F492451

General Info

Members Datasets Scaffolds Average Seq Length
1274 531 1272 277

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10029049|Ga0207695_100290492
Length 304
Sequence MSKDNMTDASRRALLAGGVGIAPAMATSRMADGYVTTADGTKIYYKDWGSGQPIVFSHGWPLSADDWDPQMMFFLQNRYRVIAHDRRGHGRSTQTDTGNDMDHYAPDLAALTAHLDLHNAIHVGHSTGGGEVVHYVARHQERVAKAAIISAVPPVMVKSASNPEGIPLEGFEPYRQQTAFNRPQFYLDVPSGPFYGFNRPGVKTIPGLVQNWWRQGMMGGVKAQVDCVKAFSETDFTEDLKKITVPVLVMHSKDDQVVPYADSGPKSAALLKNGTLKTYENYPHGMITTQADVINADLLAFFKA

Samples

Sample ID Description Type Environment
1 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
2 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
144 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
145 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
150 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
151 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
234 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
235 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
242 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
243 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
244 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
245 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
246 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
247 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
251 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
253 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
254 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
255 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
260 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
261 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
265 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
269 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
274 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
275 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
276 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
290 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
291 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
292 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
302 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
303 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
304 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
305 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
306 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
307 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
308 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
309 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
310 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
311 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
312 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
313 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
314 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
315 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
316 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
317 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
318 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
319 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
320 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
321 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
322 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
323 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
324 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
325 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
326 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
327 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
328 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
329 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
330 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
331 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
332 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
333 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
334 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
335 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
336 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
337 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
340 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
341 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
342 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
343 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
344 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
348 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
349 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
363 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
364 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
365 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
366 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
370 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
371 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
372 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
373 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
374 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
375 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
376 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
377 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
378 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
379 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
382 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
383 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
384 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
385 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
386 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
387 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
388 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
389 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
390 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
391 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
392 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
393 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
394 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
395 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
396 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
397 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
398 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
399 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
400 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
401 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
404 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
405 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
406 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
407 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
408 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
409 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
410 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
411 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
414 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
415 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
418 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
419 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
420 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
421 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
422 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
423 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
424 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
425 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
426 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
427 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
428 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
433 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
434 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
435 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
436 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
443 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
444 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
445 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
446 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
447 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
448 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
449 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
450 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
451 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
452 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
453 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
454 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
455 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
456 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
457 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
458 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
471 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
472 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
473 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
474 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
477 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
478 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
480 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
481 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
482 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
483 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
484 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
485 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
486 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
487 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
488 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
489 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
490 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
491 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
492 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
493 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
494 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
495 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
496 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
497 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
498 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
499 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
500 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
501 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
502 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
503 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
504 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
505 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
506 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
507 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
508 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
509 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
510 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
511 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
512 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
513 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
514 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
515 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
516 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
517 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
518 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
519 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
520 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
521 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
522 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
523 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
524 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
525 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
526 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
531 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.86
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 0.63
Rhizoplane 7.85
Rhizosphere 74.96
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000662 3300002739 Bacteria 6722
2 JGI25164J39214_1000349 3300002772 Bacteria 28764
3 JGI25150J39212_1015276 3300002774 Bacteria 1284
4 JGI25159J45721_1003457 3300002987 Bacteria 5574
5 JGI25153J46596_10001277 3300003215 Bacteria 15111
6 JGI25153J46596_10003243 3300003215 Bacteria 9147
7 JGI25160J50197_1000710 3300003354 Bacteria 18324
8 JGI25160J50197_1000774 3300003354 Bacteria 17157
9 JGI25160J50197_1003342 3300003354 Bacteria 7212
10 JGI25161J50226_1000108 3300003374 Bacteria 65159
11 JGI25161J50226_1009853 3300003374 Bacteria 1323
12 Ga0055532_1000114 3300003758 Bacteria 85635
13 Ga0055542_1003323 3300003762 Bacteria 4441
14 Ga0055536_1001668 3300003781 Bacteria 13181
15 Ga0055530_10005027 3300003791 Bacteria 6514
16 Ga0055540_1001608 3300003792 Bacteria 13175
17 Ga0055540_1004160 3300003792 Bacteria 6683
18 Ga0055540_1005734 3300003792 Bacteria 5119
19 Ga0055540_1010901 3300003792 Bacteria 2984
20 Ga0055531_10009365 3300003794 Bacteria 5013
21 Ga0055531_10010163 3300003794 Bacteria 4716
22 Ga0055543_1000020 3300004625 Bacteria 150535
23 Ga0058861_10089271 3300004800 Bacteria 2492
24 Ga0058862_10085905 3300004803 Bacteria 2023
25 Ga0058862_12278394 3300004803 Bacteria 895
26 Ga0065165_1000721 3300005262 Bacteria 46476
27 Ga0065165_1002238 3300005262 Bacteria 17195
28 Ga0065165_1008083 3300005262 Bacteria 5018
29 Ga0065165_1022880 3300005262 Bacteria 2130
30 Ga0065165_1023885 3300005262 Bacteria 2064
31 Ga0065714_10005120 3300005288 Bacteria 4919
32 Ga0065714_10010177 3300005288 Bacteria 2937
33 Ga0065712_10181387 3300005290 Bacteria 1191
34 Ga0065715_10010704 3300005293 Bacteria 2411
35 Ga0065715_10021897 3300005293 Bacteria 1377
36 Ga0065715_10307578 3300005293 Bacteria 1027
37 Ga0065707_10027623 3300005295 Bacteria 1235
38 Ga0070658_10046828 3300005327 Bacteria 3499
39 Ga0070658_10054420 3300005327 Bacteria 3250
40 Ga0070676_10005631 3300005328 Bacteria 6672
41 Ga0070676_10252359 3300005328 Bacteria 1178
42 Ga0070683_100000936 3300005329 Bacteria 21719
43 Ga0070683_100008708 3300005329 Bacteria 8628
44 Ga0070683_100109810 3300005329 Bacteria 2601
45 Ga0070670_100059090 3300005331 Bacteria 3291
46 Ga0068869_100043066 3300005334 Bacteria 3240
47 Ga0068869_100449642 3300005334 Bacteria 1068
48 Ga0070666_10014585 3300005335 Bacteria 5004
49 Ga0070666_10136178 3300005335 Bacteria 1709
50 Ga0070680_100252253 3300005336 Bacteria 1492
51 Ga0070680_100437927 3300005336 Bacteria 1116
52 Ga0068868_100000053 3300005338 Bacteria 65580
53 Ga0068868_100012606 3300005338 Bacteria 6182
54 Ga0068868_100028072 3300005338 Bacteria 4298
55 Ga0068868_100091761 3300005338 Bacteria 2447
56 Ga0070660_100019335 3300005339 Bacteria 4988
57 Ga0070660_100043845 3300005339 Bacteria 3419
58 Ga0070660_100353830 3300005339 Bacteria 1210
59 Ga0070689_100160422 3300005340 Bacteria 1817
60 Ga0070691_10046396 3300005341 Bacteria 2064
61 Ga0070661_100024549 3300005344 Bacteria 4324
62 Ga0070661_100077584 3300005344 Bacteria 2449
63 Ga0070661_100116522 3300005344 Bacteria 1998
64 Ga0070668_100002970 3300005347 Bacteria 12540
65 Ga0070668_100010579 3300005347 Bacteria 6863
66 Ga0070668_100033360 3300005347 Bacteria 3920
67 Ga0070668_100093912 3300005347 Bacteria 2368
68 Ga0070668_100259241 3300005347 Bacteria 1445
69 Ga0070669_100003310 3300005353 Bacteria 11585
70 Ga0070669_100439084 3300005353 Bacteria 1074
71 Ga0070675_100018024 3300005354 Bacteria 5619
72 Ga0070675_100028318 3300005354 Bacteria 4510
73 Ga0070675_100371124 3300005354 Bacteria 1272
74 Ga0070675_100372051 3300005354 Bacteria 1270
75 Ga0070671_100267490 3300005355 Bacteria 1453
76 Ga0070671_100268451 3300005355 Bacteria 1450
77 Ga0070674_100004168 3300005356 Bacteria 8214
78 Ga0070674_100020678 3300005356 Bacteria 4212
79 Ga0070674_100089083 3300005356 Bacteria 2222
80 Ga0070673_100000010 3300005364 Bacteria 153851
81 Ga0070673_100058879 3300005364 Bacteria 3039
82 Ga0070688_100132325 3300005365 Bacteria 1684
83 Ga0070688_100174886 3300005365 Bacteria 1485
84 Ga0070659_100041691 3300005366 Bacteria 3589
85 Ga0070659_100077903 3300005366 Bacteria 2644
86 Ga0070659_100166133 3300005366 Bacteria 1806
87 Ga0070667_100048193 3300005367 Bacteria 3586
88 Ga0070667_100186665 3300005367 Bacteria 1835
89 Ga0070714_100054764 3300005435 Bacteria 3408
90 Ga0070713_100050254 3300005436 Bacteria 3443
91 Ga0070713_100463626 3300005436 Bacteria 1192
92 Ga0070711_100057300 3300005439 Bacteria 2697
93 Ga0070705_100141910 3300005440 Bacteria 1582
94 Ga0070705_100156878 3300005440 Bacteria 1517
95 Ga0070694_100170321 3300005444 Bacteria 1604
96 Ga0070708_100045773 3300005445 Bacteria 3857
97 Ga0070708_100049795 3300005445 Bacteria 3707
98 Ga0070708_100396425 3300005445 Bacteria 1301
99 Ga0070663_100037787 3300005455 Bacteria 3363
100 Ga0070663_100124305 3300005455 Bacteria 1952
101 Ga0070663_100188240 3300005455 Bacteria 1605
102 Ga0070663_100222134 3300005455 Bacteria 1483
103 Ga0070663_100270756 3300005455 Bacteria 1350
104 Ga0070663_100368519 3300005455 Bacteria 1167
105 Ga0070678_100059686 3300005456 Bacteria 2804
106 Ga0070678_100074297 3300005456 Bacteria 2554
107 Ga0070678_100217819 3300005456 Bacteria 1585
108 Ga0070678_100267727 3300005456 Bacteria 1440
109 Ga0070678_100619333 3300005456 Bacteria 968
110 Ga0070662_100000224 3300005457 Bacteria 33436
111 Ga0070662_100151896 3300005457 Bacteria 1804
112 Ga0070662_100250519 3300005457 Bacteria 1423
113 Ga0070662_100320490 3300005457 Bacteria 1264
114 Ga0070662_100554960 3300005457 Bacteria 963
115 Ga0068867_100000007 3300005459 Bacteria 148726
116 Ga0068867_100031914 3300005459 Bacteria 3806
117 Ga0070706_100029541 3300005467 Bacteria 5049
118 Ga0070706_100243051 3300005467 Bacteria 1681
119 Ga0070706_100248543 3300005467 Bacteria 1661
120 Ga0070706_100380280 3300005467 Bacteria 1315
121 Ga0070707_100236357 3300005468 Bacteria 1779
122 Ga0070698_100094463 3300005471 Bacteria 2969
123 Ga0070699_100002512 3300005518 Bacteria 16468
124 Ga0070699_100055334 3300005518 Bacteria 3436
125 Ga0070699_100068729 3300005518 Bacteria 3078
126 Ga0070699_100276137 3300005518 Bacteria 1505
127 Ga0070679_100165782 3300005530 Bacteria 2183
128 Ga0070684_100019719 3300005535 Bacteria 5581
129 Ga0070684_100032661 3300005535 Bacteria 4437
130 Ga0070697_100046072 3300005536 Bacteria 3534
131 Ga0070697_100268363 3300005536 Bacteria 1462
132 Ga0068853_100193272 3300005539 Bacteria 1850
133 Ga0070672_100011139 3300005543 Bacteria 6263
134 Ga0070672_100088810 3300005543 Bacteria 2489
