0070711_100404754 3300005439 Bacteria 1108
65 Ga0070705_100000025 3300005440 Bacteria 79976
66 Ga0070705_100075186 3300005440 Bacteria 2056
67 Ga0070694_100002659 3300005444 Bacteria 10574
68 Ga0070694_100039128 3300005444 Bacteria 3155
69 Ga0070694_100096498 3300005444 Bacteria 2084
70 Ga0070663_100021199 3300005455 Bacteria 4318
71 Ga0070663_100028448 3300005455 Bacteria 3805
72 Ga0070663_100048448 3300005455 Bacteria 3013
73 Ga0070663_100116047 3300005455 Bacteria 2017
74 Ga0070663_100263241 3300005455 Bacteria 1368
75 Ga0070678_100001839 3300005456 Bacteria 11456
76 Ga0070678_100020180 3300005456 Bacteria 4367
77 Ga0070678_100116621 3300005456 Bacteria 2098
78 Ga0070678_100390470 3300005456 Bacteria 1206
79 Ga0070662_100041616 3300005457 Bacteria 3279
80 Ga0070662_100158126 3300005457 Bacteria 1770
81 Ga0070662_100271656 3300005457 Bacteria 1369
82 Ga0070681_10003583 3300005458 Bacteria 14563
83 Ga0070681_10019283 3300005458 Bacteria 6824
84 Ga0070681_10020454 3300005458 Bacteria 6634
85 Ga0070706_100065025 3300005467 Bacteria 3372
86 Ga0070706_100129470 3300005467 Bacteria 2355
87 Ga0070707_100181967 3300005468 Bacteria 2049
88 Ga0070698_100081539 3300005471 Bacteria 3229
89 Ga0070698_100355433 3300005471 Bacteria 1397
90 Ga0070698_100627416 3300005471 Bacteria 1016
91 Ga0070699_100005455 3300005518 Bacteria 11149
92 Ga0070679_100017206 3300005530 Bacteria 6992
93 Ga0070679_100055345 3300005530 Bacteria 3950
94 Ga0070679_100091499 3300005530 Bacteria 3030
95 Ga0070679_100151366 3300005530 Bacteria 2296
96 Ga0070679_100497797 3300005530 Bacteria 1163
97 Ga0070684_100502230 3300005535 Bacteria 1123
98 Ga0070697_100039826 3300005536 Bacteria 3801
99 Ga0068853_100040297 3300005539 Bacteria 3985
100 Ga0068853_100078703 3300005539 Bacteria 2881
101 Ga0070686_100029775 3300005544 Bacteria 3325
102 Ga0070686_100067129 3300005544 Bacteria 2335
103 Ga0070695_100001562 3300005545 Bacteria 12784
104 Ga0070695_100002588 3300005545 Bacteria 10446
105 Ga0070695_100042426 3300005545 Bacteria 2888
106 Ga0070696_100006938 3300005546 Bacteria 7562
107 Ga0070696_100269342 3300005546 Bacteria 1294
108 Ga0070693_100015729 3300005547 Bacteria 3901
109 Ga0070693_100164039 3300005547 Bacteria 1418
110 Ga0070665_100017279 3300005548 Bacteria 7239
111 Ga0070665_100036690 3300005548 Bacteria 4929
112 Ga0070665_100060269 3300005548 Bacteria 3804
113 Ga0070665_100060631 3300005548 Bacteria 3792
114 Ga0070665_100089787 3300005548 Bacteria 3079
115 Ga0070665_100105910 3300005548 Bacteria 2814
116 Ga0070665_100115492 3300005548 Bacteria 2687
117 Ga0070665_100136512 3300005548 Bacteria 2456
118 Ga0068855_100021611 3300005563 Bacteria 7718
119 Ga0068855_100154201 3300005563 Bacteria 2611
120 Ga0068855_100342016 3300005563 Bacteria 1649
121 Ga0068855_100837186 3300005563 Bacteria 976
122 Ga0070664_100176017 3300005564 Bacteria 1899
123 Ga0070664_100298355 3300005564 Bacteria 1456
124 Ga0068857_100019837 3300005577 Bacteria 5907
125 Ga0068857_100055694 3300005577 Bacteria 3509
126 Ga0068857_100063891 3300005577 Bacteria 3272
127 Ga0068857_100182900 3300005577 Bacteria 1908
128 Ga0068857_100264315 3300005577 Bacteria 1580
129 Ga0068856_100021308 3300005614 Bacteria 6298
130 Ga0068856_100381812 3300005614 Bacteria 1428
131 Ga0068856_100670610 3300005614 Bacteria 1057
132 Ga0068852_100027942 3300005616 Bacteria 4607
133 Ga0068852_100040460 3300005616 Bacteria 3933
134 Ga0068852_100053703 3300005616 Bacteria 3470
135 Ga0068859_100001168 3300005617 Bacteria 26848
136 Ga0068859_100004047 3300005617 Bacteria 14944
137 Ga0068859_100241285 3300005617 Bacteria 1896
138 Ga0068859_100264911 3300005617 Bacteria 1810
139 Ga0068864_100002145 3300005618 Bacteria 16304
140 Ga0068864_100013439 3300005618 Bacteria 6788
141 Ga0068864_100025263 3300005618 Bacteria 5001
142 Ga0068864_100209501 3300005618 Bacteria 1794
143 Ga0068864_100298750 3300005618 Bacteria 1507
144 Ga0068866_10092115 3300005718 Bacteria 1653
145 Ga0068861_100013208 3300005719 Bacteria 5777
146 Ga0068861_100322267 3300005719 Bacteria 1346
147 Ga0068851_10011125 3300005834 Bacteria 4214
148 Ga0068851_10013505 3300005834 Bacteria 3866
149 Ga0068870_10030478 3300005840 Bacteria 2726
150 Ga0068870_10072449 3300005840 Bacteria 1882
151 Ga0068863_100021798 3300005841 Bacteria 6114
152 Ga0068863_100844381 3300005841 Bacteria 914
153 Ga0068858_100001027 3300005842 Bacteria 28804
154 Ga0068858_100079726 3300005842 Bacteria 3042
155 Ga0068858_100232239 3300005842 Bacteria 1749
156 Ga0068858_100581983 3300005842 Bacteria 1085
157 Ga0068860_100000277 3300005843 Bacteria 73951
158 Ga0068860_100125995 3300005843 Bacteria 2455
159 Ga0068860_100202794 3300005843 Bacteria 1922
160 Ga0068862_100002691 3300005844 Bacteria 15621
161 Ga0068862_100034967 3300005844 Bacteria 4253
162 Ga0068862_100062761 3300005844 Bacteria 3196
163 Ga0068862_100191733 3300005844 Bacteria 1839
164 Ga0068862_100668954 3300005844 Bacteria 1003
165 Ga0081455_10006927 3300005937 Bacteria 12057
166 Ga0081455_10010133 3300005937 Bacteria 9603
167 Ga0081455_10048471 3300005937 Bacteria 3670
168 Ga0081455_10067232 3300005937 Bacteria 2987
169 Ga0081455_10074531 3300005937 Bacteria 2803
170 Ga0081455_10173848 3300005937 Bacteria 1637
171 Ga0081538_10011066 3300005981 Bacteria 7336
172 Ga0081538_10013652 3300005981 Bacteria 6421
173 Ga0081540_1000948 3300005983 Bacteria 26149
174 Ga0081540_1001030 3300005983 Bacteria 24972
175 Ga0081540_1001133 3300005983 Bacteria 23567
176 Ga0081540_1004138 3300005983 Bacteria 11189
177 Ga0081540_1007687 3300005983 Bacteria 7643
178 Ga0081540_1009201 3300005983 Bacteria 6815
179 Ga0081540_1013951 3300005983 Bacteria 5186
180 Ga0081540_1035627 3300005983 Bacteria 2665
181 Ga0081540_1090369 3300005983 Bacteria 1348
182 Ga0081540_1098779 3300005983 Bacteria 1263
183 Ga0081539_10089918 3300005985 Bacteria 1589
184 Ga0070717_10055084 3300006028 Bacteria 3280
185 Ga0070717_10075229 3300006028 Bacteria 2824
186 Ga0070717_10573725 3300006028 Bacteria 1022
187 Ga0075365_10037210 3300006038 Bacteria 3158
188 Ga0075365_10081986 3300006038 Bacteria 2186
189 Ga0075365_10097868 3300006038 Bacteria 2006
190 Ga0075365_10289724 3300006038 Bacteria 1152
191 Ga0075368_10007748 3300006042 Bacteria 3803
192 Ga0075368_10008930 3300006042 Bacteria 3593
193 Ga0075368_10011042 3300006042 Bacteria 3280
194 Ga0075363_100000141 3300006048 Bacteria 17707
195 Ga0075363_100010581 3300006048 Bacteria 4388
196 Ga0075363_100017455 3300006048 Bacteria 3560
197 Ga0075363_100018089 3300006048 Bacteria 3505
198 Ga0075363_100085720 3300006048 Bacteria 1728
199 Ga0075363_100117604 3300006048 Bacteria 1482
200 Ga0075364_10014811 3300006051 Bacteria 4824
201 Ga0075364_10149608 3300006051 Bacteria 1573
202 Ga0075364_10300634 3300006051 Bacteria 1092
203 Ga0075364_10306092 3300006051 Bacteria 1082
204 Ga0070716_100073068 3300006173 Bacteria 2022
205 Ga0070712_100035165 3300006175 Bacteria 3400
206 Ga0070712_100073137 3300006175 Bacteria 2458
207 Ga0070712_100097031 3300006175 Bacteria 2171
208 Ga0070712_100105268 3300006175 Bacteria 2095
209 Ga0070712_100136565 3300006175 Bacteria 1865
210 Ga0075362_10017898 3300006177 Bacteria 2926
211 Ga0075362_10022640 3300006177 Bacteria 2650
212 Ga0075362_10024000 3300006177 Bacteria 2584
213 Ga0075362_10035038 3300006177 Bacteria 2190
214 Ga0075362_10035505 3300006177 Bacteria 2176
215 Ga0075362_10049476 3300006177 Bacteria 1877
216 Ga0075362_10157868 3300006177 Bacteria 1091
217 Ga0075367_10001014 3300006178 Bacteria 11543
218 Ga0075367_10021428 3300006178 Bacteria 3611
219 Ga0075367_10054935 3300006178 Bacteria 2362
220 Ga0075367_10070956 3300006178 Bacteria 2095
221 Ga0075369_10015863 3300006186 Bacteria 3031
222 Ga0075369_10058565 3300006186 Bacteria 1677
223 Ga0075366_10001716 3300006195 Bacteria 11020
224 Ga0075366_10012370 3300006195 Bacteria 4840
225 Ga0075366_10035333 3300006195 Bacteria 2946
226 Ga0075366_10041040 3300006195 Bacteria 2738
227 Ga0075366_10143419 3300006195 Bacteria 1445
228 Ga0097621_100006676 3300006237 Bacteria 8199
229 Ga0097621_100079744 3300006237 Bacteria 2722
230 Ga0097621_100174536 3300006237 Bacteria 1854
231 Ga0097621_100402810 3300006237 Bacteria 1225
232 Ga0075370_10016088 3300006353 Bacteria 4020
233 Ga0075370_10020374 3300006353 Bacteria 3624
234 Ga0075370_10025265 3300006353 Bacteria 3284
235 Ga0075370_10029757 3300006353 Bacteria 3043
236 Ga0075370_10032929 3300006353 Bacteria 2900
237 Ga0068871_100001655 3300006358 Bacteria 14988
238 Ga0075428_100013546 3300006844 Bacteria 9079
239 Ga0075428_100029097 3300006844 Bacteria 6113
240 Ga0075428_100043811 3300006844 Bacteria 4919
241 Ga0075428_100129570 3300006844 Bacteria 2745
242 Ga0075430_100189206 3300006846 Bacteria 1711
243 Ga0075430_100247339 3300006846 Bacteria 1478
244 Ga0075431_100060089 3300006847 Bacteria 3922
245 Ga0075431_100098882 3300006847 Bacteria 3011
246 Ga0075431_100531924 3300006847 Bacteria 1164
247 Ga0075433_10055263 3300006852 Bacteria 3465
248 Ga0075433_10378537 3300006852 Bacteria 1250
249 Ga0075434_100028848 3300006871 Bacteria 5458
250 Ga0075434_100113871 3300006871 Bacteria 2717
251 Ga0075434_100149486 3300006871 Bacteria 2356
252 Ga0075429_100008549 3300006880 Bacteria 8904
253 Ga0075429_100573423 3300006880 Bacteria 989
254 Ga0068865_100121251 3300006881 Bacteria 1945
255 Ga0097620_100001168 3300006931 Bacteria 26848
256 Ga0097620_100004047 3300006931 Bacteria 14944
257 Ga0097620_100241287 3300006931 Bacteria 1896
258 Ga0097620_100264898 3300006931 Bacteria 1810
259 Ga0075435_100265293 3300007076 Bacteria 1464
260 Ga0099794_10003694 3300007265 Bacteria 5888
261 Ga0099794_10026848 3300007265 Bacteria 2665
262 Ga0099795_10009230 3300007788 Bacteria 2852
263 Ga0099795_10009692 3300007788 Bacteria 2805
264 Ga0099795_10010883 3300007788 Bacteria 2697
265 Ga0099795_10074455 3300007788 Bacteria 1287
266 Ga0105250_10089165 3300009092 Bacteria 1253
267 Ga0105240_10093755 3300009093 Bacteria 3664
268 Ga0105240_10236287 3300009093 Bacteria 2121
269 Ga0111539_10032652 3300009094 Bacteria 6321
270 Ga0111539_10037824 3300009094 Bacteria 5823
271 Ga0111539_10059271 3300009094 Bacteria 4540
272 Ga0111539_10468757 3300009094 Bacteria 1466
273 Ga0105245_10008002 3300009098 Bacteria 9245
274 Ga0105245_10101824 3300009098 Bacteria 2659
275 Ga0105245_10136801 3300009098 Bacteria 2303
276 Ga0105245_10214103 3300009098 Bacteria 1856
277 Ga0105245_10388880 3300009098 Bacteria 1391
278 Ga0105245_10879512 3300009098 Bacteria 937
279 Ga0105247_10043195 3300009101 Bacteria 2761
280 Ga0105247_10252945 3300009101 Bacteria 1205
281 Ga0114129_10061881 3300009147 Bacteria 5231
282 Ga0114129_10079079 3300009147 Bacteria 4572
283 Ga0114129_10104178 3300009147 Bacteria 3921
284 Ga0114129_10220299 3300009147 Bacteria 2560
285 Ga0114129_10390310 3300009147 Bacteria 1836
286 Ga0114129_10525711 3300009147 Bacteria 1542
287 Ga0105243_10773495 3300009148 Bacteria 943
288 Ga0105241_10188416 3300009174 Bacteria 1716
289 Ga0105242_10035577 3300009176 Bacteria 3993
290 Ga0105242_10246244 3300009176 Bacteria 1609
291 Ga0105248_10009206 3300009177 Bacteria 10865
292 Ga0105248_10155990 3300009177 Bacteria 2576
293 Ga0105248_10356426 3300009177 Bacteria 1647
294 Ga0105237_10008069 3300009545 Bacteria 11447
295 Ga0105237_10028364 3300009545 Bacteria 5703
296 Ga0105237_10141503 3300009545 Bacteria 2400
297 Ga0105238_10048532 3300009551 Bacteria 4278
298 Ga0105238_10059815 3300009551 Bacteria 3816
299 Ga0105238_10082285 3300009551 Bacteria 3209
300 Ga0105249_10000605 3300009553 Bacteria 32703
301 Ga0105249_10003429 3300009553 Bacteria 13728
302 Ga0105249_10222468 3300009553 Bacteria 1858
303 Ga0105249_10519592 3300009553 Bacteria 1238
304 Ga0099796_10051530 3300010159 Bacteria 1430
305 Ga0105239_10038265 3300010375 Bacteria 5257
306 Ga0105239_10151061 3300010375 Bacteria 2592
307 Ga0105239_10216339 3300010375 Bacteria 2148
308 Ga0105239_10236387 3300010375 Bacteria 2051
309 Ga0105239_10331930 3300010375 Bacteria 1715
310 Ga0105239_10342245 3300010375 Bacteria 1688
311 Ga0105239_10432352 3300010375 Bacteria 1492
312 Ga0105246_10010454 3300011119 Bacteria 5744
313 Ga0157371_10032500 3300013102 Bacteria 3754
314 Ga0157370_10206548 3300013104 Bacteria 1821
315 Ga0157370_10222583 3300013104 Bacteria 1748
316 Ga0157370_10346516 3300013104 Bacteria 1369
317 Ga0157369_10036010 3300013105 Bacteria 5425
318 Ga0157374_10009863 3300013296 Bacteria 8198
319 Ga0157374_10075314 3300013296 Bacteria 3189
320 Ga0157374_10159069 3300013296 Bacteria 2200
321 Ga0157378_10083134 3300013297 Bacteria 2897
322 Ga0157378_10224932 3300013297 Bacteria 1785
323 Ga0157378_10312879 3300013297 Bacteria 1523
324 Ga0157378_10328021 3300013297 Bacteria 1489
325 Ga0163162_10050519 3300013306 Bacteria 4170
326 Ga0163162_10279533 3300013306 Bacteria 1801
327 Ga0157375_10006361 3300013308 Bacteria 10295
328 Ga0157375_10342272 3300013308 Bacteria 1661
329 Ga0157375_10809922 3300013308 Bacteria 1085
330 Ga0163163_10010304 3300014325 Bacteria 8401
331 Ga0163163_10052924 3300014325 Bacteria 4007
332 Ga0163163_10079530 3300014325 Bacteria 3277
333 Ga0157379_10594393 3300014968 Bacteria 1033
334 Ga0157376_10006589 3300014969 Bacteria 8217
335 Ga0157376_10147314 3300014969 Bacteria 2119
336 Ga0163161_10174938 3300017792 Bacteria 1643
337 Ga0163161_10269997 3300017792 Bacteria 1331
338 Ga0213872_10012811 3300021361 Bacteria 3936
339 Ga0213872_10045180 3300021361 Bacteria 2004
340 Ga0213874_10039268 3300021377 Bacteria 1409
341 Ga0213876_10075200 3300021384 Bacteria 1784
342 Ga0213875_10007330 3300021388 Bacteria 5703
343 Ga0209677_100384 3300025253 Bacteria 27031
344 Ga0209148_1000634 3300025254 Bacteria 30929
345 Ga0209233_1000027 3300025261 Bacteria 652089
346 Ga0209233_1000823 3300025261 Bacteria 13758
347 Ga0209455_1001165 3300025272 Bacteria 12657
348 Ga0209130_1000080 3300025284 Bacteria 166684
349 Ga0209758_1000257 3300025297 Bacteria 106321
350 Ga0209758_1020356 3300025297 Bacteria 3143
351 Ga0209758_1029534 3300025297 Bacteria 2290
352 Ga0209256_1000282 3300025299 Bacteria 89402
353 Ga0207426_1005450 3300025302 Bacteria 5804
354 Ga0207426_1017876 3300025302 Bacteria 2511
355 Ga0207697_10055877 3300025315 Bacteria 1637
356 Ga0207656_10034197 3300025321 Bacteria 2121
357 Ga0207653_10007423 3300025885 Bacteria 3418
358 Ga0207692_10012694 3300025898 Bacteria 3626
359 Ga0207692_10050940 3300025898 Bacteria 2096
360 Ga0207710_10053772 3300025900 Bacteria 1812
361 Ga0207688_10006216 3300025901 Bacteria 6495
362 Ga0207688_10031618 3300025901 Bacteria 2923
363 Ga0207688_10141219 3300025901 Bacteria 1417
364 Ga0207680_10004135 3300025903 Bacteria 6869
365 Ga0207680_10062751 3300025903 Bacteria 2272
366 Ga0207699_10010856 3300025906 Bacteria 4587
367 Ga0207643_10005792 3300025908 Bacteria 6604
368 Ga0207643_10183727 3300025908 Bacteria 1266
369 Ga0207684_10065073 3300025910 Bacteria 3096
370 Ga0207684_10094446 3300025910 Bacteria 2551
371 Ga0207654_10008079 3300025911 Bacteria 5304
372 Ga0207654_10092864 3300025911 Bacteria 1844
373 Ga0207707_10000173 3300025912 Bacteria 67122
374 Ga0207707_10013854 3300025912 Bacteria 7032
375 Ga0207707_10017551 3300025912 Bacteria 6242
376 Ga0207695_10017137 3300025913 Bacteria 8444
377 Ga0207671_10008698 3300025914 Bacteria 8568
378 Ga0207671_10031634 3300025914 Bacteria 3943
379 Ga0207671_10031871 3300025914 Bacteria 3925
380 Ga0207671_10616011 3300025914 Bacteria 865
381 Ga0207693_10024429 3300025915 Bacteria 4795
382 Ga0207693_10029456 3300025915 Bacteria 4336
383 Ga0207693_10052868 3300025915 Bacteria 3186
384 Ga0207693_10072525 3300025915 Bacteria 2695
385 Ga0207693_10147439 3300025915 Bacteria 1850
386 Ga0207693_10160657 3300025915 Bacteria 1767
387 Ga0207693_10189600 3300025915 Bacteria 1618
388 Ga0207693_10286642 3300025915 Bacteria 1290
389 Ga0207660_10001377 3300025917 Bacteria 16302
390 Ga0207660_10026034 3300025917 Bacteria 3979
391 Ga0207660_10084621 3300025917 Bacteria 2338
392 Ga0207657_10001946 3300025919 Bacteria 22297
393 Ga0207657_10093213 3300025919 Bacteria 2509
394 Ga0207657_10131176 3300025919 Bacteria 2054
395 Ga0207649_10162341 3300025920 Bacteria 1549
396 Ga0207649_10263469 3300025920 Bacteria 1246
397 Ga0207652_10015359 3300025921 Bacteria 6218
398 Ga0207652_10026152 3300025921 Bacteria 4858
399 Ga0207652_10067896 3300025921 Bacteria 3092
400 Ga0207652_10139651 3300025921 Bacteria 2166
401 Ga0207652_10297946 3300025921 Bacteria 1455
402 Ga0207652_10321879 3300025921 Bacteria 1396
403 Ga0207646_10064179 3300025922 Bacteria 3278
404 Ga0207646_10151434 3300025922 Bacteria 2092
405 Ga0207694_10195681 3300025924 Bacteria 1644
406 Ga0207650_10042538 3300025925 Bacteria 3333
407 Ga0207650_10293599 3300025925 Bacteria 1326
408 Ga0207659_10001153 3300025926 Bacteria 15743
409 Ga0207659_10097093 3300025926 Bacteria 2213
410 Ga0207659_10256933 3300025926 Bacteria 1420
411 Ga0207687_10005525 3300025927 Bacteria 8362
412 Ga0207687_10048589 3300025927 Bacteria 2947
413 Ga0207687_10359117 3300025927 Bacteria 1189
414 Ga0207700_10026543 3300025928 Bacteria 4040
415 Ga0207700_10123458 3300025928 Bacteria 2103
416 Ga0207700_10154525 3300025928 Bacteria 1900
417 Ga0207700_10159266 3300025928 Bacteria 1873
418 Ga0207700_10183102 3300025928 Bacteria 1756
419 Ga0207664_10004269 3300025929 Bacteria 9672
420 Ga0207664_10216863 3300025929 Bacteria 1658
421 Ga0207644_10002964 3300025931 Bacteria 10935
422 Ga0207644_10275051 3300025931 Bacteria 1351
423 Ga0207690_10032618 3300025932 Bacteria 3343
424 Ga0207690_10244041 3300025932 Bacteria 1385
425 Ga0207706_10475257 3300025933 Bacteria 1080
426 Ga0207686_10023414 3300025934 Bacteria 3568
427 Ga0207686_10054687 3300025934 Bacteria 2501
428 Ga0207686_10218937 3300025934 Bacteria 1373
429 Ga0207709_10041560 3300025935 Bacteria 2760
430 Ga0207670_10207029 3300025936 Bacteria 1493
431 Ga0207669_10028432 3300025937 Bacteria 3076
432 Ga0207669_10129051 3300025937 Bacteria 1733
433 Ga0207669_10196220 3300025937 Bacteria 1461
434 Ga0207669_10429201 3300025937 Bacteria 1042
435 Ga0207704_10009866 3300025938 Bacteria 4628
436 Ga0207665_10015911 3300025939 Bacteria 4938
437 Ga0207665_10086816 3300025939 Bacteria 2162
438 Ga0207665_10173940 3300025939 Bacteria 1556
439 Ga0207665_10240936 3300025939 Bacteria 1332
440 Ga0207691_10021052 3300025940 Bacteria 6162
441 Ga0207691_10061758 3300025940 Bacteria 3403
442 Ga0207711_10188461 3300025941 Bacteria 1879
443 Ga0207689_10004088 3300025942 Bacteria 13269
444 Ga0207689_10019078 3300025942 Bacteria 5783
445 Ga0207689_10214602 3300025942 Bacteria 1590
446 Ga0207689_10299982 3300025942 Bacteria 1332
447 Ga0207661_10357003 3300025944 Bacteria 1320
448 Ga0207661_10449207 3300025944 Bacteria 1174
449 Ga0207679_10083188 3300025945 Bacteria 2452
450 Ga0207679_10113597 3300025945 Bacteria 2143
451 Ga0207679_10212311 3300025945 Bacteria 1624
452 Ga0207667_10115539 3300025949 Bacteria 2766
453 Ga0207667_10290568 3300025949 Bacteria 1670
454 Ga0207667_10688512 3300025949 Bacteria 1025
455 Ga0207651_10000597 3300025960 Bacteria 15239
456 Ga0207651_10154455 3300025960 Bacteria 1791
457 Ga0207712_10004527 3300025961 Bacteria 8777
458 Ga0207712_10005753 3300025961 Bacteria 7814
459 Ga0207712_10248874 3300025961 Bacteria 1435
460 Ga0207668_10016019 3300025972 Bacteria 4669
461 Ga0207668_10067863 3300025972 Bacteria 2533
462 Ga0207668_10084839 3300025972 Bacteria 2309
463 Ga0207668_10160443 3300025972 Bacteria 1751
464 Ga0207640_10118085 3300025981 Bacteria 1894
465 Ga0207658_10329026 3300025986 Bacteria 1325
466 Ga0207677_10003770 3300026023 Bacteria 8048
467 Ga0207677_10045320 3300026023 Bacteria 2936
468 Ga0207703_10002610 3300026035 Bacteria 15552
469 Ga0207703_10008823 3300026035 Bacteria 7949
470 Ga0207703_10324855 3300026035 Bacteria 1410
471 Ga0207639_10094992 3300026041 Bacteria 2395
472 Ga0207639_10146440 3300026041 Bacteria 1973
473 Ga0207639_10312492 3300026041 Bacteria 1392
474 Ga0207678_10015210 3300026067 Bacteria 6769
475 Ga0207678_10150533 3300026067 Bacteria 1987
476 Ga0207678_10190578 3300026067 Bacteria 1752
477 Ga0207708_10012241 3300026075 Bacteria 6396
478 Ga0207708_10120515 3300026075 Bacteria 2044
479 Ga0207702_10047126 3300026078 Bacteria 3630
480 Ga0207702_10143155 3300026078 Bacteria 2166
481 Ga0207641_10002468 3300026088 Bacteria 17079
482 Ga0207641_10457066 3300026088 Bacteria 1235
483 Ga0207648_10118805 3300026089 Bacteria 2324
484 Ga0207648_10353402 3300026089 Bacteria 1325
485 Ga0207676_10000580 3300026095 Bacteria 30116
486 Ga0207676_10036976 3300026095 Bacteria 3717
487 Ga0207676_10166238 3300026095 Bacteria 1917
488 Ga0207676_10303254 3300026095 Bacteria 1459
489 Ga0207676_10367455 3300026095 Bacteria 1335
490 Ga0207676_10403062 3300026095 Bacteria 1279
491 Ga0207674_10015659 3300026116 Bacteria 8325
492 Ga0207674_10034697 3300026116 Bacteria 5271
493 Ga0207674_10114721 3300026116 Bacteria 2666
494 Ga0207674_10277373 3300026116 Bacteria 1624
495 Ga0207675_100013083 3300026118 Bacteria 7745
496 Ga0207675_100024197 3300026118 Bacteria 5647
497 Ga0207675_100035075 3300026118 Bacteria 4679
498 Ga0207675_100042614 3300026118 Bacteria 4238
499 Ga0207675_100078878 3300026118 Bacteria 3086
500 Ga0207675_100101089 3300026118 Bacteria 2716
501 Ga0207675_100248702 3300026118 Bacteria 1720
502 Ga0207683_10001023 3300026121 Bacteria 25517
503 Ga0207683_10023737 3300026121 Bacteria 5276
504 Ga0207683_10244365 3300026121 Bacteria 1637
505 Ga0207683_10284911 3300026121 Bacteria 1510
506 Ga0207698_10012412 3300026142 Bacteria 5573
507 Ga0207698_10064654 3300026142 Bacteria 2868
508 Ga0207698_10318835 3300026142 Bacteria 1455
509 Ga0209969_1002713 3300027360 Bacteria 2452
510 Ga0210000_1001181 3300027462 Bacteria 3668
511 Ga0209995_1006663 3300027471 Bacteria 1857
512 Ga0209588_1051665 3300027671 Bacteria 1329
513 Ga0209813_10002641 3300027866 Bacteria 4120
514 Ga0209813_10008917 3300027866 Bacteria 2548
515 Ga0209974_10004365 3300027876 Bacteria 5027
516 Ga0268266_10000638 3300028379 Bacteria 47680
517 Ga0268266_10000807 3300028379 Bacteria 41568
518 Ga0268266_10006312 3300028379 Bacteria 10862
519 Ga0268266_10014067 3300028379 Bacteria 6887
520 Ga0268266_10026691 3300028379 Bacteria 4914
521 Ga0268266_10044321 3300028379 Bacteria 3803
522 Ga0268266_10077532 3300028379 Bacteria 2889
523 Ga0268266_10083302 3300028379 Bacteria 2792
524 Ga0268266_10192756 3300028379 Bacteria 1861
525 Ga0268266_10276362 3300028379 Bacteria 1561
526 Ga0268266_10315468 3300028379 Bacteria 1462
527 Ga0268265_10012069 3300028380 Bacteria 5850
528 Ga0268265_10053120 3300028380 Bacteria 3068
529 Ga0268265_10150499 3300028380 Bacteria 1962
530 Ga0268265_10533308 3300028380 Bacteria 1111
531 Ga0268264_10000153 3300028381 Bacteria 157298
532 Ga0268264_10006067 3300028381 Bacteria 10212
533 Ga0268264_10036845 3300028381 Bacteria 4030
534 Ga0268264_10050796 3300028381 Bacteria 3454
535 Ga0268264_10118856 3300028381 Bacteria 2326
536 Ga0268264_10172214 3300028381 Bacteria 1959
537 Ga0268264_10363491 3300028381 Bacteria 1381
538 Ga0265334_10011486 3300028573 Bacteria 3729
539 Ga0265334_10086967 3300028573 Bacteria 1145
540 Ga0265318_10064691 3300028577 Bacteria 1360
541 Ga0265336_10002438 3300028666 Bacteria 7676
542 Ga0265336_10030507 3300028666 Bacteria 1679
543 Ga0307515_10069488 3300028794 Bacteria 4813
544 Ga0307515_10112145 3300028794 Bacteria 3174
545 Ga0307515_10280587 3300028794 Bacteria 1374
546 Ga0307515_10438062 3300028794 Bacteria 924
547 Ga0265324_10000005 3300029957 Bacteria 347038
548 Ga0265324_10030827 3300029957 Bacteria 1880
549 Ga0307512_10134930 3300030522 Bacteria 1533
550 Ga0265330_10030697 3300031235 Bacteria 2411
551 Ga0265330_10043044 3300031235 Bacteria 1999
552 Ga0265332_10003501 3300031238 Bacteria 7553
553 Ga0265332_10043296 3300031238 Bacteria 1944
554 Ga0265325_10000275 3300031241 Bacteria 36614
555 Ga0265325_10035066 3300031241 Bacteria 2666
556 Ga0265325_10105730 3300031241 Bacteria 1373
557 Ga0265340_10016232 3300031247 Bacteria 3859
558 Ga0265340_10061619 3300031247 Bacteria 1794
559 Ga0265340_10111774 3300031247 Bacteria 1262
560 Ga0265339_10012668 3300031249 Bacteria 5134
561 Ga0265331_10058615 3300031250 Bacteria 1823
562 Ga0265331_10070769 3300031250 Bacteria 1632
563 Ga0265316_10133838 3300031344 Bacteria 1866
564 Ga0265316_10315350 3300031344 Bacteria 1137
565 Ga0307513_10334704 3300031456 Bacteria 1267
566 Ga0307509_10052324 3300031507 Bacteria 4360
567 Ga0307509_10101091 3300031507 Bacteria 2919
568 Ga0307509_10314743 3300031507 Bacteria 1305
569 Ga0307509_10345484 3300031507 Bacteria 1213
570 Ga0307508_10000013 3300031616 Bacteria 242867
571 Ga0307508_10108370 3300031616 Bacteria 2377
572 Ga0307508_10221025 3300031616 Bacteria 1494
573 Ga0307508_10234257 3300031616 Bacteria 1434
574 Ga0316575_10033914 3300031665 Bacteria 2004
575 Ga0265314_10018722 3300031711 Bacteria 5388
576 Ga0265314_10063589 3300031711 Bacteria 2503
577 Ga0265314_10103425 3300031711 Bacteria 1826
578 Ga0265314_10123483 3300031711 Bacteria 1626
579 Ga0265342_10001629 3300031712 Bacteria 20703
580 Ga0265342_10046005 3300031712 Bacteria 2624
581 Ga0316578_10044206 3300031728 Bacteria 2590
582 Ga0307516_10006924 3300031730 Bacteria 13165
583 Ga0307516_10030289 3300031730 Bacteria 5462
584 Ga0307516_10083279 3300031730 Bacteria 3040
585 Ga0307516_10106088 3300031730 Bacteria 2620
586 Ga0307516_10144560 3300031730 Bacteria 2145
587 Ga0307409_100081192 3300031995 Bacteria 2620
588 Ga0307409_100155964 3300031995 Bacteria 1989
589 Ga0307409_100657687 3300031995 Bacteria 1042
590 Ga0307416_100404360 3300032002 Bacteria 1404
591 Ga0307411_10098383 3300032005 Bacteria 2062
592 Ga0307415_100188368 3300032126 Bacteria 1626
593 Ga0307507_10037332 3300033179 Bacteria 4946
594 Ga0307510_10003040 3300033180 Bacteria 19361
595 Ga0307510_10185499 3300033180 Bacteria 1636
596 Ga0373930_0031559 3300034816 Bacteria 1093
597 Ga0373926_0028931 3300035083 Bacteria 1946
598 Ga0373926_0043877 3300035083 Bacteria 1601
599 Ga0373949_0020562 3300035090 Bacteria 1512
600 Ga0373923_0010398 3300035111 Bacteria 3383
601 Ga0373923_0020855 3300035111 Bacteria 2552
602 Ga0373936_0000188 3300035113 Bacteria 20582
603 Ga0373936_0016640 3300035113 Bacteria 2830
604 Ga0373936_0019068 3300035113 Bacteria 2656
605 Ga0373936_0047360 3300035113 Bacteria 1734
606 Ga0373936_0053141 3300035113 Bacteria 1642
607 Ga0373939_0002169 3300035114 Bacteria 4660
608 Ga0373941_0000271 3300035115 Bacteria 9970
609 Ga0373941_0050861 3300035115 Bacteria 1317
610 Ga0373945_0026901 3300035116 Bacteria 2006
611 Ga0373945_0053145 3300035116 Bacteria 1495
612 Ga0373953_0001135 3300035117 Bacteria 7559
613 Ga0373953_0004237 3300035117 Bacteria 4553
614 Ga0373953_0030172 3300035117 Bacteria 2101
615 Ga0373954_0000659 3300035118 Bacteria 13205
616 Ga0373954_0001716 3300035118 Bacteria 8978
617 Ga0373954_0014721 3300035118 Bacteria 3490
618 Ga0373954_0049410 3300035118 Bacteria 1972
619 Ga0373956_0008072 3300035119 Bacteria 4257
620 Ga0373957_0002330 3300035120 Bacteria 5392
621 Ga0373943_0003598 3300035170 Bacteria 7051
622 Ga0373943_0004594 3300035170 Bacteria 6239
623 Ga0373943_0032326 3300035170 Bacteria 2487
624 Ga0373946_0004585 3300035171 Bacteria 4952
625 Ga0373946_0008437 3300035171 Bacteria 3779
626 Ga0373946_0021251 3300035171 Bacteria 2515
627 Ga0373955_0000335 3300035172 Bacteria 19651
628 Ga0373955_0000706 3300035172 Bacteria 14388
629 Ga0373955_0017724 3300035172 Bacteria 3528
630 Ga0316574_0001571 3300035398 Bacteria 10911
631 Ga0373924_0000657 3300035410 Bacteria 10762
632 Ga0373924_0003203 3300035410 Bacteria 5596
633 Ga0373924_0049158 3300035410 Bacteria 1744
634 Ga0373931_0046874 3300035691 Bacteria 2286
635 Ga0373931_0130431 3300035691 Bacteria 1446
636 Ga0373931_0169218 3300035691 Bacteria 1286
637 Ga0373935_0000021 3300035692 Bacteria 65504
638 Ga0373935_0001283 3300035692 Bacteria 13847
639 Ga0373935_0024891 3300035692 Bacteria 3687
640 Ga0373935_0061578 3300035692 Bacteria 2402
641 Ga0373935_0140586 3300035692 Bacteria 1631
642 Ga0373935_0279099 3300035692 Bacteria 1176
643 Ga0373935_0465570 3300035692 Bacteria 914
644 Ga0373927_0000515 3300035695 Bacteria 29473
645 Ga0373927_0006658 3300035695 Bacteria 7862
646 Ga0373927_0009946 3300035695 Bacteria 6373
647 Ga0373927_0021530 3300035695 Bacteria 4226
648 Ga0373927_0026143 3300035695 Bacteria 3814
649 Ga0373927_0114196 3300035695 Bacteria 1760
650 Ga0373927_0195453 3300035695 Bacteria 1327
651 Ga0373933_0011288 3300035724 Bacteria 4919
652 Ga0373933_0092462 3300035724 Bacteria 1868
653 Ga0373947_0000479 3300035725 Bacteria 22951
654 Ga0373947_0003063 3300035725 Bacteria 9948
655 Ga0373947_0013284 3300035725 Bacteria 4717
656 Ga0373947_0063774 3300035725 Bacteria 2245
657 Ga0373947_0164456 3300035725 Bacteria 1436
658 Ga0373937_0000003 3300036401 Bacteria 235408
659 Ga0373937_0005938 3300036401 Bacteria 10508
660 Ga0373937_0254715 3300036401 Bacteria 1655
661 Ga0373937_0400365 3300036401 Bacteria 1302
662 Ga0316584_0014288 3300036712 Bacteria 5647
663 Ga0373925_0000118 3300037068 Bacteria 85072
664 Ga0373925_0007182 3300037068 Bacteria 8141
665 Ga0373925_0027532 3300037068 Bacteria 4159
666 Ga0373925_0042097 3300037068 Bacteria 3388
667 Ga0373925_0088194 3300037068 Bacteria 2369
668 Ga0373925_0126535 3300037068 Bacteria 1988
669 Ga0395900_0009415 3300037418 Bacteria 10015
670 Ga0395898_0016882 3300037466 Bacteria 7455
671 Ga0395898_0024634 3300037466 Bacteria 6070
672 Ga0395898_0346845 3300037466 Bacteria 1416
673 Ga0395898_0358675 3300037466 Bacteria 1390
674 Ga0395905_0051168 3300037471 Bacteria 3869
675 Ga0395905_0447005 3300037471 Bacteria 1190
676 Ga0436364_0304115 3300037853 Bacteria 2055
677 Ga0436364_1355688 3300037853 Bacteria 33586
678 Ga0395901_0009062 3300038443 Bacteria 10077
679 Ga0436365_0079213 3300039437 Bacteria 2443
680 Ga0436365_0356953 3300039437 Bacteria 1177
681 Ga0436365_0669858 3300039437 Bacteria 1956
682 Ga0436365_1233769 3300039437 Bacteria 10406
683 Ga0436365_1447372 3300039437 Bacteria 1544
684 Ga0436365_1891193 3300039437 Bacteria 2267
685 Ga0436360_0853720 3300039438 Bacteria 4705
686 Ga0436361_0283608 3300039447 Bacteria 13248
687 Ga0436361_0331296 3300039447 Bacteria 1685
688 Ga0436361_0337036 3300039447 Bacteria 7219
689 Ga0436361_0696146 3300039447 Bacteria 2411
690 Ga0436361_1007450 3300039447 Bacteria 3195
691 Ga0436361_1011773 3300039447 Bacteria 1307
692 Ga0436363_0800492 3300039450 Bacteria 1687
693 Ga0439453_0000298 3300041408 Bacteria 5152
694 Ga0451791_0758265 3300041451 Bacteria 1487
695 Ga0451853_2143278 3300041512 Bacteria 1469
696 Ga0439443_006608 3300042003 Bacteria 1590
697 Ga0450911_000463 3300042115 Bacteria 13062
698 Ga0439458_0006605 3300042157 Bacteria 2586
699 Ga0439435_0097964 3300042436 Bacteria 898
700 Ga0451577_0235541 3300042876 Bacteria 1656
701 Ga0466963_0159422 3300044694 Bacteria 1570
702 Ga0453684_0009414 3300044712 Bacteria 17086
703 Ga0453684_0869795 3300044712 Bacteria 967
704 Ga0466968_0114564 3300044735 Bacteria 1215
705 Ga0466959_0196160 3300045049 Bacteria 1407
706 Ga0466967_0078248 3300045976 Bacteria 2979
707 Ga0495592_0000215 3300046454 Bacteria 49510
708 Ga0495592_0004136 3300046454 Bacteria 10571
709 Ga0495592_0023188 3300046454 Bacteria 4721
710 Ga0495592_0225482 3300046454 Bacteria 1250
711 Ga0495603_0000156 3300046455 Bacteria 34369
712 Ga0495603_0002154 3300046455 Bacteria 11584
713 Ga0495603_0046248 3300046455 Bacteria 2594
714 Ga0495603_0120284 3300046455 Bacteria 1530
715 Ga0495603_0131595 3300046455 Bacteria 1456
716 Ga0495603_0271863 3300046455 Bacteria 975
717 Ga0495629_0000297 3300046459 Bacteria 42433
718 Ga0495629_0002353 3300046459 Bacteria 14564
719 Ga0495629_0012373 3300046459 Bacteria 6179
720 Ga0495629_0024099 3300046459 Bacteria 4333
721 Ga0495629_0108670 3300046459 Bacteria 1934
722 Ga0495629_0179028 3300046459 Bacteria 1470
723 Ga0495641_0003033 3300046461 Bacteria 12847
724 Ga0495641_0031993 3300046461 Bacteria 2508
725 Ga0495651_0000371 3300046462 Bacteria 34639
726 Ga0495651_0034356 3300046462 Bacteria 3952
727 Ga0495651_0049838 3300046462 Bacteria 3232
728 Ga0495653_0000039 3300046463 Bacteria 119840
729 Ga0495653_0007683 3300046463 Bacteria 8825
730 Ga0495653_0047555 3300046463 Bacteria 3318
731 Ga0495653_0059547 3300046463 Bacteria 2897
732 Ga0495653_0108612 3300046463 Bacteria 1998
733 Ga0495653_0184286 3300046463 Bacteria 1430
734 Ga0495580_0004950 3300046472 Bacteria 11137
735 Ga0495580_0013227 3300046472 Bacteria 6308
736 Ga0495580_0057855 3300046472 Bacteria 2728
737 Ga0495580_0060558 3300046472 Bacteria 2659
738 Ga0495580_0161460 3300046472 Bacteria 1551
739 Ga0495582_0000087 3300046473 Bacteria 47529
740 Ga0495582_0018146 3300046473 Bacteria 3850
741 Ga0495639_0000153 3300046475 Bacteria 35461
742 Ga0495639_0013941 3300046475 Bacteria 3477
743 Ga0495662_0002873 3300046476 Bacteria 8714
744 Ga0495662_0002946 3300046476 Bacteria 8591
745 Ga0495662_0007383 3300046476 Bacteria 5430
746 Ga0495664_0000015 3300046477 Bacteria 192569
747 Ga0495664_0004879 3300046477 Bacteria 7338
748 Ga0495664_0019627 3300046477 Bacteria 3889
749 Ga0495664_0035984 3300046477 Bacteria 2917
750 Ga0495664_0092439 3300046477 Bacteria 1820
751 Ga0495584_0062710 3300046491 Bacteria 1868
752 Ga0495584_0149564 3300046491 Bacteria 1186
753 Ga0495594_0001275 3300046499 Bacteria 13162
754 Ga0495594_0044076 3300046499 Bacteria 2446
755 Ga0495594_0068933 3300046499 Bacteria 1964
756 Ga0495594_0142820 3300046499 Bacteria 1358
757 Ga0495596_0084630 3300046500 Bacteria 1231
758 Ga0495607_0071269 3300046501 Bacteria 1938
759 Ga0495606_0044078 3300046507 Bacteria 2969
760 Ga0495608_0000025 3300046511 Bacteria 158132
761 Ga0495608_0002817 3300046511 Bacteria 12470
762 Ga0495608_0031065 3300046511 Bacteria 3613
763 Ga0495608_0061472 3300046511 Bacteria 2470
764 Ga0495608_0066690 3300046511 Bacteria 2356
765 Ga0495610_0042191 3300046512 Bacteria 2284
766 Ga0495618_0000040 3300046514 Bacteria 98012
767 Ga0495618_0105972 3300046514 Bacteria 1800
768 Ga0495618_0175840 3300046514 Bacteria 1361
769 Ga0495618_0206114 3300046514 Bacteria 1244
770 Ga0495628_0000011 3300046516 Bacteria 225267
771 Ga0495628_0006351 3300046516 Bacteria 10331
772 Ga0495628_0006427 3300046516 Bacteria 10268
773 Ga0495630_0000735 3300046517 Bacteria 23119
774 Ga0495630_0001070 3300046517 Bacteria 18897
775 Ga0495630_0119190 3300046517 Bacteria 2002
776 Ga0495630_0147017 3300046517 Bacteria 1792
777 Ga0495631_0083667 3300046518 Bacteria 1375
778 Ga0495632_0041392 3300046519 Bacteria 2315
779 Ga0495637_0069026 3300046520 Bacteria 1431
780 Ga0495644_0054123 3300046523 Bacteria 1507
781 Ga0495648_0010886 3300046524 Bacteria 6898