135 Ga0070695_100067850 3300005545 Bacteria 2327
136 Ga0070665_100126012 3300005548 Bacteria 2563
137 Ga0070665_100306758 3300005548 Bacteria 1591
138 Ga0070665_100316182 3300005548 Bacteria 1565
139 Ga0070665_100629071 3300005548 Bacteria 1086
140 Ga0070704_100100225 3300005549 Bacteria 2180
141 Ga0068855_100341132 3300005563 Bacteria 1652
142 Ga0068855_100388521 3300005563 Bacteria 1531
143 Ga0070664_100041990 3300005564 Bacteria 3861
144 Ga0070664_100050681 3300005564 Bacteria 3514
145 Ga0068857_100017116 3300005577 Bacteria 6350
146 Ga0068854_100489607 3300005578 Bacteria 1034
147 Ga0070702_100116239 3300005615 Bacteria 1667
148 Ga0068852_100080278 3300005616 Bacteria 2892
149 Ga0068852_100213734 3300005616 Bacteria 1831
150 Ga0068864_100008698 3300005618 Bacteria 8377
151 Ga0068864_100343080 3300005618 Bacteria 1408
152 Ga0068861_100002901 3300005719 Bacteria 11299
153 Ga0068861_100018409 3300005719 Bacteria 4977
154 Ga0068861_100083156 3300005719 Bacteria 2510
155 Ga0068861_100088820 3300005719 Bacteria 2435
156 Ga0068861_100498255 3300005719 Bacteria 1101
157 Ga0068851_10038537 3300005834 Bacteria 2398
158 Ga0068870_10000970 3300005840 Bacteria 11283
159 Ga0068863_100075810 3300005841 Bacteria 3182
160 Ga0068863_100134656 3300005841 Bacteria 2360
161 Ga0068863_100147749 3300005841 Bacteria 2249
162 Ga0068863_100204940 3300005841 Bacteria 1898
163 Ga0068863_100229612 3300005841 Bacteria 1790
164 Ga0068863_100251302 3300005841 Bacteria 1708
165 Ga0068858_100025545 3300005842 Bacteria 5496
166 Ga0068858_100042002 3300005842 Bacteria 4240
167 Ga0068858_100056317 3300005842 Bacteria 3634
168 Ga0068860_100006936 3300005843 Bacteria 11354
169 Ga0068860_100049874 3300005843 Bacteria 3986
170 Ga0068860_100061429 3300005843 Bacteria 3570
171 Ga0068860_100212061 3300005843 Bacteria 1879
172 Ga0068862_100000841 3300005844 Bacteria 30209
173 Ga0068862_100079179 3300005844 Bacteria 2848
174 Ga0081455_10001668 3300005937 Bacteria 26917
175 Ga0081455_10005180 3300005937 Bacteria 14352
176 Ga0081455_10006288 3300005937 Bacteria 12771
177 Ga0081455_10049461 3300005937 Bacteria 3624
178 Ga0081538_10096999 3300005981 Bacteria 1500
179 Ga0081540_1000688 3300005983 Bacteria 31561
180 Ga0081540_1000739 3300005983 Bacteria 30091
181 Ga0081540_1047569 3300005983 Bacteria 2156
182 Ga0081539_10001833 3300005985 Bacteria 33546
183 Ga0075365_10029757 3300006038 Bacteria 3493
184 Ga0075365_10064681 3300006038 Bacteria 2450
185 Ga0075365_10079499 3300006038 Bacteria 2219
186 Ga0075365_10090197 3300006038 Bacteria 2087
187 Ga0075368_10100078 3300006042 Bacteria 1190
188 Ga0075363_100033297 3300006048 Bacteria 2682
189 Ga0075432_10015485 3300006058 Bacteria 2600
190 Ga0070716_100078778 3300006173 Bacteria 1960
191 Ga0070712_100138092 3300006175 Bacteria 1856
192 Ga0070712_100174188 3300006175 Bacteria 1672
193 Ga0070712_100207987 3300006175 Bacteria 1541
194 Ga0070712_100258067 3300006175 Bacteria 1395
195 Ga0075362_10000378 3300006177 Bacteria 12764
196 Ga0075362_10013889 3300006177 Bacteria 3236
197 Ga0075362_10076029 3300006177 Bacteria 1541
198 Ga0075367_10024462 3300006178 Bacteria 3406
199 Ga0075369_10005701 3300006186 Bacteria 4672
200 Ga0075369_10049001 3300006186 Bacteria 1824
201 Ga0075369_10071660 3300006186 Bacteria 1525
202 Ga0075366_10027098 3300006195 Bacteria 3361
203 Ga0075366_10222617 3300006195 Bacteria 1150
204 Ga0097621_100030634 3300006237 Bacteria 4261
205 Ga0068871_100021666 3300006358 Bacteria 4944
206 Ga0068871_100060493 3300006358 Bacteria 3090
207 Ga0075428_100019819 3300006844 Bacteria 7443
208 Ga0075430_100018889 3300006846 Bacteria 5865
209 Ga0075430_100045336 3300006846 Bacteria 3715
210 Ga0075431_100018004 3300006847 Bacteria 7185
211 Ga0075431_100073613 3300006847 Bacteria 3524
212 Ga0075431_100140936 3300006847 Bacteria 2485
213 Ga0075433_10000196 3300006852 Bacteria 34036
214 Ga0075433_10002289 3300006852 Bacteria 14573
215 Ga0075433_10231042 3300006852 Bacteria 1643
216 Ga0075433_10441342 3300006852 Bacteria 1147
217 Ga0075434_100002691 3300006871 Bacteria 15694
218 Ga0075434_100032415 3300006871 Bacteria 5152
219 Ga0075434_100036174 3300006871 Bacteria 4884
220 Ga0075434_100043508 3300006871 Bacteria 4454
221 Ga0075434_100173174 3300006871 Bacteria 2178
222 Ga0075434_100223062 3300006871 Bacteria 1905
223 Ga0075434_100376014 3300006871 Bacteria 1442
224 Ga0075429_100014540 3300006880 Bacteria 6820
225 Ga0075429_100079801 3300006880 Bacteria 2852
226 Ga0068865_100000010 3300006881 Bacteria 159548
227 Ga0068865_100482870 3300006881 Bacteria 1030
228 Ga0075436_100001361 3300006914 Bacteria 16623
229 Ga0099824_1021533 3300006942 Bacteria 4473
230 Ga0075435_100013352 3300007076 Bacteria 6107
231 Ga0075435_100033111 3300007076 Bacteria 4084
232 Ga0075435_100054651 3300007076 Bacteria 3223
233 Ga0075435_100097774 3300007076 Bacteria 2429
234 Ga0099794_10021388 3300007265 Bacteria 2939
235 Ga0099795_10011474 3300007788 Bacteria 2650
236 Ga0105251_10011088 3300009011 Bacteria 5170
237 Ga0105251_10030142 3300009011 Bacteria 2726
238 Ga0105251_10066235 3300009011 Bacteria 1689
239 Ga0105244_10011278 3300009036 Bacteria 5374
240 Ga0105244_10033048 3300009036 Bacteria 2732
241 Ga0105250_10004415 3300009092 Bacteria 6478
242 Ga0105250_10022797 3300009092 Bacteria 2523
243 Ga0105250_10031236 3300009092 Bacteria 2139
244 Ga0105250_10069898 3300009092 Bacteria 1417
245 Ga0105240_10001146 3300009093 Bacteria 46418
246 Ga0105240_10150877 3300009093 Bacteria 2768
247 Ga0111539_10042650 3300009094 Bacteria 5445
248 Ga0111539_10097826 3300009094 Bacteria 3447
249 Ga0111539_10310362 3300009094 Bacteria 1836
250 Ga0105245_10000174 3300009098 Bacteria 61234
251 Ga0105245_10079557 3300009098 Bacteria 2993
252 Ga0105245_10165228 3300009098 Bacteria 2103
253 Ga0105247_10052360 3300009101 Bacteria 2516
254 Ga0105247_10188844 3300009101 Bacteria 1379
255 Ga0114129_10032034 3300009147 Bacteria 7431
256 Ga0114129_10037094 3300009147 Bacteria 6882
257 Ga0114129_10119597 3300009147 Bacteria 3628
258 Ga0114129_10125802 3300009147 Bacteria 3524
259 Ga0114129_10128927 3300009147 Bacteria 3476
260 Ga0114129_10327486 3300009147 Bacteria 2035
261 Ga0114129_10525243 3300009147 Bacteria 1543
262 Ga0105243_10000054 3300009148 Bacteria 136517
263 Ga0105243_10000650 3300009148 Bacteria 34412
264 Ga0105243_10161575 3300009148 Bacteria 1932
265 Ga0105243_10245250 3300009148 Bacteria 1596
266 Ga0105241_10027208 3300009174 Bacteria 4258
267 Ga0105242_10000821 3300009176 Bacteria 24146
268 Ga0105242_10215240 3300009176 Bacteria 1714
269 Ga0105248_10006263 3300009177 Bacteria 13046
270 Ga0105248_10006970 3300009177 Bacteria 12381
271 Ga0105248_10021325 3300009177 Bacteria 7180
272 Ga0105248_10646171 3300009177 Bacteria 1193
273 Ga0105248_10839840 3300009177 Bacteria 1037
274 Ga0105237_10041847 3300009545 Bacteria 4620
275 Ga0105238_10329720 3300009551 Bacteria 1513
276 Ga0105249_10000653 3300009553 Bacteria 31473
277 Ga0105249_10009100 3300009553 Bacteria 8686
278 Ga0105249_10066278 3300009553 Bacteria 3324
279 Ga0105249_10224028 3300009553 Bacteria 1852
280 Ga0105249_10227082 3300009553 Bacteria 1840
281 Ga0105239_10063253 3300010375 Bacteria 4063
282 Ga0105239_10077256 3300010375 Bacteria 3664
283 Ga0105239_10081105 3300010375 Bacteria 3571
284 Ga0105239_10106945 3300010375 Bacteria 3099
285 Ga0105239_10131425 3300010375 Bacteria 2785
286 Ga0105239_10156146 3300010375 Bacteria 2548
287 Ga0105239_10204092 3300010375 Bacteria 2215
288 Ga0105239_10424519 3300010375 Bacteria 1506
289 Ga0105239_10518636 3300010375 Bacteria 1356
290 Ga0105239_10743693 3300010375 Bacteria 1122
291 Ga0105246_10001706 3300011119 Bacteria 13114
292 Ga0157373_10250627 3300013100 Bacteria 1252
293 Ga0157370_10051107 3300013104 Bacteria 3949
294 Ga0157374_10000468 3300013296 Bacteria 36718
295 Ga0157374_10037319 3300013296 Bacteria 4459
296 Ga0157374_10083317 3300013296 Bacteria 3038
297 Ga0157374_10211300 3300013296 Bacteria 1902
298 Ga0157378_10000494 3300013297 Bacteria 37394
299 Ga0157378_10108212 3300013297 Bacteria 2545
300 Ga0157378_10122492 3300013297 Bacteria 2399
301 Ga0157378_10236269 3300013297 Bacteria 1744
302 Ga0163162_10002044 3300013306 Bacteria 18979
303 Ga0163162_10004882 3300013306 Bacteria 12932
304 Ga0163162_10266217 3300013306 Bacteria 1845
305 Ga0163162_10296879 3300013306 Bacteria 1747
306 Ga0163162_10306192 3300013306 Bacteria 1721
307 Ga0163162_10458275 3300013306 Bacteria 1407
308 Ga0157372_10006245 3300013307 Bacteria 12672
309 Ga0157372_10152027 3300013307 Bacteria 2672
310 Ga0157375_10000306 3300013308 Bacteria 44319
311 Ga0157375_10009201 3300013308 Bacteria 8660
312 Ga0157375_10088941 3300013308 Bacteria 3144
313 Ga0157375_10153199 3300013308 Bacteria 2442
314 Ga0157375_10219430 3300013308 Bacteria 2060
315 Ga0163163_10015523 3300014325 Bacteria 7042
316 Ga0163163_10072523 3300014325 Bacteria 3433
317 Ga0163163_10270509 3300014325 Bacteria 1751
318 Ga0163163_10332917 3300014325 Bacteria 1573
319 Ga0163163_10476867 3300014325 Bacteria 1308
320 Ga0157380_10103397 3300014326 Bacteria 2377
321 Ga0157380_10505086 3300014326 Bacteria 1175
322 Ga0182008_10004732 3300014497 Bacteria 7887
323 Ga0157377_10051614 3300014745 Bacteria 2320
324 Ga0157377_10061106 3300014745 Bacteria 2152
325 Ga0157377_10102716 3300014745 Bacteria 1706
326 Ga0157379_10000589 3300014968 Bacteria 29397
327 Ga0157376_10000047 3300014969 Bacteria 107974
328 Ga0157376_10029686 3300014969 Bacteria 4358
329 Ga0157376_10079589 3300014969 Bacteria 2809
330 Ga0157376_10126954 3300014969 Bacteria 2270
331 Ga0157376_10129146 3300014969 Bacteria 2252
332 Ga0157376_10374350 3300014969 Bacteria 1370
333 Ga0157376_10483416 3300014969 Bacteria 1214
334 Ga0157376_10724175 3300014969 Bacteria 1002
335 Ga0163161_10002676 3300017792 Bacteria 12659
336 Ga0163161_10011963 3300017792 Bacteria 6020
337 Ga0163161_10048757 3300017792 Bacteria 3059
338 Ga0163161_10163935 3300017792 Bacteria 1696
339 Ga0206351_10413641 3300020077 Bacteria 2894
340 Ga0206352_10167672 3300020078 Bacteria 921
341 Ga0206353_10230641 3300020082 Bacteria 871
342 Ga0214542_1000007 3300021321 Bacteria 291816
343 Ga0214545_1000006 3300021324 Bacteria 291693
344 Ga0214543_1000009 3300021327 Bacteria 384302
345 Ga0213872_10031678 3300021361 Bacteria 2424
346 Ga0213874_10027830 3300021377 Bacteria 1611
347 Ga0213874_10051968 3300021377 Bacteria 1260
348 Ga0213876_10000830 3300021384 Bacteria 20830
349 Ga0213876_10153108 3300021384 Bacteria 1226
350 Ga0213871_10003523 3300021441 Bacteria 3028
351 Ga0224572_1006262 3300024225 Bacteria 2148
352 Ga0209436_100095 3300025208 Bacteria 43584
353 Ga0209147_100037 3300025229 Bacteria 326977
354 Ga0209563_102659 3300025230 Bacteria 3957
355 Ga0207427_100044 3300025231 Bacteria 242623
356 Ga0209437_100005 3300025233 Bacteria 1071596
357 Ga0207425_1005829 3300025245 Bacteria 3451
358 Ga0209677_103672 3300025253 Bacteria 4826
359 Ga0209148_1000216 3300025254 Bacteria 98209
360 Ga0209129_1000449 3300025258 Bacteria 30679
361 Ga0209233_1000006 3300025261 Bacteria 1473685
362 Ga0209233_1000011 3300025261 Bacteria 1071611
363 Ga0209233_1026747 3300025261 Bacteria 1406
364 Ga0209455_1004148 3300025272 Bacteria 4850
365 Ga0209673_1022298 3300025273 Bacteria 2188
366 Ga0209130_1000004 3300025284 Bacteria 633436
367 Ga0209675_1001965 3300025291 Bacteria 11055
368 Ga0209676_1000102 3300025292 Bacteria 227372
369 Ga0209564_1000630 3300025295 Bacteria 53795
370 Ga0209758_1000015 3300025297 Bacteria 851943
371 Ga0209758_1000161 3300025297 Bacteria 154278
372 Ga0209758_1000523 3300025297 Bacteria 61460
373 Ga0209758_1000673 3300025297 Bacteria 51032
374 Ga0209758_1001304 3300025297 Bacteria 30476
375 Ga0209758_1002531 3300025297 Bacteria 18469
376 Ga0209758_1012357 3300025297 Bacteria 4789
377 Ga0209050_1000105 3300025298 Bacteria 227285
378 Ga0209256_1004503 3300025299 Bacteria 8706
379 Ga0207426_1000003 3300025302 Bacteria 1063212
380 Ga0207426_1000103 3300025302 Bacteria 250320
381 Ga0207426_1000186 3300025302 Bacteria 154130
382 Ga0207426_1001117 3300025302 Bacteria 24608
383 Ga0207426_1006768 3300025302 Bacteria 4910
384 Ga0207426_1031513 3300025302 Bacteria 1729
385 Ga0209051_1000066 3300025303 Bacteria 227369
386 Ga0209051_1000842 3300025303 Bacteria 31590
387 Ga0209051_1069682 3300025303 Bacteria 1064
388 Ga0209257_1000124 3300025304 Bacteria 218195
389 Ga0209257_1004161 3300025304 Bacteria 11487
390 Ga0209257_1012222 3300025304 Bacteria 4003
391 Ga0209257_1014736 3300025304 Bacteria 3326
392 Ga0207697_10079172 3300025315 Bacteria 1384
393 Ga0207656_10027517 3300025321 Bacteria 2326
394 Ga0207696_1001307 3300025711 Bacteria 13771
395 Ga0207696_1004904 3300025711 Bacteria 5667
396 Ga0207696_1019321 3300025711 Bacteria 2221
397 Ga0207696_1021538 3300025711 Bacteria 2062
398 Ga0207655_1000219 3300025728 Bacteria 98533
399 Ga0207655_1003812 3300025728 Bacteria 11000
400 Ga0207655_1019209 3300025728 Bacteria 3585
401 Ga0207713_1001250 3300025735 Bacteria 21045
402 Ga0207713_1005534 3300025735 Bacteria 7878
403 Ga0207713_1011327 3300025735 Bacteria 4860
404 Ga0207713_1014629 3300025735 Bacteria 4064
405 Ga0207713_1029292 3300025735 Bacteria 2468
406 Ga0207713_1071712 3300025735 Bacteria 1277
407 Ga0207682_10017983 3300025893 Bacteria 2760
408 Ga0207642_10070238 3300025899 Bacteria 1664
409 Ga0207710_10096455 3300025900 Bacteria 1391
410 Ga0207688_10033993 3300025901 Bacteria 2822
411 Ga0207688_10118132 3300025901 Bacteria 1545
412 Ga0207680_10051832 3300025903 Bacteria 2456
413 Ga0207685_10022593 3300025905 Bacteria 2129
414 Ga0207685_10081903 3300025905 Bacteria 1338
415 Ga0207645_10002621 3300025907 Bacteria 14025
416 Ga0207645_10079516 3300025907 Bacteria 2102
417 Ga0207643_10001722 3300025908 Bacteria 12265
418 Ga0207643_10145151 3300025908 Bacteria 1419
419 Ga0207705_10078789 3300025909 Bacteria 2399
420 Ga0207705_10121776 3300025909 Bacteria 1936
421 Ga0207684_10000551 3300025910 Bacteria 46114
422 Ga0207684_10240802 3300025910 Bacteria 1561
423 Ga0207695_10000006 3300025913 Bacteria 1135309
424 Ga0207695_10029049 3300025913 Bacteria 6119
425 Ga0207695_10107951 3300025913 Bacteria 2768
426 Ga0207695_10134837 3300025913 Bacteria 2423
427 Ga0207671_10001982 3300025914 Bacteria 22573
428 Ga0207671_10245185 3300025914 Bacteria 1408
429 Ga0207671_10405747 3300025914 Bacteria 1084
430 Ga0207693_10092501 3300025915 Bacteria 2370
431 Ga0207693_10165227 3300025915 Bacteria 1742
432 Ga0207693_10186568 3300025915 Bacteria 1632
433 Ga0207693_10300660 3300025915 Bacteria 1257
434 Ga0207663_10005081 3300025916 Bacteria 6606
435 Ga0207663_10014189 3300025916 Bacteria 4354
436 Ga0207657_10015056 3300025919 Bacteria 7511
437 Ga0207657_10020505 3300025919 Bacteria 6244
438 Ga0207657_10301289 3300025919 Bacteria 1269
439 Ga0207649_10118716 3300025920 Bacteria 1780
440 Ga0207646_10136484 3300025922 Bacteria 2209
441 Ga0207681_10015796 3300025923 Bacteria 4713
442 Ga0207681_10016589 3300025923 Bacteria 4609
443 Ga0207650_10001184 3300025925 Bacteria 19164
444 Ga0207650_10336880 3300025925 Bacteria 1238
445 Ga0207650_10419538 3300025925 Bacteria 1110
446 Ga0207659_10066989 3300025926 Bacteria 2607
447 Ga0207659_10072643 3300025926 Bacteria 2516
448 Ga0207659_10088213 3300025926 Bacteria 2310
449 Ga0207687_10003479 3300025927 Bacteria 10598
450 Ga0207687_10067976 3300025927 Bacteria 2537
451 Ga0207687_10320104 3300025927 Bacteria 1255
452 Ga0207687_10574693 3300025927 Bacteria 948
453 Ga0207700_10276746 3300025928 Bacteria 1442
454 Ga0207664_10004030 3300025929 Bacteria 9905
455 Ga0207664_10004183 3300025929 Bacteria 9751
456 Ga0207644_10117485 3300025931 Bacteria 2020
457 Ga0207644_10139220 3300025931 Bacteria 1867
458 Ga0207644_10172231 3300025931 Bacteria 1691
459 Ga0207690_10040648 3300025932 Bacteria 3042
460 Ga0207690_10603417 3300025932 Bacteria 896
461 Ga0207706_10000099 3300025933 Bacteria 90874
462 Ga0207706_10074400 3300025933 Bacteria 2987
463 Ga0207706_10144932 3300025933 Bacteria 2089
464 Ga0207706_10146563 3300025933 Bacteria 2076
465 Ga0207706_10455101 3300025933 Bacteria 1107
466 Ga0207686_10000556 3300025934 Bacteria 24000
467 Ga0207686_10092823 3300025934 Bacteria 1997
468 Ga0207686_10533616 3300025934 Bacteria 915
469 Ga0207709_10000001 3300025935 Bacteria 2228154
470 Ga0207709_10000050 3300025935 Bacteria 234391
471 Ga0207709_10157812 3300025935 Bacteria 1579
472 Ga0207669_10172641 3300025937 Bacteria 1541
473 Ga0207704_10000020 3300025938 Bacteria 148847
474 Ga0207704_10241666 3300025938 Bacteria 1350
475 Ga0207704_10251728 3300025938 Bacteria 1326
476 Ga0207704_10558423 3300025938 Bacteria 931
477 Ga0207704_10617928 3300025938 Bacteria 889
478 Ga0207665_10057439 3300025939 Bacteria 2629
479 Ga0207691_10019910 3300025940 Bacteria 6347
480 Ga0207691_10084660 3300025940 Bacteria 2846
481 Ga0207711_10008722 3300025941 Bacteria 8478
482 Ga0207711_10033578 3300025941 Bacteria 4343
483 Ga0207711_10044828 3300025941 Bacteria 3777
484 Ga0207711_10151681 3300025941 Bacteria 2092
485 Ga0207711_10156504 3300025941 Bacteria 2060
486 Ga0207711_10178488 3300025941 Bacteria 1930
487 Ga0207711_10465869 3300025941 Bacteria 1177
488 Ga0207711_10676638 3300025941 Bacteria 963
489 Ga0207689_10000268 3300025942 Bacteria 47140
490 Ga0207689_10102081 3300025942 Bacteria 2356
491 Ga0207689_10182450 3300025942 Bacteria 1731
492 Ga0207661_10004116 3300025944 Bacteria 10164
493 Ga0207661_10126476 3300025944 Bacteria 2183
494 Ga0207679_10026618 3300025945 Bacteria 3990
495 Ga0207679_10042358 3300025945 Bacteria 3272
496 Ga0207679_10124704 3300025945 Bacteria 2056
497 Ga0207667_10202935 3300025949 Bacteria 2034
498 Ga0207651_10000005 3300025960 Bacteria 246132
499 Ga0207651_10036256 3300025960 Bacteria 3217
500 Ga0207712_10000766 3300025961 Bacteria 24134
501 Ga0207712_10059303 3300025961 Bacteria 2708
502 Ga0207668_10001482 3300025972 Bacteria 13734
503 Ga0207668_10025322 3300025972 Bacteria 3838
504 Ga0207668_10187986 3300025972 Bacteria 1634
505 Ga0207640_10264089 3300025981 Bacteria 1343
506 Ga0207640_10350821 3300025981 Bacteria 1185
507 Ga0207658_10259166 3300025986 Bacteria 1481
508 Ga0207658_10419075 3300025986 Bacteria 1180
509 Ga0207658_10432943 3300025986 Bacteria 1162
510 Ga0207677_10000094 3300026023 Bacteria 73172
511 Ga0207677_10736984 3300026023 Bacteria 877
512 Ga0207703_10022818 3300026035 Bacteria 4916
513 Ga0207703_10128817 3300026035 Bacteria 2182
514 Ga0207703_10244529 3300026035 Bacteria 1614
515 Ga0207639_10275045 3300026041 Bacteria 1479
516 Ga0207639_10284319 3300026041 Bacteria 1456
517 Ga0207678_10004996 3300026067 Bacteria 11889
518 Ga0207678_10030395 3300026067 Bacteria 4716
519 Ga0207678_10035091 3300026067 Bacteria 4367
520 Ga0207678_10143463 3300026067 Bacteria 2038
521 Ga0207678_10144100 3300026067 Bacteria 2033
522 Ga0207678_10153886 3300026067 Bacteria 1963
523 Ga0207678_10167776 3300026067 Bacteria 1874
524 Ga0207708_10035930 3300026075 Bacteria 3770
525 Ga0207702_10004466 3300026078 Bacteria 12430
526 Ga0207702_10633823 3300026078 Bacteria 1051
527 Ga0207641_10058824 3300026088 Bacteria 3272
528 Ga0207641_10067525 3300026088 Bacteria 3063
529 Ga0207641_10095784 3300026088 Bacteria 2606
530 Ga0207641_10169684 3300026088 Bacteria 1990
531 Ga0207641_10229583 3300026088 Bacteria 1724
532 Ga0207641_10329544 3300026088 Bacteria 1450
533 Ga0207641_10588017 3300026088 Bacteria 1089
534 Ga0207641_10660400 3300026088 Bacteria 1027
535 Ga0207648_10000017 3300026089 Bacteria 148699
536 Ga0207648_10056899 3300026089 Bacteria 3412
537 Ga0207648_10352691 3300026089 Bacteria 1326
538 Ga0207676_10019547 3300026095 Bacteria 4944
539 Ga0207674_10015782 3300026116 Bacteria 8284
540 Ga0207675_100000743 3300026118 Bacteria 32405
541 Ga0207675_100111244 3300026118 Bacteria 2584
542 Ga0207675_100122674 3300026118 Bacteria 2460
543 Ga0207675_100129842 3300026118 Bacteria 2389
544 Ga0207675_100459009 3300026118 Bacteria 1263
545 Ga0207675_100824362 3300026118 Bacteria 942
546 Ga0207683_10001266 3300026121 Bacteria 22940
547 Ga0207683_10003380 3300026121 Bacteria 13917
548 Ga0207683_10246292 3300026121 Bacteria 1630
549 Ga0207683_10349685 3300026121 Bacteria 1356
550 Ga0207698_10025077 3300026142 Bacteria 4194
551 Ga0209389_1000440 3300027296 Bacteria 24698
552 Ga0209589_1014238 3300027357 Bacteria 10051
553 Ga0209489_104739 3300027361 Bacteria 24698
554 Ga0209813_10061358 3300027866 Bacteria 1200
555 Ga0209813_10061471 3300027866 Bacteria 1200
556 Ga0207428_10002358 3300027907 Bacteria 18868
557 Ga0207428_10009941 3300027907 Bacteria 8522
558 Ga0207428_10040710 3300027907 Bacteria 3766
559 Ga0207428_10220291 3300027907 Bacteria 1423
560 Ga0268266_10003810 3300028379 Bacteria 14752
561 Ga0268266_10137464 3300028379 Bacteria 2190
562 Ga0268266_10258496 3300028379 Bacteria 1613
563 Ga0268266_10343456 3300028379 Bacteria 1401
564 Ga0268266_10383920 3300028379 Bacteria 1325
565 Ga0268266_10543218 3300028379 Bacteria 1113
566 Ga0268266_10605913 3300028379 Bacteria 1052
567 Ga0268265_10014015 3300028380 Bacteria 5460
568 Ga0268265_10038111 3300028380 Bacteria 3533
569 Ga0268264_10051634 3300028381 Bacteria 3427
570 Ga0268264_10078589 3300028381 Bacteria 2813
571 Ga0268264_10129884 3300028381 Bacteria 2231
572 Ga0268264_10201667 3300028381 Bacteria 1820
573 Ga0265337_1003252 3300028556 Bacteria 7098
574 Ga0265326_10008080 3300028558 Bacteria 3190
575 Ga0265319_1002546 3300028563 Bacteria 9870
576 Ga0265318_10001843 3300028577 Bacteria 11984
577 Ga0265323_10000460 3300028653 Bacteria 23089
578 Ga0265322_10003769 3300028654 Bacteria 4558
579 Ga0265336_10000496 3300028666 Bacteria 23032
580 Ga0307515_10108806 3300028794 Bacteria 3262
581 Ga0307515_10221083 3300028794 Bacteria 1712
582 Ga0265338_10000207 3300028800 Bacteria 110193
583 Ga0265324_10001132 3300029957 Bacteria 15986
584 Ga0265760_10006688 3300031090 Bacteria 3301
585 Ga0265332_10130299 3300031238 Bacteria 1055
586 Ga0265325_10003746 3300031241 Bacteria 9820
587 Ga0265339_10025802 3300031249 Bacteria 3369
588 Ga0265331_10015560 3300031250 Bacteria 4013
589 Ga0307513_10095445 3300031456 Bacteria 3015
590 Ga0307509_10073298 3300031507 Bacteria 3565
591 Ga0307408_100002600 3300031548 Bacteria 12569
592 Ga0307408_100153860 3300031548 Bacteria 1818
593 Ga0265313_10109740 3300031595 Bacteria 1214
594 Ga0307508_10264534 3300031616 Bacteria 1314
595 Ga0307508_10290235 3300031616 Bacteria 1229
596 Ga0265314_10084887 3300031711 Bacteria 2077
597 Ga0307405_10086090 3300031731 Bacteria 2068
598 Ga0307405_10123495 3300031731 Bacteria 1776
599 Ga0307413_10032230 3300031824 Bacteria 2968
600 Ga0307413_10368857 3300031824 Bacteria 1114
601 Ga0307518_10162193 3300031838 Bacteria 1535
602 Ga0307410_10002012 3300031852 Bacteria 9588
603 Ga0307406_10332970 3300031901 Bacteria 1179
604 Ga0307412_10167187 3300031911 Bacteria 1641
605 Ga0307412_10293696 3300031911 Bacteria 1281
606 Ga0307409_100019897 3300031995 Bacteria 4559
607 Ga0307409_100021452 3300031995 Bacteria 4429
608 Ga0307409_100076356 3300031995 Bacteria 2686
609 Ga0307416_100085731 3300032002 Bacteria 2682
610 Ga0307416_100378134 3300032002 Bacteria 1445
611 Ga0307411_10117923 3300032005 Bacteria 1914
612 Ga0307415_100587128 3300032126 Bacteria 989
613 Ga0307415_100771093 3300032126 Bacteria 875
614 Ga0307510_10000010 3300033180 Bacteria 377457
615 Ga0307510_10002425 3300033180 Bacteria 21169
616 Ga0307510_10031827 3300033180 Bacteria 5949
617 Ga0307510_10136414 3300033180 Bacteria 2110
618 Ga0315911_1000017 3300033442 Bacteria 161609
619 Ga0316215_1003916 3300033544 Bacteria 1424
620 Ga0373950_0022648 3300034818 Bacteria 1119
621 Ga0373940_0022910 3300035088 Bacteria 1608
622 Ga0373940_0037550 3300035088 Bacteria 1319
623 Ga0373923_0007823 3300035111 Bacteria 3777
624 Ga0373936_0025520 3300035113 Bacteria 2311
625 Ga0373954_0061010 3300035118 Bacteria 1779
626 Ga0373954_0068969 3300035118 Bacteria 1678
627 Ga0373956_0000975 3300035119 Bacteria 11900
628 Ga0373957_0004073 3300035120 Bacteria 4405
629 Ga0373957_0012267 3300035120 Bacteria 2880
630 Ga0373960_0024655 3300035121 Bacteria 1629
631 Ga0373943_0003909 3300035170 Bacteria 6783
632 Ga0373946_0080865 3300035171 Bacteria 1422
633 Ga0373955_0005613 3300035172 Bacteria 5644
634 Ga0373955_0087939 3300035172 Bacteria 1766
635 Ga0373924_0031466 3300035410 Bacteria 2134
636 Ga0373924_0032874 3300035410 Bacteria 2091
637 Ga0373931_0028816 3300035691 Bacteria 2847
638 Ga0373931_0029512 3300035691 Bacteria 2816
639 Ga0373935_0030339 3300035692 Bacteria 3350
640 Ga0373935_0038926 3300035692 Bacteria 2979
641 Ga0373935_0095961 3300035692 Bacteria 1948
642 Ga0373933_0063572 3300035724 Bacteria 2231
643 Ga0373933_0110245 3300035724 Bacteria 1716
644 Ga0373947_0306169 3300035725 Bacteria 1060
645 Ga0373937_0049532 3300036401 Bacteria 3846
646 Ga0373937_0168741 3300036401 Bacteria 2053
647 Ga0373937_0569882 3300036401 Bacteria 1075
648 Ga0373925_0073646 3300037068 Bacteria 2585
649 Ga0373925_0354679 3300037068 Bacteria 1191
650 Ga0395900_0067574 3300037418 Bacteria 3672
651 Ga0395900_0072770 3300037418 Bacteria 3533
652 Ga0395900_0094148 3300037418 Bacteria 3077
653 Ga0395900_0189853 3300037418 Bacteria 2085
654 Ga0395898_0008708 3300037466 Bacteria 10706
655 Ga0395898_0034738 3300037466 Bacteria 5019
656 Ga0395898_0056803 3300037466 Bacteria 3814
657 Ga0395898_0141503 3300037466 Bacteria 2303
658 Ga0395898_0413047 3300037466 Bacteria 1286
659 Ga0395898_0583670 3300037466 Bacteria 1060
660 Ga0395898_0585390 3300037466 Bacteria 1058
661 Ga0395898_0723277 3300037466 Bacteria 937
662 Ga0395905_0051031 3300037471 Bacteria 3874
663 Ga0395905_0159776 3300037471 Bacteria 2118
664 Ga0395905_0197190 3300037471 Bacteria 1888
665 Ga0436364_0450606 3300037853 Bacteria 9715
666 Ga0436364_1354805 3300037853 Bacteria 1560
667 Ga0436364_1478902 3300037853 Bacteria 2634
668 Ga0395901_0035212 3300038443 Bacteria 5173
669 Ga0395901_0081439 3300038443 Bacteria 3381
670 Ga0395901_0104579 3300038443 Bacteria 2971
671 Ga0395901_0313904 3300038443 Bacteria 1623
672 Ga0395901_0423159 3300038443 Bacteria 1365
673 Ga0395901_0641588 3300038443 Bacteria 1066
674 Ga0395901_0851711 3300038443 Bacteria 897
675 Ga0436365_0421020 3300039437 Bacteria 15417
676 Ga0436365_0584558 3300039437 Bacteria 1694
677 Ga0436365_1571889 3300039437 Bacteria 1297
678 Ga0436360_0531402 3300039438 Bacteria 3545
679 Ga0436360_0608758 3300039438 Bacteria 5905
680 Ga0436361_0279311 3300039447 Bacteria 1961
681 Ga0436361_0795914 3300039447 Bacteria 15178
682 Ga0436363_0108190 3300039450 Bacteria 3336
683 Ga0436363_0115736 3300039450 Bacteria 1819
684 Ga0436362_0133091 3300039453 Bacteria 6169
685 Ga0436362_0392491 3300039453 Bacteria 16385
686 Ga0436362_0462054 3300039453 Bacteria 13636
687 Ga0439436_0029214 3300041404 Bacteria 1606
688 Ga0439438_000188 3300041405 Bacteria 27781
689 Ga0439438_021439 3300041405 Bacteria 1801
690 Ga0439438_024445 3300041405 Bacteria 1654
691 Ga0439447_000289 3300041407 Bacteria 17867
692 Ga0439447_044189 3300041407 Bacteria 1078
693 Ga0439466_0001316 3300041411 Bacteria 9680
694 Ga0439466_0009307 3300041411 Bacteria 3675
695 Ga0439466_0056601 3300041411 Bacteria 1272
696 Ga0439465_0028217 3300041413 Bacteria 1779
697 Ga0451833_1484977 3300041491 Bacteria 1735
698 Ga0439441_008523 3300042001 Bacteria 1678
699 Ga0439448_0081193 3300042005 Bacteria 1089
700 Ga0439449_0073961 3300042007 Bacteria 1256
701 Ga0439451_000373 3300042009 Bacteria 8672
702 Ga0439452_000077 3300042010 Bacteria 84014
703 Ga0439452_001743 3300042010 Bacteria 8522
704 Ga0439462_0044862 3300042015 Bacteria 1183
705 Ga0439463_020400 3300042016 Bacteria 1653
706 Ga0450919_001810 3300042121 Bacteria 2783
707 Ga0450920_000770 3300042122 Bacteria 5162
708 Ga0450922_000106 3300042124 Bacteria 8074
709 Ga0450906_006336 3300042145 Bacteria 2392
710 Ga0450906_015492 3300042145 Bacteria 1385
711 Ga0450907_000035 3300042146 Bacteria 60070
712 Ga0439446_0016435 3300042156 Bacteria 2061
713 Ga0439458_0015364 3300042157 Bacteria 1734
714 Ga0439458_0017524 3300042157 Bacteria 1637
715 Ga0450908_013341 3300042184 Bacteria 1482
716 Ga0439434_0000053 3300042435 Bacteria 28044
717 Ga0439434_0039928 3300042435 Bacteria 1440
718 Ga0439459_0005704 3300042438 Bacteria 2054
719 Ga0439440_0046737 3300042993 Bacteria 1070
720 Ga0466972_0000136 3300044658 Bacteria 60410
721 Ga0466972_0005603 3300044658 Bacteria 6291
722 Ga0466972_0019144 3300044658 Bacteria 3423
723 Ga0466978_0032140 3300044671 Bacteria 3208
724 Ga0466965_0023854 3300044683 Bacteria 2956
725 Ga0466965_0102968 3300044683 Bacteria 1461
726 Ga0466961_0000418 3300044693 Bacteria 27114
727 Ga0466964_0008332 3300044706 Bacteria 3890
728 Ga0466968_0001216 3300044735 Bacteria 9120
729 Ga0466968_0175419 3300044735 Bacteria 995
730 Ga0466970_0005495 3300044765 Bacteria 6290
731 Ga0466970_0054899 3300044765 Bacteria 2127
732 Ga0466957_0037807 3300044842 Bacteria 2906
733 Ga0466957_0168668 3300044842 Bacteria 1425
734 Ga0466960_0008953 3300044901 Bacteria 4115
735 Ga0466960_0112981 3300044901 Bacteria 1413
736 Ga0466959_0027721 3300045049 Bacteria 4200
737 Ga0451576_0067557 3300045051 Bacteria 3721
738 Ga0451576_0306918 3300045051 Bacteria 1660
739 Ga0451576_0402191 3300045051 Bacteria 1436
740 Ga0466967_0061249 3300045976 Bacteria 3338
741 Ga0466967_0073392 3300045976 Bacteria 3070
742 Ga0466967_0188800 3300045976 Bacteria 1947
743 Ga0466967_0283194 3300045976 Bacteria 1591
744 Ga0495617_000492 3300046452 Bacteria 20885
745 Ga0495617_004483 3300046452 Bacteria 5080
746 Ga0495617_046140 3300046452 Bacteria 1452
747 Ga0495627_000874 3300046453 Bacteria 21347
748 Ga0495627_001078 3300046453 Bacteria 17940
749 Ga0495627_003617 3300046453 Bacteria 6727
750 Ga0495592_0111335 3300046454 Bacteria 1937
751 Ga0495603_0067969 3300046455 Bacteria 2096
752 Ga0495590_0001642 3300046457 Bacteria 9554
753 Ga0495590_0026636 3300046457 Bacteria 2029
754 Ga0495590_0029225 3300046457 Bacteria 1933
755 Ga0495591_001976 3300046458 Bacteria 11974
756 Ga0495591_020413 3300046458 Bacteria 2189
757 Ga0495629_0091342 3300046459 Bacteria 2125
758 Ga0495638_0001077 3300046460 Bacteria 26593
759 Ga0495638_0002448 3300046460 Bacteria 15154
760 Ga0495638_0031716 3300046460 Bacteria 3393
761 Ga0495638_0034928 3300046460 Bacteria 3207
762 Ga0495638_0065947 3300046460 Bacteria 2227
763 Ga0495651_0003859 3300046462 Bacteria 11459
764 Ga0495651_0052046 3300046462 Bacteria 3155
765 Ga0495651_0100107 3300046462 Bacteria 2159
766 Ga0495653_0012646 3300046463 Bacteria 6893
767 Ga0495650_0003064 3300046471 Bacteria 12577
768 Ga0495580_0003180 3300046472 Bacteria 14073
769 Ga0495580_0011169 3300046472 Bacteria 6955
770 Ga0495580_0120717 3300046472 Bacteria 1820
771 Ga0495582_0037715 3300046473 Bacteria 2658
772 Ga0495605_0015127 3300046474 Bacteria 4206
773 Ga0495605_0166224 3300046474 Bacteria 977
774 Ga0495639_0000023 3300046475 Bacteria 70927
775 Ga0495639_0006851 3300046475 Bacteria 4898
776 Ga0495639_0040595 3300046475 Bacteria 2094
777 Ga0495664_0025986 3300046477 Bacteria 3409
778 Ga0495664_0026559 3300046477 Bacteria 3372
779 Ga0495584_0000018 3300046491 Bacteria 142382
780 Ga0495584_0208609 3300046491 Bacteria 993
781 Ga0495584_0235866 3300046491 Bacteria 930
782 Ga0495585_0000020 3300046492 Bacteria 156639
783 Ga0495585_0010657 3300046492 Bacteria 5462
784 Ga0495585_0048186 3300046492 Bacteria 2370
785 Ga0495585_0232386 3300046492 Bacteria 926
786 Ga0495596_0117639 3300046500 Bacteria 1032
787 Ga0495607_0011594 3300046501 Bacteria 5861
788 Ga0495607_0022935 3300046501 Bacteria 3913
789 Ga0495607_0044363 3300046501 Bacteria 2622
790 Ga0495607_0075705 3300046501 Bacteria 1864
791 Ga0495607_0156039 3300046501 Bacteria 1164
792 Ga0495583_0028838 3300046506 Bacteria 2723
793 Ga0495583_0074047 3300046506 Bacteria 1492
794 Ga0495583_0097666 3300046506 Bacteria 1257
795 Ga0495606_0195322 3300046507 Bacteria 1157
796 Ga0495608_0067813 3300046511 Bacteria 2333
797 Ga0495608_0094035 3300046511 Bacteria 1936
798 Ga0495610_0008260 3300046512 Bacteria 6769
799 Ga0495610_0027368 3300046512 Bacteria 3031
800 Ga0495610_0036794 3300046512 Bacteria 2498
801 Ga0495616_0013791 3300046513 Bacteria 4546
802 Ga0495616_0018314 3300046513 Bacteria 3846
803 Ga0495616_0025388 3300046513 Bacteria 3166
804 Ga0495616_0095812 3300046513 Bacteria 1398
805 Ga0495618_0045348 3300046514 Bacteria 2773
806 Ga0495618_0222282 3300046514 Bacteria 1191
807 Ga0495620_0013312 3300046515 Bacteria 4216
808 Ga0495620_0053632 3300046515 Bacteria 1706
809 Ga0495628_0005397 3300046516 Bacteria 11206
810 Ga0495628_0048965 3300046516 Bacteria 3347
811 Ga0495630_0040029 3300046517 Bacteria 3503
812 Ga0495631_0000012 3300046518 Bacteria 110338
813 Ga0495631_0017638 3300046518 Bacteria 3372
814 Ga0495632_0003144 3300046519 Bacteria 11932
815 Ga0495632_0005156 3300046519 Bacteria 8717
816 Ga0495632_0018652 3300046519 Bacteria 3802
817 Ga0495632_0024920 3300046519 Bacteria 3171
818 Ga0495632_0035423 3300046519 Bacteria 2547
819 Ga0495632_0062989 3300046519 Bacteria 1796
820 Ga0495637_0001867 3300046520 Bacteria 12036
821 Ga0495637_0030210 3300046520 Bacteria 2404
822 Ga0495643_0004784 3300046522 Bacteria 9343
823 Ga0495643_0078738 3300046522 Bacteria 1720
824 Ga0495643_0123611 3300046522 Bacteria 1305
825 Ga0495643_0141479 3300046522 Bacteria 1199
826 Ga0495644_0000104 3300046523 Bacteria 40103
827 Ga0495644_0007261 3300046523 Bacteria 4283
828 Ga0495644_0020211 3300046523 Bacteria 2540
829 Ga0495648_0000031 3300046524 Bacteria 213136
830 Ga0495648_0007265 3300046524 Bacteria 8892
831 Ga0495648_0008944 3300046524 Bacteria 7828
832 Ga0495648_0113277 3300046524 Bacteria 1471
833 Ga0495648_0175873 3300046524 Bacteria 1092
834 Ga0495663_0010270 3300046525 Bacteria 2602
835 Ga0495663_0051861 3300046525 Bacteria 1272
836 Ga0495663_0078914 3300046525 Bacteria 1058
837 Ga0495642_0007224 3300046528 Bacteria 4262
838 Ga0495642_0039226 3300046528 Bacteria 1921
839 Ga0495652_0003519 3300046529 Bacteria 15399
840 Ga0495652_0017024 3300046529 Bacteria 6494
841 Ga0495652_0067937 3300046529 Bacteria 2987
842 Ga0495652_0216192 3300046529 Bacteria 1443
843 Ga0495654_0009404 3300046530 Bacteria 5358
844 Ga0495654_0039877 3300046530 Bacteria 2342
845 Ga0495665_0020435 3300046531 Bacteria 3557
846 Ga0495640_0009890 3300046533 Bacteria 7398
847 Ga0495640_0010505 3300046533 Bacteria 7147
848 Ga0495640_0012541 3300046533 Bacteria 6470
849 Ga0495640_0036104 3300046533 Bacteria 3493
850 Ga0495640_0214458 3300046533 Bacteria 1216
851 Ga0495640_0233608 3300046533 Bacteria 1156
852 Ga0495587_0045588 3300046536 Bacteria 2606
853 Ga0495587_0063414 3300046536 Bacteria 2161
854 Ga0495609_0018660 3300046538 Bacteria 3214
855 Ga0495621_0009132 3300046539 Bacteria 3000
856 Ga0495597_0004749 3300046542 Bacteria 7355
857 Ga0495645_0088940 3300046543 Bacteria 2208
858 Ga0495622_0000135 3300046557 Bacteria 63001
859 Ga0495622_0006392 3300046557 Bacteria 5469
860 Ga0495633_0010860 3300046558 Bacteria 4951
861 Ga0495633_0011162 3300046558 Bacteria 4866
862 Ga0495633_0078201 3300046558 Bacteria 1540
863 Ga0495667_0013972 3300046559 Bacteria 5421
864 Ga0495667_0037568 3300046559 Bacteria 3227
865 Ga0495667_0098706 3300046559 Bacteria 1891
866 Ga0495656_0000458 3300046615 Bacteria 13288
867 Ga0495656_0091438 3300046615 Bacteria 1392
868 Ga0495668_0000379 3300046616 Bacteria 58955
869 Ga0495668_0001460 3300046616 Bacteria 22743
870 Ga0495668_0061698 3300046616 Bacteria 2067
871 Ga0495668_0129588 3300046616 Bacteria 1381
872 Ga0495634_0012519 3300046642 Bacteria 6138
873 Ga0495634_0019109 3300046642 Bacteria 4870
874 Ga0495634_0040724 3300046642 Bacteria 3157
875 Ga0495634_0185462 3300046642 Bacteria 1300
876 Ga0495611_0025905 3300046648 Bacteria 2557
877 Ga0495611_0067561 3300046648 Bacteria 1631
878 Ga0495625_0003166 3300046660 Bacteria 16750
879 Ga0495625_0006295 3300046660 Bacteria 10614
880 Ga0495625_0008990 3300046660 Bacteria 8435
881 Ga0495625_0009366 3300046660 Bacteria 8200
882 Ga0495625_0010307 3300046660 Bacteria 7749
883 Ga0495625_0020975 3300046660 Bacteria 5037
884 Ga0495625_0066618 3300046660 Bacteria 2536
885 Ga0495625_0092097 3300046660 Bacteria 2095
886 Ga0495625_0099537 3300046660 Bacteria 1999
887 Ga0495625_0185471 3300046660 Bacteria 1381
888 Ga0495635_0008082 3300046663 Bacteria 7352
889 Ga0495635_0008097 3300046663 Bacteria 7345
890 Ga0495635_0008697 3300046663 Bacteria 7091
891 Ga0495661_0008974 3300046665 Bacteria 6881
892 Ga0495661_0016063 3300046665 Bacteria 4973
893 Ga0495661_0020003 3300046665 Bacteria 4377
894 Ga0495661_0020284 3300046665 Bacteria 4341
895 Ga0495661_0132157 3300046665 Bacteria 1366
896 Ga0495588_0020268 3300046674 Bacteria 3265
897 Ga0495657_0002707 3300046675 Bacteria 14796
898 Ga0495657_0016628 3300046675 Bacteria 5357
899 Ga0495657_0243340 3300046675 Bacteria 1085
900 Ga0495599_0002038 3300046678 Bacteria 11701
901 Ga0495623_0016423 3300046679 Bacteria 4783
902 Ga0495646_0066697 3300046680 Bacteria 2128
903 Ga0495647_0014698 3300046681 Bacteria 2731
904 Ga0495658_0022238 3300046683 Bacteria 3351
905 Ga0495669_0055671 3300046684 Bacteria 1781
906 Ga0495613_0039833 3300046689 Bacteria 3482
907 Ga0495613_0064133 3300046689 Bacteria 2687
908 Ga0495624_0010916 3300046690 Bacteria 6262
909 Ga0495624_0019352 3300046690 Bacteria 4547
910 Ga0495670_0014224 3300046691 Bacteria 3915
911 Ga0495670_0015862 3300046691 Bacteria 3702
912 Ga0495671_0017068 3300046692 Bacteria 3865
913 Ga0495671_0120811 3300046692 Bacteria 1278
914 Ga0495649_0010770 3300046694 Bacteria 5386
915 Ga0495649_0014859 3300046694 Bacteria 4449
916 Ga0495589_0015892 3300046794 Bacteria 3870
917 Ga0495589_0137756 3300046794 Bacteria 1170
918 Ga0495600_0015865 3300046809 Bacteria 4771
919 Ga0495600_0016359 3300046809 Bacteria 4706