782 Ga0495648_0071673 3300046524 Bacteria 2007
783 Ga0495666_0119220 3300046526 Bacteria 1236
784 Ga0495666_0163414 3300046526 Bacteria 1032
785 Ga0495652_0000014 3300046529 Bacteria 225484
786 Ga0495652_0003411 3300046529 Bacteria 15714
787 Ga0495652_0021093 3300046529 Bacteria 5790
788 Ga0495652_0056860 3300046529 Bacteria 3320
789 Ga0495652_0141972 3300046529 Bacteria 1888
790 Ga0495652_0181442 3300046529 Bacteria 1615
791 Ga0495665_0000117 3300046531 Bacteria 37802
792 Ga0495665_0018416 3300046531 Bacteria 3753
793 Ga0495665_0029046 3300046531 Bacteria 2963
794 Ga0495665_0144892 3300046531 Bacteria 1240
795 Ga0495640_0000008 3300046533 Bacteria 220320
796 Ga0495640_0002597 3300046533 Bacteria 14524
797 Ga0495640_0004127 3300046533 Bacteria 11621
798 Ga0495640_0006608 3300046533 Bacteria 9148
799 Ga0495640_0029328 3300046533 Bacteria 3951
800 Ga0495640_0033546 3300046533 Bacteria 3645
801 Ga0495586_0066111 3300046535 Bacteria 1971
802 Ga0495587_0000015 3300046536 Bacteria 187415
803 Ga0495587_0105210 3300046536 Bacteria 1624
804 Ga0495587_0148235 3300046536 Bacteria 1337
805 Ga0495598_0067311 3300046537 Bacteria 1119
806 Ga0495645_0000205 3300046543 Bacteria 42289
807 Ga0495645_0015634 3300046543 Bacteria 5398
808 Ga0495645_0212503 3300046543 Bacteria 1305
809 Ga0495622_0001116 3300046557 Bacteria 14039
810 Ga0495622_0012790 3300046557 Bacteria 3892
811 Ga0495622_0022552 3300046557 Bacteria 2934
812 Ga0495633_0012232 3300046558 Bacteria 4576
813 Ga0495633_0018062 3300046558 Bacteria 3588
814 Ga0495633_0241681 3300046558 Bacteria 825
815 Ga0495667_0000013 3300046559 Bacteria 220294
816 Ga0495667_0003186 3300046559 Bacteria 11002
817 Ga0495667_0009440 3300046559 Bacteria 6609
818 Ga0495667_0035701 3300046559 Bacteria 3321
819 Ga0495667_0048193 3300046559 Bacteria 2813
820 Ga0495656_0038466 3300046615 Bacteria 1982
821 Ga0495656_0050802 3300046615 Bacteria 1772
822 Ga0495656_0080625 3300046615 Bacteria 1468
823 Ga0495656_0090492 3300046615 Bacteria 1398
824 Ga0495656_0113401 3300046615 Bacteria 1271
825 Ga0495656_0132881 3300046615 Bacteria 1186
826 Ga0495668_0061227 3300046616 Bacteria 2076
827 Ga0495634_0000397 3300046642 Bacteria 42705
828 Ga0495634_0020673 3300046642 Bacteria 4664
829 Ga0495634_0035244 3300046642 Bacteria 3428
830 Ga0495634_0085555 3300046642 Bacteria 2054
831 Ga0495634_0087759 3300046642 Bacteria 2024
832 Ga0495634_0163526 3300046642 Bacteria 1402
833 Ga0495634_0256832 3300046642 Bacteria 1067
834 Ga0495611_0164424 3300046648 Bacteria 1037
835 Ga0495635_0000012 3300046663 Bacteria 225271
836 Ga0495635_0004107 3300046663 Bacteria 10098
837 Ga0495635_0004151 3300046663 Bacteria 10047
838 Ga0495635_0018107 3300046663 Bacteria 4919
839 Ga0495635_0123512 3300046663 Bacteria 1765
840 Ga0495635_0231983 3300046663 Bacteria 1247
841 Ga0495659_0040529 3300046664 Bacteria 1660
842 Ga0495588_0015743 3300046674 Bacteria 3646
843 Ga0495588_0180414 3300046674 Bacteria 1116
844 Ga0495657_0000392 3300046675 Bacteria 40698
845 Ga0495657_0022202 3300046675 Bacteria 4549
846 Ga0495657_0029999 3300046675 Bacteria 3811
847 Ga0495657_0110574 3300046675 Bacteria 1741
848 Ga0495599_0000008 3300046678 Bacteria 225534
849 Ga0495599_0002862 3300046678 Bacteria 10060
850 Ga0495599_0011481 3300046678 Bacteria 5444
851 Ga0495599_0085231 3300046678 Unclassified 1973
852 Ga0495623_0000002 3300046679 Bacteria 166669
853 Ga0495623_0004294 3300046679 Bacteria 9381
854 Ga0495646_0000004 3300046680 Bacteria 268993
855 Ga0495646_0007517 3300046680 Bacteria 6923
856 Ga0495646_0012394 3300046680 Bacteria 5419
857 Ga0495646_0068396 3300046680 Bacteria 2097
858 Ga0495647_0000365 3300046681 Bacteria 12760
859 Ga0495647_0030887 3300046681 Bacteria 1990
860 Ga0495647_0092453 3300046681 Bacteria 1242
861 Ga0495658_0000644 3300046683 Bacteria 18891
862 Ga0495658_0005335 3300046683 Bacteria 6324
863 Ga0495658_0010016 3300046683 Bacteria 4732
864 Ga0495658_0067118 3300046683 Bacteria 2074
865 Ga0495658_0333745 3300046683 Bacteria 962
866 Ga0495669_0001797 3300046684 Bacteria 8765
867 Ga0495669_0235895 3300046684 Bacteria 878
868 Ga0495613_0005220 3300046689 Bacteria 9755
869 Ga0495613_0025843 3300046689 Bacteria 4375
870 Ga0495613_0092092 3300046689 Bacteria 2195
871 Ga0495613_0096248 3300046689 Bacteria 2141
872 Ga0495613_0133652 3300046689 Bacteria 1776
873 Ga0495613_0172601 3300046689 Bacteria 1534
874 Ga0495613_0176962 3300046689 Bacteria 1512
875 Ga0495624_0000668 3300046690 Bacteria 26801
876 Ga0495624_0010384 3300046690 Bacteria 6419
877 Ga0495624_0031831 3300046690 Bacteria 3425
878 Ga0495624_0053173 3300046690 Bacteria 2557
879 Ga0495624_0088047 3300046690 Bacteria 1917
880 Ga0495670_0029534 3300046691 Bacteria 2721
881 Ga0495649_0014605 3300046694 Bacteria 4493
882 Ga0495589_0215883 3300046794 Bacteria 902
883 Ga0495600_0000164 3300046809 Bacteria 38938
884 Ga0495600_0054313 3300046809 Bacteria 2616
885 Ga0495600_0067583 3300046809 Bacteria 2336
886 Ga0495600_0079839 3300046809 Bacteria 2136
887 Ga0495600_0121829 3300046809 Bacteria 1696
888 Ga0495581_0042306 3300047315 Bacteria 2636
889 Ga0495581_0050644 3300047315 Bacteria 2398
890 Ga0495581_0170545 3300047315 Bacteria 1273
891 Ga0495604_0000001 3300047317 Bacteria 708627
892 Ga0495604_0005885 3300047317 Bacteria 9724
893 Ga0495604_0013618 3300047317 Bacteria 6486
894 Ga0495604_0067701 3300047317 Bacteria 2712
895 Ga0495674_0000023 3300047319 Bacteria 157443
896 Ga0495674_0000177 3300047319 Bacteria 50030
897 Ga0495674_0019813 3300047319 Bacteria 6237
898 Ga0495674_0045558 3300047319 Bacteria 3894
899 Ga0495674_0727625 3300047319 Bacteria 777
900 Ga0495672_0103149 3300047320 Bacteria 1543
901 Ga0495672_0103306 3300047320 Bacteria 1542
902 Ga0495676_0034415 3300047321 Bacteria 4252
903 Ga0495676_0072783 3300047321 Bacteria 2638
904 Ga0495676_0080274 3300047321 Bacteria 2478
905 Ga0495676_0084451 3300047321 Bacteria 2396
906 Ga0495676_0086527 3300047321 Bacteria 2358
907 Ga0495676_0088281 3300047321 Bacteria 2326
908 Ga0495680_0000341 3300047322 Bacteria 51840
909 Ga0495680_0015838 3300047322 Bacteria 6490
910 Ga0495680_0027227 3300047322 Bacteria 4699
911 Ga0495675_0000315 3300047444 Bacteria 34499
912 Ga0495675_0003409 3300047444 Bacteria 9576
913 Ga0495675_0084439 3300047444 Bacteria 1998
914 Ga0495673_0127309 3300047469 Bacteria 1003
915 Ga0495684_0000007 3300047471 Bacteria 225614
916 Ga0495684_0002187 3300047471 Bacteria 15656
917 Ga0495684_0008299 3300047471 Bacteria 8045
918 Ga0495684_0015335 3300047471 Bacteria 5898
919 Ga0495684_0032231 3300047471 Bacteria 4022
920 Ga0495684_0186385 3300047471 Bacteria 1536
921 Ga0495684_0388659 3300047471 Bacteria 982
922 Ga0495686_0037232 3300047472 Bacteria 3118
923 Ga0495686_0082579 3300047472 Bacteria 1961
924 Ga0495593_0000156 3300047673 Bacteria 34308
925 Ga0495593_0000806 3300047673 Bacteria 18126
926 Ga0495593_0001736 3300047673 Bacteria 12917
927 Ga0495593_0048014 3300047673 Bacteria 2269
928 Ga0495602_0000157 3300048088 Bacteria 63001
929 Ga0495602_0063338 3300048088 Bacteria 3204
930 Ga0495602_0101775 3300048088 Bacteria 2356
931 Ga0495602_0141854 3300048088 Bacteria 1901
932 Ga0495614_0015188 3300048089 Bacteria 3359
933 Ga0495614_0053533 3300048089 Bacteria 1731
934 Ga0496100_0030002 3300048903 Bacteria 3369
935 Ga0496100_0050336 3300048903 Bacteria 2699
936 Ga0496100_0120303 3300048903 Bacteria 1836
937 Ga0496100_0160883 3300048903 Bacteria 1609
938 Ga0496100_0250974 3300048903 Bacteria 1309
939 Ga0496101_0005444 3300048904 Bacteria 8116
940 Ga0496101_0047905 3300048904 Bacteria 3070
941 Ga0496101_0177057 3300048904 Bacteria 1641
942 Ga0496101_0229894 3300048904 Bacteria 1441
943 Ga0496101_0372334 3300048904 Bacteria 1123
944 Ga0496102_0001321 3300048905 Bacteria 22246
945 Ga0496102_0009948 3300048905 Bacteria 8179
946 Ga0496102_0072817 3300048905 Bacteria 3158
947 Ga0496102_0082283 3300048905 Bacteria 2969
948 Ga0496102_0170653 3300048905 Bacteria 2048
949 Ga0496102_0275217 3300048905 Bacteria 1587
950 Ga0496102_0342705 3300048905 Bacteria 1407
951 Ga0496103_0004098 3300048906 Bacteria 8857
952 Ga0496103_0021611 3300048906 Bacteria 3871
953 Ga0496103_0031466 3300048906 Bacteria 3233
954 Ga0496103_0189523 3300048906 Bacteria 1322
955 Ga0496104_0001524 3300048907 Bacteria 19975
956 Ga0496104_0018835 3300048907 Bacteria 6306
957 Ga0496104_0104086 3300048907 Bacteria 2719
958 Ga0496104_0361717 3300048907 Bacteria 1363
959 Ga0496104_0520828 3300048907 Bacteria 1100
960 Ga0496104_0632991 3300048907 Bacteria 979
961 Ga0496105_0001515 3300048908 Bacteria 16423
962 Ga0496105_0008435 3300048908 Bacteria 8009
963 Ga0496105_0015352 3300048908 Bacteria 6102
964 Ga0496105_0021910 3300048908 Bacteria 5172
965 Ga0496105_0067767 3300048908 Bacteria 2947
966 Ga0496106_0001932 3300048909 Bacteria 15544
967 Ga0496106_0003944 3300048909 Bacteria 11084
968 Ga0496106_0122573 3300048909 Bacteria 2033
969 Ga0496106_0266501 3300048909 Bacteria 1371
970 Ga0496106_0286344 3300048909 Bacteria 1320
971 Ga0496106_0468090 3300048909 Bacteria 1012
972 Ga0496107_0003324 3300048910 Bacteria 10749
973 Ga0496107_0033724 3300048910 Bacteria 3664
974 Ga0496107_0107623 3300048910 Bacteria 2048
975 Ga0496107_0116329 3300048910 Bacteria 1968
976 Ga0496107_0206472 3300048910 Bacteria 1460
977 Ga0496108_0001028 3300048911 Bacteria 21742
978 Ga0496108_0038439 3300048911 Bacteria 3987
979 Ga0496108_0102747 3300048911 Bacteria 2439
980 Ga0496108_0157273 3300048911 Bacteria 1963
981 Ga0496108_0168537 3300048911 Bacteria 1894
982 Ga0496108_0326572 3300048911 Bacteria 1338
983 Ga0496109_0002430 3300048912 Bacteria 15588
984 Ga0496109_0018985 3300048912 Bacteria 6055
985 Ga0496109_0047987 3300048912 Bacteria 3884
986 Ga0496109_0059126 3300048912 Bacteria 3502
987 Ga0496109_0088619 3300048912 Bacteria 2860
988 Ga0496109_0107195 3300048912 Bacteria 2595
989 Ga0496109_0395015 3300048912 Bacteria 1306
990 Ga0496110_0040479 3300048913 Bacteria 4061
991 Ga0496110_0044959 3300048913 Bacteria 3857
992 Ga0496110_0109178 3300048913 Bacteria 2485
993 Ga0496110_0184059 3300048913 Bacteria 1897
994 Ga0496110_0347488 3300048913 Bacteria 1351
995 Ga0496111_0000436 3300048914 Bacteria 21122
996 Ga0496111_0051596 3300048914 Bacteria 2969
997 Ga0496112_0000009 3300048915 Bacteria 299708
998 Ga0496112_0004518 3300048915 Bacteria 11815
999 Ga0496112_0022204 3300048915 Bacteria 6048
1000 Ga0496112_0060849 3300048915 Bacteria 3721
1001 Ga0496112_0109906 3300048915 Bacteria 2727
1002 Ga0496112_0154474 3300048915 Bacteria 2262
1003 Ga0496112_0198310 3300048915 Bacteria 1967
1004 Ga0496112_0359328 3300048915 Bacteria 1398
1005 Ga0496113_0001905 3300048916 Bacteria 11913
1006 Ga0496113_0041523 3300048916 Bacteria 3395
1007 Ga0496113_0056320 3300048916 Bacteria 2951
1008 Ga0496113_0059668 3300048916 Bacteria 2874
1009 Ga0496113_0085190 3300048916 Bacteria 2427
1010 Ga0496113_0200118 3300048916 Bacteria 1588
1011 Ga0496113_0233762 3300048916 Bacteria 1466
1012 Ga0496113_0369931 3300048916 Bacteria 1150
1013 Ga0496114_0054940 3300048917 Bacteria 3320
1014 Ga0496114_0101111 3300048917 Bacteria 2461
1015 Ga0496114_0102814 3300048917 Bacteria 2441
1016 Ga0496114_0112915 3300048917 Bacteria 2329
1017 Ga0496114_0253607 3300048917 Bacteria 1548
1018 Ga0496114_0545555 3300048917 Bacteria 1025
1019 Ga0496115_0028337 3300048918 Bacteria 4389
1020 Ga0496115_0066112 3300048918 Bacteria 2921
1021 Ga0496115_0073654 3300048918 Bacteria 2772
1022 Ga0496115_0112310 3300048918 Bacteria 2239
1023 Ga0496115_0126754 3300048918 Bacteria 2103
1024 Ga0496115_0157970 3300048918 Bacteria 1873
1025 Ga0496115_0313612 3300048918 Bacteria 1284
1026 Ga0496117_0004621 3300048920 Bacteria 15000
1027 Ga0496118_0001262 3300048921 Bacteria 38805
1028 Ga0496118_0076571 3300048921 Bacteria 2378
1029 Ga0496118_0083141 3300048921 Bacteria 2240
1030 Ga0496118_0109041 3300048921 Bacteria 1844
1031 Ga0496119_0024084 3300048922 Bacteria 4294
1032 Ga0496119_0115828 3300048922 Bacteria 1480
1033 Ga0496120_0039344 3300048923 Bacteria 2790
1034 Ga0496121_0000091 3300048924 Bacteria 216685
1035 Ga0496121_0000689 3300048924 Bacteria 62997
1036 Ga0496121_0030703 3300048924 Bacteria 4930
1037 Ga0496121_0056005 3300048924 Bacteria 3279
1038 Ga0496121_0056015 3300048924 Bacteria 3279
1039 Ga0496121_0058249 3300048924 Bacteria 3195
1040 Ga0496121_0222243 3300048924 Bacteria 1329
1041 Ga0496121_0295982 3300048924 Bacteria 1100
1042 Ga0496121_0395981 3300048924 Bacteria 906
1043 Ga0496122_0044469 3300048925 Bacteria 3465
1044 Ga0496124_0005646 3300048927 Bacteria 13982
1045 Ga0496124_0014474 3300048927 Bacteria 7627
1046 Ga0496124_0051872 3300048927 Bacteria 3488
1047 Ga0496124_0056243 3300048927 Bacteria 3319
1048 Ga0496124_0231029 3300048927 Bacteria 1383
1049 Ga0496125_0000654 3300048928 Bacteria 57851
1050 Ga0496125_0002454 3300048928 Bacteria 24086
1051 Ga0496125_0065286 3300048928 Bacteria 2885
1052 Ga0496125_0074940 3300048928 Bacteria 2621
1053 Ga0496126_0003243 3300048929 Bacteria 20798
1054 Ga0496126_0004862 3300048929 Bacteria 15734
1055 Ga0496126_0012552 3300048929 Bacteria 8671
1056 Ga0496126_0014034 3300048929 Bacteria 8117
1057 Ga0496126_0020591 3300048929 Bacteria 6460
1058 Ga0496126_0030165 3300048929 Bacteria 5141
1059 Ga0496126_0037854 3300048929 Bacteria 4494
1060 Ga0496126_0044004 3300048929 Bacteria 4114
1061 Ga0496126_0049099 3300048929 Bacteria 3854
1062 Ga0496126_0072937 3300048929 Bacteria 3053
1063 Ga0496126_0297859 3300048929 Bacteria 1332
1064 Ga0496126_0428315 3300048929 Bacteria 1068
1065 Ga0495678_088405 3300049459 Bacteria 1097
1066 Ga0501031_0012910 3300049568 Bacteria 5455
1067 Ga0501032_0000055 3300049569 Bacteria 99207
1068 Ga0501032_0158590 3300049569 Bacteria 1486
1069 Ga0501033_0001478 3300049570 Bacteria 20801
1070 Ga0501033_0018756 3300049570 Bacteria 5229
1071 Ga0501033_0079101 3300049570 Bacteria 2413
1072 Ga0501034_0000933 3300049571 Bacteria 42599
1073 Ga0501034_0001822 3300049571 Bacteria 27090
1074 Ga0501034_0002182 3300049571 Bacteria 24239
1075 Ga0501034_0070974 3300049571 Bacteria 3493
1076 Ga0501034_0096343 3300049571 Bacteria 2955
1077 Ga0501034_0331436 3300049571 Bacteria 1453
1078 Ga0501034_0373781 3300049571 Bacteria 1351
1079 Ga0501034_0520334 3300049571 Bacteria 1101
1080 Ga0501036_0000021 3300049572 Bacteria 114136
1081 Ga0501036_0000242 3300049572 Bacteria 36845
1082 Ga0501036_0120809 3300049572 Bacteria 2213
1083 Ga0501036_0262974 3300049572 Bacteria 1445
1084 Ga0501037_0001418 3300049573 Bacteria 17590
1085 Ga0501037_0030614 3300049573 Bacteria 3976
1086 Ga0501038_0000070 3300049574 Bacteria 84371
1087 Ga0501038_0246525 3300049574 Bacteria 1416
1088 Ga0501038_0269272 3300049574 Bacteria 1344
1089 Ga0501038_0285424 3300049574 Bacteria 1298
1090 Ga0501038_0362468 3300049574 Bacteria 1127
1091 Ga0501039_0001437 3300049575 Bacteria 17545
1092 Ga0501039_0033778 3300049575 Bacteria 3946
1093 Ga0501039_0415761 3300049575 Bacteria 1056
1094 Ga0501040_0195246 3300049576 Bacteria 1437
1095 Ga0501043_0000078 3300049579 Bacteria 85968
1096 Ga0501043_0004230 3300049579 Bacteria 11701
1097 Ga0501046_0000627 3300049580 Bacteria 34652
1098 Ga0501046_0031030 3300049580 Bacteria 4336
1099 Ga0501047_0000073 3300049581 Bacteria 125990
1100 Ga0501047_0000810 3300049581 Bacteria 32588
1101 Ga0501047_0011598 3300049581 Bacteria 8340
1102 Ga0501047_0023017 3300049581 Bacteria 5981
1103 Ga0501047_0093548 3300049581 Bacteria 2885
1104 Ga0501047_0112279 3300049581 Bacteria 2608
1105 Ga0501047_0416859 3300049581 Bacteria 1174
1106 Ga0501048_0000014 3300049582 Bacteria 75001
1107 Ga0501048_0001060 3300049582 Bacteria 20590
1108 Ga0501067_0000177 3300049583 Bacteria 35936
1109 Ga0501067_0084754 3300049583 Bacteria 1758
1110 Ga0501068_0007168 3300049584 Bacteria 6174
1111 Ga0501068_0010646 3300049584 Bacteria 5173
1112 Ga0501069_0098344 3300049585 Bacteria 1660
1113 Ga0501070_0001227 3300049586 Bacteria 22954
1114 Ga0501070_0009345 3300049586 Bacteria 8291
1115 Ga0501070_0036782 3300049586 Bacteria 4088
1116 Ga0501070_0051653 3300049586 Bacteria 3412
1117 Ga0501070_0284209 3300049586 Bacteria 1349
1118 Ga0501071_0193364 3300049587 Bacteria 1526
1119 Ga0501072_0001047 3300049588 Bacteria 20473
1120 Ga0501072_0004769 3300049588 Bacteria 10323
1121 Ga0501072_0023276 3300049588 Bacteria 4811
1122 Ga0501073_0000039 3300049589 Bacteria 86080
1123 Ga0501074_0000019 3300049590 Bacteria 72385
1124 Ga0501074_0272855 3300049590 Bacteria 1202
1125 Ga0501077_0239881 3300049593 Bacteria 1152
1126 Ga0501077_0270992 3300049593 Bacteria 1080
1127 Ga0501080_0000187 3300049742 Bacteria 45224
1128 Ga0501080_0000827 3300049742 Bacteria 25307
1129 Ga0501080_0044354 3300049742 Bacteria 4140
1130 Ga0501080_0264120 3300049742 Bacteria 1567
1131 Ga0501083_0000242 3300049744 Bacteria 35191
1132 Ga0501083_0000398 3300049744 Bacteria 27675
1133 Ga0501083_0158048 3300049744 Bacteria 1483
1134 Ga0501083_0188169 3300049744 Bacteria 1347
1135 Ga0501280_008804 3300049776 Bacteria 1405
1136 Ga0501035_0001565 3300049822 Bacteria 23271
1137 Ga0501035_0002405 3300049822 Bacteria 18344
1138 Ga0501035_0015977 3300049822 Bacteria 6928
1139 Ga0501035_0046011 3300049822 Bacteria 3925
1140 Ga0501044_0000179 3300049823 Bacteria 78633
1141 Ga0501044_0000760 3300049823 Bacteria 39010
1142 Ga0501044_0007764 3300049823 Bacteria 11795
1143 Ga0501044_0011580 3300049823 Bacteria 9560