920 Ga0495600_0049123 3300046809 Bacteria 2752
921 Ga0495660_0006726 3300046810 Bacteria 6788
922 Ga0495660_0020038 3300046810 Bacteria 3835
923 Ga0495660_0054864 3300046810 Bacteria 2158
924 Ga0495660_0074516 3300046810 Bacteria 1793
925 Ga0495660_0074756 3300046810 Bacteria 1789
926 Ga0495581_0180834 3300047315 Bacteria 1233
927 Ga0495581_0195438 3300047315 Bacteria 1183
928 Ga0495604_0002138 3300047317 Bacteria 15893
929 Ga0495604_0014695 3300047317 Bacteria 6240
930 Ga0495604_0043019 3300047317 Bacteria 3538
931 Ga0495604_0147158 3300047317 Bacteria 1678
932 Ga0495604_0156087 3300047317 Bacteria 1616
933 Ga0495636_0017552 3300047318 Bacteria 2866
934 Ga0495674_0007907 3300047319 Bacteria 10149
935 Ga0495674_0011599 3300047319 Bacteria 8311
936 Ga0495674_0027876 3300047319 Bacteria 5158
937 Ga0495674_0031722 3300047319 Bacteria 4797
938 Ga0495672_0004293 3300047320 Bacteria 11753
939 Ga0495672_0011045 3300047320 Bacteria 6396
940 Ga0495672_0016133 3300047320 Bacteria 5047
941 Ga0495672_0037660 3300047320 Bacteria 2957
942 Ga0495680_0002914 3300047322 Bacteria 17181
943 Ga0495680_0017078 3300047322 Bacteria 6209
944 Ga0495680_0103519 3300047322 Bacteria 2119
945 Ga0495680_0165952 3300047322 Bacteria 1601
946 Ga0495683_0000710 3300047323 Bacteria 24349
947 Ga0495683_0001671 3300047323 Bacteria 14129
948 Ga0495683_0008766 3300047323 Bacteria 5397
949 Ga0495687_000921 3300047443 Bacteria 30536
950 Ga0495687_007170 3300047443 Bacteria 6639
951 Ga0495675_0146703 3300047444 Bacteria 1459
952 Ga0495679_001535 3300047446 Bacteria 13026
953 Ga0495679_002871 3300047446 Bacteria 8539
954 Ga0495679_004458 3300047446 Bacteria 6452
955 Ga0495685_006282 3300047447 Bacteria 3883
956 Ga0495673_0078696 3300047469 Bacteria 1369
957 Ga0495673_0079243 3300047469 Bacteria 1363
958 Ga0495673_0099085 3300047469 Bacteria 1181
959 Ga0495681_0000397 3300047470 Bacteria 33833
960 Ga0495681_0000547 3300047470 Bacteria 28724
961 Ga0495681_0001186 3300047470 Bacteria 19820
962 Ga0495681_0012872 3300047470 Bacteria 4891
963 Ga0495681_0017947 3300047470 Bacteria 3915
964 Ga0495681_0126519 3300047470 Bacteria 1091
965 Ga0495684_0017357 3300047471 Bacteria 5539
966 Ga0495684_0017725 3300047471 Bacteria 5484
967 Ga0495686_0000007 3300047472 Bacteria 732622
968 Ga0495686_0109171 3300047472 Bacteria 1661
969 Ga0495686_0233070 3300047472 Bacteria 1041
970 Ga0495593_0015883 3300047673 Bacteria 4254
971 Ga0495593_0082237 3300047673 Bacteria 1664
972 Ga0495602_0019051 3300048088 Bacteria 6827
973 Ga0495602_0056943 3300048088 Bacteria 3433
974 Ga0495602_0447260 3300048088 Bacteria 913
975 Ga0495626_0000845 3300048091 Bacteria 27398
976 Ga0495626_0029000 3300048091 Bacteria 2680
977 Ga0496100_0009364 3300048903 Bacteria 5504
978 Ga0496100_0082011 3300048903 Bacteria 2180
979 Ga0496100_0087564 3300048903 Bacteria 2118
980 Ga0496101_0003793 3300048904 Bacteria 9440
981 Ga0496101_0284140 3300048904 Bacteria 1294
982 Ga0496102_0058370 3300048905 Bacteria 3526
983 Ga0496102_0100652 3300048905 Bacteria 2684
984 Ga0496102_0170509 3300048905 Bacteria 2049
985 Ga0496102_0207435 3300048905 Bacteria 1847
986 Ga0496102_0208728 3300048905 Bacteria 1841
987 Ga0496102_0369840 3300048905 Bacteria 1349
988 Ga0496102_0434422 3300048905 Bacteria 1232
989 Ga0496103_0004902 3300048906 Bacteria 8080
990 Ga0496103_0009846 3300048906 Bacteria 5659
991 Ga0496103_0014190 3300048906 Bacteria 4730
992 Ga0496104_0005066 3300048907 Bacteria 11494
993 Ga0496104_0009671 3300048907 Bacteria 8589
994 Ga0496104_0010700 3300048907 Bacteria 8203
995 Ga0496104_0015598 3300048907 Bacteria 6887
996 Ga0496104_0032718 3300048907 Bacteria 4840
997 Ga0496104_0102177 3300048907 Bacteria 2745
998 Ga0496104_0118272 3300048907 Bacteria 2544
999 Ga0496104_0131059 3300048907 Bacteria 2408
1000 Ga0496104_0304657 3300048907 Bacteria 1506
1001 Ga0496104_0423708 3300048907 Bacteria 1243
1002 Ga0496104_0617881 3300048907 Bacteria 993
1003 Ga0496104_0681228 3300048907 Bacteria 936
1004 Ga0496105_0006092 3300048908 Bacteria 9231
1005 Ga0496105_0009651 3300048908 Bacteria 7555
1006 Ga0496105_0014216 3300048908 Bacteria 6335
1007 Ga0496105_0014320 3300048908 Bacteria 6313
1008 Ga0496105_0031903 3300048908 Bacteria 4321
1009 Ga0496105_0034869 3300048908 Bacteria 4141
1010 Ga0496105_0037646 3300048908 Bacteria 3983
1011 Ga0496105_0079967 3300048908 Bacteria 2699
1012 Ga0496105_0494034 3300048908 Bacteria 961
1013 Ga0496106_0007532 3300048909 Bacteria 8052
1014 Ga0496106_0136867 3300048909 Bacteria 1924
1015 Ga0496107_0002250 3300048910 Bacteria 12441
1016 Ga0496107_0033508 3300048910 Bacteria 3675
1017 Ga0496107_0040983 3300048910 Bacteria 3325
1018 Ga0496107_0203050 3300048910 Bacteria 1473
1019 Ga0496107_0281526 3300048910 Bacteria 1238
1020 Ga0496108_0000085 3300048911 Bacteria 101144
1021 Ga0496108_0001801 3300048911 Bacteria 17081
1022 Ga0496108_0006400 3300048911 Bacteria 9549
1023 Ga0496108_0020352 3300048911 Bacteria 5454
1024 Ga0496108_0042363 3300048911 Bacteria 3801
1025 Ga0496108_0072132 3300048911 Bacteria 2914
1026 Ga0496108_0072840 3300048911 Bacteria 2900
1027 Ga0496108_0243586 3300048911 Bacteria 1564
1028 Ga0496108_0295921 3300048911 Bacteria 1409
1029 Ga0496109_0001374 3300048912 Bacteria 20185
1030 Ga0496109_0004444 3300048912 Bacteria 11712
1031 Ga0496109_0036931 3300048912 Bacteria 4412
1032 Ga0496109_0053693 3300048912 Bacteria 3676
1033 Ga0496109_0082176 3300048912 Bacteria 2969
1034 Ga0496109_0086856 3300048912 Bacteria 2889
1035 Ga0496109_0387451 3300048912 Bacteria 1320
1036 Ga0496109_0408682 3300048912 Bacteria 1283
1037 Ga0496109_0443578 3300048912 Bacteria 1226
1038 Ga0496109_0478057 3300048912 Bacteria 1176
1039 Ga0496110_0018710 3300048913 Bacteria 5811
1040 Ga0496110_0029557 3300048913 Bacteria 4718
1041 Ga0496110_0045912 3300048913 Bacteria 3820
1042 Ga0496110_0053216 3300048913 Bacteria 3558
1043 Ga0496110_0074262 3300048913 Bacteria 3019
1044 Ga0496110_0088189 3300048913 Bacteria 2771
1045 Ga0496110_0143362 3300048913 Bacteria 2160
1046 Ga0496110_0144931 3300048913 Bacteria 2148
1047 Ga0496110_0243531 3300048913 Bacteria 1636
1048 Ga0496110_0406893 3300048913 Bacteria 1240
1049 Ga0496111_0064299 3300048914 Bacteria 2661
1050 Ga0496111_0067113 3300048914 Bacteria 2606
1051 Ga0496111_0095491 3300048914 Bacteria 2181
1052 Ga0496111_0104796 3300048914 Bacteria 2080
1053 Ga0496111_0315307 3300048914 Bacteria 1158
1054 Ga0496111_0380680 3300048914 Bacteria 1043
1055 Ga0496112_0021643 3300048915 Bacteria 6116
1056 Ga0496112_0033033 3300048915 Bacteria 5025
1057 Ga0496112_0045443 3300048915 Bacteria 4305
1058 Ga0496112_0112479 3300048915 Bacteria 2693
1059 Ga0496112_0224235 3300048915 Bacteria 1835
1060 Ga0496112_0260771 3300048915 Bacteria 1682
1061 Ga0496112_0537154 3300048915 Bacteria 1103
1062 Ga0496113_0012688 3300048916 Bacteria 5671
1063 Ga0496113_0014036 3300048916 Bacteria 5450
1064 Ga0496113_0022391 3300048916 Bacteria 4469
1065 Ga0496113_0063348 3300048916 Bacteria 2794
1066 Ga0496113_0095656 3300048916 Bacteria 2296
1067 Ga0496113_0137702 3300048916 Bacteria 1919
1068 Ga0496113_0225110 3300048916 Bacteria 1495
1069 Ga0496114_0045265 3300048917 Bacteria 3655
1070 Ga0496114_0145281 3300048917 Bacteria 2056
1071 Ga0496114_0169480 3300048917 Bacteria 1902
1072 Ga0496115_0005716 3300048918 Bacteria 9053
1073 Ga0496115_0018829 3300048918 Bacteria 5308
1074 Ga0496115_0077044 3300048918 Bacteria 2711
1075 Ga0496115_0173765 3300048918 Bacteria 1781
1076 Ga0496115_0229361 3300048918 Bacteria 1532
1077 Ga0496116_0027763 3300048919 Bacteria 4113
1078 Ga0496117_0118578 3300048920 Bacteria 1631
1079 Ga0496118_0003627 3300048921 Bacteria 19165
1080 Ga0496118_0006416 3300048921 Bacteria 12932
1081 Ga0496118_0026860 3300048921 Bacteria 4891
1082 Ga0496118_0062501 3300048921 Bacteria 2748
1083 Ga0496118_0064285 3300048921 Bacteria 2693
1084 Ga0496118_0074260 3300048921 Bacteria 2432
1085 Ga0496118_0104134 3300048921 Bacteria 1906
1086 Ga0496118_0116038 3300048921 Bacteria 1761
1087 Ga0496119_0016733 3300048922 Bacteria 5559
1088 Ga0496119_0130230 3300048922 Bacteria 1372
1089 Ga0496120_0024839 3300048923 Bacteria 3729
1090 Ga0496120_0036314 3300048923 Bacteria 2935
1091 Ga0496120_0138042 3300048923 Bacteria 1241
1092 Ga0496121_0011940 3300048924 Bacteria 9558
1093 Ga0496121_0022098 3300048924 Bacteria 6191
1094 Ga0496121_0033120 3300048924 Bacteria 4683
1095 Ga0496121_0047098 3300048924 Bacteria 3681
1096 Ga0496121_0061226 3300048924 Bacteria 3090
1097 Ga0496121_0086490 3300048924 Bacteria 2463
1098 Ga0496121_0104919 3300048924 Bacteria 2170
1099 Ga0496121_0199799 3300048924 Bacteria 1426
1100 Ga0496122_0022896 3300048925 Bacteria 5531
1101 Ga0496122_0049351 3300048925 Bacteria 3225
1102 Ga0496123_0009076 3300048926 Bacteria 9007
1103 Ga0496124_0001884 3300048927 Bacteria 28875
1104 Ga0496124_0027989 3300048927 Bacteria 5047
1105 Ga0496124_0126529 3300048927 Bacteria 2034
1106 Ga0496125_0000398 3300048928 Bacteria 81112
1107 Ga0496125_0000583 3300048928 Bacteria 62446
1108 Ga0496125_0053998 3300048928 Bacteria 3288
1109 Ga0496125_0095590 3300048928 Bacteria 2210
1110 Ga0496126_0001707 3300048929 Bacteria 32618
1111 Ga0496126_0009017 3300048929 Bacteria 10667
1112 Ga0496126_0029280 3300048929 Bacteria 5232
1113 Ga0496126_0089745 3300048929 Bacteria 2705
1114 Ga0496126_0119397 3300048929 Bacteria 2288
1115 Ga0496126_0132022 3300048929 Bacteria 2157
1116 Ga0496126_0178374 3300048929 Bacteria 1806
1117 Ga0496126_0286070 3300048929 Bacteria 1364
1118 Ga0495678_000022 3300049459 Bacteria 237031
1119 Ga0495678_001125 3300049459 Bacteria 22215
1120 Ga0495678_098343 3300049459 Bacteria 1018
1121 Ga0495682_0000574 3300049460 Bacteria 24911
1122 Ga0495682_0040027 3300049460 Bacteria 1719
1123 Ga0501032_0013596 3300049569 Bacteria 5782
1124 Ga0501033_0006993 3300049570 Bacteria 8807
1125 Ga0501034_0018551 3300049571 Bacteria 7131
1126 Ga0501034_0052501 3300049571 Bacteria 4106
1127 Ga0501034_0711227 3300049571 Bacteria 902
1128 Ga0501036_0112415 3300049572 Bacteria 2302
1129 Ga0501036_0119131 3300049572 Bacteria 2229
1130 Ga0501036_0480354 3300049572 Bacteria 1034
1131 Ga0501037_0093757 3300049573 Bacteria 2171
1132 Ga0501038_0316086 3300049574 Bacteria 1222
1133 Ga0501039_0020160 3300049575 Bacteria 5112
1134 Ga0501042_0098751 3300049578 Bacteria 2099
1135 Ga0501043_0026650 3300049579 Bacteria 4535
1136 Ga0501043_0086301 3300049579 Bacteria 2466
1137 Ga0501043_0159620 3300049579 Bacteria 1762
1138 Ga0501046_0092638 3300049580 Bacteria 2323
1139 Ga0501047_0038808 3300049581 Bacteria 4607
1140 Ga0501047_0048403 3300049581 Bacteria 4105
1141 Ga0501047_0075636 3300049581 Bacteria 3240
1142 Ga0501047_0116105 3300049581 Bacteria 2558
1143 Ga0501047_0233825 3300049581 Bacteria 1690
1144 Ga0501047_0245192 3300049581 Bacteria 1641
1145 Ga0501048_0054813 3300049582 Bacteria 2832
1146 Ga0501048_0104477 3300049582 Bacteria 1999
1147 Ga0501067_0059862 3300049583 Bacteria 2108
1148 Ga0501069_0013696 3300049585 Bacteria 4328
1149 Ga0501070_0003666 3300049586 Bacteria 13277
1150 Ga0501070_0556715 3300049586 Bacteria 917
1151 Ga0501072_0148193 3300049588 Bacteria 1871
1152 Ga0501073_0029084 3300049589 Bacteria 3948
1153 Ga0501073_0047240 3300049589 Bacteria 3026
1154 Ga0501080_0002569 3300049742 Bacteria 15898
1155 Ga0501080_0101917 3300049742 Bacteria 2663
1156 Ga0501083_0011783 3300049744 Bacteria 6127
1157 Ga0501241_000151 3300049758 Bacteria 15510
1158 Ga0501035_0051837 3300049822 Bacteria 3672
1159 Ga0501035_0087490 3300049822 Bacteria 2746
1160 Ga0501035_0146140 3300049822 Bacteria 2053
1161 Ga0501044_0096873 3300049823 Bacteria 2971
1162 Ga0501044_0105731 3300049823 Bacteria 2827
1163 nmdc:mga03683_142946_c1 3300050489 Bacteria 1076
1164 nmdc:mga03683_36634_c1 3300050489 Bacteria 1996
1165 nmdc:mga03683_914_c1 3300050489 Bacteria 8506
1166 nmdc:mga00v17_342510_c1 3300050491 Bacteria 972
1167 nmdc:mga00v17_367239_c1 3300050491 Bacteria 936
1168 nmdc:mga00v17_94271_c1 3300050491 Bacteria 1883
1169 nmdc:mga0yw44_107635_c1 3300050492 Bacteria 1783
1170 nmdc:mga0yw44_108109_c1 3300050492 Bacteria 1779
1171 nmdc:mga0yw44_12728_c1 3300050492 Bacteria 4396
1172 nmdc:mga0yw44_302158_c1 3300050492 Bacteria 1072
1173 nmdc:mga0yw44_45018_c1 3300050492 Bacteria 2643
1174 nmdc:mga0yw44_53561_c1 3300050492 Bacteria 2451
1175 nmdc:mga0yw44_5380_c1 3300050492 Bacteria 6035
1176 nmdc:mga0yw44_65075_c1 3300050492 Bacteria 2246
1177 nmdc:mga0k408_101913_c1 3300050493 Bacteria 1693
1178 nmdc:mga0k408_133218_c1 3300050493 Bacteria 1476
1179 nmdc:mga0k408_156449_c1 3300050493 Bacteria 1357
1180 nmdc:mga06z11_24711_c1 3300050494 Bacteria 2839
1181 nmdc:mga06z11_5599_c1 3300050494 Bacteria 5052
1182 nmdc:mga07m45_40912_c1 3300050496 Bacteria 2595
1183 nmdc:mga05p37_12256_c1 3300050507 Bacteria 10238
1184 nmdc:mga05p37_137380_c1 3300050507 Bacteria 2996
1185 nmdc:mga05p37_191551_c1 3300050507 Bacteria 2482
1186 nmdc:mga05p37_198474_c1 3300050507 Bacteria 2432
1187 nmdc:mga05p37_342483_c1 3300050507 Bacteria 1763
1188 nmdc:mga05p37_66088_c1 3300050507 Bacteria 4449
1189 nmdc:mga05p37_756827_c1 3300050507 Bacteria 1070
1190 nmdc:mga09592_10818_c1 3300050508 Bacteria 7421
1191 nmdc:mga09592_472262_c1 3300050508 Bacteria 1081
1192 nmdc:mga09592_85276_c1 3300050508 Bacteria 2695
1193 nmdc:mga0qj67_50665_c1 3300050509 Bacteria 3284
1194 nmdc:mga06r32_12962_c1 3300050510 Bacteria 7538
1195 nmdc:mga06r32_16971_c1 3300050510 Bacteria 6643
1196 nmdc:mga06r32_43327_c1 3300050510 Bacteria 4282
1197 nmdc:mga08y16_160261_c1 3300050511 Bacteria 2338
1198 nmdc:mga08y16_73423_c1 3300050511 Bacteria 3565
1199 nmdc:mga0n895_103480_c1 3300050512 Bacteria 2859
1200 nmdc:mga0n895_151062_c1 3300050512 Bacteria 2353
1201 nmdc:mga0n895_21382_c1 3300050512 Bacteria 6049
1202 nmdc:mga0n895_29435_c1 3300050512 Bacteria 5239
1203 nmdc:mga0n895_4039_c1 3300050512 Bacteria 11935
1204 nmdc:mga0n895_405504_c1 3300050512 Bacteria 1379
1205 nmdc:mga0rr50_3155_c1 3300050513 Bacteria 9422
1206 nmdc:mga0rr50_470_c1 3300050513 Bacteria 21400
1207 nmdc:mga0rr50_47936_c1 3300050513 Bacteria 3155
1208 nmdc:mga0rr50_71799_c1 3300050513 Bacteria 2642
1209 nmdc:mga0rr50_9726_c1 3300050513 Bacteria 6065
1210 nmdc:mga08x19_2945_c1 3300050514 Bacteria 10233
1211 nmdc:mga08x19_42039_c1 3300050514 Bacteria 2912
1212 nmdc:mga0a205_131196_c1 3300050515 Bacteria 2406
1213 nmdc:mga0a205_135822_c1 3300050515 Bacteria 2360
1214 nmdc:mga0a205_16730_c1 3300050515 Bacteria 6868
1215 nmdc:mga0a205_177611_c1 3300050515 Bacteria 2024
1216 nmdc:mga0a205_24882_c1 3300050515 Bacteria 5698
1217 nmdc:mga0a205_282263_c1 3300050515 Bacteria 1536
1218 nmdc:mga0a205_31051_c1 3300050515 Bacteria 5117
1219 nmdc:mga0a205_4844_c1 3300050515 Bacteria 12102
1220 nmdc:mga0sz30_187_c1 3300050516 Bacteria 22807
1221 nmdc:mga0sz30_73028_c1 3300050516 Bacteria 1479
1222 Ga0495601_0377012 3300053077 Bacteria 921
1223 Ga0495612_0132622 3300053078 Bacteria 1077
1224 Ga0500610_0195721 3300053079 Bacteria 978
1225 Ga0495595_0029694 3300053084 Bacteria 2448
1226 Ga0495595_0042897 3300053084 Bacteria 2073
1227 Ga0495595_0193324 3300053084 Bacteria 1011
1228 Ga0495619_0006090 3300053085 Bacteria 7638
1229 Ga0495619_0057341 3300053085 Bacteria 2584
1230 Ga0495619_0081532 3300053085 Bacteria 2178
1231 Ga0500643_000210 3300053087 Bacteria 55059
1232 Ga0500643_003295 3300053087 Bacteria 7838
1233 Ga0500647_0027384 3300053091 Bacteria 2694
1234 Ga0500566_0000908 3300053094 Bacteria 16964
1235 Ga0500566_0008156 3300053094 Bacteria 6197
1236 Ga0500641_0016502 3300053096 Bacteria 2750
1237 Ga0500556_0000049 3300053104 Bacteria 122572
1238 Ga0500556_0009208 3300053104 Bacteria 2865
1239 Ga0500557_000196 3300053105 Bacteria 10188
1240 Ga0500562_024014 3300053108 Bacteria 1593
1241 Ga0500582_069329 3300053114 Bacteria 1196
1242 Ga0500595_000372 3300053119 Bacteria 28914
1243 Ga0500607_098593 3300053121 Bacteria 1455
1244 Ga0500642_0000002 3300053130 Bacteria 795093
1245 Ga0500642_0000053 3300053130 Bacteria 71632
1246 Ga0500642_0023118 3300053130 Bacteria 2490
1247 Ga0500559_0023878 3300053136 Bacteria 2597
1248 Ga0500559_0029435 3300053136 Bacteria 2352
1249 Ga0500577_0116040 3300053142 Bacteria 1110
1250 Ga0500589_101031 3300053147 Bacteria 1252
1251 Ga0500590_021996 3300053148 Bacteria 3310
1252 Ga0500590_098146 3300053148 Bacteria 1411
1253 Ga0500616_0064762 3300053153 Bacteria 1881
1254 Ga0500619_020259 3300053154 Bacteria 1898
1255 Ga0500622_0001817 3300053156 Bacteria 16215
1256 Ga0500638_001015 3300053162 Bacteria 8135
1257 Ga0500638_140525 3300053162 Bacteria 1085
1258 Ga0500638_158285 3300053162 Bacteria 1000
1259 Ga0500636_0000033 3300053177 Bacteria 72990
1260 Ga0500637_0001490 3300053178 Bacteria 9968
1261 Ga0500645_000173 3300053730 Bacteria 50903
1262 Ga0500645_084030 3300053730 Bacteria 907
1263 Ga0500599_001058 3300053736 Bacteria 3108
1264 Ga0500601_000590 3300053737 Bacteria 5187
1265 Ga0500661_000075 3300055283 Bacteria 15501
1266 Ga0587066_003124 3300059490 Bacteria 1912
1267 Ga0587075_002353 3300059644 Bacteria 1989
1268 Ga0587076_012928 3300059645 Bacteria 1256
1269 Ga0587111_0044713 3300060346 Bacteria 957
1270 Ga0501082_0134983 3300060353 Bacteria 2141
1271 Ga0501082_0196188 3300060353 Bacteria 1756
1272 Ga0466962_0087966 3300061719 Bacteria 1488

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007788 Ga0099795_10011474 Ga0099795_100114743 257
2 3300010375 Ga0105239_10743693 Ga0105239_107436931 260
3 3300006175 Ga0070712_100138092 Ga0070712_1001380923 271
4 3300004803 Ga0058862_12278394 Ga0058862_122783941 273
5 3300005329 Ga0070683_100008708 Ga0070683_1000087082 273
6 3300005338 Ga0068868_100012606 Ga0068868_1000126065 273
7 3300005339 Ga0070660_100019335 Ga0070660_1000193352 273
8 3300005339 Ga0070660_100353830 Ga0070660_1003538301 273
9 3300005344 Ga0070661_100077584 Ga0070661_1000775842 273
10 3300005355 Ga0070671_100267490 Ga0070671_1002674903 273
11 3300005366 Ga0070659_100041691 Ga0070659_1000416912 273
12 3300005455 Ga0070663_100037787 Ga0070663_1000377873 273
13 3300005455 Ga0070663_100270756 Ga0070663_1002707561 273
14 3300005535 Ga0070684_100032661 Ga0070684_1000326614 273
15 3300005539 Ga0068853_100193272 Ga0068853_1001932721 273
16 3300005563 Ga0068855_100341132 Ga0068855_1003411321 273
17 3300005564 Ga0070664_100041990 Ga0070664_1000419904 273
18 3300005577 Ga0068857_100017116 Ga0068857_1000171163 273
19 3300005618 Ga0068864_100008698 Ga0068864_1000086988 273
20 3300005618 Ga0068864_100343080 Ga0068864_1003430801 273
21 3300005841 Ga0068863_100075810 Ga0068863_1000758102 273
22 3300006173 Ga0070716_100078778 Ga0070716_1000787782 273
23 3300006846 Ga0075430_100018889 Ga0075430_1000188893 273
24 3300006847 Ga0075431_100140936 Ga0075431_1001409362 273
25 3300006852 Ga0075433_10231042 Ga0075433_102310422 273
26 3300006871 Ga0075434_100036174 Ga0075434_1000361749 273
27 3300006880 Ga0075429_100079801 Ga0075429_1000798012 273
28 3300006881 Ga0068865_100482870 Ga0068865_1004828701 273
29 3300009094 Ga0111539_10042650 Ga0111539_100426502 273
30 3300009098 Ga0105245_10079557 Ga0105245_100795572 273
31 3300009147 Ga0114129_10125802 Ga0114129_101258022 273
32 3300009177 Ga0105248_10006263 Ga0105248_100062632 273
33 3300010375 Ga0105239_10131425 Ga0105239_101314251 273
34 3300013100 Ga0157373_10250627 Ga0157373_102506272 273
35 3300013296 Ga0157374_10037319 Ga0157374_100373195 273
36 3300013307 Ga0157372_10006245 Ga0157372_100062459 273
37 3300014325 Ga0163163_10072523 Ga0163163_100725233 273
38 3300014745 Ga0157377_10102716 Ga0157377_101027162 273
39 3300014969 Ga0157376_10029686 Ga0157376_100296864 273
40 3300014969 Ga0157376_10724175 Ga0157376_107241751 273
41 3300025909 Ga0207705_10121776 Ga0207705_101217761 273
42 3300025913 Ga0207695_10029049 Ga0207695_100290492 273
43 3300025919 Ga0207657_10020505 Ga0207657_100205052 273
44 3300025920 Ga0207649_10118716 Ga0207649_101187162 273
45 3300025931 Ga0207644_10172231 Ga0207644_101722312 273
46 3300025944 Ga0207661_10126476 Ga0207661_101264761 273
47 3300025945 Ga0207679_10124704 Ga0207679_101247042 273
48 3300026041 Ga0207639_10275045 Ga0207639_102750452 273
49 3300026041 Ga0207639_10284319 Ga0207639_102843192 273
50 3300026088 Ga0207641_10058824 Ga0207641_100588242 273
51 3300026095 Ga0207676_10019547 Ga0207676_100195475 273
52 3300026116 Ga0207674_10015782 Ga0207674_100157825 273
53 3300027907 Ga0207428_10002358 Ga0207428_1000235817 273
54 3300028379 Ga0268266_10258496 Ga0268266_102584961 273
55 3300037471 Ga0395905_0197190 Ga0395905_0197190_899_1744 273
56 3300047443 Ga0495687_000921 Ga0495687_000921_16054_16878 273
57 3300048915 Ga0496112_0112479 Ga0496112_0112479_1465_2310 273
58 3300050508 nmdc:mga09592_85276_c1 nmdc:mga09592_85276_c1_997_1839 273
59 3300050510 nmdc:mga06r32_16971_c1 nmdc:mga06r32_16971_c1_2195_3037 273
60 3300050512 nmdc:mga0n895_29435_c1 nmdc:mga0n895_29435_c1_410_1252 273
61 3300050515 nmdc:mga0a205_31051_c1 nmdc:mga0a205_31051_c1_2290_3132 273
62 3300003215 JGI25153J46596_10001277 JGI25153J46596_100012774 274
63 3300003215 JGI25153J46596_10003243 JGI25153J46596_100032437 274
64 3300003354 JGI25160J50197_1000710 JGI25160J50197_100071010 274
65 3300003354 JGI25160J50197_1003342 JGI25160J50197_10033429 274
66 3300003374 JGI25161J50226_1009853 JGI25161J50226_10098533 274
67 3300003762 Ga0055542_1003323 Ga0055542_10033234 274
68 3300003792 Ga0055540_1004160 Ga0055540_10041606 274
69 3300003792 Ga0055540_1005734 Ga0055540_10057343 274
70 3300003792 Ga0055540_1010901 Ga0055540_10109012 274
71 3300003794 Ga0055531_10009365 Ga0055531_100093652 274
72 3300004800 Ga0058861_10089271 Ga0058861_100892713 274
73 3300004803 Ga0058862_10085905 Ga0058862_100859052 274
74 3300005262 Ga0065165_1000721 Ga0065165_10007211 274
75 3300005262 Ga0065165_1008083 Ga0065165_10080834 274
76 3300005262 Ga0065165_1023885 Ga0065165_10238853 274
77 3300005290 Ga0065712_10181387 Ga0065712_101813872 274
78 3300005293 Ga0065715_10010704 Ga0065715_100107043 274
79 3300005293 Ga0065715_10021897 Ga0065715_100218972 274
80 3300005293 Ga0065715_10307578 Ga0065715_103075781 274
81 3300005295 Ga0065707_10027623 Ga0065707_100276231 274
82 3300005327 Ga0070658_10046828 Ga0070658_100468282 274
83 3300005327 Ga0070658_10054420 Ga0070658_100544202 274
84 3300005328 Ga0070676_10252359 Ga0070676_102523591 274
85 3300005329 Ga0070683_100000936 Ga0070683_1000009364 274
86 3300005329 Ga0070683_100109810 Ga0070683_1001098102 274
87 3300005331 Ga0070670_100059090 Ga0070670_1000590901 274
88 3300005334 Ga0068869_100043066 Ga0068869_1000430664 274
89 3300005334 Ga0068869_100449642 Ga0068869_1004496421 274
90 3300005335 Ga0070666_10014585 Ga0070666_100145852 274
91 3300005335 Ga0070666_10136178 Ga0070666_101361782 274
92 3300005336 Ga0070680_100252253 Ga0070680_1002522533 274
93 3300005336 Ga0070680_100437927 Ga0070680_1004379271 274
94 3300005338 Ga0068868_100028072 Ga0068868_1000280726 274
95 3300005338 Ga0068868_100091761 Ga0068868_1000917613 274
96 3300005339 Ga0070660_100043845 Ga0070660_1000438451 274
97 3300005340 Ga0070689_100160422 Ga0070689_1001604222 274
98 3300005341 Ga0070691_10046396 Ga0070691_100463961 274
99 3300005344 Ga0070661_100024549 Ga0070661_1000245492 274
100 3300005344 Ga0070661_100116522 Ga0070661_1001165222 274
101 3300005347 Ga0070668_100002970 Ga0070668_1000029706 274
102 3300005347 Ga0070668_100010579 Ga0070668_1000105798 274
103 3300005347 Ga0070668_100033360 Ga0070668_1000333603 274
104 3300005347 Ga0070668_100093912 Ga0070668_1000939122 274
105 3300005347 Ga0070668_100259241 Ga0070668_1002592412 274
106 3300005353 Ga0070669_100003310 Ga0070669_1000033106 274
107 3300005353 Ga0070669_100439084 Ga0070669_1004390841 274
108 3300005354 Ga0070675_100018024 Ga0070675_1000180245 274
109 3300005354 Ga0070675_100028318 Ga0070675_1000283183 274
110 3300005354 Ga0070675_100371124 Ga0070675_1003711241 274
111 3300005354 Ga0070675_100372051 Ga0070675_1003720512 274
112 3300005355 Ga0070671_100268451 Ga0070671_1002684511 274
113 3300005356 Ga0070674_100004168 Ga0070674_1000041684 274
114 3300005356 Ga0070674_100020678 Ga0070674_1000206785 274
115 3300005356 Ga0070674_100089083 Ga0070674_1000890832 274
116 3300005364 Ga0070673_100058879 Ga0070673_1000588791 274
117 3300005365 Ga0070688_100132325 Ga0070688_1001323252 274
118 3300005365 Ga0070688_100174886 Ga0070688_1001748862 274
119 3300005366 Ga0070659_100077903 Ga0070659_1000779033 274
120 3300005366 Ga0070659_100166133 Ga0070659_1001661331 274
121 3300005367 Ga0070667_100048193 Ga0070667_1000481932 274
122 3300005367 Ga0070667_100186665 Ga0070667_1001866652 274
123 3300005435 Ga0070714_100054764 Ga0070714_1000547642 274
124 3300005436 Ga0070713_100050254 Ga0070713_1000502542 274
125 3300005436 Ga0070713_100463626 Ga0070713_1004636261 274
126 3300005439 Ga0070711_100057300 Ga0070711_1000573002 274
127 3300005440 Ga0070705_100141910 Ga0070705_1001419102 274
128 3300005440 Ga0070705_100156878 Ga0070705_1001568781 274
129 3300005444 Ga0070694_100170321 Ga0070694_1001703211 274
130 3300005445 Ga0070708_100045773 Ga0070708_1000457735 274
131 3300005445 Ga0070708_100049795 Ga0070708_1000497952 274
132 3300005445 Ga0070708_100396425 Ga0070708_1003964252 274
133 3300005455 Ga0070663_100124305 Ga0070663_1001243052 274
134 3300005455 Ga0070663_100222134 Ga0070663_1002221342 274
135 3300005455 Ga0070663_100368519 Ga0070663_1003685192 274
136 3300005456 Ga0070678_100059686 Ga0070678_1000596862 274
137 3300005456 Ga0070678_100074297 Ga0070678_1000742972 274
138 3300005456 Ga0070678_100217819 Ga0070678_1002178193 274
139 3300005456 Ga0070678_100267727 Ga0070678_1002677271 274
140 3300005456 Ga0070678_100619333 Ga0070678_1006193331 274
141 3300005457 Ga0070662_100000224 Ga0070662_10000022413 274
142 3300005457 Ga0070662_100151896 Ga0070662_1001518962 274
143 3300005457 Ga0070662_100250519 Ga0070662_1002505191 274
144 3300005457 Ga0070662_100320490 Ga0070662_1003204901 274
145 3300005457 Ga0070662_100554960 Ga0070662_1005549601 274
146 3300005459 Ga0068867_100031914 Ga0068867_1000319142 274
147 3300005467 Ga0070706_100029541 Ga0070706_1000295414 274
148 3300005467 Ga0070706_100243051 Ga0070706_1002430512 274
149 3300005467 Ga0070706_100248543 Ga0070706_1002485431 274
150 3300005467 Ga0070706_100380280 Ga0070706_1003802802 274
151 3300005468 Ga0070707_100236357 Ga0070707_1002363572 274
152 3300005471 Ga0070698_100094463 Ga0070698_1000944632 274
153 3300005518 Ga0070699_100002512 Ga0070699_1000025129 274
154 3300005518 Ga0070699_100055334 Ga0070699_1000553344 274
155 3300005518 Ga0070699_100068729 Ga0070699_1000687292 274
156 3300005518 Ga0070699_100276137 Ga0070699_1002761372 274
157 3300005530 Ga0070679_100165782 Ga0070679_1001657822 274
158 3300005535 Ga0070684_100019719 Ga0070684_1000197195 274
159 3300005536 Ga0070697_100046072 Ga0070697_1000460721 274
160 3300005536 Ga0070697_100268363 Ga0070697_1002683632 274
161 3300005543 Ga0070672_100011139 Ga0070672_1000111398 274
162 3300005543 Ga0070672_100088810 Ga0070672_1000888102 274
163 3300005545 Ga0070695_100067850 Ga0070695_1000678503 274
164 3300005548 Ga0070665_100126012 Ga0070665_1001260122 274
165 3300005548 Ga0070665_100306758 Ga0070665_1003067582 274
166 3300005548 Ga0070665_100316182 Ga0070665_1003161822 274
167 3300005548 Ga0070665_100629071 Ga0070665_1006290712 274
168 3300005549 Ga0070704_100100225 Ga0070704_1001002253 274
169 3300005563 Ga0068855_100388521 Ga0068855_1003885211 274
170 3300005564 Ga0070664_100050681 Ga0070664_1000506812 274
171 3300005578 Ga0068854_100489607 Ga0068854_1004896071 274
172 3300005615 Ga0070702_100116239 Ga0070702_1001162392 274
173 3300005616 Ga0068852_100080278 Ga0068852_1000802782 274
174 3300005616 Ga0068852_100213734 Ga0068852_1002137342 274
175 3300005719 Ga0068861_100002901 Ga0068861_1000029016 274
176 3300005719 Ga0068861_100018409 Ga0068861_1000184093 274
177 3300005719 Ga0068861_100083156 Ga0068861_1000831564 274
178 3300005719 Ga0068861_100088820 Ga0068861_1000888202 274
179 3300005719 Ga0068861_100498255 Ga0068861_1004982551 274
180 3300005834 Ga0068851_10038537 Ga0068851_100385372 274
181 3300005840 Ga0068870_10000970 Ga0068870_100009702 274
182 3300005841 Ga0068863_100134656 Ga0068863_1001346562 274
183 3300005841 Ga0068863_100147749 Ga0068863_1001477492 274
184 3300005841 Ga0068863_100204940 Ga0068863_1002049403 274
185 3300005841 Ga0068863_100229612 Ga0068863_1002296121 274
186 3300005841 Ga0068863_100251302 Ga0068863_1002513021 274
187 3300005842 Ga0068858_100025545 Ga0068858_1000255456 274
188 3300005842 Ga0068858_100042002 Ga0068858_1000420024 274
189 3300005842 Ga0068858_100056317 Ga0068858_1000563172 274
190 3300005843 Ga0068860_100006936 Ga0068860_1000069367 274
191 3300005843 Ga0068860_100049874 Ga0068860_1000498745 274
192 3300005843 Ga0068860_100061429 Ga0068860_1000614294 274
193 3300005843 Ga0068860_100212061 Ga0068860_1002120612 274
194 3300005844 Ga0068862_100000841 Ga0068862_10000084113 274
195 3300005844 Ga0068862_100079179 Ga0068862_1000791792 274
196 3300005937 Ga0081455_10001668 Ga0081455_100016682 274
197 3300005937 Ga0081455_10005180 Ga0081455_100051806 274
198 3300005937 Ga0081455_10006288 Ga0081455_100062888 274
199 3300005937 Ga0081455_10049461 Ga0081455_100494612 274
200 3300005981 Ga0081538_10096999 Ga0081538_100969992 274
201 3300005983 Ga0081540_1000688 Ga0081540_100068816 274
202 3300005983 Ga0081540_1000739 Ga0081540_100073945 274
203 3300005983 Ga0081540_1047569 Ga0081540_10475692 274
204 3300005985 Ga0081539_10001833 Ga0081539_1000183332 274
205 3300006038 Ga0075365_10029757 Ga0075365_100297573 274
206 3300006038 Ga0075365_10064681 Ga0075365_100646812 274
207 3300006038 Ga0075365_10079499 Ga0075365_100794992 274
208 3300006038 Ga0075365_10090197 Ga0075365_100901972 274
209 3300006042 Ga0075368_10100078 Ga0075368_101000782 274
210 3300006048 Ga0075363_100033297 Ga0075363_1000332973 274
211 3300006175 Ga0070712_100174188 Ga0070712_1001741882 274
212 3300006175 Ga0070712_100207987 Ga0070712_1002079872 274
213 3300006175 Ga0070712_100258067 Ga0070712_1002580672 274
214 3300006177 Ga0075362_10000378 Ga0075362_1000037817 274
215 3300006177 Ga0075362_10013889 Ga0075362_100138893 274
216 3300006178 Ga0075367_10024462 Ga0075367_100244624 274
217 3300006186 Ga0075369_10005701 Ga0075369_100057012 274
218 3300006186 Ga0075369_10049001 Ga0075369_100490011 274
219 3300006186 Ga0075369_10071660 Ga0075369_100716603 274
220 3300006195 Ga0075366_10027098 Ga0075366_100270984 274
221 3300006195 Ga0075366_10222617 Ga0075366_102226171 274
222 3300006237 Ga0097621_100030634 Ga0097621_1000306343 274
223 3300006358 Ga0068871_100021666 Ga0068871_1000216664 274
224 3300006358 Ga0068871_100060493 Ga0068871_1000604931 274
225 3300006844 Ga0075428_100019819 Ga0075428_1000198197 274
226 3300006846 Ga0075430_100045336 Ga0075430_1000453363 274
227 3300006847 Ga0075431_100018004 Ga0075431_1000180047 274
228 3300006847 Ga0075431_100073613 Ga0075431_1000736132 274
229 3300006852 Ga0075433_10000196 Ga0075433_1000019618 274
230 3300006852 Ga0075433_10002289 Ga0075433_1000228912 274
231 3300006852 Ga0075433_10441342 Ga0075433_104413421 274
232 3300006871 Ga0075434_100002691 Ga0075434_1000026918 274
233 3300006871 Ga0075434_100032415 Ga0075434_1000324154 274
234 3300006871 Ga0075434_100043508 Ga0075434_1000435083 274
235 3300006871 Ga0075434_100173174 Ga0075434_1001731743 274
236 3300006871 Ga0075434_100223062 Ga0075434_1002230622 274
237 3300006871 Ga0075434_100376014 Ga0075434_1003760142 274
238 3300006880 Ga0075429_100014540 Ga0075429_1000145403 274
239 3300006914 Ga0075436_100001361 Ga0075436_10000136110 274
240 3300006942 Ga0099824_1021533 Ga0099824_10215333 274
241 3300007076 Ga0075435_100013352 Ga0075435_1000133526 274
242 3300007076 Ga0075435_100033111 Ga0075435_1000331114 274
243 3300007076 Ga0075435_100054651 Ga0075435_1000546511 274
244 3300007076 Ga0075435_100097774 Ga0075435_1000977743 274
245 3300007265 Ga0099794_10021388 Ga0099794_100213883 274
246 3300009093 Ga0105240_10001146 Ga0105240_1000114643 274
247 3300009093 Ga0105240_10150877 Ga0105240_101508773 274
248 3300009094 Ga0111539_10097826 Ga0111539_100978263 274
249 3300009094 Ga0111539_10310362 Ga0111539_103103622 274
250 3300009098 Ga0105245_10165228 Ga0105245_101652283 274
251 3300009101 Ga0105247_10052360 Ga0105247_100523602 274
252 3300009101 Ga0105247_10188844 Ga0105247_101888442 274
253 3300009147 Ga0114129_10032034 Ga0114129_100320347 274
254 3300009147 Ga0114129_10037094 Ga0114129_100370941 274
255 3300009147 Ga0114129_10119597 Ga0114129_101195974 274
256 3300009147 Ga0114129_10128927 Ga0114129_101289273 274
257 3300009147 Ga0114129_10327486 Ga0114129_103274862 274
258 3300009147 Ga0114129_10525243 Ga0114129_105252431 274
259 3300009148 Ga0105243_10161575 Ga0105243_101615752 274
260 3300009148 Ga0105243_10245250 Ga0105243_102452502 274
261 3300009174 Ga0105241_10027208 Ga0105241_100272084 274
262 3300009176 Ga0105242_10215240 Ga0105242_102152402 274
263 3300009177 Ga0105248_10006970 Ga0105248_100069706 274
264 3300009177 Ga0105248_10021325 Ga0105248_100213254 274
265 3300009177 Ga0105248_10646171 Ga0105248_106461711 274
266 3300009177 Ga0105248_10839840 Ga0105248_108398401 274
267 3300009545 Ga0105237_10041847 Ga0105237_100418472 274
268 3300009551 Ga0105238_10329720 Ga0105238_103297202 274
269 3300009553 Ga0105249_10000653 Ga0105249_1000065325 274
270 3300009553 Ga0105249_10066278 Ga0105249_100662783 274
271 3300009553 Ga0105249_10224028 Ga0105249_102240282 274
272 3300009553 Ga0105249_10227082 Ga0105249_102270821 274
273 3300010375 Ga0105239_10063253 Ga0105239_100632532 274
274 3300010375 Ga0105239_10077256 Ga0105239_100772562 274
275 3300010375 Ga0105239_10081105 Ga0105239_100811054 274
276 3300010375 Ga0105239_10106945 Ga0105239_101069452 274
277 3300010375 Ga0105239_10156146 Ga0105239_101561462 274
278 3300010375 Ga0105239_10204092 Ga0105239_102040922 274
279 3300010375 Ga0105239_10424519 Ga0105239_104245192 274
280 3300010375 Ga0105239_10518636 Ga0105239_105186361 274
281 3300013296 Ga0157374_10083317 Ga0157374_100833171 274
282 3300013296 Ga0157374_10211300 Ga0157374_102113002 274
283 3300013297 Ga0157378_10108212 Ga0157378_101082121 274
284 3300013297 Ga0157378_10122492 Ga0157378_101224922 274
285 3300013297 Ga0157378_10236269 Ga0157378_102362691 274
286 3300013306 Ga0163162_10002044 Ga0163162_1000204413 274
287 3300013306 Ga0163162_10004882 Ga0163162_100048826 274
288 3300013306 Ga0163162_10266217 Ga0163162_102662172 274
289 3300013306 Ga0163162_10296879 Ga0163162_102968792 274
290 3300013306 Ga0163162_10306192 Ga0163162_103061922 274
291 3300013308 Ga0157375_10088941 Ga0157375_100889413 274
292 3300013308 Ga0157375_10153199 Ga0157375_101531991 274
293 3300013308 Ga0157375_10219430 Ga0157375_102194302 274
294 3300014325 Ga0163163_10015523 Ga0163163_100155234 274
295 3300014325 Ga0163163_10270509 Ga0163163_102705092 274
296 3300014325 Ga0163163_10332917 Ga0163163_103329171 274
297 3300014325 Ga0163163_10476867 Ga0163163_104768671 274
298 3300014326 Ga0157380_10103397 Ga0157380_101033973 274
299 3300014326 Ga0157380_10505086 Ga0157380_105050861 274
300 3300014745 Ga0157377_10061106 Ga0157377_100611063 274
301 3300014968 Ga0157379_10000589 Ga0157379_100005896 274
302 3300014969 Ga0157376_10079589 Ga0157376_100795892 274
303 3300014969 Ga0157376_10126954 Ga0157376_101269542 274
304 3300014969 Ga0157376_10129146 Ga0157376_101291462 274
305 3300014969 Ga0157376_10374350 Ga0157376_103743502 274
306 3300014969 Ga0157376_10483416 Ga0157376_104834161 274
307 3300017792 Ga0163161_10048757 Ga0163161_100487573 274
308 3300020077 Ga0206351_10413641 Ga0206351_104136412 274
309 3300020078 Ga0206352_10167672 Ga0206352_101676721 274
310 3300020082 Ga0206353_10230641 Ga0206353_102306411 274
311 3300021321 Ga0214542_1000007 Ga0214542_1000007125 274
312 3300021324 Ga0214545_1000006 Ga0214545_1000006168 274
313 3300021327 Ga0214543_1000009 Ga0214543_1000009256 274
314 3300021361 Ga0213872_10031678 Ga0213872_100316781 274
315 3300021377 Ga0213874_10027830 Ga0213874_100278301 274
316 3300021377 Ga0213874_10051968 Ga0213874_100519681 274
317 3300021384 Ga0213876_10000830 Ga0213876_1000083010 274
318 3300021384 Ga0213876_10153108 Ga0213876_101531081 274
319 3300021441 Ga0213871_10003523 Ga0213871_100035233 274
320 3300024225 Ga0224572_1006262 Ga0224572_10062622 274
321 3300025230 Ga0209563_102659 Ga0209563_1026595 274
322 3300025245 Ga0207425_1005829 Ga0207425_10058292 274
323 3300025253 Ga0209677_103672 Ga0209677_1036725 274
324 3300025254 Ga0209148_1000216 Ga0209148_100021685 274
325 3300025261 Ga0209233_1000006 Ga0209233_10000061281 274
326 3300025261 Ga0209233_1026747 Ga0209233_10267471 274
327 3300025272 Ga0209455_1004148 Ga0209455_10041484 274
328 3300025273 Ga0209673_1022298 Ga0209673_10222982 274
329 3300025297 Ga0209758_1000015 Ga0209758_1000015617 274
330 3300025297 Ga0209758_1000161 Ga0209758_100016149 274
331 3300025297 Ga0209758_1000523 Ga0209758_100052338 274
332 3300025297 Ga0209758_1000673 Ga0209758_100067320 274
333 3300025297 Ga0209758_1001304 Ga0209758_100130431 274
334 3300025297 Ga0209758_1002531 Ga0209758_100253113 274
335 3300025297 Ga0209758_1012357 Ga0209758_10123575 274
336 3300025299 Ga0209256_1004503 Ga0209256_10045039 274
337 3300025302 Ga0207426_1000186 Ga0207426_1000186143 274
338 3300025302 Ga0207426_1001117 Ga0207426_10011176 274
339 3300025302 Ga0207426_1006768 Ga0207426_10067686 274
340 3300025302 Ga0207426_1031513 Ga0207426_10315133 274
341 3300025303 Ga0209051_1000842 Ga0209051_100084217 274
342 3300025303 Ga0209051_1069682 Ga0209051_10696822 274
343 3300025304 Ga0209257_1004161 Ga0209257_10041616 274
344 3300025304 Ga0209257_1012222 Ga0209257_10122225 274
345 3300025304 Ga0209257_1014736 Ga0209257_10147363 274