1144 Ga0501044_0030537 3300049823 Bacteria 5678
1145 Ga0501044_0175676 3300049823 Bacteria 2111
1146 Ga0501044_0196826 3300049823 Bacteria 1975
1147 Ga0501044_0239108 3300049823 Bacteria 1760
1148 Ga0501044_0258782 3300049823 Bacteria 1679
1149 Ga0501045_0003829 3300049824 Bacteria 10352
1150 nmdc:mga03683_21967_c1 3300050489 Bacteria 2468
1151 nmdc:mga03683_38137_c1 3300050489 Bacteria 1961
1152 nmdc:mga03n38_1330_c1 3300050490 Bacteria 6995
1153 nmdc:mga03n38_2665_c1 3300050490 Bacteria 5572
1154 nmdc:mga03n38_35453_c1 3300050490 Bacteria 2137
1155 nmdc:mga00v17_11637_c1 3300050491 Bacteria 4837
1156 nmdc:mga00v17_23514_c1 3300050491 Bacteria 3564
1157 nmdc:mga00v17_299054_c1 3300050491 Bacteria 1045
1158 nmdc:mga00v17_391929_c1 3300050491 Bacteria 903
1159 nmdc:mga0yw44_154217_c1 3300050492 Bacteria 1500
1160 nmdc:mga0yw44_18489_c1 3300050492 Bacteria 3819
1161 nmdc:mga0yw44_35656_c1 3300050492 Bacteria 2925
1162 nmdc:mga0yw44_9147_c1 3300050492 Bacteria 4985
1163 nmdc:mga0k408_153136_c1 3300050493 Bacteria 1373
1164 nmdc:mga0k408_15360_c1 3300050493 Bacteria 4233
1165 nmdc:mga0k408_3608_c1 3300050493 Bacteria 8187
1166 nmdc:mga06z11_127234_c1 3300050494 Bacteria 1427
1167 nmdc:mga06z11_13614_c1 3300050494 Bacteria 3579
1168 nmdc:mga06z11_186_c1 3300050494 Bacteria 24841
1169 nmdc:mga06z11_76491_c1 3300050494 Bacteria 1785
1170 nmdc:mga04h51_21675_c1 3300050495 Bacteria 1936
1171 nmdc:mga04h51_28517_c1 3300050495 Bacteria 1742
1172 nmdc:mga04h51_58354_c1 3300050495 Bacteria 1316
1173 nmdc:mga04h51_778_c1 3300050495 Bacteria 7378
1174 nmdc:mga07m45_117688_c1 3300050496 Bacteria 1533
1175 nmdc:mga07m45_21937_c1 3300050496 Bacteria 3483
1176 nmdc:mga07m45_5521_c1 3300050496 Bacteria 6303
1177 nmdc:mga07m45_78381_c1 3300050496 Bacteria 1885
1178 nmdc:mga05p37_40622_c1 3300050507 Bacteria 5713
1179 nmdc:mga05p37_42327_c1 3300050507 Bacteria 5595
1180 nmdc:mga05p37_50505_c1 3300050507 Bacteria 5115
1181 nmdc:mga09592_253527_c1 3300050508 Bacteria 1525
1182 nmdc:mga0qj67_124016_c1 3300050509 Bacteria 2090
1183 nmdc:mga0qj67_135166_c1 3300050509 Bacteria 1998
1184 nmdc:mga0qj67_299408_c1 3300050509 Bacteria 1303
1185 nmdc:mga0qj67_358758_c1 3300050509 Bacteria 1178
1186 nmdc:mga06r32_151936_c1 3300050510 Bacteria 2294
1187 nmdc:mga06r32_33861_c1 3300050510 Bacteria 4814
1188 nmdc:mga06r32_620656_c1 3300050510 Bacteria 1051
1189 nmdc:mga08y16_126369_c1 3300050511 Bacteria 2660
1190 nmdc:mga08y16_66137_c1 3300050511 Bacteria 3773
1191 nmdc:mga0n895_108270_c1 3300050512 Bacteria 2793
1192 nmdc:mga0n895_13911_c1 3300050512 Bacteria 7285
1193 nmdc:mga0n895_19291_c1 3300050512 Bacteria 6335
1194 nmdc:mga0rr50_20477_c1 3300050513 Bacteria 4494
1195 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
1196 nmdc:mga08x19_249656_c1 3300050514 Bacteria 1225
1197 nmdc:mga08x19_31667_c1 3300050514 Bacteria 3329
1198 nmdc:mga0a205_240939_c2 3300050515 Bacteria 1257
1199 nmdc:mga0a205_4562_c1 3300050515 Bacteria 12428
1200 Ga0495601_0000014 3300053077 Bacteria 220318
1201 Ga0495601_0014089 3300053077 Bacteria 4816
1202 Ga0495601_0049720 3300053077 Bacteria 2644
1203 Ga0495601_0205583 3300053077 Bacteria 1286
1204 Ga0495612_0000014 3300053078 Bacteria 187444
1205 Ga0495612_0004468 3300053078 Bacteria 5803
1206 Ga0495612_0005662 3300053078 Bacteria 5161
1207 Ga0500635_0135741 3300053080 Bacteria 930
1208 Ga0495595_0000182 3300053084 Bacteria 25199
1209 Ga0495595_0014994 3300053084 Bacteria 3298
1210 Ga0495595_0025675 3300053084 Bacteria 2613
1211 Ga0495619_0000006 3300053085 Bacteria 384835
1212 Ga0495619_0002975 3300053085 Bacteria 10999
1213 Ga0495619_0014309 3300053085 Bacteria 5013
1214 Ga0495619_0036592 3300053085 Bacteria 3197
1215 Ga0495619_0094549 3300053085 Bacteria 2027
1216 Ga0495619_0148166 3300053085 Bacteria 1618
1217 Ga0495619_0273788 3300053085 Bacteria 1170
1218 Ga0500566_0031352 3300053094 Bacteria 3100
1219 Ga0500641_0024369 3300053096 Bacteria 2333
1220 Ga0500641_0078732 3300053096 Bacteria 1396
1221 Ga0500641_0088013 3300053096 Bacteria 1324
1222 Ga0500554_034185 3300053102 Bacteria 1520
1223 Ga0500562_008917 3300053108 Bacteria 2534
1224 Ga0500595_003184 3300053119 Bacteria 7768
1225 Ga0500595_007594 3300053119 Bacteria 4491
1226 Ga0500595_008592 3300053119 Bacteria 4167
1227 Ga0500595_035637 3300053119 Bacteria 1636
1228 Ga0500658_0073284 3300053134 Bacteria 1449
1229 Ga0500658_0093262 3300053134 Bacteria 1305
1230 Ga0500568_0051490 3300053139 Bacteria 1619
1231 Ga0500589_054344 3300053147 Bacteria 1851
1232 Ga0500590_077094 3300053148 Bacteria 1645
1233 Ga0500603_021041 3300053150 Bacteria 1600
1234 Ga0500616_0000036 3300053153 Bacteria 390769
1235 Ga0500627_0017660 3300053158 Bacteria 2808
1236 Ga0500638_000448 3300053162 Bacteria 9923
1237 Ga0500639_121992 3300053163 Bacteria 1250
1238 Ga0500637_0003908 3300053178 Bacteria 6954
1239 Ga0500645_053793 3300053730 Bacteria 1171
1240 Ga0501084_0088702 3300054114 Bacteria 2596
1241 Ga0501084_0460880 3300054114 Bacteria 1075
1242 Ga0500661_000254 3300055283 Bacteria 9618
1243 Ga0501082_0004803 3300060353 Bacteria 11786
1244 Ga0466962_0119973 3300061719 Bacteria 1269
1245 Ga0530510_0354842 3300061734 Bacteria 1102

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100502230 Ga0070684_1005022302 210
2 3300025945 Ga0207679_10083188 Ga0207679_100831883 210
3 3300047319 Ga0495674_0727625 Ga0495674_0727625_34_741 235
4 3300047471 Ga0495684_0388659 Ga0495684_0388659_63_770 235
5 3300046491 Ga0495584_0062710 Ga0495584_0062710_189_1067 236
6 3300044712 Ga0453684_0869795 Ga0453684_0869795_45_857 241
7 3300048927 Ga0496124_0231029 Ga0496124_0231029_304_1122 241
8 3300048929 Ga0496126_0020591 Ga0496126_0020591_4295_5113 241
9 3300028666 Ga0265336_10030507 Ga0265336_100305072 242
10 3300031344 Ga0265316_10315350 Ga0265316_103153502 242
11 3300010159 Ga0099796_10051530 Ga0099796_100515301 243
12 3300025921 Ga0207652_10139651 Ga0207652_101396513 244
13 3300042115 Ga0450911_000463 Ga0450911_000463_6461_7279 244
14 3300048915 Ga0496112_0359328 Ga0496112_0359328_190_1014 244
15 3300048918 Ga0496115_0126754 Ga0496115_0126754_400_1143 244
16 3300049581 Ga0501047_0112279 Ga0501047_0112279_885_1718 244
17 3300049586 Ga0501070_0051653 Ga0501070_0051653_2184_3011 244
18 3300049593 Ga0501077_0239881 Ga0501077_0239881_301_1134 244
19 3300049822 Ga0501035_0002405 Ga0501035_0002405_13667_14494 244
20 3300050509 nmdc:mga0qj67_135166_c1 nmdc:mga0qj67_135166_c1_82_912 244
21 3300061734 Ga0530510_0354842 Ga0530510_0354842_133_966 244
22 3300006237 Ga0097621_100402810 Ga0097621_1004028102 246
23 3300046455 Ga0495603_0120284 Ga0495603_0120284_74_898 246
24 3300046472 Ga0495580_0161460 Ga0495580_0161460_240_1064 246
25 3300046499 Ga0495594_0142820 Ga0495594_0142820_52_882 246
26 3300046500 Ga0495596_0084630 Ga0495596_0084630_263_1093 246
27 3300046615 Ga0495656_0090492 Ga0495656_0090492_48_878 246
28 3300003214 JGI25165J46597_1000033 JGI25165J46597_1000033246 247
29 3300003214 JGI25165J46597_1000087 JGI25165J46597_1000087161 247
30 3300006177 Ga0075362_10017898 Ga0075362_100178984 247
31 3300025261 Ga0209233_1000027 Ga0209233_1000027419 247
32 3300048917 Ga0496114_0545555 Ga0496114_0545555_24_767 247
33 3300049574 Ga0501038_0269272 Ga0501038_0269272_363_1199 247
34 3300049823 Ga0501044_0258782 Ga0501044_0258782_163_999 247
35 3300003659 JGI25404J52841_10028431 JGI25404J52841_100284312 248
36 3300005983 Ga0081540_1007687 Ga0081540_10076874 248
37 3300046455 Ga0495603_0131595 Ga0495603_0131595_22_768 248
38 3300048917 Ga0496114_0101111 Ga0496114_0101111_1158_1904 248
39 3300049569 Ga0501032_0158590 Ga0501032_0158590_549_1385 248
40 3300049572 Ga0501036_0262974 Ga0501036_0262974_79_915 248
41 3300049581 Ga0501047_0011598 Ga0501047_0011598_4896_5732 248
42 3300049586 Ga0501070_0036782 Ga0501070_0036782_577_1413 248
43 3300049742 Ga0501080_0044354 Ga0501080_0044354_3104_3940 248
44 3300049822 Ga0501035_0046011 Ga0501035_0046011_1261_2097 248
45 3300049823 Ga0501044_0011580 Ga0501044_0011580_3985_4821 248
46 3300021361 Ga0213872_10012811 Ga0213872_100128114 249
47 3300039447 Ga0436361_0337036 Ga0436361_0337036_3766_4599 249
48 3300050492 nmdc:mga0yw44_154217_c1 nmdc:mga0yw44_154217_c1_433_1260 250
49 3300035113 Ga0373936_0019068 Ga0373936_0019068_1081_1983 252
50 3300035118 Ga0373954_0049410 Ga0373954_0049410_84_986 252
51 3300046663 Ga0495635_0123512 Ga0495635_0123512_249_1082 252
52 3300046690 Ga0495624_0088047 Ga0495624_0088047_820_1722 252
53 3300047319 Ga0495674_0045558 Ga0495674_0045558_1782_2684 252
54 3300049571 Ga0501034_0070974 Ga0501034_0070974_2673_3440 252
55 3300049571 Ga0501034_0520334 Ga0501034_0520334_54_821 252
56 3300049587 Ga0501071_0193364 Ga0501071_0193364_54_821 252
57 3300049823 Ga0501044_0000760 Ga0501044_0000760_16622_17455 252
58 3300048907 Ga0496104_0001524 Ga0496104_0001524_17444_18340 253
59 3300048908 Ga0496105_0067767 Ga0496105_0067767_1324_2220 253
60 3300048911 Ga0496108_0102747 Ga0496108_0102747_1527_2423 253
61 3300048912 Ga0496109_0059126 Ga0496109_0059126_1082_1978 253
62 3300048916 Ga0496113_0041523 Ga0496113_0041523_2347_3243 253
63 3300048924 Ga0496121_0030703 Ga0496121_0030703_2918_3757 254
64 3300048925 Ga0496122_0044469 Ga0496122_0044469_2357_3130 254
65 3300048929 Ga0496126_0004862 Ga0496126_0004862_3212_3985 254
66 3300032005 Ga0307411_10098383 Ga0307411_100983832 255
67 3300061719 Ga0466962_0119973 Ga0466962_0119973_464_1240 255
68 3300006175 Ga0070712_100035165 Ga0070712_1000351653 256
69 3300009098 Ga0105245_10136801 Ga0105245_101368013 256
70 3300025915 Ga0207693_10052868 Ga0207693_100528683 256
71 3300028794 Ga0307515_10112145 Ga0307515_101121452 256
72 3300047472 Ga0495686_0082579 Ga0495686_0082579_925_1761 256
73 3300053108 Ga0500562_008917 Ga0500562_008917_1247_2083 256
74 3300049571 Ga0501034_0002182 Ga0501034_0002182_15352_16173 257
75 3300049572 Ga0501036_0000242 Ga0501036_0000242_23889_24701 257
76 3300049574 Ga0501038_0285424 Ga0501038_0285424_343_1155 257
77 3300049584 Ga0501068_0007168 Ga0501068_0007168_2624_3445 257
78 3300049586 Ga0501070_0009345 Ga0501070_0009345_1278_2090 257
79 3300049823 Ga0501044_0007764 Ga0501044_0007764_1993_2814 257
80 3300053119 Ga0500595_008592 Ga0500595_008592_241_1068 257
81 3300053153 Ga0500616_0000036 Ga0500616_0000036_349354_350193 257
82 3300054114 Ga0501084_0460880 Ga0501084_0460880_245_1057 257
83 3300035725 Ga0373947_0063774 Ga0373947_0063774_611_1513 258
84 3300047320 Ga0495672_0103149 Ga0495672_0103149_158_985 258
85 3300047321 Ga0495676_0084451 Ga0495676_0084451_280_1182 258
86 3300005337 Ga0070682_100144487 Ga0070682_1001444872 259
87 3300005458 Ga0070681_10003583 Ga0070681_100035834 259
88 3300005530 Ga0070679_100017206 Ga0070679_1000172064 259
89 3300010375 Ga0105239_10216339 Ga0105239_102163392 259
90 3300025912 Ga0207707_10000173 Ga0207707_1000017348 259
91 3300025917 Ga0207660_10026034 Ga0207660_100260344 259
92 3300026095 Ga0207676_10403062 Ga0207676_104030622 259
93 3300028794 Ga0307515_10280587 Ga0307515_102805872 259
94 3300041451 Ga0451791_0758265 Ga0451791_0758265_304_1146 259
95 3300042876 Ga0451577_0235541 Ga0451577_0235541_745_1557 259
96 3300044712 Ga0453684_0009414 Ga0453684_0009414_9253_10065 259
97 3300046558 Ga0495633_0241681 Ga0495633_0241681_27_815 259
98 3300046674 Ga0495588_0180414 Ga0495588_0180414_17_805 259
99 3300048909 Ga0496106_0286344 Ga0496106_0286344_520_1308 259
100 3300053085 Ga0495619_0273788 Ga0495619_0273788_142_942 259
101 3300053139 Ga0500568_0051490 Ga0500568_0051490_300_1127 259
102 3300031238 Ga0265332_10003501 Ga0265332_100035013 260
103 3300031247 Ga0265340_10016232 Ga0265340_100162324 260
104 3300031250 Ga0265331_10070769 Ga0265331_100707692 260
105 3300031711 Ga0265314_10063589 Ga0265314_100635893 260
106 3300031712 Ga0265342_10001629 Ga0265342_100016295 260
107 3300039447 Ga0436361_0696146 Ga0436361_0696146_539_1405 260
108 3300005842 Ga0068858_100079726 Ga0068858_1000797262 261
109 3300009098 Ga0105245_10008002 Ga0105245_100080027 261
110 3300009177 Ga0105248_10356426 Ga0105248_103564262 261
111 3300025927 Ga0207687_10005525 Ga0207687_100055252 261
112 3300025941 Ga0207711_10188461 Ga0207711_101884612 261
113 3300025942 Ga0207689_10299982 Ga0207689_102999822 261
114 3300026095 Ga0207676_10367455 Ga0207676_103674552 261
115 3300031730 Ga0307516_10106088 Ga0307516_101060883 261
116 3300039437 Ga0436365_0356953 Ga0436365_0356953_51_845 261
117 iso_pu_bacteria 2513237098 2513673673 261
118 iso_pu_bacteria 2524023210 2524470658 261
119 iso_pu_bacteria 2885383462 2885389434 261
120 iso_pu_bacteria 2903768456 2903775045 261
121 iso_pu_bacteria 8056681323 8056683975 261
122 3300005844 Ga0068862_100191733 Ga0068862_1001917333 262
123 3300025940 Ga0207691_10061758 Ga0207691_100617582 262
124 3300026118 Ga0207675_100078878 Ga0207675_1000788783 262
125 3300037466 Ga0395898_0358675 Ga0395898_0358675_333_1133 263
126 3300044694 Ga0466963_0159422 Ga0466963_0159422_431_1270 263
127 3300006177 Ga0075362_10157868 Ga0075362_101578681 264
128 3300035171 Ga0373946_0008437 Ga0373946_0008437_847_1749 264
129 3300037068 Ga0373925_0027532 Ga0373925_0027532_1421_2323 264
130 3300046472 Ga0495580_0013227 Ga0495580_0013227_1586_2488 264
131 3300046529 Ga0495652_0181442 Ga0495652_0181442_262_1164 264
132 3300046531 Ga0495665_0029046 Ga0495665_0029046_1025_1927 264
133 3300046533 Ga0495640_0006608 Ga0495640_0006608_752_1654 264
134 3300046559 Ga0495667_0035701 Ga0495667_0035701_1605_2507 264
135 3300046642 Ga0495634_0020673 Ga0495634_0020673_1586_2488 264
136 3300046681 Ga0495647_0092453 Ga0495647_0092453_180_1082 264
137 3300047471 Ga0495684_0015335 Ga0495684_0015335_1044_1946 264
138 3300047472 Ga0495686_0037232 Ga0495686_0037232_2013_2846 264
139 3300048911 Ga0496108_0326572 Ga0496108_0326572_437_1240 264
140 3300048929 Ga0496126_0428315 Ga0496126_0428315_220_1053 264
141 3300049571 Ga0501034_0000933 Ga0501034_0000933_39226_40059 264
142 3300049575 Ga0501039_0415761 Ga0501039_0415761_140_973 264
143 3300049579 Ga0501043_0004230 Ga0501043_0004230_5417_6250 264
144 3300049581 Ga0501047_0000073 Ga0501047_0000073_50541_51374 264
145 3300049582 Ga0501048_0000014 Ga0501048_0000014_42049_42882 264
146 3300049742 Ga0501080_0000187 Ga0501080_0000187_18989_19822 264
147 3300049744 Ga0501083_0000398 Ga0501083_0000398_20333_21166 264
148 3300049823 Ga0501044_0030537 Ga0501044_0030537_1774_2607 264
149 3300053085 Ga0495619_0036592 Ga0495619_0036592_1248_2150 264
150 3300005842 Ga0068858_100581983 Ga0068858_1005819832 265
151 3300026088 Ga0207641_10457066 Ga0207641_104570661 265
152 3300028666 Ga0265336_10002438 Ga0265336_100024386 265
153 3300029957 Ga0265324_10000005 Ga0265324_10000005317 265
154 3300029957 Ga0265324_10030827 Ga0265324_100308271 265
155 3300031241 Ga0265325_10000275 Ga0265325_100002758 265
156 3300031616 Ga0307508_10221025 Ga0307508_102210252 265
157 3300031711 Ga0265314_10018722 Ga0265314_100187222 265
158 3300037068 Ga0373925_0007182 Ga0373925_0007182_7104_7931 265
159 iso_pu_bacteria 8056689827 8056690838 265
160 3300005329 Ga0070683_100191712 Ga0070683_1001917123 266
161 3300005338 Ga0068868_100007160 Ga0068868_1000071602 266
162 3300005364 Ga0070673_100860993 Ga0070673_1008609931 266
163 3300005981 Ga0081538_10011066 Ga0081538_100110667 266
164 3300006237 Ga0097621_100079744 Ga0097621_1000797444 266
165 3300011119 Ga0105246_10010454 Ga0105246_100104544 266
166 3300013296 Ga0157374_10075314 Ga0157374_100753144 266
167 3300013308 Ga0157375_10006361 Ga0157375_100063617 266
168 3300014968 Ga0157379_10594393 Ga0157379_105943932 266
169 3300025915 Ga0207693_10024429 Ga0207693_100244292 266
170 3300025944 Ga0207661_10357003 Ga0207661_103570032 266
171 3300031711 Ga0265314_10103425 Ga0265314_101034253 266
172 3300041512 Ga0451853_2143278 Ga0451853_2143278_514_1323 266
173 3300046517 Ga0495630_0119190 Ga0495630_0119190_524_1339 266
174 3300046529 Ga0495652_0141972 Ga0495652_0141972_154_963 266
175 3300046689 Ga0495613_0133652 Ga0495613_0133652_49_864 266
176 3300048903 Ga0496100_0050336 Ga0496100_0050336_1278_2087 266
177 3300048904 Ga0496101_0005444 Ga0496101_0005444_2456_3265 266
178 3300048906 Ga0496103_0031466 Ga0496103_0031466_75_884 266
179 3300048907 Ga0496104_0361717 Ga0496104_0361717_165_974 266
180 3300048908 Ga0496105_0021910 Ga0496105_0021910_103_912 266
181 3300048912 Ga0496109_0047987 Ga0496109_0047987_893_1702 266
182 3300048913 Ga0496110_0044959 Ga0496110_0044959_398_1207 266
183 3300048916 Ga0496113_0369931 Ga0496113_0369931_76_885 266
184 3300048918 Ga0496115_0313612 Ga0496115_0313612_53_862 266
185 3300048929 Ga0496126_0030165 Ga0496126_0030165_397_1206 266
186 3300049570 Ga0501033_0018756 Ga0501033_0018756_2719_3555 266
187 iso_pu_bacteria 2508501128 2509154168 266
188 3300009101 Ga0105247_10043195 Ga0105247_100431951 267
189 3300013297 Ga0157378_10328021 Ga0157378_103280212 267
190 3300025933 Ga0207706_10475257 Ga0207706_104752571 267
191 3300031995 Ga0307409_100155964 Ga0307409_1001559642 267
192 3300035695 Ga0373927_0114196 Ga0373927_0114196_38_868 267
193 3300039437 Ga0436365_1447372 Ga0436365_1447372_137_949 267
194 3300039437 Ga0436365_1891193 Ga0436365_1891193_50_871 267
195 3300046455 Ga0495603_0046248 Ga0495603_0046248_1510_2322 267
196 3300046512 Ga0495610_0042191 Ga0495610_0042191_156_968 267
197 3300046519 Ga0495632_0041392 Ga0495632_0041392_28_840 267
198 3300046557 Ga0495622_0022552 Ga0495622_0022552_367_1179 267
199 3300046615 Ga0495656_0113401 Ga0495656_0113401_219_1031 267
200 3300046615 Ga0495656_0132881 Ga0495656_0132881_336_1148 267
201 3300046616 Ga0495668_0061227 Ga0495668_0061227_826_1638 267
202 3300048924 Ga0496121_0295982 Ga0496121_0295982_192_1004 267
203 3300048929 Ga0496126_0014034 Ga0496126_0014034_4428_5240 267
204 3300048929 Ga0496126_0049099 Ga0496126_0049099_2734_3546 267
205 3300053119 Ga0500595_035637 Ga0500595_035637_610_1422 267
206 3300053148 Ga0500590_077094 Ga0500590_077094_788_1600 267
207 3300005467 Ga0070706_100129470 Ga0070706_1001294703 268
208 3300005471 Ga0070698_100627416 Ga0070698_1006274161 268
209 3300005530 Ga0070679_100497797 Ga0070679_1004977971 268
210 3300005983 Ga0081540_1013951 Ga0081540_10139515 268
211 3300006028 Ga0070717_10573725 Ga0070717_105737251 268
212 3300006048 Ga0075363_100017455 Ga0075363_1000174553 268
213 3300006195 Ga0075366_10041040 Ga0075366_100410402 268
214 3300007076 Ga0075435_100265293 Ga0075435_1002652932 268
215 3300009147 Ga0114129_10525711 Ga0114129_105257111 268
216 3300025253 Ga0209677_100384 Ga0209677_10038413 268
217 3300025261 Ga0209233_1000823 Ga0209233_10008239 268
218 3300025921 Ga0207652_10297946 Ga0207652_102979461 268
219 3300028794 Ga0307515_10438062 Ga0307515_104380622 268
220 3300031665 Ga0316575_10033914 Ga0316575_100339142 268
221 3300031728 Ga0316578_10044206 Ga0316578_100442062 268
222 3300035113 Ga0373936_0047360 Ga0373936_0047360_485_1300 268
223 3300035398 Ga0316574_0001571 Ga0316574_0001571_7028_7852 268
224 3300036712 Ga0316584_0014288 Ga0316584_0014288_2477_3301 268
225 3300037466 Ga0395898_0024634 Ga0395898_0024634_991_1809 268
226 3300037466 Ga0395898_0346845 Ga0395898_0346845_516_1355 268
227 3300037471 Ga0395905_0051168 Ga0395905_0051168_283_1122 268
228 3300045049 Ga0466959_0196160 Ga0466959_0196160_554_1369 268
229 3300045976 Ga0466967_0078248 Ga0466967_0078248_2060_2875 268
230 3300046455 Ga0495603_0271863 Ga0495603_0271863_62_904 268
231 3300047320 Ga0495672_0103306 Ga0495672_0103306_557_1438 268
232 3300048915 Ga0496112_0109906 Ga0496112_0109906_509_1327 268
233 3300048921 Ga0496118_0076571 Ga0496118_0076571_187_1002 268
234 3300048924 Ga0496121_0395981 Ga0496121_0395981_66_881 268
235 3300050490 nmdc:mga03n38_35453_c1 nmdc:mga03n38_35453_c1_694_1509 268
236 3300050491 nmdc:mga00v17_299054_c1 nmdc:mga00v17_299054_c1_162_995 268
237 3300050510 nmdc:mga06r32_620656_c1 nmdc:mga06r32_620656_c1_50_883 268
238 3300005444 Ga0070694_100096498 Ga0070694_1000964982 269
239 3300005563 Ga0068855_100837186 Ga0068855_1008371862 269
240 3300025302 Ga0207426_1017876 Ga0207426_10178764 269
241 3300025925 Ga0207650_10042538 Ga0207650_100425383 269
242 3300025937 Ga0207669_10196220 Ga0207669_101962202 269
243 3300025960 Ga0207651_10154455 Ga0207651_101544552 269
244 3300027360 Ga0209969_1002713 Ga0209969_10027132 269
245 3300027462 Ga0210000_1001181 Ga0210000_10011814 269
246 3300027471 Ga0209995_1006663 Ga0209995_10066631 269
247 3300027876 Ga0209974_10004365 Ga0209974_100043652 269
248 3300039437 Ga0436365_0669858 Ga0436365_0669858_709_1527 269
249 3300049588 Ga0501072_0001047 Ga0501072_0001047_14891_15709 269
250 3300050494 nmdc:mga06z11_76491_c1 nmdc:mga06z11_76491_c1_27_860 269
251 iso_pu_bacteria 2643221595 2643985075 269
252 iso_pu_bacteria 2728368998 2728750428 269
253 iso_pu_bacteria 3005710791 3005713221 269
254 3300005354 Ga0070675_100294084 Ga0070675_1002940843 270
255 3300005365 Ga0070688_100089020 Ga0070688_1000890202 270
256 3300005844 Ga0068862_100668954 Ga0068862_1006689542 270
257 3300009098 Ga0105245_10879512 Ga0105245_108795121 270
258 3300021388 Ga0213875_10007330 Ga0213875_100073306 270
259 3300025926 Ga0207659_10256933 Ga0207659_102569333 270
260 3300025936 Ga0207670_10207029 Ga0207670_102070293 270
261 3300025939 Ga0207665_10086816 Ga0207665_100868162 270
262 3300028379 Ga0268266_10276362 Ga0268266_102763622 270
263 3300037853 Ga0436364_1355688 Ga0436364_1355688_19766_20614 270
264 3300041408 Ga0439453_0000298 Ga0439453_0000298_3321_4145 270
265 3300042003 Ga0439443_006608 Ga0439443_006608_737_1561 270
266 3300042436 Ga0439435_0097964 Ga0439435_0097964_56_880 270
267 3300046477 Ga0495664_0004879 Ga0495664_0004879_5059_5907 270
268 3300046543 Ga0495645_0015634 Ga0495645_0015634_1946_2794 270
269 3300046678 Ga0495599_0011481 Ga0495599_0011481_3604_4452 270
270 3300048929 Ga0496126_0072937 Ga0496126_0072937_2085_2906 270
271 3300049571 Ga0501034_0001822 Ga0501034_0001822_11662_12483 270
272 3300049571 Ga0501034_0096343 Ga0501034_0096343_1884_2720 270
273 3300049776 Ga0501280_008804 Ga0501280_008804_298_1131 270
274 3300053078 Ga0495612_0005662 Ga0495612_0005662_2777_3625 270
275 iso_pu_bacteria 2513237101 2513694561 270
276 iso_pu_bacteria 2513237104 2513720124 270
277 iso_pu_bacteria 2524023205 2524439386 270
278 iso_pu_bacteria 2643221550 2643770908 270
279 iso_pu_bacteria 2643221651 2644287479 270
280 iso_pu_bacteria 2721755755 2723842372 270
281 iso_pu_bacteria 2744054633 2745078098 270
282 iso_pu_bacteria 2791355199 2793079002 270
283 iso_pu_bacteria 2874604998 2874608936 270
284 iso_pu_bacteria 2876808645 2876810096 270
285 iso_pu_bacteria 2879110137 2879112393 270
286 iso_pu_bacteria 2889033259 2889034713 270
287 iso_pu_bacteria 2908739725 2908739835 270
288 iso_pu_bacteria 2922361189 2922364819 270
289 iso_pu_bacteria 2922386360 2922391725 270
290 iso_pu_bacteria 2996336353 2996340832 270
291 iso_pu_bacteria 3005474847 3005476187 270
292 iso_pu_bacteria 8006926726 8006929699 270
293 iso_pu_bacteria 8006964411 8006965155 270
294 iso_pu_bacteria 8006984368 8006987248 270
295 iso_pu_bacteria 8006994254 8006995401 270
296 iso_pu_bacteria 8056673599 8056679090 270
297 3300005339 Ga0070660_100016043 Ga0070660_1000160432 271
298 3300005355 Ga0070671_100120177 Ga0070671_1001201772 271
299 3300005456 Ga0070678_100390470 Ga0070678_1003904701 271
300 3300005458 Ga0070681_10019283 Ga0070681_100192832 271
301 3300005467 Ga0070706_100065025 Ga0070706_1000650255 271
302 3300005468 Ga0070707_100181967 Ga0070707_1001819672 271
303 3300005471 Ga0070698_100081539 Ga0070698_1000815393 271
304 3300005530 Ga0070679_100151366 Ga0070679_1001513662 271
305 3300005544 Ga0070686_100029775 Ga0070686_1000297752 271
306 3300005718 Ga0068866_10092115 Ga0068866_100921152 271
307 3300005937 Ga0081455_10048471 Ga0081455_100484712 271
308 3300006195 Ga0075366_10035333 Ga0075366_100353333 271
309 3300009177 Ga0105248_10155990 Ga0105248_101559902 271
310 3300009551 Ga0105238_10082285 Ga0105238_100822855 271
311 3300013308 Ga0157375_10809922 Ga0157375_108099222 271
312 3300025297 Ga0209758_1000257 Ga0209758_100025715 271
313 3300025910 Ga0207684_10094446 Ga0207684_100944463 271
314 3300025915 Ga0207693_10029456 Ga0207693_100294563 271
315 3300025917 Ga0207660_10084621 Ga0207660_100846211 271
316 3300025919 Ga0207657_10093213 Ga0207657_100932133 271
317 3300025921 Ga0207652_10067896 Ga0207652_100678965 271
318 3300025922 Ga0207646_10151434 Ga0207646_101514342 271
319 3300025928 Ga0207700_10123458 Ga0207700_101234582 271
320 3300025928 Ga0207700_10183102 Ga0207700_101831022 271
321 3300025939 Ga0207665_10173940 Ga0207665_101739402 271
322 3300025942 Ga0207689_10214602 Ga0207689_102146022 271
323 3300026078 Ga0207702_10047126 Ga0207702_100471262 271
324 3300026121 Ga0207683_10284911 Ga0207683_102849113 271
325 3300028379 Ga0268266_10315468 Ga0268266_103154682 271
326 3300028381 Ga0268264_10050796 Ga0268264_100507964 271
327 3300034816 Ga0373930_0031559 Ga0373930_0031559_73_897 271
328 3300035410 Ga0373924_0003203 Ga0373924_0003203_4526_5428 271
329 3300035691 Ga0373931_0169218 Ga0373931_0169218_350_1174 271
330 3300035692 Ga0373935_0465570 Ga0373935_0465570_79_903 271
331 3300035695 Ga0373927_0006658 Ga0373927_0006658_5272_6102 271
332 3300035695 Ga0373927_0026143 Ga0373927_0026143_374_1276 271
333 3300037068 Ga0373925_0088194 Ga0373925_0088194_213_1043 271
334 3300039437 Ga0436365_0079213 Ga0436365_0079213_1210_2037 271
335 3300046473 Ga0495582_0018146 Ga0495582_0018146_2349_3251 271
336 3300046475 Ga0495639_0013941 Ga0495639_0013941_514_1416 271
337 3300046477 Ga0495664_0019627 Ga0495664_0019627_2363_3265 271
338 3300046536 Ga0495587_0105210 Ga0495587_0105210_130_954 271
339 3300046683 Ga0495658_0333745 Ga0495658_0333745_50_880 271
340 3300046809 Ga0495600_0067583 Ga0495600_0067583_342_1244 271
341 3300047315 Ga0495581_0170545 Ga0495581_0170545_365_1195 271
342 3300047673 Ga0495593_0048014 Ga0495593_0048014_170_1072 271
343 3300048089 Ga0495614_0053533 Ga0495614_0053533_374_1204 271
344 3300048903 Ga0496100_0160883 Ga0496100_0160883_85_909 271
345 3300048905 Ga0496102_0072817 Ga0496102_0072817_2164_2988 271
346 3300048907 Ga0496104_0104086 Ga0496104_0104086_1714_2538 271
347 3300048908 Ga0496105_0015352 Ga0496105_0015352_3019_3843 271
348 3300048913 Ga0496110_0184059 Ga0496110_0184059_455_1291 271
349 3300048914 Ga0496111_0051596 Ga0496111_0051596_2131_2955 271
350 3300048915 Ga0496112_0154474 Ga0496112_0154474_899_1735 271
351 3300048916 Ga0496113_0059668 Ga0496113_0059668_111_947 271
352 3300048916 Ga0496113_0233762 Ga0496113_0233762_54_878 271
353 3300048917 Ga0496114_0054940 Ga0496114_0054940_275_1099 271
354 3300048918 Ga0496115_0066112 Ga0496115_0066112_637_1461 271
355 3300048924 Ga0496121_0058249 Ga0496121_0058249_224_1048 271
356 3300049593 Ga0501077_0270992 Ga0501077_0270992_194_1030 271
357 3300050491 nmdc:mga00v17_23514_c1 nmdc:mga00v17_23514_c1_2630_3502 271
358 3300050492 nmdc:mga0yw44_18489_c1 nmdc:mga0yw44_18489_c1_84_956 271
359 3300050493 nmdc:mga0k408_15360_c1 nmdc:mga0k408_15360_c1_53_877 271
360 3300050514 nmdc:mga08x19_249656_c1 nmdc:mga08x19_249656_c1_63_899 271
361 3300053084 Ga0495595_0025675 Ga0495595_0025675_1448_2272 271
362 3300053085 Ga0495619_0094549 Ga0495619_0094549_329_1153 271
363 3300053094 Ga0500566_0031352 Ga0500566_0031352_1646_2470 271
364 3300053102 Ga0500554_034185 Ga0500554_034185_353_1177 271
365 3300053119 Ga0500595_003184 Ga0500595_003184_3491_4315 271
366 3300053119 Ga0500595_007594 Ga0500595_007594_852_1676 271
367 3300053150 Ga0500603_021041 Ga0500603_021041_57_881 271
368 3300053162 Ga0500638_000448 Ga0500638_000448_8134_8958 271
369 3300053178 Ga0500637_0003908 Ga0500637_0003908_1331_2155 271
370 3300055283 Ga0500661_000254 Ga0500661_000254_3592_4416 271
371 iso_pu_bacteria 2523231067 2523469108 271
372 iso_pu_bacteria 2643221564 2643838212 271
373 iso_pu_bacteria 2738543031 2739351953 271
374 iso_pu_bacteria 2857524615 2857529787 271
375 3300003659 JGI25404J52841_10003411 JGI25404J52841_100034111 272
376 3300003762 Ga0055542_1009052 Ga0055542_10090522 272
377 3300005336 Ga0070680_100020280 Ga0070680_1000202803 272
378 3300005336 Ga0070680_100022812 Ga0070680_1000228125 272
379 3300005406 Ga0070703_10004707 Ga0070703_100047074 272
380 3300005435 Ga0070714_100130067 Ga0070714_1001300672 272
381 3300005436 Ga0070713_100289289 Ga0070713_1002892892 272
382 3300005436 Ga0070713_100339479 Ga0070713_1003394791 272
383 3300005437 Ga0070710_10038211 Ga0070710_100382112 272
384 3300005438 Ga0070701_10076488 Ga0070701_100764882 272
385 3300005439 Ga0070711_100245935 Ga0070711_1002459351 272
386 3300005439 Ga0070711_100404754 Ga0070711_1004047541 272
387 3300005440 Ga0070705_100000025 Ga0070705_10000002560 272
388 3300005444 Ga0070694_100002659 Ga0070694_1000026597 272
389 3300005444 Ga0070694_100039128 Ga0070694_1000391283 272
390 3300005457 Ga0070662_100271656 Ga0070662_1002716562 272
391 3300005458 Ga0070681_10020454 Ga0070681_100204544 272
392 3300005518 Ga0070699_100005455 Ga0070699_1000054556 272
393 3300005530 Ga0070679_100055345 Ga0070679_1000553454 272
394 3300005530 Ga0070679_100091499 Ga0070679_1000914992 272
395 3300005536 Ga0070697_100039826 Ga0070697_1000398263 272
396 3300005539 Ga0068853_100040297 Ga0068853_1000402975 272
397 3300005545 Ga0070695_100001562 Ga0070695_1000015628 272
398 3300005545 Ga0070695_100042426 Ga0070695_1000424262 272
399 3300005546 Ga0070696_100006938 Ga0070696_1000069382 272
400 3300005546 Ga0070696_100269342 Ga0070696_1002693422 272
401 3300005547 Ga0070693_100015729 Ga0070693_1000157292 272
402 3300005548 Ga0070665_100017279 Ga0070665_1000172793 272
403 3300005548 Ga0070665_100105910 Ga0070665_1001059102 272
404 3300005563 Ga0068855_100342016 Ga0068855_1003420162 272
405 3300005577 Ga0068857_100019837 Ga0068857_1000198372 272
406 3300005577 Ga0068857_100264315 Ga0068857_1002643151 272
407 3300005614 Ga0068856_100670610 Ga0068856_1006706102 272
408 3300005617 Ga0068859_100001168 Ga0068859_10000116824 272
409 3300005618 Ga0068864_100298750 Ga0068864_1002987502 272
410 3300005844 Ga0068862_100002691 Ga0068862_1000026914 272
411 3300005937 Ga0081455_10067232 Ga0081455_100672323 272
412 3300005983 Ga0081540_1001030 Ga0081540_100103017 272
413 3300005983 Ga0081540_1001133 Ga0081540_100113313 272
414 3300005983 Ga0081540_1035627 Ga0081540_10356272 272
415 3300005983 Ga0081540_1098779 Ga0081540_10987792 272
416 3300006028 Ga0070717_10075229 Ga0070717_100752292 272
417 3300006038 Ga0075365_10289724 Ga0075365_102897241 272
418 3300006048 Ga0075363_100117604 Ga0075363_1001176042 272
419 3300006173 Ga0070716_100073068 Ga0070716_1000730683 272
420 3300006175 Ga0070712_100073137 Ga0070712_1000731372 272
421 3300006175 Ga0070712_100097031 Ga0070712_1000970312 272
422 3300006175 Ga0070712_100136565 Ga0070712_1001365652 272
423 3300006178 Ga0075367_10054935 Ga0075367_100549353 272
424 3300006195 Ga0075366_10001716 Ga0075366_1000171611 272
425 3300006844 Ga0075428_100129570 Ga0075428_1001295703 272
426 3300006847 Ga0075431_100060089 Ga0075431_1000600896 272
427 3300006871 Ga0075434_100149486 Ga0075434_1001494863 272
428 3300006880 Ga0075429_100008549 Ga0075429_1000085494 272
429 3300006931 Ga0097620_100001168 Ga0097620_1000011683 272
430 3300007788 Ga0099795_10010883 Ga0099795_100108833 272
431 3300009098 Ga0105245_10388880 Ga0105245_103888802 272
432 3300009147 Ga0114129_10104178 Ga0114129_101041781 272
433 3300009148 Ga0105243_10773495 Ga0105243_107734951 272
434 3300009553 Ga0105249_10000605 Ga0105249_1000060518 272
435 3300009553 Ga0105249_10003429 Ga0105249_100034294 272
436 3300010375 Ga0105239_10432352 Ga0105239_104323522 272
437 3300013104 Ga0157370_10346516 Ga0157370_103465162 272
438 3300013297 Ga0157378_10083134 Ga0157378_100831342 272
439 3300025254 Ga0209148_1000634 Ga0209148_100063423 272
440 3300025272 Ga0209455_1001165 Ga0209455_100116510 272
441 3300025885 Ga0207653_10007423 Ga0207653_100074234 272
442 3300025898 Ga0207692_10012694 Ga0207692_100126943 272
443 3300025906 Ga0207699_10010856 Ga0207699_100108565 272
444 3300025912 Ga0207707_10017551 Ga0207707_100175514 272
445 3300025915 Ga0207693_10072525 Ga0207693_100725254 272
446 3300025915 Ga0207693_10147439 Ga0207693_101474391 272
447 3300025915 Ga0207693_10286642 Ga0207693_102866421 272
448 3300025917 Ga0207660_10001377 Ga0207660_1000137712 272
449 3300025921 Ga0207652_10015359 Ga0207652_100153597 272
450 3300025921 Ga0207652_10321879 Ga0207652_103218792 272
451 3300025925 Ga0207650_10293599 Ga0207650_102935991 272
452 3300025927 Ga0207687_10359117 Ga0207687_103591172 272
453 3300025928 Ga0207700_10154525 Ga0207700_101545251 272
454 3300025928 Ga0207700_10159266 Ga0207700_101592662 272
455 3300025929 Ga0207664_10004269 Ga0207664_100042693 272
456 3300025939 Ga0207665_10015911 Ga0207665_100159115 272
457 3300025961 Ga0207712_10004527 Ga0207712_100045276 272
458 3300025961 Ga0207712_10005753 Ga0207712_100057535 272
459 3300025986 Ga0207658_10329026 Ga0207658_103290261 272
460 3300026041 Ga0207639_10312492 Ga0207639_103124921 272
461 3300026075 Ga0207708_10012241 Ga0207708_100122412 272
462 3300026095 Ga0207676_10303254 Ga0207676_103032542 272
463 3300026116 Ga0207674_10015659 Ga0207674_100156592 272
464 3300026118 Ga0207675_100042614 Ga0207675_1000426142 272
465 3300026142 Ga0207698_10064654 Ga0207698_100646543 272
466 3300028379 Ga0268266_10077532 Ga0268266_100775322 272
467 3300028380 Ga0268265_10012069 Ga0268265_100120694 272
468 3300028381 Ga0268264_10006067 Ga0268264_100060677 272
469 3300028381 Ga0268264_10172214 Ga0268264_101722143 272
470 3300028573 Ga0265334_10011486 Ga0265334_100114864 272
471 3300028577 Ga0265318_10064691 Ga0265318_100646912 272
472 3300031235 Ga0265330_10030697 Ga0265330_100306972 272
473 3300031241 Ga0265325_10105730 Ga0265325_101057302 272
474 3300031247 Ga0265340_10111774 Ga0265340_101117741 272
475 3300031250 Ga0265331_10058615 Ga0265331_100586152 272
476 3300031712 Ga0265342_10046005 Ga0265342_100460053 272
477 3300032002 Ga0307416_100404360 Ga0307416_1004043602 272
478 3300035113 Ga0373936_0000188 Ga0373936_0000188_12817_13644 272
479 3300035117 Ga0373953_0001135 Ga0373953_0001135_2461_3288 272
480 3300035118 Ga0373954_0001716 Ga0373954_0001716_3167_3994 272
481 3300035170 Ga0373943_0003598 Ga0373943_0003598_4083_4910 272
482 3300035171 Ga0373946_0004585 Ga0373946_0004585_2042_2869 272
483 3300035172 Ga0373955_0000706 Ga0373955_0000706_2046_2873 272
484 3300035410 Ga0373924_0000657 Ga0373924_0000657_6089_6916 272
485 3300035692 Ga0373935_0000021 Ga0373935_0000021_31620_32447 272
486 3300035695 Ga0373927_0009946 Ga0373927_0009946_3657_4484 272
487 3300035724 Ga0373933_0011288 Ga0373933_0011288_1225_2052 272