346 3300025315 Ga0207697_10079172 Ga0207697_100791721 274
347 3300025321 Ga0207656_10027517 Ga0207656_100275172 274
348 3300025893 Ga0207682_10017983 Ga0207682_100179832 274
349 3300025899 Ga0207642_10070238 Ga0207642_100702382 274
350 3300025900 Ga0207710_10096455 Ga0207710_100964552 274
351 3300025901 Ga0207688_10033993 Ga0207688_100339932 274
352 3300025901 Ga0207688_10118132 Ga0207688_101181322 274
353 3300025903 Ga0207680_10051832 Ga0207680_100518322 274
354 3300025905 Ga0207685_10022593 Ga0207685_100225931 274
355 3300025905 Ga0207685_10081903 Ga0207685_100819031 274
356 3300025907 Ga0207645_10079516 Ga0207645_100795162 274
357 3300025908 Ga0207643_10001722 Ga0207643_1000172213 274
358 3300025908 Ga0207643_10145151 Ga0207643_101451512 274
359 3300025909 Ga0207705_10078789 Ga0207705_100787892 274
360 3300025910 Ga0207684_10000551 Ga0207684_100005512 274
361 3300025910 Ga0207684_10240802 Ga0207684_102408021 274
362 3300025913 Ga0207695_10000006 Ga0207695_10000006247 274
363 3300025913 Ga0207695_10107951 Ga0207695_101079513 274
364 3300025913 Ga0207695_10134837 Ga0207695_101348372 274
365 3300025914 Ga0207671_10001982 Ga0207671_1000198211 274
366 3300025914 Ga0207671_10245185 Ga0207671_102451851 274
367 3300025914 Ga0207671_10405747 Ga0207671_104057471 274
368 3300025915 Ga0207693_10092501 Ga0207693_100925012 274
369 3300025915 Ga0207693_10165227 Ga0207693_101652272 274
370 3300025915 Ga0207693_10186568 Ga0207693_101865682 274
371 3300025915 Ga0207693_10300660 Ga0207693_103006602 274
372 3300025916 Ga0207663_10005081 Ga0207663_100050812 274
373 3300025916 Ga0207663_10014189 Ga0207663_100141893 274
374 3300025919 Ga0207657_10015056 Ga0207657_100150564 274
375 3300025919 Ga0207657_10301289 Ga0207657_103012892 274
376 3300025922 Ga0207646_10136484 Ga0207646_101364843 274
377 3300025923 Ga0207681_10016589 Ga0207681_100165894 274
378 3300025925 Ga0207650_10001184 Ga0207650_100011841 274
379 3300025925 Ga0207650_10336880 Ga0207650_103368802 274
380 3300025925 Ga0207650_10419538 Ga0207650_104195381 274
381 3300025926 Ga0207659_10066989 Ga0207659_100669891 274
382 3300025926 Ga0207659_10072643 Ga0207659_100726432 274
383 3300025926 Ga0207659_10088213 Ga0207659_100882132 274
384 3300025927 Ga0207687_10067976 Ga0207687_100679762 274
385 3300025927 Ga0207687_10320104 Ga0207687_103201042 274
386 3300025927 Ga0207687_10574693 Ga0207687_105746931 274
387 3300025928 Ga0207700_10276746 Ga0207700_102767461 274
388 3300025929 Ga0207664_10004030 Ga0207664_100040309 274
389 3300025929 Ga0207664_10004183 Ga0207664_100041838 274
390 3300025931 Ga0207644_10117485 Ga0207644_101174852 274
391 3300025931 Ga0207644_10139220 Ga0207644_101392202 274
392 3300025932 Ga0207690_10040648 Ga0207690_100406483 274
393 3300025932 Ga0207690_10603417 Ga0207690_106034171 274
394 3300025933 Ga0207706_10000099 Ga0207706_1000009932 274
395 3300025933 Ga0207706_10074400 Ga0207706_100744002 274
396 3300025933 Ga0207706_10144932 Ga0207706_101449322 274
397 3300025933 Ga0207706_10146563 Ga0207706_101465631 274
398 3300025933 Ga0207706_10455101 Ga0207706_104551012 274
399 3300025934 Ga0207686_10092823 Ga0207686_100928231 274
400 3300025934 Ga0207686_10533616 Ga0207686_105336161 274
401 3300025935 Ga0207709_10157812 Ga0207709_101578123 274
402 3300025937 Ga0207669_10172641 Ga0207669_101726412 274
403 3300025938 Ga0207704_10241666 Ga0207704_102416662 274
404 3300025938 Ga0207704_10251728 Ga0207704_102517282 274
405 3300025938 Ga0207704_10558423 Ga0207704_105584231 274
406 3300025938 Ga0207704_10617928 Ga0207704_106179281 274
407 3300025939 Ga0207665_10057439 Ga0207665_100574391 274
408 3300025940 Ga0207691_10019910 Ga0207691_100199105 274
409 3300025940 Ga0207691_10084660 Ga0207691_100846602 274
410 3300025941 Ga0207711_10008722 Ga0207711_100087225 274
411 3300025941 Ga0207711_10033578 Ga0207711_100335784 274
412 3300025941 Ga0207711_10044828 Ga0207711_100448284 274
413 3300025941 Ga0207711_10151681 Ga0207711_101516812 274
414 3300025941 Ga0207711_10156504 Ga0207711_101565041 274
415 3300025941 Ga0207711_10178488 Ga0207711_101784882 274
416 3300025941 Ga0207711_10465869 Ga0207711_104658692 274
417 3300025941 Ga0207711_10676638 Ga0207711_106766381 274
418 3300025942 Ga0207689_10102081 Ga0207689_101020812 274
419 3300025942 Ga0207689_10182450 Ga0207689_101824501 274
420 3300025944 Ga0207661_10004116 Ga0207661_100041163 274
421 3300025945 Ga0207679_10026618 Ga0207679_100266183 274
422 3300025945 Ga0207679_10042358 Ga0207679_100423582 274
423 3300025949 Ga0207667_10202935 Ga0207667_102029352 274
424 3300025960 Ga0207651_10036256 Ga0207651_100362562 274
425 3300025961 Ga0207712_10000766 Ga0207712_1000076611 274
426 3300025972 Ga0207668_10001482 Ga0207668_100014824 274
427 3300025972 Ga0207668_10025322 Ga0207668_100253225 274
428 3300025972 Ga0207668_10187986 Ga0207668_101879862 274
429 3300025981 Ga0207640_10264089 Ga0207640_102640891 274
430 3300025981 Ga0207640_10350821 Ga0207640_103508211 274
431 3300025986 Ga0207658_10259166 Ga0207658_102591662 274
432 3300025986 Ga0207658_10419075 Ga0207658_104190751 274
433 3300025986 Ga0207658_10432943 Ga0207658_104329431 274
434 3300026023 Ga0207677_10736984 Ga0207677_107369841 274
435 3300026035 Ga0207703_10022818 Ga0207703_100228182 274
436 3300026035 Ga0207703_10128817 Ga0207703_101288172 274
437 3300026035 Ga0207703_10244529 Ga0207703_102445291 274
438 3300026067 Ga0207678_10004996 Ga0207678_1000499612 274
439 3300026067 Ga0207678_10030395 Ga0207678_100303956 274
440 3300026067 Ga0207678_10035091 Ga0207678_100350914 274
441 3300026067 Ga0207678_10143463 Ga0207678_101434632 274
442 3300026067 Ga0207678_10153886 Ga0207678_101538861 274
443 3300026075 Ga0207708_10035930 Ga0207708_100359304 274
444 3300026078 Ga0207702_10004466 Ga0207702_1000446612 274
445 3300026078 Ga0207702_10633823 Ga0207702_106338231 274
446 3300026088 Ga0207641_10067525 Ga0207641_100675253 274
447 3300026088 Ga0207641_10095784 Ga0207641_100957843 274
448 3300026088 Ga0207641_10169684 Ga0207641_101696842 274
449 3300026088 Ga0207641_10229583 Ga0207641_102295832 274
450 3300026088 Ga0207641_10329544 Ga0207641_103295441 274
451 3300026088 Ga0207641_10588017 Ga0207641_105880171 274
452 3300026088 Ga0207641_10660400 Ga0207641_106604001 274
453 3300026089 Ga0207648_10056899 Ga0207648_100568992 274
454 3300026089 Ga0207648_10352691 Ga0207648_103526911 274
455 3300026118 Ga0207675_100000743 Ga0207675_10000074323 274
456 3300026118 Ga0207675_100111244 Ga0207675_1001112442 274
457 3300026118 Ga0207675_100122674 Ga0207675_1001226742 274
458 3300026118 Ga0207675_100129842 Ga0207675_1001298424 274
459 3300026118 Ga0207675_100459009 Ga0207675_1004590092 274
460 3300026118 Ga0207675_100824362 Ga0207675_1008243621 274
461 3300026121 Ga0207683_10001266 Ga0207683_100012662 274
462 3300026121 Ga0207683_10003380 Ga0207683_100033804 274
463 3300026121 Ga0207683_10246292 Ga0207683_102462921 274
464 3300026121 Ga0207683_10349685 Ga0207683_103496852 274
465 3300026142 Ga0207698_10025077 Ga0207698_100250774 274
466 3300027296 Ga0209389_1000440 Ga0209389_10004408 274
467 3300027357 Ga0209589_1014238 Ga0209589_10142388 274
468 3300027361 Ga0209489_104739 Ga0209489_1047398 274
469 3300027866 Ga0209813_10061358 Ga0209813_100613582 274
470 3300027866 Ga0209813_10061471 Ga0209813_100614712 274
471 3300027907 Ga0207428_10040710 Ga0207428_100407104 274
472 3300027907 Ga0207428_10220291 Ga0207428_102202911 274
473 3300028379 Ga0268266_10003810 Ga0268266_1000381015 274
474 3300028379 Ga0268266_10137464 Ga0268266_101374641 274
475 3300028379 Ga0268266_10343456 Ga0268266_103434562 274
476 3300028379 Ga0268266_10383920 Ga0268266_103839202 274
477 3300028379 Ga0268266_10543218 Ga0268266_105432181 274
478 3300028379 Ga0268266_10605913 Ga0268266_106059132 274
479 3300028380 Ga0268265_10014015 Ga0268265_100140153 274
480 3300028380 Ga0268265_10038111 Ga0268265_100381114 274
481 3300028381 Ga0268264_10051634 Ga0268264_100516344 274
482 3300028381 Ga0268264_10078589 Ga0268264_100785892 274
483 3300028381 Ga0268264_10129884 Ga0268264_101298842 274
484 3300028381 Ga0268264_10201667 Ga0268264_102016672 274
485 3300028556 Ga0265337_1003252 Ga0265337_10032523 274
486 3300028558 Ga0265326_10008080 Ga0265326_100080803 274
487 3300028563 Ga0265319_1002546 Ga0265319_10025468 274
488 3300028577 Ga0265318_10001843 Ga0265318_1000184310 274
489 3300028653 Ga0265323_10000460 Ga0265323_1000046012 274
490 3300028654 Ga0265322_10003769 Ga0265322_100037694 274
491 3300028666 Ga0265336_10000496 Ga0265336_1000049615 274
492 3300028794 Ga0307515_10108806 Ga0307515_101088061 274
493 3300028794 Ga0307515_10221083 Ga0307515_102210833 274
494 3300028800 Ga0265338_10000207 Ga0265338_1000020778 274
495 3300029957 Ga0265324_10001132 Ga0265324_100011328 274
496 3300031090 Ga0265760_10006688 Ga0265760_100066883 274
497 3300031241 Ga0265325_10003746 Ga0265325_100037462 274
498 3300031250 Ga0265331_10015560 Ga0265331_100155602 274
499 3300031456 Ga0307513_10095445 Ga0307513_100954453 274
500 3300031507 Ga0307509_10073298 Ga0307509_100732982 274
501 3300031595 Ga0265313_10109740 Ga0265313_101097402 274
502 3300031616 Ga0307508_10290235 Ga0307508_102902351 274
503 3300031711 Ga0265314_10084887 Ga0265314_100848872 274
504 3300031731 Ga0307405_10086090 Ga0307405_100860902 274
505 3300031824 Ga0307413_10032230 Ga0307413_100322302 274
506 3300031824 Ga0307413_10368857 Ga0307413_103688571 274
507 3300031838 Ga0307518_10162193 Ga0307518_101621932 274
508 3300031852 Ga0307410_10002012 Ga0307410_100020126 274
509 3300031901 Ga0307406_10332970 Ga0307406_103329702 274
510 3300031911 Ga0307412_10167187 Ga0307412_101671872 274
511 3300031995 Ga0307409_100019897 Ga0307409_1000198973 274
512 3300031995 Ga0307409_100076356 Ga0307409_1000763562 274
513 3300032002 Ga0307416_100085731 Ga0307416_1000857312 274
514 3300032002 Ga0307416_100378134 Ga0307416_1003781342 274
515 3300032005 Ga0307411_10117923 Ga0307411_101179232 274
516 3300032126 Ga0307415_100587128 Ga0307415_1005871281 274
517 3300032126 Ga0307415_100771093 Ga0307415_1007710931 274
518 3300033180 Ga0307510_10000010 Ga0307510_10000010285 274
519 3300033180 Ga0307510_10002425 Ga0307510_100024254 274
520 3300033180 Ga0307510_10031827 Ga0307510_100318276 274
521 3300033180 Ga0307510_10136414 Ga0307510_101364143 274
522 3300033442 Ga0315911_1000017 Ga0315911_1000017132 274
523 3300033544 Ga0316215_1003916 Ga0316215_10039162 274
524 3300034818 Ga0373950_0022648 Ga0373950_0022648_16_840 274
525 3300035088 Ga0373940_0022910 Ga0373940_0022910_514_1338 274
526 3300035088 Ga0373940_0037550 Ga0373940_0037550_154_978 274
527 3300035111 Ga0373923_0007823 Ga0373923_0007823_434_1258 274
528 3300035113 Ga0373936_0025520 Ga0373936_0025520_1447_2271 274
529 3300035118 Ga0373954_0061010 Ga0373954_0061010_201_1025 274
530 3300035118 Ga0373954_0068969 Ga0373954_0068969_330_1154 274
531 3300035119 Ga0373956_0000975 Ga0373956_0000975_5669_6493 274
532 3300035120 Ga0373957_0004073 Ga0373957_0004073_570_1394 274
533 3300035120 Ga0373957_0012267 Ga0373957_0012267_861_1685 274
534 3300035121 Ga0373960_0024655 Ga0373960_0024655_758_1582 274
535 3300035170 Ga0373943_0003909 Ga0373943_0003909_2374_3198 274
536 3300035171 Ga0373946_0080865 Ga0373946_0080865_431_1255 274
537 3300035172 Ga0373955_0005613 Ga0373955_0005613_3237_4061 274
538 3300035172 Ga0373955_0087939 Ga0373955_0087939_449_1273 274
539 3300035410 Ga0373924_0031466 Ga0373924_0031466_1281_2105 274
540 3300035410 Ga0373924_0032874 Ga0373924_0032874_242_1066 274
541 3300035691 Ga0373931_0028816 Ga0373931_0028816_522_1388 274
542 3300035691 Ga0373931_0029512 Ga0373931_0029512_922_1746 274
543 3300035692 Ga0373935_0030339 Ga0373935_0030339_332_1156 274
544 3300035692 Ga0373935_0038926 Ga0373935_0038926_368_1192 274
545 3300035692 Ga0373935_0095961 Ga0373935_0095961_995_1819 274
546 3300035724 Ga0373933_0063572 Ga0373933_0063572_241_1065 274
547 3300035724 Ga0373933_0110245 Ga0373933_0110245_758_1582 274
548 3300035725 Ga0373947_0306169 Ga0373947_0306169_164_988 274
549 3300036401 Ga0373937_0049532 Ga0373937_0049532_2780_3604 274
550 3300036401 Ga0373937_0168741 Ga0373937_0168741_121_945 274
551 3300036401 Ga0373937_0569882 Ga0373937_0569882_60_884 274
552 3300037068 Ga0373925_0073646 Ga0373925_0073646_783_1607 274
553 3300037068 Ga0373925_0354679 Ga0373925_0354679_18_842 274
554 3300037418 Ga0395900_0072770 Ga0395900_0072770_713_1618 274
555 3300037418 Ga0395900_0094148 Ga0395900_0094148_750_1574 274
556 3300037418 Ga0395900_0189853 Ga0395900_0189853_981_1805 274
557 3300037466 Ga0395898_0008708 Ga0395898_0008708_3250_4074 274
558 3300037466 Ga0395898_0034738 Ga0395898_0034738_290_1333 274
559 3300037466 Ga0395898_0056803 Ga0395898_0056803_321_1145 274
560 3300037466 Ga0395898_0141503 Ga0395898_0141503_1171_2076 274
561 3300037466 Ga0395898_0413047 Ga0395898_0413047_157_981 274
562 3300037466 Ga0395898_0583670 Ga0395898_0583670_137_961 274
563 3300037466 Ga0395898_0585390 Ga0395898_0585390_16_840 274
564 3300037466 Ga0395898_0723277 Ga0395898_0723277_47_871 274
565 3300037471 Ga0395905_0051031 Ga0395905_0051031_2553_3377 274
566 3300037471 Ga0395905_0159776 Ga0395905_0159776_1179_2003 274
567 3300037853 Ga0436364_0450606 Ga0436364_0450606_50_874 274
568 3300037853 Ga0436364_1354805 Ga0436364_1354805_683_1507 274
569 3300037853 Ga0436364_1478902 Ga0436364_1478902_1158_1982 274
570 3300038443 Ga0395901_0035212 Ga0395901_0035212_4018_4842 274
571 3300038443 Ga0395901_0081439 Ga0395901_0081439_1000_1905 274
572 3300038443 Ga0395901_0104579 Ga0395901_0104579_1375_2418 274
573 3300038443 Ga0395901_0313904 Ga0395901_0313904_357_1181 274
574 3300038443 Ga0395901_0423159 Ga0395901_0423159_156_980 274
575 3300038443 Ga0395901_0641588 Ga0395901_0641588_219_1043 274
576 3300038443 Ga0395901_0851711 Ga0395901_0851711_41_865 274
577 3300039437 Ga0436365_0421020 Ga0436365_0421020_3892_4716 274
578 3300039437 Ga0436365_0584558 Ga0436365_0584558_40_864 274
579 3300039437 Ga0436365_1571889 Ga0436365_1571889_40_864 274
580 3300039438 Ga0436360_0531402 Ga0436360_0531402_2625_3449 274
581 3300039438 Ga0436360_0608758 Ga0436360_0608758_3162_4019 274
582 3300039447 Ga0436361_0279311 Ga0436361_0279311_377_1258 274
583 3300039447 Ga0436361_0795914 Ga0436361_0795914_8105_8962 274
584 3300039450 Ga0436363_0108190 Ga0436363_0108190_1505_2359 274
585 3300039450 Ga0436363_0115736 Ga0436363_0115736_660_1484 274
586 3300039453 Ga0436362_0133091 Ga0436362_0133091_5162_5986 274
587 3300039453 Ga0436362_0392491 Ga0436362_0392491_15_839 274
588 3300039453 Ga0436362_0462054 Ga0436362_0462054_5153_6010 274
589 3300041491 Ga0451833_1484977 Ga0451833_1484977_301_1125 274
590 3300042001 Ga0439441_008523 Ga0439441_008523_394_1218 274
591 3300042005 Ga0439448_0081193 Ga0439448_0081193_179_1006 274
592 3300042016 Ga0439463_020400 Ga0439463_020400_403_1227 274
593 3300042157 Ga0439458_0015364 Ga0439458_0015364_394_1218 274
594 3300042157 Ga0439458_0017524 Ga0439458_0017524_601_1461 274
595 3300042435 Ga0439434_0039928 Ga0439434_0039928_235_1059 274
596 3300042438 Ga0439459_0005704 Ga0439459_0005704_1189_2013 274
597 3300042993 Ga0439440_0046737 Ga0439440_0046737_162_986 274
598 3300044658 Ga0466972_0000136 Ga0466972_0000136_45229_46053 274
599 3300044658 Ga0466972_0005603 Ga0466972_0005603_1903_2727 274
600 3300044683 Ga0466965_0023854 Ga0466965_0023854_2041_2865 274
601 3300044683 Ga0466965_0102968 Ga0466965_0102968_94_918 274
602 3300044735 Ga0466968_0175419 Ga0466968_0175419_98_922 274
603 3300044765 Ga0466970_0005495 Ga0466970_0005495_3027_3851 274
604 3300044765 Ga0466970_0054899 Ga0466970_0054899_949_1773 274
605 3300044842 Ga0466957_0168668 Ga0466957_0168668_426_1250 274
606 3300044901 Ga0466960_0008953 Ga0466960_0008953_1633_2457 274
607 3300044901 Ga0466960_0112981 Ga0466960_0112981_182_1006 274
608 3300045051 Ga0451576_0067557 Ga0451576_0067557_2866_3690 274
609 3300045051 Ga0451576_0306918 Ga0451576_0306918_272_1132 274
610 3300045051 Ga0451576_0402191 Ga0451576_0402191_485_1327 274
611 3300045976 Ga0466967_0061249 Ga0466967_0061249_1276_2100 274
612 3300045976 Ga0466967_0073392 Ga0466967_0073392_604_1428 274
613 3300045976 Ga0466967_0188800 Ga0466967_0188800_749_1573 274
614 3300046452 Ga0495617_000492 Ga0495617_000492_18402_19226 274
615 3300046452 Ga0495617_046140 Ga0495617_046140_614_1438 274
616 3300046454 Ga0495592_0111335 Ga0495592_0111335_350_1174 274
617 3300046455 Ga0495603_0067969 Ga0495603_0067969_352_1176 274
618 3300046457 Ga0495590_0001642 Ga0495590_0001642_793_1773 274
619 3300046457 Ga0495590_0029225 Ga0495590_0029225_686_1510 274
620 3300046459 Ga0495629_0091342 Ga0495629_0091342_671_1495 274
621 3300046460 Ga0495638_0002448 Ga0495638_0002448_12043_12867 274
622 3300046462 Ga0495651_0003859 Ga0495651_0003859_3943_4767 274
623 3300046462 Ga0495651_0052046 Ga0495651_0052046_929_1753 274
624 3300046462 Ga0495651_0100107 Ga0495651_0100107_63_887 274
625 3300046463 Ga0495653_0012646 Ga0495653_0012646_5445_6269 274
626 3300046472 Ga0495580_0003180 Ga0495580_0003180_9605_10429 274
627 3300046472 Ga0495580_0011169 Ga0495580_0011169_2125_2949 274
628 3300046472 Ga0495580_0120717 Ga0495580_0120717_527_1351 274
629 3300046473 Ga0495582_0037715 Ga0495582_0037715_244_1068 274
630 3300046474 Ga0495605_0015127 Ga0495605_0015127_2629_3609 274
631 3300046475 Ga0495639_0006851 Ga0495639_0006851_2790_3614 274
632 3300046475 Ga0495639_0040595 Ga0495639_0040595_1115_1939 274
633 3300046477 Ga0495664_0025986 Ga0495664_0025986_304_1128 274
634 3300046477 Ga0495664_0026559 Ga0495664_0026559_1910_2734 274
635 3300046491 Ga0495584_0208609 Ga0495584_0208609_44_868 274
636 3300046491 Ga0495584_0235866 Ga0495584_0235866_51_875 274
637 3300046492 Ga0495585_0000020 Ga0495585_0000020_141484_142308 274
638 3300046492 Ga0495585_0048186 Ga0495585_0048186_1008_1832 274
639 3300046492 Ga0495585_0232386 Ga0495585_0232386_13_837 274
640 3300046500 Ga0495596_0117639 Ga0495596_0117639_94_918 274
641 3300046501 Ga0495607_0044363 Ga0495607_0044363_845_1825 274
642 3300046501 Ga0495607_0075705 Ga0495607_0075705_555_1535 274
643 3300046501 Ga0495607_0156039 Ga0495607_0156039_308_1132 274
644 3300046506 Ga0495583_0097666 Ga0495583_0097666_176_1000 274
645 3300046507 Ga0495606_0195322 Ga0495606_0195322_276_1100 274
646 3300046511 Ga0495608_0067813 Ga0495608_0067813_994_1818 274
647 3300046511 Ga0495608_0094035 Ga0495608_0094035_514_1338 274
648 3300046513 Ga0495616_0013791 Ga0495616_0013791_2841_3665 274
649 3300046513 Ga0495616_0025388 Ga0495616_0025388_950_1930 274
650 3300046513 Ga0495616_0095812 Ga0495616_0095812_495_1319 274
651 3300046514 Ga0495618_0045348 Ga0495618_0045348_1817_2641 274
652 3300046514 Ga0495618_0222282 Ga0495618_0222282_77_901 274
653 3300046515 Ga0495620_0013312 Ga0495620_0013312_1243_2067 274
654 3300046516 Ga0495628_0005397 Ga0495628_0005397_7442_8266 274