488 3300035725 Ga0373947_0000479 Ga0373947_0000479_10210_11037 272
489 3300036401 Ga0373937_0000003 Ga0373937_0000003_48229_49056 272
490 3300036401 Ga0373937_0254715 Ga0373937_0254715_512_1339 272
491 3300037068 Ga0373925_0000118 Ga0373925_0000118_24494_25321 272
492 3300046454 Ga0495592_0000215 Ga0495592_0000215_35685_36512 272
493 3300046462 Ga0495651_0000371 Ga0495651_0000371_21811_22638 272
494 3300046463 Ga0495653_0000039 Ga0495653_0000039_33138_33965 272
495 3300046476 Ga0495662_0002873 Ga0495662_0002873_4721_5548 272
496 3300046477 Ga0495664_0000015 Ga0495664_0000015_153606_154433 272
497 3300046511 Ga0495608_0000025 Ga0495608_0000025_147131_147958 272
498 3300046511 Ga0495608_0066690 Ga0495608_0066690_130_957 272
499 3300046514 Ga0495618_0000040 Ga0495618_0000040_58958_59785 272
500 3300046514 Ga0495618_0206114 Ga0495618_0206114_297_1124 272
501 3300046516 Ga0495628_0000011 Ga0495628_0000011_186353_187180 272
502 3300046517 Ga0495630_0001070 Ga0495630_0001070_15359_16186 272
503 3300046529 Ga0495652_0000014 Ga0495652_0000014_38305_39132 272
504 3300046531 Ga0495665_0018416 Ga0495665_0018416_698_1525 272
505 3300046533 Ga0495640_0000008 Ga0495640_0000008_186353_187180 272
506 3300046536 Ga0495587_0000015 Ga0495587_0000015_33111_33938 272
507 3300046543 Ga0495645_0000205 Ga0495645_0000205_3194_4021 272
508 3300046559 Ga0495667_0000013 Ga0495667_0000013_186339_187166 272
509 3300046642 Ga0495634_0000397 Ga0495634_0000397_23663_24490 272
510 3300046663 Ga0495635_0000012 Ga0495635_0000012_38092_38919 272
511 3300046663 Ga0495635_0231983 Ga0495635_0231983_15_842 272
512 3300046675 Ga0495657_0000392 Ga0495657_0000392_28485_29312 272
513 3300046678 Ga0495599_0000008 Ga0495599_0000008_38355_39182 272
514 3300046679 Ga0495623_0000002 Ga0495623_0000002_160537_161364 272
515 3300046680 Ga0495646_0000004 Ga0495646_0000004_235007_235834 272
516 3300046683 Ga0495658_0067118 Ga0495658_0067118_95_922 272
517 3300046689 Ga0495613_0092092 Ga0495613_0092092_284_1111 272
518 3300046690 Ga0495624_0010384 Ga0495624_0010384_1465_2292 272
519 3300046809 Ga0495600_0000164 Ga0495600_0000164_25664_26491 272
520 3300047317 Ga0495604_0000001 Ga0495604_0000001_470946_471773 272
521 3300047319 Ga0495674_0000023 Ga0495674_0000023_123395_124222 272
522 3300047321 Ga0495676_0080274 Ga0495676_0080274_471_1298 272
523 3300047322 Ga0495680_0000341 Ga0495680_0000341_26524_27351 272
524 3300047444 Ga0495675_0000315 Ga0495675_0000315_31763_32590 272
525 3300047471 Ga0495684_0000007 Ga0495684_0000007_38165_38992 272
526 3300047673 Ga0495593_0000806 Ga0495593_0000806_2840_3667 272
527 3300048088 Ga0495602_0000157 Ga0495602_0000157_29024_29851 272
528 3300048088 Ga0495602_0101775 Ga0495602_0101775_12_839 272
529 3300048905 Ga0496102_0001321 Ga0496102_0001321_4025_4852 272
530 3300048905 Ga0496102_0275217 Ga0496102_0275217_397_1224 272
531 3300048907 Ga0496104_0632991 Ga0496104_0632991_27_854 272
532 3300048909 Ga0496106_0003944 Ga0496106_0003944_295_1122 272
533 3300048909 Ga0496106_0468090 Ga0496106_0468090_168_995 272
534 3300048910 Ga0496107_0003324 Ga0496107_0003324_3792_4619 272
535 3300048910 Ga0496107_0107623 Ga0496107_0107623_744_1571 272
536 3300048913 Ga0496110_0040479 Ga0496110_0040479_2426_3253 272
537 3300048915 Ga0496112_0000009 Ga0496112_0000009_195812_196648 272
538 3300048915 Ga0496112_0022204 Ga0496112_0022204_4784_5611 272
539 3300048918 Ga0496115_0157970 Ga0496115_0157970_228_1055 272
540 3300048924 Ga0496121_0000091 Ga0496121_0000091_62812_63639 272
541 3300049572 Ga0501036_0120809 Ga0501036_0120809_1046_1873 272
542 3300049580 Ga0501046_0031030 Ga0501046_0031030_2455_3282 272
543 3300049581 Ga0501047_0093548 Ga0501047_0093548_1761_2588 272
544 3300049823 Ga0501044_0175676 Ga0501044_0175676_417_1244 272
545 3300050490 nmdc:mga03n38_2665_c1 nmdc:mga03n38_2665_c1_2811_3638 272
546 3300050492 nmdc:mga0yw44_35656_c1 nmdc:mga0yw44_35656_c1_1324_2151 272
547 3300050493 nmdc:mga0k408_153136_c1 nmdc:mga0k408_153136_c1_112_939 272
548 3300050493 nmdc:mga0k408_3608_c1 nmdc:mga0k408_3608_c1_1276_2118 272
549 3300050495 nmdc:mga04h51_28517_c1 nmdc:mga04h51_28517_c1_597_1424 272
550 3300050496 nmdc:mga07m45_5521_c1 nmdc:mga07m45_5521_c1_3716_4543 272
551 3300050509 nmdc:mga0qj67_299408_c1 nmdc:mga0qj67_299408_c1_45_875 272
552 3300050513 nmdc:mga0rr50_20477_c1 nmdc:mga0rr50_20477_c1_3368_4195 272
553 3300053077 Ga0495601_0000014 Ga0495601_0000014_33139_33966 272
554 3300053078 Ga0495612_0000014 Ga0495612_0000014_33117_33944 272
555 3300053084 Ga0495595_0000182 Ga0495595_0000182_9080_9907 272
556 3300053085 Ga0495619_0000006 Ga0495619_0000006_186353_187180 272
557 3300053096 Ga0500641_0078732 Ga0500641_0078732_261_1088 272
558 3300053147 Ga0500589_054344 Ga0500589_054344_413_1240 272
559 3300005293 Ga0065715_10157741 Ga0065715_101577412 273
560 3300005330 Ga0070690_100039011 Ga0070690_1000390113 273
561 3300005335 Ga0070666_10014844 Ga0070666_100148442 273
562 3300005338 Ga0068868_100005715 Ga0068868_1000057152 273
563 3300005345 Ga0070692_10198783 Ga0070692_101987832 273
564 3300005354 Ga0070675_100001562 Ga0070675_10000156210 273
565 3300005355 Ga0070671_100001109 Ga0070671_10000110910 273
566 3300005364 Ga0070673_100071020 Ga0070673_1000710203 273
567 3300005365 Ga0070688_100010378 Ga0070688_1000103783 273
568 3300005456 Ga0070678_100001839 Ga0070678_10000183910 273
569 3300005614 Ga0068856_100381812 Ga0068856_1003818122 273
570 3300005616 Ga0068852_100027942 Ga0068852_1000279423 273
571 3300005616 Ga0068852_100053703 Ga0068852_1000537033 273
572 3300005617 Ga0068859_100004047 Ga0068859_10000404710 273
573 3300005618 Ga0068864_100002145 Ga0068864_10000214515 273
574 3300005719 Ga0068861_100322267 Ga0068861_1003222672 273
575 3300005834 Ga0068851_10013505 Ga0068851_100135052 273
576 3300005840 Ga0068870_10030478 Ga0068870_100304785 273
577 3300005841 Ga0068863_100021798 Ga0068863_1000217982 273
578 3300005842 Ga0068858_100001027 Ga0068858_10000102720 273
579 3300005937 Ga0081455_10006927 Ga0081455_100069276 273
580 3300005937 Ga0081455_10010133 Ga0081455_100101335 273
581 3300005983 Ga0081540_1090369 Ga0081540_10903692 273
582 3300006237 Ga0097621_100006676 Ga0097621_10000667610 273
583 3300006358 Ga0068871_100001655 Ga0068871_10000165510 273
584 3300006846 Ga0075430_100247339 Ga0075430_1002473392 273
585 3300006880 Ga0075429_100573423 Ga0075429_1005734231 273
586 3300006931 Ga0097620_100004047 Ga0097620_10000404710 273
587 3300009147 Ga0114129_10390310 Ga0114129_103903102 273
588 3300009177 Ga0105248_10009206 Ga0105248_100092063 273
589 3300009553 Ga0105249_10519592 Ga0105249_105195922 273
590 3300013102 Ga0157371_10032500 Ga0157371_100325004 273
591 3300013104 Ga0157370_10222583 Ga0157370_102225832 273
592 3300013296 Ga0157374_10159069 Ga0157374_101590692 273
593 3300013306 Ga0163162_10050519 Ga0163162_100505192 273
594 3300013308 Ga0157375_10342272 Ga0157375_103422722 273
595 3300014325 Ga0163163_10052924 Ga0163163_100529241 273
596 3300014969 Ga0157376_10006589 Ga0157376_100065894 273
597 3300017792 Ga0163161_10174938 Ga0163161_101749382 273
598 3300025299 Ga0209256_1000282 Ga0209256_100028229 273
599 3300025321 Ga0207656_10034197 Ga0207656_100341972 273
600 3300025903 Ga0207680_10004135 Ga0207680_100041356 273
601 3300025908 Ga0207643_10183727 Ga0207643_101837272 273
602 3300025926 Ga0207659_10001153 Ga0207659_100011531 273
603 3300025929 Ga0207664_10216863 Ga0207664_102168632 273
604 3300025931 Ga0207644_10002964 Ga0207644_100029642 273
605 3300025937 Ga0207669_10129051 Ga0207669_101290512 273
606 3300025942 Ga0207689_10004088 Ga0207689_1000408813 273
607 3300025960 Ga0207651_10000597 Ga0207651_100005979 273
608 3300025981 Ga0207640_10118085 Ga0207640_101180852 273
609 3300026023 Ga0207677_10003770 Ga0207677_100037706 273
610 3300026035 Ga0207703_10002610 Ga0207703_100026108 273
611 3300026088 Ga0207641_10002468 Ga0207641_100024688 273
612 3300026095 Ga0207676_10000580 Ga0207676_100005808 273
613 3300026118 Ga0207675_100248702 Ga0207675_1002487022 273
614 3300026121 Ga0207683_10001023 Ga0207683_1000102310 273
615 3300026142 Ga0207698_10012412 Ga0207698_100124125 273
616 3300028381 Ga0268264_10118856 Ga0268264_101188562 273
617 3300028794 Ga0307515_10069488 Ga0307515_100694885 273
618 3300031730 Ga0307516_10144560 Ga0307516_101445602 273
619 3300033180 Ga0307510_10185499 Ga0307510_101854992 273
620 3300035115 Ga0373941_0000271 Ga0373941_0000271_756_1589 273
621 3300035117 Ga0373953_0004237 Ga0373953_0004237_940_1770 273
622 3300046459 Ga0495629_0108670 Ga0495629_0108670_1073_1906 273
623 3300046462 Ga0495651_0034356 Ga0495651_0034356_2746_3579 273
624 3300046463 Ga0495653_0007683 Ga0495653_0007683_6998_7828 273
625 3300046507 Ga0495606_0044078 Ga0495606_0044078_1530_2363 273
626 3300046524 Ga0495648_0071673 Ga0495648_0071673_763_1596 273
627 3300046526 Ga0495666_0163414 Ga0495666_0163414_79_909 273
628 3300046533 Ga0495640_0029328 Ga0495640_0029328_724_1557 273
629 3300046642 Ga0495634_0163526 Ga0495634_0163526_476_1309 273
630 3300046642 Ga0495634_0256832 Ga0495634_0256832_23_853 273
631 3300046663 Ga0495635_0018107 Ga0495635_0018107_3146_3979 273
632 3300046675 Ga0495657_0029999 Ga0495657_0029999_2029_2862 273
633 3300046680 Ga0495646_0068396 Ga0495646_0068396_997_1830 273
634 3300046681 Ga0495647_0030887 Ga0495647_0030887_943_1773 273
635 3300046689 Ga0495613_0096248 Ga0495613_0096248_886_1719 273
636 3300046689 Ga0495613_0176962 Ga0495613_0176962_120_950 273
637 3300046690 Ga0495624_0053173 Ga0495624_0053173_310_1143 273
638 3300046691 Ga0495670_0029534 Ga0495670_0029534_1851_2681 273
639 3300046694 Ga0495649_0014605 Ga0495649_0014605_2176_3009 273
640 3300047317 Ga0495604_0013618 Ga0495604_0013618_4606_5439 273
641 3300047321 Ga0495676_0088281 Ga0495676_0088281_553_1386 273
642 3300047444 Ga0495675_0003409 Ga0495675_0003409_2304_3134 273
643 3300047469 Ga0495673_0127309 Ga0495673_0127309_26_859 273
644 3300048088 Ga0495602_0063338 Ga0495602_0063338_199_1029 273
645 3300048088 Ga0495602_0141854 Ga0495602_0141854_1022_1855 273
646 3300048904 Ga0496101_0177057 Ga0496101_0177057_312_1145 273
647 3300048908 Ga0496105_0008435 Ga0496105_0008435_5671_6504 273
648 3300048911 Ga0496108_0157273 Ga0496108_0157273_237_1079 273
649 3300048912 Ga0496109_0018985 Ga0496109_0018985_2081_2923 273
650 3300048912 Ga0496109_0395015 Ga0496109_0395015_20_850 273
651 3300048916 Ga0496113_0085190 Ga0496113_0085190_167_1000 273
652 3300048922 Ga0496119_0024084 Ga0496119_0024084_2353_3186 273
653 3300048923 Ga0496120_0039344 Ga0496120_0039344_976_1809 273
654 3300048924 Ga0496121_0056015 Ga0496121_0056015_1451_2284 273
655 3300048927 Ga0496124_0056243 Ga0496124_0056243_772_1605 273
656 3300048928 Ga0496125_0074940 Ga0496125_0074940_1528_2361 273
657 3300048929 Ga0496126_0012552 Ga0496126_0012552_3119_3952 273
658 3300048929 Ga0496126_0297859 Ga0496126_0297859_28_858 273
659 3300049568 Ga0501031_0012910 Ga0501031_0012910_776_1609 273
660 3300049569 Ga0501032_0000055 Ga0501032_0000055_43151_43984 273
661 3300049570 Ga0501033_0001478 Ga0501033_0001478_18900_19733 273
662 3300049571 Ga0501034_0331436 Ga0501034_0331436_590_1423 273
663 3300049572 Ga0501036_0000021 Ga0501036_0000021_73831_74664 273
664 3300049573 Ga0501037_0001418 Ga0501037_0001418_5041_5874 273
665 3300049573 Ga0501037_0030614 Ga0501037_0030614_946_1779 273
666 3300049574 Ga0501038_0000070 Ga0501038_0000070_39013_39846 273
667 3300049574 Ga0501038_0246525 Ga0501038_0246525_513_1346 273
668 3300049575 Ga0501039_0001437 Ga0501039_0001437_14547_15380 273
669 3300049575 Ga0501039_0033778 Ga0501039_0033778_2190_3023 273
670 3300049579 Ga0501043_0000078 Ga0501043_0000078_66890_67723 273
671 3300049580 Ga0501046_0000627 Ga0501046_0000627_5653_6486 273
672 3300049581 Ga0501047_0000810 Ga0501047_0000810_7434_8267 273
673 3300049581 Ga0501047_0023017 Ga0501047_0023017_4332_5165 273
674 3300049581 Ga0501047_0416859 Ga0501047_0416859_308_1141 273
675 3300049582 Ga0501048_0001060 Ga0501048_0001060_2902_3735 273
676 3300049583 Ga0501067_0000177 Ga0501067_0000177_32356_33189 273
677 3300049583 Ga0501067_0084754 Ga0501067_0084754_243_1076 273
678 3300049584 Ga0501068_0010646 Ga0501068_0010646_157_990 273
679 3300049585 Ga0501069_0098344 Ga0501069_0098344_261_1094 273
680 3300049586 Ga0501070_0001227 Ga0501070_0001227_12657_13490 273
681 3300049586 Ga0501070_0284209 Ga0501070_0284209_413_1246 273
682 3300049588 Ga0501072_0004769 Ga0501072_0004769_2837_3670 273
683 3300049588 Ga0501072_0023276 Ga0501072_0023276_151_984 273
684 3300049589 Ga0501073_0000039 Ga0501073_0000039_69933_70766 273
685 3300049590 Ga0501074_0000019 Ga0501074_0000019_42605_43438 273
686 3300049742 Ga0501080_0000827 Ga0501080_0000827_20289_21122 273
687 3300049744 Ga0501083_0000242 Ga0501083_0000242_3057_3890 273
688 3300049744 Ga0501083_0158048 Ga0501083_0158048_490_1323 273
689 3300049744 Ga0501083_0188169 Ga0501083_0188169_238_1071 273
690 3300049822 Ga0501035_0001565 Ga0501035_0001565_8916_9749 273
691 3300049823 Ga0501044_0000179 Ga0501044_0000179_16342_17175 273
692 3300049823 Ga0501044_0239108 Ga0501044_0239108_168_1001 273
693 3300049824 Ga0501045_0003829 Ga0501045_0003829_2956_3789 273
694 3300050507 nmdc:mga05p37_40622_c1 nmdc:mga05p37_40622_c1_2230_3060 273
695 3300050508 nmdc:mga09592_253527_c1 nmdc:mga09592_253527_c1_572_1402 273
696 3300050510 nmdc:mga06r32_151936_c1 nmdc:mga06r32_151936_c1_65_895 273
697 3300053077 Ga0495601_0205583 Ga0495601_0205583_141_971 273
698 3300053730 Ga0500645_053793 Ga0500645_053793_197_1027 273
699 3300054114 Ga0501084_0088702 Ga0501084_0088702_88_921 273
700 3300060353 Ga0501082_0004803 Ga0501082_0004803_1423_2256 273
701 3300003215 JGI25153J46596_10001537 JGI25153J46596_100015373 274
702 3300005329 Ga0070683_100411014 Ga0070683_1004110142 274
703 3300005331 Ga0070670_100018595 Ga0070670_1000185957 274
704 3300005331 Ga0070670_100622686 Ga0070670_1006226861 274
705 3300005334 Ga0068869_100017122 Ga0068869_1000171225 274
706 3300005334 Ga0068869_100175363 Ga0068869_1001753632 274
707 3300005335 Ga0070666_10030114 Ga0070666_100301144 274
708 3300005335 Ga0070666_10242110 Ga0070666_102421101 274
709 3300005336 Ga0070680_100020948 Ga0070680_1000209482 274
710 3300005336 Ga0070680_100329092 Ga0070680_1003290921 274
711 3300005337 Ga0070682_100182740 Ga0070682_1001827401 274
712 3300005338 Ga0068868_100007157 Ga0068868_1000071577 274
713 3300005339 Ga0070660_100013688 Ga0070660_1000136884 274
714 3300005340 Ga0070689_100141679 Ga0070689_1001416792 274
715 3300005343 Ga0070687_100297431 Ga0070687_1002974311 274
716 3300005344 Ga0070661_100101157 Ga0070661_1001011571 274
717 3300005347 Ga0070668_100106151 Ga0070668_1001061513 274
718 3300005347 Ga0070668_100126362 Ga0070668_1001263623 274
719 3300005347 Ga0070668_100141257 Ga0070668_1001412572 274
720 3300005353 Ga0070669_100162443 Ga0070669_1001624431 274
721 3300005354 Ga0070675_100136591 Ga0070675_1001365912 274
722 3300005355 Ga0070671_100051865 Ga0070671_1000518654 274
723 3300005355 Ga0070671_100452947 Ga0070671_1004529472 274
724 3300005356 Ga0070674_100163784 Ga0070674_1001637842 274
725 3300005356 Ga0070674_100304584 Ga0070674_1003045842 274
726 3300005356 Ga0070674_100342737 Ga0070674_1003427372 274
727 3300005365 Ga0070688_100201784 Ga0070688_1002017842 274
728 3300005366 Ga0070659_100055929 Ga0070659_1000559292 274
729 3300005435 Ga0070714_100080871 Ga0070714_1000808711 274
730 3300005436 Ga0070713_100007640 Ga0070713_1000076404 274
731 3300005440 Ga0070705_100075186 Ga0070705_1000751863 274
732 3300005455 Ga0070663_100021199 Ga0070663_1000211995 274
733 3300005455 Ga0070663_100028448 Ga0070663_1000284481 274
734 3300005455 Ga0070663_100048448 Ga0070663_1000484484 274
735 3300005455 Ga0070663_100116047 Ga0070663_1001160472 274
736 3300005455 Ga0070663_100263241 Ga0070663_1002632412 274
737 3300005456 Ga0070678_100020180 Ga0070678_1000201805 274
738 3300005456 Ga0070678_100116621 Ga0070678_1001166212 274
739 3300005457 Ga0070662_100041616 Ga0070662_1000416162 274
740 3300005457 Ga0070662_100158126 Ga0070662_1001581262 274
741 3300005471 Ga0070698_100355433 Ga0070698_1003554332 274
742 3300005539 Ga0068853_100078703 Ga0068853_1000787034 274
743 3300005544 Ga0070686_100067129 Ga0070686_1000671293 274
744 3300005547 Ga0070693_100164039 Ga0070693_1001640391 274
745 3300005548 Ga0070665_100036690 Ga0070665_1000366903 274
746 3300005548 Ga0070665_100060269 Ga0070665_1000602695 274
747 3300005548 Ga0070665_100060631 Ga0070665_1000606314 274
748 3300005548 Ga0070665_100115492 Ga0070665_1001154923 274
749 3300005548 Ga0070665_100136512 Ga0070665_1001365122 274
750 3300005563 Ga0068855_100021611 Ga0068855_1000216117 274
751 3300005563 Ga0068855_100154201 Ga0068855_1001542012 274
752 3300005564 Ga0070664_100176017 Ga0070664_1001760172 274
753 3300005564 Ga0070664_100298355 Ga0070664_1002983551 274
754 3300005577 Ga0068857_100055694 Ga0068857_1000556943 274
755 3300005577 Ga0068857_100063891 Ga0068857_1000638914 274
756 3300005577 Ga0068857_100182900 Ga0068857_1001829002 274
757 3300005614 Ga0068856_100021308 Ga0068856_1000213087 274
758 3300005616 Ga0068852_100040460 Ga0068852_1000404605 274
759 3300005617 Ga0068859_100241285 Ga0068859_1002412852 274
760 3300005617 Ga0068859_100264911 Ga0068859_1002649112 274
761 3300005618 Ga0068864_100013439 Ga0068864_1000134397 274
762 3300005618 Ga0068864_100025263 Ga0068864_1000252634 274
763 3300005618 Ga0068864_100209501 Ga0068864_1002095012 274
764 3300005719 Ga0068861_100013208 Ga0068861_1000132084 274
765 3300005834 Ga0068851_10011125 Ga0068851_100111253 274
766 3300005840 Ga0068870_10072449 Ga0068870_100724492 274
767 3300005841 Ga0068863_100844381 Ga0068863_1008443811 274
768 3300005842 Ga0068858_100232239 Ga0068858_1002322391 274
769 3300005843 Ga0068860_100000277 Ga0068860_1000002775 274
770 3300005843 Ga0068860_100125995 Ga0068860_1001259953 274
771 3300005843 Ga0068860_100202794 Ga0068860_1002027942 274
772 3300005844 Ga0068862_100034967 Ga0068862_1000349675 274
773 3300005844 Ga0068862_100062761 Ga0068862_1000627614 274
774 3300005937 Ga0081455_10074531 Ga0081455_100745313 274
775 3300005937 Ga0081455_10173848 Ga0081455_101738482 274
776 3300005981 Ga0081538_10013652 Ga0081538_100136525 274
777 3300005983 Ga0081540_1000948 Ga0081540_100094811 274
778 3300005983 Ga0081540_1004138 Ga0081540_10041387 274
779 3300005983 Ga0081540_1009201 Ga0081540_10092013 274
780 3300005985 Ga0081539_10089918 Ga0081539_100899182 274
781 3300006028 Ga0070717_10055084 Ga0070717_100550843 274
782 3300006038 Ga0075365_10081986 Ga0075365_100819862 274
783 3300006038 Ga0075365_10097868 Ga0075365_100978682 274
784 3300006042 Ga0075368_10007748 Ga0075368_100077482 274
785 3300006042 Ga0075368_10011042 Ga0075368_100110422 274
786 3300006048 Ga0075363_100000141 Ga0075363_10000014119 274
787 3300006048 Ga0075363_100010581 Ga0075363_1000105817 274
788 3300006048 Ga0075363_100018089 Ga0075363_1000180893 274
789 3300006051 Ga0075364_10014811 Ga0075364_100148115 274
790 3300006051 Ga0075364_10149608 Ga0075364_101496082 274
791 3300006051 Ga0075364_10306092 Ga0075364_103060921 274
792 3300006175 Ga0070712_100105268 Ga0070712_1001052682 274
793 3300006177 Ga0075362_10022640 Ga0075362_100226404 274
794 3300006177 Ga0075362_10024000 Ga0075362_100240003 274
795 3300006177 Ga0075362_10035505 Ga0075362_100355053 274
796 3300006177 Ga0075362_10049476 Ga0075362_100494763 274
797 3300006178 Ga0075367_10001014 Ga0075367_100010142 274
798 3300006178 Ga0075367_10021428 Ga0075367_100214282 274
799 3300006178 Ga0075367_10070956 Ga0075367_100709561 274
800 3300006186 Ga0075369_10015863 Ga0075369_100158633 274
801 3300006186 Ga0075369_10058565 Ga0075369_100585652 274
802 3300006195 Ga0075366_10012370 Ga0075366_100123704 274
803 3300006195 Ga0075366_10143419 Ga0075366_101434192 274
804 3300006237 Ga0097621_100174536 Ga0097621_1001745362 274
805 3300006353 Ga0075370_10016088 Ga0075370_100160883 274
806 3300006353 Ga0075370_10020374 Ga0075370_100203744 274
807 3300006353 Ga0075370_10025265 Ga0075370_100252653 274
808 3300006353 Ga0075370_10032929 Ga0075370_100329294 274
809 3300006844 Ga0075428_100013546 Ga0075428_1000135462 274
810 3300006844 Ga0075428_100029097 Ga0075428_1000290977 274
811 3300006844 Ga0075428_100043811 Ga0075428_1000438114 274
812 3300006846 Ga0075430_100189206 Ga0075430_1001892062 274
813 3300006847 Ga0075431_100098882 Ga0075431_1000988821 274
814 3300006847 Ga0075431_100531924 Ga0075431_1005319242 274
815 3300006852 Ga0075433_10378537 Ga0075433_103785372 274
816 3300006871 Ga0075434_100028848 Ga0075434_1000288484 274
817 3300006881 Ga0068865_100121251 Ga0068865_1001212512 274
818 3300006931 Ga0097620_100241287 Ga0097620_1002412872 274
819 3300006931 Ga0097620_100264898 Ga0097620_1002648982 274
820 3300007265 Ga0099794_10003694 Ga0099794_100036943 274
821 3300007265 Ga0099794_10026848 Ga0099794_100268481 274
822 3300007788 Ga0099795_10009230 Ga0099795_100092303 274
823 3300007788 Ga0099795_10074455 Ga0099795_100744552 274
824 3300009092 Ga0105250_10089165 Ga0105250_100891651 274
825 3300009093 Ga0105240_10093755 Ga0105240_100937552 274
826 3300009094 Ga0111539_10032652 Ga0111539_100326523 274
827 3300009094 Ga0111539_10059271 Ga0111539_100592712 274
828 3300009094 Ga0111539_10468757 Ga0111539_104687572 274
829 3300009098 Ga0105245_10101824 Ga0105245_101018242 274
830 3300009098 Ga0105245_10214103 Ga0105245_102141032 274
831 3300009101 Ga0105247_10252945 Ga0105247_102529451 274
832 3300009147 Ga0114129_10061881 Ga0114129_100618815 274
833 3300009147 Ga0114129_10079079 Ga0114129_100790793 274
834 3300009147 Ga0114129_10220299 Ga0114129_102202992 274
835 3300009174 Ga0105241_10188416 Ga0105241_101884162 274
836 3300009176 Ga0105242_10035577 Ga0105242_100355774 274
837 3300009176 Ga0105242_10246244 Ga0105242_102462442 274
838 3300009545 Ga0105237_10008069 Ga0105237_100080696 274
839 3300009545 Ga0105237_10028364 Ga0105237_100283643 274
840 3300009551 Ga0105238_10048532 Ga0105238_100485322 274
841 3300009551 Ga0105238_10059815 Ga0105238_100598152 274
842 3300009553 Ga0105249_10222468 Ga0105249_102224682 274
843 3300010375 Ga0105239_10038265 Ga0105239_100382654 274
844 3300010375 Ga0105239_10236387 Ga0105239_102363872 274
845 3300010375 Ga0105239_10331930 Ga0105239_103319302 274
846 3300010375 Ga0105239_10342245 Ga0105239_103422451 274
847 3300013104 Ga0157370_10206548 Ga0157370_102065482 274
848 3300013105 Ga0157369_10036010 Ga0157369_100360104 274
849 3300013296 Ga0157374_10009863 Ga0157374_100098637 274
850 3300013297 Ga0157378_10224932 Ga0157378_102249322 274
851 3300013297 Ga0157378_10312879 Ga0157378_103128792 274
852 3300013306 Ga0163162_10279533 Ga0163162_102795332 274
853 3300014325 Ga0163163_10010304 Ga0163163_1001030410 274
854 3300014325 Ga0163163_10079530 Ga0163163_100795304 274
855 3300014969 Ga0157376_10147314 Ga0157376_101473142 274
856 3300021361 Ga0213872_10045180 Ga0213872_100451802 274
857 3300021377 Ga0213874_10039268 Ga0213874_100392682 274
858 3300021384 Ga0213876_10075200 Ga0213876_100752002 274
859 3300025297 Ga0209758_1020356 Ga0209758_10203564 274
860 3300025297 Ga0209758_1029534 Ga0209758_10295343 274
861 3300025315 Ga0207697_10055877 Ga0207697_100558772 274
862 3300025898 Ga0207692_10050940 Ga0207692_100509403 274
863 3300025900 Ga0207710_10053772 Ga0207710_100537723 274
864 3300025901 Ga0207688_10006216 Ga0207688_100062165 274
865 3300025901 Ga0207688_10031618 Ga0207688_100316183 274
866 3300025901 Ga0207688_10141219 Ga0207688_101412192 274
867 3300025903 Ga0207680_10062751 Ga0207680_100627513 274
868 3300025908 Ga0207643_10005792 Ga0207643_100057927 274
869 3300025910 Ga0207684_10065073 Ga0207684_100650733 274
870 3300025911 Ga0207654_10008079 Ga0207654_100080795 274
871 3300025911 Ga0207654_10092864 Ga0207654_100928642 274
872 3300025912 Ga0207707_10013854 Ga0207707_100138546 274
873 3300025914 Ga0207671_10008698 Ga0207671_100086984 274
874 3300025914 Ga0207671_10031634 Ga0207671_100316343 274
875 3300025914 Ga0207671_10031871 Ga0207671_100318713 274
876 3300025914 Ga0207671_10616011 Ga0207671_106160111 274
877 3300025915 Ga0207693_10160657 Ga0207693_101606572 274
878 3300025915 Ga0207693_10189600 Ga0207693_101896002 274
879 3300025919 Ga0207657_10001946 Ga0207657_1000194615 274
880 3300025919 Ga0207657_10131176 Ga0207657_101311762 274
881 3300025920 Ga0207649_10162341 Ga0207649_101623412 274
882 3300025920 Ga0207649_10263469 Ga0207649_102634692 274
883 3300025921 Ga0207652_10026152 Ga0207652_100261525 274
884 3300025922 Ga0207646_10064179 Ga0207646_100641792 274
885 3300025924 Ga0207694_10195681 Ga0207694_101956812 274
886 3300025926 Ga0207659_10097093 Ga0207659_100970933 274
887 3300025927 Ga0207687_10048589 Ga0207687_100485893 274
888 3300025928 Ga0207700_10026543 Ga0207700_100265433 274
889 3300025931 Ga0207644_10275051 Ga0207644_102750512 274
890 3300025932 Ga0207690_10032618 Ga0207690_100326184 274
891 3300025932 Ga0207690_10244041 Ga0207690_102440412 274
892 3300025934 Ga0207686_10023414 Ga0207686_100234142 274
893 3300025934 Ga0207686_10054687 Ga0207686_100546873 274
894 3300025934 Ga0207686_10218937 Ga0207686_102189372 274
895 3300025935 Ga0207709_10041560 Ga0207709_100415602 274
896 3300025937 Ga0207669_10028432 Ga0207669_100284323 274
897 3300025937 Ga0207669_10429201 Ga0207669_104292011 274
898 3300025938 Ga0207704_10009866 Ga0207704_100098663 274
899 3300025939 Ga0207665_10240936 Ga0207665_102409362 274
900 3300025940 Ga0207691_10021052 Ga0207691_100210523 274
901 3300025942 Ga0207689_10019078 Ga0207689_100190782 274
902 3300025944 Ga0207661_10449207 Ga0207661_104492072 274
903 3300025945 Ga0207679_10113597 Ga0207679_101135972 274
904 3300025945 Ga0207679_10212311 Ga0207679_102123112 274
905 3300025949 Ga0207667_10115539 Ga0207667_101155393 274
906 3300025949 Ga0207667_10290568 Ga0207667_102905682 274
907 3300025949 Ga0207667_10688512 Ga0207667_106885122 274
908 3300025961 Ga0207712_10248874 Ga0207712_102488742 274
909 3300025972 Ga0207668_10016019 Ga0207668_100160195 274
910 3300025972 Ga0207668_10067863 Ga0207668_100678632 274
911 3300025972 Ga0207668_10084839 Ga0207668_100848392 274
912 3300025972 Ga0207668_10160443 Ga0207668_101604431 274
913 3300026023 Ga0207677_10045320 Ga0207677_100453203 274
914 3300026035 Ga0207703_10008823 Ga0207703_100088233 274
915 3300026035 Ga0207703_10324855 Ga0207703_103248552 274
916 3300026041 Ga0207639_10094992 Ga0207639_100949922 274
917 3300026041 Ga0207639_10146440 Ga0207639_101464403 274
918 3300026067 Ga0207678_10015210 Ga0207678_100152108 274
919 3300026067 Ga0207678_10150533 Ga0207678_101505333 274
920 3300026067 Ga0207678_10190578 Ga0207678_101905782 274
921 3300026075 Ga0207708_10120515 Ga0207708_101205153 274
922 3300026078 Ga0207702_10143155 Ga0207702_101431551 274
923 3300026089 Ga0207648_10118805 Ga0207648_101188053 274
924 3300026089 Ga0207648_10353402 Ga0207648_103534021 274
925 3300026095 Ga0207676_10036976 Ga0207676_100369765 274
926 3300026095 Ga0207676_10166238 Ga0207676_101662382 274
927 3300026116 Ga0207674_10034697 Ga0207674_100346975 274
928 3300026116 Ga0207674_10114721 Ga0207674_101147212 274
929 3300026116 Ga0207674_10277373 Ga0207674_102773732 274
930 3300026118 Ga0207675_100013083 Ga0207675_1000130832 274
931 3300026118 Ga0207675_100024197 Ga0207675_1000241977 274
932 3300026118 Ga0207675_100035075 Ga0207675_1000350753 274
933 3300026118 Ga0207675_100101089 Ga0207675_1001010892 274
934 3300026121 Ga0207683_10023737 Ga0207683_100237376 274
935 3300026121 Ga0207683_10244365 Ga0207683_102443652 274
936 3300026142 Ga0207698_10318835 Ga0207698_103188352 274
937 3300027671 Ga0209588_1051665 Ga0209588_10516652 274
938 3300027866 Ga0209813_10002641 Ga0209813_100026412 274
939 3300027866 Ga0209813_10008917 Ga0209813_100089172 274
940 3300028379 Ga0268266_10000638 Ga0268266_1000063829 274
941 3300028379 Ga0268266_10000807 Ga0268266_1000080731 274
942 3300028379 Ga0268266_10006312 Ga0268266_100063125 274
943 3300028379 Ga0268266_10014067 Ga0268266_100140678 274
944 3300028379 Ga0268266_10026691 Ga0268266_100266913 274
945 3300028379 Ga0268266_10044321 Ga0268266_100443213 274
946 3300028379 Ga0268266_10083302 Ga0268266_100833021 274
947 3300028380 Ga0268265_10053120 Ga0268265_100531202 274
948 3300028380 Ga0268265_10150499 Ga0268265_101504991 274
949 3300028380 Ga0268265_10533308 Ga0268265_105333082 274
950 3300028381 Ga0268264_10000153 Ga0268264_10000153152 274
951 3300028381 Ga0268264_10036845 Ga0268264_100368452 274
952 3300028381 Ga0268264_10363491 Ga0268264_103634912 274
953 3300028573 Ga0265334_10086967 Ga0265334_100869672 274
954 3300030522 Ga0307512_10134930 Ga0307512_101349302 274
955 3300031235 Ga0265330_10043044 Ga0265330_100430442 274
956 3300031238 Ga0265332_10043296 Ga0265332_100432962 274
957 3300031241 Ga0265325_10035066 Ga0265325_100350662 274
958 3300031344 Ga0265316_10133838 Ga0265316_101338383 274
959 3300031456 Ga0307513_10334704 Ga0307513_103347041 274
960 3300031507 Ga0307509_10052324 Ga0307509_100523243 274
961 3300031507 Ga0307509_10101091 Ga0307509_101010912 274
962 3300031507 Ga0307509_10314743 Ga0307509_103147431 274
963 3300031507 Ga0307509_10345484 Ga0307509_103454841 274
964 3300031616 Ga0307508_10000013 Ga0307508_1000001373 274
965 3300031616 Ga0307508_10108370 Ga0307508_101083702 274
966 3300031616 Ga0307508_10234257 Ga0307508_102342571 274
967 3300031711 Ga0265314_10123483 Ga0265314_101234831 274
968 3300031730 Ga0307516_10006924 Ga0307516_100069243 274
969 3300031730 Ga0307516_10030289 Ga0307516_100302892 274
970 3300031730 Ga0307516_10083279 Ga0307516_100832792 274
971 3300031995 Ga0307409_100081192 Ga0307409_1000811922 274
972 3300031995 Ga0307409_100657687 Ga0307409_1006576872 274
973 3300032126 Ga0307415_100188368 Ga0307415_1001883682 274
974 3300033179 Ga0307507_10037332 Ga0307507_100373322 274
975 3300033180 Ga0307510_10003040 Ga0307510_100030407 274
976 3300035083 Ga0373926_0028931 Ga0373926_0028931_369_1202 274
977 3300035083 Ga0373926_0043877 Ga0373926_0043877_64_897 274
978 3300035090 Ga0373949_0020562 Ga0373949_0020562_483_1316 274
979 3300035111 Ga0373923_0020855 Ga0373923_0020855_708_1541 274
980 3300035113 Ga0373936_0053141 Ga0373936_0053141_446_1279 274
981 3300035115 Ga0373941_0050861 Ga0373941_0050861_426_1259 274
982 3300035116 Ga0373945_0053145 Ga0373945_0053145_120_953 274
983 3300035117 Ga0373953_0030172 Ga0373953_0030172_114_947 274
984 3300035170 Ga0373943_0032326 Ga0373943_0032326_876_1709 274
985 3300035171 Ga0373946_0021251 Ga0373946_0021251_662_1495 274
986 3300035410 Ga0373924_0049158 Ga0373924_0049158_606_1439 274
987 3300035691 Ga0373931_0130431 Ga0373931_0130431_320_1153 274
988 3300035692 Ga0373935_0024891 Ga0373935_0024891_171_1004 274
989 3300035692 Ga0373935_0061578 Ga0373935_0061578_1539_2372 274
990 3300035692 Ga0373935_0140586 Ga0373935_0140586_722_1555 274
991 3300035692 Ga0373935_0279099 Ga0373935_0279099_330_1163 274
992 3300035695 Ga0373927_0021530 Ga0373927_0021530_2086_2919 274
993 3300035695 Ga0373927_0195453 Ga0373927_0195453_289_1122 274
994 3300035724 Ga0373933_0092462 Ga0373933_0092462_636_1469 274
995 3300035725 Ga0373947_0013284 Ga0373947_0013284_2512_3345 274
996 3300035725 Ga0373947_0164456 Ga0373947_0164456_65_898 274
997 3300036401 Ga0373937_0400365 Ga0373937_0400365_105_938 274
998 3300037068 Ga0373925_0042097 Ga0373925_0042097_2454_3287 274
999 3300037068 Ga0373925_0126535 Ga0373925_0126535_43_876 274
1000 3300037418 Ga0395900_0009415 Ga0395900_0009415_5930_6763 274
1001 3300037466 Ga0395898_0016882 Ga0395898_0016882_5786_6619 274
1002 3300037471 Ga0395905_0447005 Ga0395905_0447005_254_1087 274
1003 3300037853 Ga0436364_0304115 Ga0436364_0304115_1073_1918 274
1004 3300038443 Ga0395901_0009062 Ga0395901_0009062_5743_6576 274
1005 3300039437 Ga0436365_1233769 Ga0436365_1233769_9289_10134 274
1006 3300039438 Ga0436360_0853720 Ga0436360_0853720_3480_4328 274
1007 3300039447 Ga0436361_0283608 Ga0436361_0283608_5125_5982 274
1008 3300039447 Ga0436361_0331296 Ga0436361_0331296_519_1364 274
1009 3300039447 Ga0436361_1007450 Ga0436361_1007450_12_860 274
1010 3300039447 Ga0436361_1011773 Ga0436361_1011773_304_1158 274
1011 3300039450 Ga0436363_0800492 Ga0436363_0800492_748_1593 274
1012 3300042157 Ga0439458_0006605 Ga0439458_0006605_1597_2442 274
1013 3300044735 Ga0466968_0114564 Ga0466968_0114564_243_1091 274
1014 3300046454 Ga0495592_0225482 Ga0495592_0225482_158_991 274
1015 3300046455 Ga0495603_0002154 Ga0495603_0002154_6195_7028 274
1016 3300046459 Ga0495629_0012373 Ga0495629_0012373_4160_4993 274
1017 3300046459 Ga0495629_0024099 Ga0495629_0024099_2724_3557 274
1018 3300046459 Ga0495629_0179028 Ga0495629_0179028_420_1253 274
1019 3300046462 Ga0495651_0049838 Ga0495651_0049838_1258_2091 274
1020 3300046463 Ga0495653_0047555 Ga0495653_0047555_813_1646 274
1021 3300046463 Ga0495653_0108612 Ga0495653_0108612_99_944 274
1022 3300046463 Ga0495653_0184286 Ga0495653_0184286_155_988 274
1023 3300046472 Ga0495580_0057855 Ga0495580_0057855_1742_2575 274
1024 3300046472 Ga0495580_0060558 Ga0495580_0060558_1592_2425 274
1025 3300046476 Ga0495662_0007383 Ga0495662_0007383_537_1370 274
1026 3300046477 Ga0495664_0092439 Ga0495664_0092439_612_1445 274
1027 3300046491 Ga0495584_0149564 Ga0495584_0149564_152_985 274
1028 3300046499 Ga0495594_0068933 Ga0495594_0068933_355_1188 274
1029 3300046501 Ga0495607_0071269 Ga0495607_0071269_397_1230 274
1030 3300046511 Ga0495608_0031065 Ga0495608_0031065_793_1626 274
1031 3300046511 Ga0495608_0061472 Ga0495608_0061472_582_1427 274
1032 3300046514 Ga0495618_0175840 Ga0495618_0175840_354_1187 274
1033 3300046517 Ga0495630_0147017 Ga0495630_0147017_194_1027 274
1034 3300046523 Ga0495644_0054123 Ga0495644_0054123_122_955 274
1035 3300046524 Ga0495648_0010886 Ga0495648_0010886_2973_3806 274
1036 3300046526 Ga0495666_0119220 Ga0495666_0119220_178_1011 274
1037 3300046529 Ga0495652_0056860 Ga0495652_0056860_1533_2366 274
1038 3300046531 Ga0495665_0144892 Ga0495665_0144892_154_987 274
1039 3300046533 Ga0495640_0033546 Ga0495640_0033546_710_1543 274
1040 3300046535 Ga0495586_0066111 Ga0495586_0066111_445_1278 274
1041 3300046536 Ga0495587_0148235 Ga0495587_0148235_39_872 274
1042 3300046543 Ga0495645_0212503 Ga0495645_0212503_127_960 274
1043 3300046557 Ga0495622_0012790 Ga0495622_0012790_100_933 274
1044 3300046558 Ga0495633_0012232 Ga0495633_0012232_3712_4545 274
1045 3300046559 Ga0495667_0048193 Ga0495667_0048193_911_1744 274
1046 3300046615 Ga0495656_0038466 Ga0495656_0038466_399_1232 274
1047 3300046615 Ga0495656_0050802 Ga0495656_0050802_691_1566 274
1048 3300046615 Ga0495656_0080625 Ga0495656_0080625_365_1198 274