655 3300046516 Ga0495628_0048965 Ga0495628_0048965_1818_2642 274
656 3300046517 Ga0495630_0040029 Ga0495630_0040029_2295_3119 274
657 3300046518 Ga0495631_0000012 Ga0495631_0000012_23756_24736 274
658 3300046522 Ga0495643_0078738 Ga0495643_0078738_15_866 274
659 3300046522 Ga0495643_0141479 Ga0495643_0141479_62_1042 274
660 3300046523 Ga0495644_0007261 Ga0495644_0007261_1698_2522 274
661 3300046524 Ga0495648_0000031 Ga0495648_0000031_174269_175093 274
662 3300046524 Ga0495648_0007265 Ga0495648_0007265_2200_3180 274
663 3300046524 Ga0495648_0113277 Ga0495648_0113277_546_1370 274
664 3300046525 Ga0495663_0051861 Ga0495663_0051861_341_1165 274
665 3300046525 Ga0495663_0078914 Ga0495663_0078914_168_992 274
666 3300046528 Ga0495642_0007224 Ga0495642_0007224_2820_3797 274
667 3300046528 Ga0495642_0039226 Ga0495642_0039226_1001_1825 274
668 3300046529 Ga0495652_0003519 Ga0495652_0003519_2853_3677 274
669 3300046529 Ga0495652_0017024 Ga0495652_0017024_3188_4012 274
670 3300046529 Ga0495652_0067937 Ga0495652_0067937_2048_2872 274
671 3300046529 Ga0495652_0216192 Ga0495652_0216192_223_1047 274
672 3300046530 Ga0495654_0039877 Ga0495654_0039877_193_1173 274
673 3300046531 Ga0495665_0020435 Ga0495665_0020435_2068_2892 274
674 3300046533 Ga0495640_0009890 Ga0495640_0009890_4254_5078 274
675 3300046533 Ga0495640_0010505 Ga0495640_0010505_711_1535 274
676 3300046533 Ga0495640_0012541 Ga0495640_0012541_925_1749 274
677 3300046533 Ga0495640_0036104 Ga0495640_0036104_2546_3370 274
678 3300046533 Ga0495640_0214458 Ga0495640_0214458_358_1182 274
679 3300046533 Ga0495640_0233608 Ga0495640_0233608_251_1075 274
680 3300046536 Ga0495587_0045588 Ga0495587_0045588_1343_2167 274
681 3300046536 Ga0495587_0063414 Ga0495587_0063414_850_1674 274
682 3300046538 Ga0495609_0018660 Ga0495609_0018660_1919_2743 274
683 3300046539 Ga0495621_0009132 Ga0495621_0009132_1667_2491 274
684 3300046543 Ga0495645_0088940 Ga0495645_0088940_626_1450 274
685 3300046557 Ga0495622_0006392 Ga0495622_0006392_3588_4412 274
686 3300046558 Ga0495633_0011162 Ga0495633_0011162_3030_3854 274
687 3300046558 Ga0495633_0078201 Ga0495633_0078201_361_1185 274
688 3300046559 Ga0495667_0013972 Ga0495667_0013972_2858_3682 274
689 3300046559 Ga0495667_0037568 Ga0495667_0037568_2009_2833 274
690 3300046559 Ga0495667_0098706 Ga0495667_0098706_591_1415 274
691 3300046615 Ga0495656_0000458 Ga0495656_0000458_9232_10056 274
692 3300046616 Ga0495668_0001460 Ga0495668_0001460_11902_12882 274
693 3300046616 Ga0495668_0061698 Ga0495668_0061698_339_1163 274
694 3300046616 Ga0495668_0129588 Ga0495668_0129588_515_1339 274
695 3300046642 Ga0495634_0012519 Ga0495634_0012519_1545_2369 274
696 3300046642 Ga0495634_0019109 Ga0495634_0019109_3122_3946 274
697 3300046642 Ga0495634_0040724 Ga0495634_0040724_106_930 274
698 3300046642 Ga0495634_0185462 Ga0495634_0185462_60_884 274
699 3300046648 Ga0495611_0025905 Ga0495611_0025905_1677_2501 274
700 3300046648 Ga0495611_0067561 Ga0495611_0067561_549_1373 274
701 3300046660 Ga0495625_0009366 Ga0495625_0009366_2391_3371 274
702 3300046660 Ga0495625_0066618 Ga0495625_0066618_1206_2030 274
703 3300046660 Ga0495625_0092097 Ga0495625_0092097_322_1146 274
704 3300046660 Ga0495625_0099537 Ga0495625_0099537_254_1078 274
705 3300046660 Ga0495625_0185471 Ga0495625_0185471_468_1292 274
706 3300046663 Ga0495635_0008082 Ga0495635_0008082_1943_2767 274
707 3300046663 Ga0495635_0008097 Ga0495635_0008097_1537_2361 274
708 3300046663 Ga0495635_0008697 Ga0495635_0008697_5930_6754 274
709 3300046665 Ga0495661_0020003 Ga0495661_0020003_2452_3432 274
710 3300046665 Ga0495661_0132157 Ga0495661_0132157_172_1152 274
711 3300046674 Ga0495588_0020268 Ga0495588_0020268_674_1498 274
712 3300046675 Ga0495657_0002707 Ga0495657_0002707_11239_12063 274
713 3300046675 Ga0495657_0016628 Ga0495657_0016628_1546_2370 274
714 3300046675 Ga0495657_0243340 Ga0495657_0243340_146_970 274
715 3300046678 Ga0495599_0002038 Ga0495599_0002038_3772_4596 274
716 3300046679 Ga0495623_0016423 Ga0495623_0016423_2498_3322 274
717 3300046680 Ga0495646_0066697 Ga0495646_0066697_595_1419 274
718 3300046681 Ga0495647_0014698 Ga0495647_0014698_718_1542 274
719 3300046683 Ga0495658_0022238 Ga0495658_0022238_949_1773 274
720 3300046684 Ga0495669_0055671 Ga0495669_0055671_405_1229 274
721 3300046689 Ga0495613_0039833 Ga0495613_0039833_196_1020 274
722 3300046689 Ga0495613_0064133 Ga0495613_0064133_486_1310 274
723 3300046690 Ga0495624_0010916 Ga0495624_0010916_697_1521 274
724 3300046690 Ga0495624_0019352 Ga0495624_0019352_787_1611 274
725 3300046692 Ga0495671_0120811 Ga0495671_0120811_223_1203 274
726 3300046794 Ga0495589_0137756 Ga0495589_0137756_191_1015 274
727 3300046809 Ga0495600_0015865 Ga0495600_0015865_3627_4451 274
728 3300046809 Ga0495600_0016359 Ga0495600_0016359_1382_2206 274
729 3300046809 Ga0495600_0049123 Ga0495600_0049123_759_1583 274
730 3300046810 Ga0495660_0054864 Ga0495660_0054864_233_1213 274
731 3300046810 Ga0495660_0074516 Ga0495660_0074516_192_1016 274
732 3300047315 Ga0495581_0180834 Ga0495581_0180834_185_1009 274
733 3300047315 Ga0495581_0195438 Ga0495581_0195438_117_941 274
734 3300047317 Ga0495604_0002138 Ga0495604_0002138_3832_4656 274
735 3300047317 Ga0495604_0014695 Ga0495604_0014695_1100_1924 274
736 3300047317 Ga0495604_0043019 Ga0495604_0043019_625_1449 274
737 3300047317 Ga0495604_0147158 Ga0495604_0147158_335_1159 274
738 3300047317 Ga0495604_0156087 Ga0495604_0156087_782_1606 274
739 3300047318 Ga0495636_0017552 Ga0495636_0017552_90_914 274
740 3300047319 Ga0495674_0007907 Ga0495674_0007907_5568_6392 274
741 3300047319 Ga0495674_0011599 Ga0495674_0011599_2289_3113 274
742 3300047319 Ga0495674_0027876 Ga0495674_0027876_3760_4584 274
743 3300047319 Ga0495674_0031722 Ga0495674_0031722_3465_4289 274
744 3300047320 Ga0495672_0011045 Ga0495672_0011045_2674_3498 274
745 3300047322 Ga0495680_0002914 Ga0495680_0002914_15712_16536 274
746 3300047322 Ga0495680_0017078 Ga0495680_0017078_2644_3468 274
747 3300047322 Ga0495680_0103519 Ga0495680_0103519_1059_1883 274
748 3300047322 Ga0495680_0165952 Ga0495680_0165952_23_847 274
749 3300047323 Ga0495683_0008766 Ga0495683_0008766_3052_3876 274
750 3300047443 Ga0495687_007170 Ga0495687_007170_1527_2351 274
751 3300047444 Ga0495675_0146703 Ga0495675_0146703_33_857 274
752 3300047446 Ga0495679_004458 Ga0495679_004458_1292_2272 274
753 3300047447 Ga0495685_006282 Ga0495685_006282_1830_2810 274
754 3300047469 Ga0495673_0099085 Ga0495673_0099085_230_1054 274
755 3300047470 Ga0495681_0017947 Ga0495681_0017947_700_1524 274
756 3300047471 Ga0495684_0017357 Ga0495684_0017357_2488_3312 274
757 3300047471 Ga0495684_0017725 Ga0495684_0017725_3996_4820 274
758 3300047472 Ga0495686_0000007 Ga0495686_0000007_257580_258404 274
759 3300047472 Ga0495686_0109171 Ga0495686_0109171_61_912 274
760 3300047673 Ga0495593_0015883 Ga0495593_0015883_963_1787 274
761 3300047673 Ga0495593_0082237 Ga0495593_0082237_762_1586 274
762 3300048088 Ga0495602_0019051 Ga0495602_0019051_2436_3260 274
763 3300048088 Ga0495602_0056943 Ga0495602_0056943_870_1694 274
764 3300048088 Ga0495602_0447260 Ga0495602_0447260_44_868 274
765 3300048091 Ga0495626_0029000 Ga0495626_0029000_775_1755 274
766 3300048903 Ga0496100_0009364 Ga0496100_0009364_937_1764 274
767 3300048903 Ga0496100_0082011 Ga0496100_0082011_372_1196 274
768 3300048903 Ga0496100_0087564 Ga0496100_0087564_378_1202 274
769 3300048904 Ga0496101_0003793 Ga0496101_0003793_2744_3571 274
770 3300048904 Ga0496101_0284140 Ga0496101_0284140_187_1011 274
771 3300048905 Ga0496102_0058370 Ga0496102_0058370_885_1712 274
772 3300048905 Ga0496102_0100652 Ga0496102_0100652_967_1791 274
773 3300048905 Ga0496102_0170509 Ga0496102_0170509_285_1109 274
774 3300048905 Ga0496102_0207435 Ga0496102_0207435_811_1671 274
775 3300048905 Ga0496102_0208728 Ga0496102_0208728_994_1818 274
776 3300048905 Ga0496102_0369840 Ga0496102_0369840_89_913 274
777 3300048905 Ga0496102_0434422 Ga0496102_0434422_379_1203 274
778 3300048906 Ga0496103_0004902 Ga0496103_0004902_2497_3321 274
779 3300048906 Ga0496103_0009846 Ga0496103_0009846_4056_4880 274
780 3300048906 Ga0496103_0014190 Ga0496103_0014190_1415_2275 274
781 3300048907 Ga0496104_0005066 Ga0496104_0005066_4518_5345 274
782 3300048907 Ga0496104_0009671 Ga0496104_0009671_4916_5776 274
783 3300048907 Ga0496104_0010700 Ga0496104_0010700_5473_6297 274
784 3300048907 Ga0496104_0015598 Ga0496104_0015598_3566_4432 274
785 3300048907 Ga0496104_0032718 Ga0496104_0032718_2703_3527 274
786 3300048907 Ga0496104_0102177 Ga0496104_0102177_1201_2025 274
787 3300048907 Ga0496104_0118272 Ga0496104_0118272_740_1564 274
788 3300048907 Ga0496104_0131059 Ga0496104_0131059_837_1697 274
789 3300048907 Ga0496104_0304657 Ga0496104_0304657_505_1329 274
790 3300048907 Ga0496104_0423708 Ga0496104_0423708_283_1107 274
791 3300048907 Ga0496104_0617881 Ga0496104_0617881_38_862 274
792 3300048907 Ga0496104_0681228 Ga0496104_0681228_10_852 274
793 3300048908 Ga0496105_0006092 Ga0496105_0006092_4144_4968 274
794 3300048908 Ga0496105_0009651 Ga0496105_0009651_5554_6378 274
795 3300048908 Ga0496105_0014216 Ga0496105_0014216_162_989 274
796 3300048908 Ga0496105_0014320 Ga0496105_0014320_2076_2942 274
797 3300048908 Ga0496105_0031903 Ga0496105_0031903_1269_2093 274
798 3300048908 Ga0496105_0034869 Ga0496105_0034869_165_989 274
799 3300048908 Ga0496105_0037646 Ga0496105_0037646_2498_3322 274
800 3300048908 Ga0496105_0079967 Ga0496105_0079967_1197_2057 274
801 3300048908 Ga0496105_0494034 Ga0496105_0494034_109_933 274
802 3300048909 Ga0496106_0007532 Ga0496106_0007532_6774_7598 274
803 3300048909 Ga0496106_0136867 Ga0496106_0136867_748_1608 274
804 3300048910 Ga0496107_0002250 Ga0496107_0002250_8649_9476 274
805 3300048910 Ga0496107_0033508 Ga0496107_0033508_822_1646 274
806 3300048910 Ga0496107_0040983 Ga0496107_0040983_456_1280 274
807 3300048910 Ga0496107_0203050 Ga0496107_0203050_327_1151 274
808 3300048910 Ga0496107_0281526 Ga0496107_0281526_77_901 274
809 3300048911 Ga0496108_0000085 Ga0496108_0000085_44811_45635 274
810 3300048911 Ga0496108_0001801 Ga0496108_0001801_13373_14239 274
811 3300048911 Ga0496108_0006400 Ga0496108_0006400_7794_8654 274
812 3300048911 Ga0496108_0020352 Ga0496108_0020352_3991_4815 274
813 3300048911 Ga0496108_0042363 Ga0496108_0042363_1481_2305 274
814 3300048911 Ga0496108_0072132 Ga0496108_0072132_351_1175 274
815 3300048911 Ga0496108_0072840 Ga0496108_0072840_897_1757 274
816 3300048911 Ga0496108_0243586 Ga0496108_0243586_660_1484 274
817 3300048911 Ga0496108_0295921 Ga0496108_0295921_99_926 274
818 3300048912 Ga0496109_0001374 Ga0496109_0001374_11456_12316 274
819 3300048912 Ga0496109_0004444 Ga0496109_0004444_3569_4435 274
820 3300048912 Ga0496109_0036931 Ga0496109_0036931_3079_3903 274
821 3300048912 Ga0496109_0053693 Ga0496109_0053693_2162_3022 274
822 3300048912 Ga0496109_0082176 Ga0496109_0082176_155_982 274
823 3300048912 Ga0496109_0086856 Ga0496109_0086856_1313_2137 274
824 3300048912 Ga0496109_0387451 Ga0496109_0387451_47_871 274
825 3300048912 Ga0496109_0408682 Ga0496109_0408682_85_909 274
826 3300048912 Ga0496109_0443578 Ga0496109_0443578_361_1197 274
827 3300048912 Ga0496109_0478057 Ga0496109_0478057_37_861 274
828 3300048913 Ga0496110_0018710 Ga0496110_0018710_1811_2677 274
829 3300048913 Ga0496110_0029557 Ga0496110_0029557_3803_4627 274
830 3300048913 Ga0496110_0045912 Ga0496110_0045912_715_1575 274
831 3300048913 Ga0496110_0053216 Ga0496110_0053216_2344_3204 274
832 3300048913 Ga0496110_0074262 Ga0496110_0074262_723_1547 274
833 3300048913 Ga0496110_0088189 Ga0496110_0088189_1115_1939 274
834 3300048913 Ga0496110_0143362 Ga0496110_0143362_665_1489 274
835 3300048913 Ga0496110_0144931 Ga0496110_0144931_957_1781 274
836 3300048913 Ga0496110_0243531 Ga0496110_0243531_263_1087 274
837 3300048913 Ga0496110_0406893 Ga0496110_0406893_18_842 274
838 3300048914 Ga0496111_0064299 Ga0496111_0064299_1116_1976 274
839 3300048914 Ga0496111_0067113 Ga0496111_0067113_896_1720 274
840 3300048914 Ga0496111_0095491 Ga0496111_0095491_817_1677 274
841 3300048914 Ga0496111_0104796 Ga0496111_0104796_50_874 274
842 3300048914 Ga0496111_0315307 Ga0496111_0315307_26_850 274
843 3300048914 Ga0496111_0380680 Ga0496111_0380680_71_940 274
844 3300048915 Ga0496112_0021643 Ga0496112_0021643_734_1594 274
845 3300048915 Ga0496112_0033033 Ga0496112_0033033_4068_4949 274
846 3300048915 Ga0496112_0045443 Ga0496112_0045443_18_842 274
847 3300048915 Ga0496112_0224235 Ga0496112_0224235_133_993 274
848 3300048915 Ga0496112_0260771 Ga0496112_0260771_731_1555 274
849 3300048915 Ga0496112_0537154 Ga0496112_0537154_264_1088 274
850 3300048916 Ga0496113_0012688 Ga0496113_0012688_1440_2306 274
851 3300048916 Ga0496113_0014036 Ga0496113_0014036_4317_5141 274
852 3300048916 Ga0496113_0022391 Ga0496113_0022391_3256_4116 274
853 3300048916 Ga0496113_0063348 Ga0496113_0063348_622_1446 274
854 3300048916 Ga0496113_0095656 Ga0496113_0095656_1344_2216 274
855 3300048916 Ga0496113_0137702 Ga0496113_0137702_322_1182 274
856 3300048916 Ga0496113_0225110 Ga0496113_0225110_194_1018 274
857 3300048917 Ga0496114_0045265 Ga0496114_0045265_228_1052 274
858 3300048917 Ga0496114_0145281 Ga0496114_0145281_673_1497 274
859 3300048918 Ga0496115_0005716 Ga0496115_0005716_6034_6861 274
860 3300048918 Ga0496115_0018829 Ga0496115_0018829_27_851 274
861 3300048918 Ga0496115_0077044 Ga0496115_0077044_928_1752 274
862 3300048918 Ga0496115_0173765 Ga0496115_0173765_886_1710 274
863 3300048918 Ga0496115_0229361 Ga0496115_0229361_587_1423 274
864 3300048919 Ga0496116_0027763 Ga0496116_0027763_3126_3950 274
865 3300048921 Ga0496118_0026860 Ga0496118_0026860_3191_4015 274
866 3300048921 Ga0496118_0074260 Ga0496118_0074260_1335_2159 274
867 3300048921 Ga0496118_0104134 Ga0496118_0104134_284_1108 274
868 3300048921 Ga0496118_0116038 Ga0496118_0116038_357_1181 274
869 3300048922 Ga0496119_0016733 Ga0496119_0016733_1752_2576 274
870 3300048922 Ga0496119_0130230 Ga0496119_0130230_33_857 274
871 3300048923 Ga0496120_0024839 Ga0496120_0024839_315_1139 274
872 3300048923 Ga0496120_0036314 Ga0496120_0036314_1838_2662 274
873 3300048923 Ga0496120_0138042 Ga0496120_0138042_169_993 274
874 3300048924 Ga0496121_0022098 Ga0496121_0022098_321_1145 274
875 3300048924 Ga0496121_0033120 Ga0496121_0033120_1469_2293 274
876 3300048924 Ga0496121_0047098 Ga0496121_0047098_1625_2449 274
877 3300048924 Ga0496121_0061226 Ga0496121_0061226_991_1815 274
878 3300048924 Ga0496121_0086490 Ga0496121_0086490_768_1592 274
879 3300048924 Ga0496121_0104919 Ga0496121_0104919_1047_1871 274
880 3300048924 Ga0496121_0199799 Ga0496121_0199799_44_868 274
881 3300048925 Ga0496122_0049351 Ga0496122_0049351_929_1753 274
882 3300048928 Ga0496125_0000398 Ga0496125_0000398_2263_3087 274
883 3300048928 Ga0496125_0000583 Ga0496125_0000583_58059_58883 274
884 3300048928 Ga0496125_0095590 Ga0496125_0095590_430_1254 274
885 3300048929 Ga0496126_0009017 Ga0496126_0009017_2724_3548 274
886 3300048929 Ga0496126_0029280 Ga0496126_0029280_3287_4111 274
887 3300048929 Ga0496126_0089745 Ga0496126_0089745_29_853 274
888 3300048929 Ga0496126_0119397 Ga0496126_0119397_1045_1869 274
889 3300048929 Ga0496126_0132022 Ga0496126_0132022_653_1477 274
890 3300048929 Ga0496126_0178374 Ga0496126_0178374_238_1062 274
891 3300048929 Ga0496126_0286070 Ga0496126_0286070_238_1062 274
892 3300049459 Ga0495678_000022 Ga0495678_000022_208462_209442 274
893 3300049459 Ga0495678_098343 Ga0495678_098343_27_851 274
894 3300049460 Ga0495682_0040027 Ga0495682_0040027_755_1579 274
895 3300049570 Ga0501033_0006993 Ga0501033_0006993_6881_7705 274
896 3300049571 Ga0501034_0052501 Ga0501034_0052501_648_1472 274
897 3300049571 Ga0501034_0711227 Ga0501034_0711227_22_846 274
898 3300049572 Ga0501036_0112415 Ga0501036_0112415_315_1139 274
899 3300049572 Ga0501036_0480354 Ga0501036_0480354_48_872 274
900 3300049573 Ga0501037_0093757 Ga0501037_0093757_308_1132 274
901 3300049579 Ga0501043_0026650 Ga0501043_0026650_1486_2310 274
902 3300049579 Ga0501043_0159620 Ga0501043_0159620_912_1736 274
903 3300049581 Ga0501047_0038808 Ga0501047_0038808_2631_3455 274
904 3300049581 Ga0501047_0048403 Ga0501047_0048403_2469_3293 274
905 3300049581 Ga0501047_0075636 Ga0501047_0075636_2156_2980 274
906 3300049581 Ga0501047_0233825 Ga0501047_0233825_41_865 274
907 3300049581 Ga0501047_0245192 Ga0501047_0245192_600_1424 274
908 3300049582 Ga0501048_0104477 Ga0501048_0104477_92_916 274
909 3300049586 Ga0501070_0003666 Ga0501070_0003666_10087_10911 274
910 3300049589 Ga0501073_0047240 Ga0501073_0047240_571_1398 274
911 3300049742 Ga0501080_0002569 Ga0501080_0002569_12314_13138 274
912 3300049822 Ga0501035_0051837 Ga0501035_0051837_225_1049 274
913 3300049822 Ga0501035_0087490 Ga0501035_0087490_1896_2720 274
914 3300049823 Ga0501044_0105731 Ga0501044_0105731_186_1010 274
915 3300050489 nmdc:mga03683_142946_c1 nmdc:mga03683_142946_c1_155_979 274
916 3300050489 nmdc:mga03683_914_c1 nmdc:mga03683_914_c1_4290_5114 274
917 3300050491 nmdc:mga00v17_342510_c1 nmdc:mga00v17_342510_c1_35_859 274
918 3300050491 nmdc:mga00v17_367239_c1 nmdc:mga00v17_367239_c1_80_904 274
919 3300050491 nmdc:mga00v17_94271_c1 nmdc:mga00v17_94271_c1_916_1740 274
920 3300050492 nmdc:mga0yw44_107635_c1 nmdc:mga0yw44_107635_c1_548_1372 274
921 3300050492 nmdc:mga0yw44_108109_c1 nmdc:mga0yw44_108109_c1_243_1070 274
922 3300050492 nmdc:mga0yw44_12728_c1 nmdc:mga0yw44_12728_c1_33_857 274
923 3300050492 nmdc:mga0yw44_302158_c1 nmdc:mga0yw44_302158_c1_77_901 274
924 3300050492 nmdc:mga0yw44_45018_c1 nmdc:mga0yw44_45018_c1_605_1429 274
925 3300050492 nmdc:mga0yw44_53561_c1 nmdc:mga0yw44_53561_c1_935_1759 274
926 3300050492 nmdc:mga0yw44_5380_c1 nmdc:mga0yw44_5380_c1_1551_2375 274
927 3300050492 nmdc:mga0yw44_65075_c1 nmdc:mga0yw44_65075_c1_624_1448 274
928 3300050493 nmdc:mga0k408_101913_c1 nmdc:mga0k408_101913_c1_238_1062 274
929 3300050493 nmdc:mga0k408_133218_c1 nmdc:mga0k408_133218_c1_634_1458 274
930 3300050493 nmdc:mga0k408_156449_c1 nmdc:mga0k408_156449_c1_79_903 274
931 3300050494 nmdc:mga06z11_24711_c1 nmdc:mga06z11_24711_c1_1468_2292 274
932 3300050494 nmdc:mga06z11_5599_c1 nmdc:mga06z11_5599_c1_2285_3169 274
933 3300050496 nmdc:mga07m45_40912_c1 nmdc:mga07m45_40912_c1_791_1615 274
934 3300050507 nmdc:mga05p37_12256_c1 nmdc:mga05p37_12256_c1_1954_2778 274
935 3300050507 nmdc:mga05p37_137380_c1 nmdc:mga05p37_137380_c1_75_986 274
936 3300050507 nmdc:mga05p37_191551_c1 nmdc:mga05p37_191551_c1_269_1093 274
937 3300050507 nmdc:mga05p37_198474_c1 nmdc:mga05p37_198474_c1_579_1415 274
938 3300050507 nmdc:mga05p37_342483_c1 nmdc:mga05p37_342483_c1_284_1108 274
939 3300050507 nmdc:mga05p37_66088_c1 nmdc:mga05p37_66088_c1_2461_3285 274
940 3300050507 nmdc:mga05p37_756827_c1 nmdc:mga05p37_756827_c1_226_1050 274
941 3300050508 nmdc:mga09592_10818_c1 nmdc:mga09592_10818_c1_5475_6299 274