1049 3300046642 Ga0495634_0085555 Ga0495634_0085555_1047_1880 274
1050 3300046642 Ga0495634_0087759 Ga0495634_0087759_112_945 274
1051 3300046648 Ga0495611_0164424 Ga0495611_0164424_140_973 274
1052 3300046664 Ga0495659_0040529 Ga0495659_0040529_274_1107 274
1053 3300046675 Ga0495657_0110574 Ga0495657_0110574_535_1368 274
1054 3300046678 Ga0495599_0085231 Ga0495599_0085231_361_1194 274
1055 3300046683 Ga0495658_0005335 Ga0495658_0005335_3405_4238 274
1056 3300046684 Ga0495669_0001797 Ga0495669_0001797_2051_2962 274
1057 3300046684 Ga0495669_0235895 Ga0495669_0235895_11_844 274
1058 3300046689 Ga0495613_0172601 Ga0495613_0172601_179_1012 274
1059 3300046690 Ga0495624_0031831 Ga0495624_0031831_1043_1876 274
1060 3300046794 Ga0495589_0215883 Ga0495589_0215883_14_847 274
1061 3300046809 Ga0495600_0054313 Ga0495600_0054313_711_1544 274
1062 3300046809 Ga0495600_0079839 Ga0495600_0079839_413_1246 274
1063 3300047315 Ga0495581_0050644 Ga0495581_0050644_624_1457 274
1064 3300047317 Ga0495604_0067701 Ga0495604_0067701_372_1205 274
1065 3300047321 Ga0495676_0072783 Ga0495676_0072783_27_860 274
1066 3300047321 Ga0495676_0086527 Ga0495676_0086527_508_1341 274
1067 3300047322 Ga0495680_0015838 Ga0495680_0015838_572_1405 274
1068 3300047444 Ga0495675_0084439 Ga0495675_0084439_615_1448 274
1069 3300047471 Ga0495684_0032231 Ga0495684_0032231_2378_3211 274
1070 3300047471 Ga0495684_0186385 Ga0495684_0186385_382_1215 274
1071 3300048903 Ga0496100_0120303 Ga0496100_0120303_595_1506 274
1072 3300048903 Ga0496100_0250974 Ga0496100_0250974_28_861 274
1073 3300048904 Ga0496101_0047905 Ga0496101_0047905_2064_2897 274
1074 3300048904 Ga0496101_0229894 Ga0496101_0229894_279_1190 274
1075 3300048904 Ga0496101_0372334 Ga0496101_0372334_19_864 274
1076 3300048905 Ga0496102_0009948 Ga0496102_0009948_4686_5519 274
1077 3300048905 Ga0496102_0082283 Ga0496102_0082283_722_1555 274
1078 3300048905 Ga0496102_0170653 Ga0496102_0170653_186_1031 274
1079 3300048905 Ga0496102_0342705 Ga0496102_0342705_439_1272 274
1080 3300048906 Ga0496103_0004098 Ga0496103_0004098_3083_3916 274
1081 3300048906 Ga0496103_0021611 Ga0496103_0021611_584_1417 274
1082 3300048906 Ga0496103_0189523 Ga0496103_0189523_36_869 274
1083 3300048907 Ga0496104_0018835 Ga0496104_0018835_3861_4694 274
1084 3300048908 Ga0496105_0001515 Ga0496105_0001515_3585_4418 274
1085 3300048909 Ga0496106_0001932 Ga0496106_0001932_3778_4611 274
1086 3300048909 Ga0496106_0122573 Ga0496106_0122573_473_1318 274
1087 3300048909 Ga0496106_0266501 Ga0496106_0266501_417_1316 274
1088 3300048910 Ga0496107_0033724 Ga0496107_0033724_1672_2505 274
1089 3300048910 Ga0496107_0116329 Ga0496107_0116329_254_1099 274
1090 3300048910 Ga0496107_0206472 Ga0496107_0206472_396_1229 274
1091 3300048911 Ga0496108_0001028 Ga0496108_0001028_17037_17870 274
1092 3300048911 Ga0496108_0038439 Ga0496108_0038439_1858_2691 274
1093 3300048911 Ga0496108_0168537 Ga0496108_0168537_626_1471 274
1094 3300048912 Ga0496109_0002430 Ga0496109_0002430_12136_12969 274
1095 3300048912 Ga0496109_0088619 Ga0496109_0088619_797_1630 274
1096 3300048912 Ga0496109_0107195 Ga0496109_0107195_373_1206 274
1097 3300048913 Ga0496110_0347488 Ga0496110_0347488_129_962 274
1098 3300048914 Ga0496111_0000436 Ga0496111_0000436_6599_7432 274
1099 3300048915 Ga0496112_0004518 Ga0496112_0004518_473_1306 274
1100 3300048915 Ga0496112_0060849 Ga0496112_0060849_2225_3058 274
1101 3300048915 Ga0496112_0198310 Ga0496112_0198310_612_1457 274
1102 3300048916 Ga0496113_0001905 Ga0496113_0001905_4853_5686 274
1103 3300048916 Ga0496113_0056320 Ga0496113_0056320_1593_2426 274
1104 3300048916 Ga0496113_0200118 Ga0496113_0200118_485_1318 274
1105 3300048917 Ga0496114_0102814 Ga0496114_0102814_1065_1898 274
1106 3300048917 Ga0496114_0112915 Ga0496114_0112915_627_1460 274
1107 3300048917 Ga0496114_0253607 Ga0496114_0253607_100_1011 274
1108 3300048918 Ga0496115_0073654 Ga0496115_0073654_160_993 274
1109 3300048918 Ga0496115_0112310 Ga0496115_0112310_712_1623 274
1110 3300048920 Ga0496117_0004621 Ga0496117_0004621_799_1632 274
1111 3300048921 Ga0496118_0001262 Ga0496118_0001262_509_1342 274
1112 3300048921 Ga0496118_0083141 Ga0496118_0083141_883_1716 274
1113 3300048921 Ga0496118_0109041 Ga0496118_0109041_738_1571 274
1114 3300048922 Ga0496119_0115828 Ga0496119_0115828_611_1444 274
1115 3300048924 Ga0496121_0000689 Ga0496121_0000689_48781_49614 274
1116 3300048924 Ga0496121_0056005 Ga0496121_0056005_472_1305 274
1117 3300048924 Ga0496121_0222243 Ga0496121_0222243_218_1051 274
1118 3300048927 Ga0496124_0005646 Ga0496124_0005646_10242_11075 274
1119 3300048927 Ga0496124_0014474 Ga0496124_0014474_399_1232 274
1120 3300048927 Ga0496124_0051872 Ga0496124_0051872_1803_2636 274
1121 3300048928 Ga0496125_0065286 Ga0496125_0065286_1085_1918 274
1122 3300048929 Ga0496126_0003243 Ga0496126_0003243_13020_13853 274
1123 3300048929 Ga0496126_0044004 Ga0496126_0044004_3269_4102 274
1124 3300049459 Ga0495678_088405 Ga0495678_088405_25_858 274
1125 3300049570 Ga0501033_0079101 Ga0501033_0079101_302_1135 274
1126 3300049571 Ga0501034_0373781 Ga0501034_0373781_202_1035 274
1127 3300049574 Ga0501038_0362468 Ga0501038_0362468_13_846 274
1128 3300049576 Ga0501040_0195246 Ga0501040_0195246_524_1372 274
1129 3300049822 Ga0501035_0015977 Ga0501035_0015977_497_1330 274
1130 3300049823 Ga0501044_0196826 Ga0501044_0196826_799_1632 274
1131 3300050489 nmdc:mga03683_21967_c1 nmdc:mga03683_21967_c1_780_1628 274
1132 3300050489 nmdc:mga03683_38137_c1 nmdc:mga03683_38137_c1_88_921 274
1133 3300050490 nmdc:mga03n38_1330_c1 nmdc:mga03n38_1330_c1_6048_6881 274
1134 3300050491 nmdc:mga00v17_11637_c1 nmdc:mga00v17_11637_c1_1974_2807 274
1135 3300050491 nmdc:mga00v17_391929_c1 nmdc:mga00v17_391929_c1_17_850 274
1136 3300050492 nmdc:mga0yw44_9147_c1 nmdc:mga0yw44_9147_c1_2459_3292 274
1137 3300050494 nmdc:mga06z11_13614_c1 nmdc:mga06z11_13614_c1_2128_2961 274
1138 3300050494 nmdc:mga06z11_186_c1 nmdc:mga06z11_186_c1_4679_5512 274
1139 3300050495 nmdc:mga04h51_58354_c1 nmdc:mga04h51_58354_c1_13_846 274
1140 3300050495 nmdc:mga04h51_778_c1 nmdc:mga04h51_778_c1_5286_6119 274
1141 3300050496 nmdc:mga07m45_117688_c1 nmdc:mga07m45_117688_c1_272_1105 274
1142 3300050496 nmdc:mga07m45_78381_c1 nmdc:mga07m45_78381_c1_213_1046 274
1143 3300050507 nmdc:mga05p37_42327_c1 nmdc:mga05p37_42327_c1_1849_2694 274
1144 3300050507 nmdc:mga05p37_50505_c1 nmdc:mga05p37_50505_c1_2975_3808 274
1145 3300050509 nmdc:mga0qj67_358758_c1 nmdc:mga0qj67_358758_c1_281_1126 274
1146 3300050510 nmdc:mga06r32_33861_c1 nmdc:mga06r32_33861_c1_2149_2994 274
1147 3300050511 nmdc:mga08y16_126369_c1 nmdc:mga08y16_126369_c1_1643_2542 274
1148 3300050511 nmdc:mga08y16_66137_c1 nmdc:mga08y16_66137_c1_2906_3739 274
1149 3300050512 nmdc:mga0n895_108270_c1 nmdc:mga0n895_108270_c1_144_977 274
1150 3300050512 nmdc:mga0n895_13911_c1 nmdc:mga0n895_13911_c1_4816_5649 274
1151 3300050514 nmdc:mga08x19_31667_c1 nmdc:mga08x19_31667_c1_2005_2913 274
1152 3300050515 nmdc:mga0a205_240939_c2 nmdc:mga0a205_240939_c2_357_1190 274
1153 3300053077 Ga0495601_0014089 Ga0495601_0014089_1646_2479 274
1154 3300053077 Ga0495601_0049720 Ga0495601_0049720_482_1315 274
1155 3300053078 Ga0495612_0004468 Ga0495612_0004468_2033_2866 274
1156 3300053080 Ga0500635_0135741 Ga0500635_0135741_29_862 274
1157 3300053084 Ga0495595_0014994 Ga0495595_0014994_1555_2388 274
1158 3300053085 Ga0495619_0014309 Ga0495619_0014309_1431_2264 274
1159 3300053085 Ga0495619_0148166 Ga0495619_0148166_128_973 274
1160 3300053096 Ga0500641_0024369 Ga0500641_0024369_456_1358 274
1161 3300053096 Ga0500641_0088013 Ga0500641_0088013_370_1203 274
1162 3300053134 Ga0500658_0073284 Ga0500658_0073284_393_1226 274
1163 3300053134 Ga0500658_0093262 Ga0500658_0093262_46_879 274
1164 3300053163 Ga0500639_121992 Ga0500639_121992_16_849 274
1165 3300005545 Ga0070695_100002588 Ga0070695_1000025888 275
1166 3300005548 Ga0070665_100089787 Ga0070665_1000897875 275
1167 3300006177 Ga0075362_10035038 Ga0075362_100350383 275
1168 3300006353 Ga0075370_10029757 Ga0075370_100297572 275
1169 3300006852 Ga0075433_10055263 Ga0075433_100552634 275
1170 3300006871 Ga0075434_100113871 Ga0075434_1001138712 275
1171 3300009093 Ga0105240_10236287 Ga0105240_102362872 275
1172 3300009094 Ga0111539_10037824 Ga0111539_100378246 275
1173 3300009545 Ga0105237_10141503 Ga0105237_101415033 275
1174 3300010375 Ga0105239_10151061 Ga0105239_101510612 275
1175 3300017792 Ga0163161_10269997 Ga0163161_102699972 275
1176 3300025913 Ga0207695_10017137 Ga0207695_100171376 275
1177 3300028379 Ga0268266_10192756 Ga0268266_101927562 275
1178 3300035111 Ga0373923_0010398 Ga0373923_0010398_1979_2827 275
1179 3300035113 Ga0373936_0016640 Ga0373936_0016640_711_1547 275
1180 3300035116 Ga0373945_0026901 Ga0373945_0026901_1023_1859 275
1181 3300035118 Ga0373954_0000659 Ga0373954_0000659_7220_8068 275
1182 3300035118 Ga0373954_0014721 Ga0373954_0014721_2126_2962 275
1183 3300035119 Ga0373956_0008072 Ga0373956_0008072_2285_3133 275
1184 3300035120 Ga0373957_0002330 Ga0373957_0002330_3776_4624 275
1185 3300035170 Ga0373943_0004594 Ga0373943_0004594_1359_2195 275
1186 3300035172 Ga0373955_0000335 Ga0373955_0000335_7155_8003 275
1187 3300035172 Ga0373955_0017724 Ga0373955_0017724_94_930 275
1188 3300035692 Ga0373935_0001283 Ga0373935_0001283_3807_4643 275
1189 3300035695 Ga0373927_0000515 Ga0373927_0000515_3589_4425 275
1190 3300035725 Ga0373947_0003063 Ga0373947_0003063_4839_5675 275
1191 3300036401 Ga0373937_0005938 Ga0373937_0005938_8457_9305 275
1192 3300046454 Ga0495592_0004136 Ga0495592_0004136_588_1436 275
1193 3300046454 Ga0495592_0023188 Ga0495592_0023188_1583_2419 275
1194 3300046455 Ga0495603_0000156 Ga0495603_0000156_20949_21785 275
1195 3300046459 Ga0495629_0000297 Ga0495629_0000297_24209_25045 275
1196 3300046459 Ga0495629_0002353 Ga0495629_0002353_9977_10825 275
1197 3300046461 Ga0495641_0003033 Ga0495641_0003033_5538_6374 275
1198 3300046461 Ga0495641_0031993 Ga0495641_0031993_756_1634 275
1199 3300046463 Ga0495653_0059547 Ga0495653_0059547_447_1283 275
1200 3300046472 Ga0495580_0004950 Ga0495580_0004950_510_1346 275
1201 3300046473 Ga0495582_0000087 Ga0495582_0000087_22483_23319 275
1202 3300046475 Ga0495639_0000153 Ga0495639_0000153_24409_25245 275
1203 3300046476 Ga0495662_0002946 Ga0495662_0002946_3948_4784 275
1204 3300046477 Ga0495664_0035984 Ga0495664_0035984_1251_2087 275
1205 3300046499 Ga0495594_0001275 Ga0495594_0001275_5423_6259 275
1206 3300046499 Ga0495594_0044076 Ga0495594_0044076_1511_2389 275
1207 3300046511 Ga0495608_0002817 Ga0495608_0002817_10498_11346 275
1208 3300046514 Ga0495618_0105972 Ga0495618_0105972_86_922 275
1209 3300046516 Ga0495628_0006351 Ga0495628_0006351_2265_3113 275
1210 3300046516 Ga0495628_0006427 Ga0495628_0006427_815_1651 275
1211 3300046517 Ga0495630_0000735 Ga0495630_0000735_11937_12773 275
1212 3300046518 Ga0495631_0083667 Ga0495631_0083667_365_1243 275
1213 3300046520 Ga0495637_0069026 Ga0495637_0069026_238_1116 275
1214 3300046529 Ga0495652_0003411 Ga0495652_0003411_10239_11075 275
1215 3300046529 Ga0495652_0021093 Ga0495652_0021093_3056_3904 275
1216 3300046531 Ga0495665_0000117 Ga0495665_0000117_25118_25954 275
1217 3300046533 Ga0495640_0002597 Ga0495640_0002597_4612_5448 275
1218 3300046533 Ga0495640_0004127 Ga0495640_0004127_6046_6894 275
1219 3300046537 Ga0495598_0067311 Ga0495598_0067311_73_951 275
1220 3300046557 Ga0495622_0001116 Ga0495622_0001116_5959_6795 275
1221 3300046558 Ga0495633_0018062 Ga0495633_0018062_2577_3455 275
1222 3300046559 Ga0495667_0003186 Ga0495667_0003186_7197_8045 275
1223 3300046559 Ga0495667_0009440 Ga0495667_0009440_1335_2171 275
1224 3300046642 Ga0495634_0035244 Ga0495634_0035244_1301_2137 275
1225 3300046663 Ga0495635_0004107 Ga0495635_0004107_3906_4742 275
1226 3300046663 Ga0495635_0004151 Ga0495635_0004151_2078_2926 275
1227 3300046674 Ga0495588_0015743 Ga0495588_0015743_558_1394 275
1228 3300046675 Ga0495657_0022202 Ga0495657_0022202_848_1696 275
1229 3300046678 Ga0495599_0002862 Ga0495599_0002862_1381_2229 275
1230 3300046679 Ga0495623_0004294 Ga0495623_0004294_7686_8534 275
1231 3300046680 Ga0495646_0007517 Ga0495646_0007517_3777_4625 275
1232 3300046680 Ga0495646_0012394 Ga0495646_0012394_914_1750 275
1233 3300046681 Ga0495647_0000365 Ga0495647_0000365_10769_11605 275
1234 3300046683 Ga0495658_0000644 Ga0495658_0000644_3943_4779 275
1235 3300046683 Ga0495658_0010016 Ga0495658_0010016_3584_4462 275
1236 3300046689 Ga0495613_0005220 Ga0495613_0005220_3817_4653 275
1237 3300046689 Ga0495613_0025843 Ga0495613_0025843_1467_2315 275
1238 3300046690 Ga0495624_0000668 Ga0495624_0000668_1759_2595 275
1239 3300046809 Ga0495600_0121829 Ga0495600_0121829_220_1056 275
1240 3300047315 Ga0495581_0042306 Ga0495581_0042306_1029_1865 275
1241 3300047317 Ga0495604_0005885 Ga0495604_0005885_7545_8393 275
1242 3300047319 Ga0495674_0000177 Ga0495674_0000177_24217_25053 275
1243 3300047319 Ga0495674_0019813 Ga0495674_0019813_1900_2748 275
1244 3300047321 Ga0495676_0034415 Ga0495676_0034415_3275_4111 275
1245 3300047322 Ga0495680_0027227 Ga0495680_0027227_998_1846 275
1246 3300047471 Ga0495684_0002187 Ga0495684_0002187_9284_10120 275
1247 3300047471 Ga0495684_0008299 Ga0495684_0008299_720_1568 275
1248 3300047673 Ga0495593_0000156 Ga0495593_0000156_21039_21875 275
1249 3300047673 Ga0495593_0001736 Ga0495593_0001736_7146_7994 275
1250 3300048089 Ga0495614_0015188 Ga0495614_0015188_2448_3284 275
1251 3300048907 Ga0496104_0520828 Ga0496104_0520828_69_917 275
1252 3300048928 Ga0496125_0000654 Ga0496125_0000654_18024_18860 275
1253 3300048928 Ga0496125_0002454 Ga0496125_0002454_23003_23839 275
1254 3300048929 Ga0496126_0037854 Ga0496126_0037854_2220_3056 275
1255 3300049590 Ga0501074_0272855 Ga0501074_0272855_37_882 275
1256 3300049742 Ga0501080_0264120 Ga0501080_0264120_692_1537 275
1257 3300050496 nmdc:mga07m45_21937_c1 nmdc:mga07m45_21937_c1_1446_2288 275
1258 3300050509 nmdc:mga0qj67_124016_c1 nmdc:mga0qj67_124016_c1_413_1255 275
1259 3300050512 nmdc:mga0n895_19291_c1 nmdc:mga0n895_19291_c1_3569_4417 275
1260 3300050514 nmdc:mga08x19_22_c1 nmdc:mga08x19_22_c1_275093_275929 275
1261 3300050515 nmdc:mga0a205_4562_c1 nmdc:mga0a205_4562_c1_7709_8557 275
1262 3300053085 Ga0495619_0002975 Ga0495619_0002975_2960_3808 275
1263 3300006038 Ga0075365_10037210 Ga0075365_100372102 276
1264 3300006042 Ga0075368_10008930 Ga0075368_100089301 276
1265 3300006048 Ga0075363_100085720 Ga0075363_1000857202 276
1266 3300006051 Ga0075364_10300634 Ga0075364_103006342 276
1267 3300007788 Ga0099795_10009692 Ga0099795_100096922 276
1268 3300048903 Ga0496100_0030002 Ga0496100_0030002_667_1509 276
1269 3300048913 Ga0496110_0109178 Ga0496110_0109178_851_1693 276
1270 3300048918 Ga0496115_0028337 Ga0496115_0028337_2179_3021 276
1271 3300050494 nmdc:mga06z11_127234_c1 nmdc:mga06z11_127234_c1_103_951 276
1272 3300050495 nmdc:mga04h51_21675_c1 nmdc:mga04h51_21675_c1_920_1774 276
1273 3300053158 Ga0500627_0017660 Ga0500627_0017660_1595_2443 276
1274 3300031247 Ga0265340_10061619 Ga0265340_100616192 277
1275 3300031249 Ga0265339_10012668 Ga0265339_100126684 277
1276 3300035114 Ga0373939_0002169 Ga0373939_0002169_952_1860 277
1277 3300035691 Ga0373931_0046874 Ga0373931_0046874_1001_1909 277
1278 iso_pu_bacteria 2841760612 2841765951 277
1279 iso_pu_bacteria 2841911363 2841912404 277
1280 iso_pu_bacteria 2841917233 2841918159 277
1281 iso_pu_bacteria 2844104063 2844105717 277
1282 iso_pu_bacteria 2851246043 2851246073 277
1283 iso_pu_bacteria 8057529695 8057531723 277
1284 3300002987 JGI25159J45721_1008904 JGI25159J45721_10089044 281
1285 3300005262 Ga0065165_1000209 Ga0065165_1000209100 281
1286 3300025284 Ga0209130_1000080 Ga0209130_100008055 281
1287 3300025302 Ga0207426_1005450 Ga0207426_10054504 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

46

278

0.92

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

55

286

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.9477 31 275
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.9256 31 275
3cvg-assembly1.cif.gz_A crystal structure of a periplasmic putative metal binding protein 0.8554 29 274
3cvg-assembly5.cif.gz_C crystal structure of a periplasmic putative metal binding protein 0.8542 87 274
3lr1-assembly1.cif.gz_A the crystal structure of the tungstate abc transporter from geobacter sulfurreducens 0.8192 30 264
ID Description Score Start End Superfamily
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9724 31 275 3.40.190.10
3muqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9625 31 260 3.40.190.10
3kn3C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9587 32 107 3.40.190.10
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9448 31 275 3.40.190.10
3muqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9273 110 225 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Y5EAF9-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9797 33 275
AF-A0A3B8SWU7-F1-model_v4 Sulfate transporter 0.9786 45 275
AF-A0A2D7SJZ4-F1-model_v4 Sulfate transporter 0.9753 28 275
AF-C0N6B9-F1-model_v4 PBP domain-containing protein 0.9715 31 278
AF-A0A3B0RCL9-F1-model_v4 Tungstate ABC transporter, substrate-binding protein 0.9697 23 247

Feature Viewer

pLDDT pTM Quality
88.18 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map