942 3300050508 nmdc:mga09592_472262_c1 nmdc:mga09592_472262_c1_148_972 274
943 3300050509 nmdc:mga0qj67_50665_c1 nmdc:mga0qj67_50665_c1_1152_1976 274
944 3300050510 nmdc:mga06r32_12962_c1 nmdc:mga06r32_12962_c1_5550_6374 274
945 3300050510 nmdc:mga06r32_43327_c1 nmdc:mga06r32_43327_c1_336_1196 274
946 3300050511 nmdc:mga08y16_160261_c1 nmdc:mga08y16_160261_c1_371_1195 274
947 3300050511 nmdc:mga08y16_73423_c1 nmdc:mga08y16_73423_c1_1165_1989 274
948 3300050512 nmdc:mga0n895_103480_c1 nmdc:mga0n895_103480_c1_624_1448 274
949 3300050512 nmdc:mga0n895_151062_c1 nmdc:mga0n895_151062_c1_1304_2128 274
950 3300050512 nmdc:mga0n895_21382_c1 nmdc:mga0n895_21382_c1_4563_5474 274
951 3300050512 nmdc:mga0n895_4039_c1 nmdc:mga0n895_4039_c1_5770_6594 274
952 3300050512 nmdc:mga0n895_405504_c1 nmdc:mga0n895_405504_c1_237_1067 274
953 3300050513 nmdc:mga0rr50_3155_c1 nmdc:mga0rr50_3155_c1_6020_6844 274
954 3300050513 nmdc:mga0rr50_470_c1 nmdc:mga0rr50_470_c1_14817_15641 274
955 3300050513 nmdc:mga0rr50_47936_c1 nmdc:mga0rr50_47936_c1_850_1710 274
956 3300050513 nmdc:mga0rr50_71799_c1 nmdc:mga0rr50_71799_c1_186_1010 274
957 3300050513 nmdc:mga0rr50_9726_c1 nmdc:mga0rr50_9726_c1_1559_2389 274
958 3300050514 nmdc:mga08x19_2945_c1 nmdc:mga08x19_2945_c1_1127_1951 274
959 3300050515 nmdc:mga0a205_131196_c1 nmdc:mga0a205_131196_c1_1546_2370 274
960 3300050515 nmdc:mga0a205_135822_c1 nmdc:mga0a205_135822_c1_1497_2321 274
961 3300050515 nmdc:mga0a205_16730_c1 nmdc:mga0a205_16730_c1_2177_3013 274
962 3300050515 nmdc:mga0a205_177611_c1 nmdc:mga0a205_177611_c1_840_1700 274
963 3300050515 nmdc:mga0a205_24882_c1 nmdc:mga0a205_24882_c1_3487_4398 274
964 3300050515 nmdc:mga0a205_282263_c1 nmdc:mga0a205_282263_c1_514_1338 274
965 3300050515 nmdc:mga0a205_4844_c1 nmdc:mga0a205_4844_c1_5381_6205 274
966 3300050516 nmdc:mga0sz30_187_c1 nmdc:mga0sz30_187_c1_2335_3159 274
967 3300050516 nmdc:mga0sz30_73028_c1 nmdc:mga0sz30_73028_c1_244_1068 274
968 3300053077 Ga0495601_0377012 Ga0495601_0377012_87_911 274
969 3300053078 Ga0495612_0132622 Ga0495612_0132622_59_883 274
970 3300053079 Ga0500610_0195721 Ga0500610_0195721_85_909 274
971 3300053084 Ga0495595_0029694 Ga0495595_0029694_1386_2210 274
972 3300053084 Ga0495595_0042897 Ga0495595_0042897_542_1366 274
973 3300053084 Ga0495595_0193324 Ga0495595_0193324_155_979 274
974 3300053085 Ga0495619_0006090 Ga0495619_0006090_3696_4520 274
975 3300053085 Ga0495619_0057341 Ga0495619_0057341_469_1293 274
976 3300053085 Ga0495619_0081532 Ga0495619_0081532_781_1605 274
977 3300053087 Ga0500643_000210 Ga0500643_000210_36582_37406 274
978 3300053091 Ga0500647_0027384 Ga0500647_0027384_1059_1883 274
979 3300053094 Ga0500566_0000908 Ga0500566_0000908_12338_13162 274
980 3300053094 Ga0500566_0008156 Ga0500566_0008156_2629_3453 274
981 3300053096 Ga0500641_0016502 Ga0500641_0016502_89_913 274
982 3300053104 Ga0500556_0009208 Ga0500556_0009208_891_1715 274
983 3300053105 Ga0500557_000196 Ga0500557_000196_7575_8399 274
984 3300053114 Ga0500582_069329 Ga0500582_069329_141_965 274
985 3300053119 Ga0500595_000372 Ga0500595_000372_15534_16358 274
986 3300053121 Ga0500607_098593 Ga0500607_098593_208_1032 274
987 3300053130 Ga0500642_0000053 Ga0500642_0000053_2951_3775 274
988 3300053130 Ga0500642_0023118 Ga0500642_0023118_188_1012 274
989 3300053136 Ga0500559_0023878 Ga0500559_0023878_1145_1969 274
990 3300053136 Ga0500559_0029435 Ga0500559_0029435_860_1684 274
991 3300053142 Ga0500577_0116040 Ga0500577_0116040_260_1084 274
992 3300053147 Ga0500589_101031 Ga0500589_101031_186_1010 274
993 3300053148 Ga0500590_021996 Ga0500590_021996_820_1644 274
994 3300053148 Ga0500590_098146 Ga0500590_098146_400_1224 274
995 3300053153 Ga0500616_0064762 Ga0500616_0064762_920_1744 274
996 3300053154 Ga0500619_020259 Ga0500619_020259_716_1540 274
997 3300053162 Ga0500638_001015 Ga0500638_001015_1249_2073 274
998 3300053162 Ga0500638_140525 Ga0500638_140525_80_904 274
999 3300053162 Ga0500638_158285 Ga0500638_158285_30_854 274
1000 3300053177 Ga0500636_0000033 Ga0500636_0000033_51601_52425 274
1001 3300053178 Ga0500637_0001490 Ga0500637_0001490_4717_5541 274
1002 3300053730 Ga0500645_084030 Ga0500645_084030_10_834 274
1003 3300053736 Ga0500599_001058 Ga0500599_001058_796_1620 274
1004 3300053737 Ga0500601_000590 Ga0500601_000590_3625_4449 274
1005 3300055283 Ga0500661_000075 Ga0500661_000075_10512_11336 274
1006 3300059490 Ga0587066_003124 Ga0587066_003124_958_1782 274
1007 3300059644 Ga0587075_002353 Ga0587075_002353_146_970 274
1008 3300059645 Ga0587076_012928 Ga0587076_012928_197_1021 274
1009 3300060346 Ga0587111_0044713 Ga0587111_0044713_123_947 274
1010 3300061719 Ga0466962_0087966 Ga0466962_0087966_55_879 274
1011 iso_pu_bacteria 2643221545 2643749078 274
1012 iso_pu_bacteria 2643221691 2644509163 274
1013 3300002772 JGI25164J39214_1000349 JGI25164J39214_100034913 275
1014 3300003354 JGI25160J50197_1000774 JGI25160J50197_10007748 275
1015 3300003758 Ga0055532_1000114 Ga0055532_100011464 275
1016 3300003781 Ga0055536_1001668 Ga0055536_100166810 275
1017 3300003791 Ga0055530_10005027 Ga0055530_100050276 275
1018 3300003792 Ga0055540_1001608 Ga0055540_10016086 275
1019 3300003794 Ga0055531_10010163 Ga0055531_100101634 275
1020 3300005262 Ga0065165_1002238 Ga0065165_100223812 275
1021 3300005288 Ga0065714_10005120 Ga0065714_100051205 275
1022 3300005288 Ga0065714_10010177 Ga0065714_100101772 275
1023 3300005455 Ga0070663_100188240 Ga0070663_1001882402 275
1024 3300006058 Ga0075432_10015485 Ga0075432_100154852 275
1025 3300006177 Ga0075362_10076029 Ga0075362_100760291 275
1026 3300009011 Ga0105251_10011088 Ga0105251_100110885 275
1027 3300009011 Ga0105251_10030142 Ga0105251_100301423 275
1028 3300009011 Ga0105251_10066235 Ga0105251_100662352 275
1029 3300009036 Ga0105244_10011278 Ga0105244_100112784 275
1030 3300009036 Ga0105244_10033048 Ga0105244_100330482 275
1031 3300009092 Ga0105250_10004415 Ga0105250_100044153 275
1032 3300009092 Ga0105250_10022797 Ga0105250_100227973 275
1033 3300009092 Ga0105250_10031236 Ga0105250_100312362 275
1034 3300009092 Ga0105250_10069898 Ga0105250_100698981 275
1035 3300009148 Ga0105243_10000650 Ga0105243_1000065010 275
1036 3300013104 Ga0157370_10051107 Ga0157370_100511073 275
1037 3300013306 Ga0163162_10458275 Ga0163162_104582751 275
1038 3300013307 Ga0157372_10152027 Ga0157372_101520272 275
1039 3300013308 Ga0157375_10009201 Ga0157375_100092019 275
1040 3300014497 Ga0182008_10004732 Ga0182008_100047329 275
1041 3300017792 Ga0163161_10002676 Ga0163161_100026761 275
1042 3300017792 Ga0163161_10011963 Ga0163161_100119632 275
1043 3300017792 Ga0163161_10163935 Ga0163161_101639352 275
1044 3300025229 Ga0209147_100037 Ga0209147_10003764 275
1045 3300025231 Ga0207427_100044 Ga0207427_100044149 275
1046 3300025233 Ga0209437_100005 Ga0209437_100005227 275
1047 3300025261 Ga0209233_1000011 Ga0209233_1000011714 275
1048 3300025291 Ga0209675_1001965 Ga0209675_10019659 275
1049 3300025292 Ga0209676_1000102 Ga0209676_100010253 275
1050 3300025298 Ga0209050_1000105 Ga0209050_100010553 275
1051 3300025302 Ga0207426_1000103 Ga0207426_1000103158 275
1052 3300025303 Ga0209051_1000066 Ga0209051_100006653 275
1053 3300025304 Ga0209257_1000124 Ga0209257_1000124137 275
1054 3300025711 Ga0207696_1001307 Ga0207696_100130712 275
1055 3300025711 Ga0207696_1004904 Ga0207696_10049045 275
1056 3300025711 Ga0207696_1019321 Ga0207696_10193212 275
1057 3300025711 Ga0207696_1021538 Ga0207696_10215382 275
1058 3300025728 Ga0207655_1000219 Ga0207655_10002192 275
1059 3300025728 Ga0207655_1003812 Ga0207655_10038126 275
1060 3300025728 Ga0207655_1019209 Ga0207655_10192092 275
1061 3300025735 Ga0207713_1001250 Ga0207713_100125011 275
1062 3300025735 Ga0207713_1005534 Ga0207713_10055348 275
1063 3300025735 Ga0207713_1011327 Ga0207713_10113271 275
1064 3300025735 Ga0207713_1014629 Ga0207713_10146293 275
1065 3300025735 Ga0207713_1029292 Ga0207713_10292921 275
1066 3300025735 Ga0207713_1071712 Ga0207713_10717121 275
1067 3300025923 Ga0207681_10015796 Ga0207681_100157962 275
1068 3300025935 Ga0207709_10000001 Ga0207709_10000001855 275
1069 3300026067 Ga0207678_10167776 Ga0207678_101677762 275
1070 3300027907 Ga0207428_10009941 Ga0207428_100099419 275
1071 3300031238 Ga0265332_10130299 Ga0265332_101302991 275
1072 3300031249 Ga0265339_10025802 Ga0265339_100258022 275
1073 3300031548 Ga0307408_100002600 Ga0307408_1000026004 275
1074 3300031616 Ga0307508_10264534 Ga0307508_102645342 275
1075 3300041405 Ga0439438_000188 Ga0439438_000188_6067_6897 275
1076 3300041405 Ga0439438_021439 Ga0439438_021439_509_1339 275
1077 3300041407 Ga0439447_000289 Ga0439447_000289_9310_10140 275
1078 3300041407 Ga0439447_044189 Ga0439447_044189_66_896 275
1079 3300041411 Ga0439466_0001316 Ga0439466_0001316_2167_2997 275
1080 3300041411 Ga0439466_0009307 Ga0439466_0009307_826_1656 275
1081 3300042009 Ga0439451_000373 Ga0439451_000373_2168_2998 275
1082 3300042010 Ga0439452_000077 Ga0439452_000077_2760_3590 275
1083 3300042010 Ga0439452_001743 Ga0439452_001743_1635_2465 275
1084 3300042121 Ga0450919_001810 Ga0450919_001810_1753_2583 275
1085 3300042122 Ga0450920_000770 Ga0450920_000770_31_861 275
1086 3300042124 Ga0450922_000106 Ga0450922_000106_7065_7895 275
1087 3300042145 Ga0450906_006336 Ga0450906_006336_697_1527 275
1088 3300042146 Ga0450907_000035 Ga0450907_000035_9630_10460 275
1089 3300042156 Ga0439446_0016435 Ga0439446_0016435_232_1062 275
1090 3300042184 Ga0450908_013341 Ga0450908_013341_548_1378 275
1091 3300042435 Ga0439434_0000053 Ga0439434_0000053_9602_10432 275
1092 3300044658 Ga0466972_0019144 Ga0466972_0019144_1843_2673 275
1093 3300044671 Ga0466978_0032140 Ga0466978_0032140_2307_3137 275
1094 3300044693 Ga0466961_0000418 Ga0466961_0000418_10045_10875 275
1095 3300044706 Ga0466964_0008332 Ga0466964_0008332_1629_2459 275
1096 3300044735 Ga0466968_0001216 Ga0466968_0001216_330_1160 275
1097 3300044842 Ga0466957_0037807 Ga0466957_0037807_975_1805 275
1098 3300045049 Ga0466959_0027721 Ga0466959_0027721_613_1443 275
1099 3300046452 Ga0495617_004483 Ga0495617_004483_1253_2083 275
1100 3300046453 Ga0495627_000874 Ga0495627_000874_1779_2609 275
1101 3300046453 Ga0495627_001078 Ga0495627_001078_4919_5749 275
1102 3300046453 Ga0495627_003617 Ga0495627_003617_140_970 275
1103 3300046457 Ga0495590_0026636 Ga0495590_0026636_50_880 275
1104 3300046458 Ga0495591_001976 Ga0495591_001976_145_975 275
1105 3300046458 Ga0495591_020413 Ga0495591_020413_1332_2162 275
1106 3300046460 Ga0495638_0001077 Ga0495638_0001077_25155_25985 275
1107 3300046460 Ga0495638_0031716 Ga0495638_0031716_2028_2858 275
1108 3300046460 Ga0495638_0034928 Ga0495638_0034928_1574_2404 275
1109 3300046460 Ga0495638_0065947 Ga0495638_0065947_1175_2005 275
1110 3300046471 Ga0495650_0003064 Ga0495650_0003064_11419_12249 275
1111 3300046474 Ga0495605_0166224 Ga0495605_0166224_120_950 275
1112 3300046475 Ga0495639_0000023 Ga0495639_0000023_20463_21293 275
1113 3300046491 Ga0495584_0000018 Ga0495584_0000018_111667_112497 275
1114 3300046492 Ga0495585_0010657 Ga0495585_0010657_1788_2618 275
1115 3300046501 Ga0495607_0011594 Ga0495607_0011594_2665_3495 275
1116 3300046501 Ga0495607_0022935 Ga0495607_0022935_2743_3573 275
1117 3300046506 Ga0495583_0028838 Ga0495583_0028838_613_1443 275
1118 3300046506 Ga0495583_0074047 Ga0495583_0074047_202_1032 275
1119 3300046512 Ga0495610_0008260 Ga0495610_0008260_731_1561 275
1120 3300046512 Ga0495610_0036794 Ga0495610_0036794_634_1464 275
1121 3300046513 Ga0495616_0018314 Ga0495616_0018314_1571_2401 275
1122 3300046515 Ga0495620_0053632 Ga0495620_0053632_754_1584 275
1123 3300046518 Ga0495631_0017638 Ga0495631_0017638_2488_3318 275
1124 3300046519 Ga0495632_0003144 Ga0495632_0003144_185_1015 275
1125 3300046519 Ga0495632_0005156 Ga0495632_0005156_1654_2484 275
1126 3300046519 Ga0495632_0018652 Ga0495632_0018652_153_983 275
1127 3300046519 Ga0495632_0024920 Ga0495632_0024920_2149_2979 275
1128 3300046519 Ga0495632_0035423 Ga0495632_0035423_945_1775 275
1129 3300046519 Ga0495632_0062989 Ga0495632_0062989_903_1733 275
1130 3300046520 Ga0495637_0001867 Ga0495637_0001867_10969_11799 275
1131 3300046520 Ga0495637_0030210 Ga0495637_0030210_237_1067 275
1132 3300046522 Ga0495643_0004784 Ga0495643_0004784_1285_2115 275
1133 3300046522 Ga0495643_0123611 Ga0495643_0123611_211_1041 275
1134 3300046523 Ga0495644_0000104 Ga0495644_0000104_30209_31039 275
1135 3300046523 Ga0495644_0020211 Ga0495644_0020211_1475_2305 275
1136 3300046524 Ga0495648_0008944 Ga0495648_0008944_469_1299 275
1137 3300046524 Ga0495648_0175873 Ga0495648_0175873_119_949 275
1138 3300046525 Ga0495663_0010270 Ga0495663_0010270_1560_2390 275
1139 3300046530 Ga0495654_0009404 Ga0495654_0009404_1366_2196 275
1140 3300046542 Ga0495597_0004749 Ga0495597_0004749_359_1189 275
1141 3300046557 Ga0495622_0000135 Ga0495622_0000135_41701_42531 275
1142 3300046558 Ga0495633_0010860 Ga0495633_0010860_1500_2330 275
1143 3300046615 Ga0495656_0091438 Ga0495656_0091438_332_1162 275
1144 3300046616 Ga0495668_0000379 Ga0495668_0000379_356_1186 275
1145 3300046660 Ga0495625_0003166 Ga0495625_0003166_1264_2094 275
1146 3300046660 Ga0495625_0006295 Ga0495625_0006295_8950_9780 275
1147 3300046660 Ga0495625_0008990 Ga0495625_0008990_4880_5710 275
1148 3300046660 Ga0495625_0010307 Ga0495625_0010307_4827_5657 275
1149 3300046665 Ga0495661_0008974 Ga0495661_0008974_1345_2175 275
1150 3300046665 Ga0495661_0016063 Ga0495661_0016063_3860_4690 275
1151 3300046665 Ga0495661_0020284 Ga0495661_0020284_2510_3340 275
1152 3300046691 Ga0495670_0014224 Ga0495670_0014224_1809_2639 275
1153 3300046691 Ga0495670_0015862 Ga0495670_0015862_422_1252 275
1154 3300046692 Ga0495671_0017068 Ga0495671_0017068_3010_3840 275
1155 3300046694 Ga0495649_0010770 Ga0495649_0010770_2580_3410 275
1156 3300046694 Ga0495649_0014859 Ga0495649_0014859_3029_3859 275
1157 3300046794 Ga0495589_0015892 Ga0495589_0015892_2842_3672 275
1158 3300046810 Ga0495660_0006726 Ga0495660_0006726_4707_5537 275
1159 3300046810 Ga0495660_0020038 Ga0495660_0020038_1797_2627 275
1160 3300046810 Ga0495660_0074756 Ga0495660_0074756_820_1650 275
1161 3300047320 Ga0495672_0004293 Ga0495672_0004293_5586_6416 275
1162 3300047320 Ga0495672_0016133 Ga0495672_0016133_1796_2632 275
1163 3300047320 Ga0495672_0037660 Ga0495672_0037660_1275_2105 275
1164 3300047323 Ga0495683_0000710 Ga0495683_0000710_17798_18628 275
1165 3300047323 Ga0495683_0001671 Ga0495683_0001671_2209_3039 275
1166 3300047446 Ga0495679_002871 Ga0495679_002871_93_923 275
1167 3300047469 Ga0495673_0078696 Ga0495673_0078696_382_1212 275
1168 3300047469 Ga0495673_0079243 Ga0495673_0079243_154_984 275
1169 3300047470 Ga0495681_0000397 Ga0495681_0000397_23682_24512 275
1170 3300047470 Ga0495681_0000547 Ga0495681_0000547_10129_10959 275
1171 3300047470 Ga0495681_0001186 Ga0495681_0001186_10822_11652 275
1172 3300047470 Ga0495681_0012872 Ga0495681_0012872_1822_2652 275
1173 3300047470 Ga0495681_0126519 Ga0495681_0126519_131_961 275
1174 3300047472 Ga0495686_0233070 Ga0495686_0233070_162_992 275
1175 3300048091 Ga0495626_0000845 Ga0495626_0000845_14973_15803 275
1176 3300048917 Ga0496114_0169480 Ga0496114_0169480_535_1365 275
1177 3300048921 Ga0496118_0003627 Ga0496118_0003627_7867_8697 275
1178 3300048927 Ga0496124_0001884 Ga0496124_0001884_10719_11549 275
1179 3300048927 Ga0496124_0126529 Ga0496124_0126529_814_1644 275
1180 3300048928 Ga0496125_0053998 Ga0496125_0053998_539_1369 275
1181 3300048929 Ga0496126_0001707 Ga0496126_0001707_24979_25809 275
1182 3300049459 Ga0495678_001125 Ga0495678_001125_232_1062 275
1183 3300049460 Ga0495682_0000574 Ga0495682_0000574_21292_22122 275
1184 3300049569 Ga0501032_0013596 Ga0501032_0013596_4573_5406 275
1185 3300049571 Ga0501034_0018551 Ga0501034_0018551_658_1491 275
1186 3300049572 Ga0501036_0119131 Ga0501036_0119131_1143_1976 275
1187 3300049574 Ga0501038_0316086 Ga0501038_0316086_379_1212 275
1188 3300049575 Ga0501039_0020160 Ga0501039_0020160_1600_2433 275
1189 3300049578 Ga0501042_0098751 Ga0501042_0098751_1232_2065 275
1190 3300049579 Ga0501043_0086301 Ga0501043_0086301_507_1340 275
1191 3300049580 Ga0501046_0092638 Ga0501046_0092638_32_865 275
1192 3300049581 Ga0501047_0116105 Ga0501047_0116105_1113_1946 275
1193 3300049582 Ga0501048_0054813 Ga0501048_0054813_1529_2362 275
1194 3300049583 Ga0501067_0059862 Ga0501067_0059862_390_1223 275
1195 3300049585 Ga0501069_0013696 Ga0501069_0013696_2674_3507 275
1196 3300049586 Ga0501070_0556715 Ga0501070_0556715_69_902 275
1197 3300049588 Ga0501072_0148193 Ga0501072_0148193_936_1769 275
1198 3300049589 Ga0501073_0029084 Ga0501073_0029084_971_1804 275
1199 3300049742 Ga0501080_0101917 Ga0501080_0101917_271_1104 275
1200 3300049758 Ga0501241_000151 Ga0501241_000151_4985_5815 275
1201 3300049822 Ga0501035_0146140 Ga0501035_0146140_325_1158 275
1202 3300049823 Ga0501044_0096873 Ga0501044_0096873_1552_2385 275
1203 3300050489 nmdc:mga03683_36634_c1 nmdc:mga03683_36634_c1_695_1525 275
1204 3300050514 nmdc:mga08x19_42039_c1 nmdc:mga08x19_42039_c1_451_1281 275
1205 3300060353 Ga0501082_0196188 Ga0501082_0196188_314_1147 275
1206 3300002739 JGI25158J39367_1000662 JGI25158J39367_10006628 276
1207 3300002774 JGI25150J39212_1015276 JGI25150J39212_10152762 276
1208 3300002987 JGI25159J45721_1003457 JGI25159J45721_10034574 276
1209 3300003374 JGI25161J50226_1000108 JGI25161J50226_100010824 276
1210 3300004625 Ga0055543_1000020 Ga0055543_100002061 276
1211 3300005262 Ga0065165_1022880 Ga0065165_10228801 276
1212 3300005328 Ga0070676_10005631 Ga0070676_100056314 276
1213 3300005338 Ga0068868_100000053 Ga0068868_1000000535 276
1214 3300005364 Ga0070673_100000010 Ga0070673_10000001012 276
1215 3300005459 Ga0068867_100000007 Ga0068867_100000007116 276
1216 3300006881 Ga0068865_100000010 Ga0068865_10000001063 276
1217 3300009098 Ga0105245_10000174 Ga0105245_1000017455 276
1218 3300009148 Ga0105243_10000054 Ga0105243_1000005492 276
1219 3300009176 Ga0105242_10000821 Ga0105242_1000082124 276
1220 3300009553 Ga0105249_10009100 Ga0105249_100091007 276
1221 3300011119 Ga0105246_10001706 Ga0105246_100017064 276
1222 3300013296 Ga0157374_10000468 Ga0157374_1000046839 276
1223 3300013297 Ga0157378_10000494 Ga0157378_1000049439 276
1224 3300013308 Ga0157375_10000306 Ga0157375_1000030620 276
1225 3300014745 Ga0157377_10051614 Ga0157377_100516143 276
1226 3300014969 Ga0157376_10000047 Ga0157376_10000047117 276
1227 3300025208 Ga0209436_100095 Ga0209436_10009524 276
1228 3300025258 Ga0209129_1000449 Ga0209129_100044925 276
1229 3300025284 Ga0209130_1000004 Ga0209130_1000004224 276
1230 3300025295 Ga0209564_1000630 Ga0209564_100063052 276
1231 3300025302 Ga0207426_1000003 Ga0207426_1000003504 276
1232 3300025907 Ga0207645_10002621 Ga0207645_100026214 276
1233 3300025927 Ga0207687_10003479 Ga0207687_1000347910 276
1234 3300025934 Ga0207686_10000556 Ga0207686_1000055624 276
1235 3300025935 Ga0207709_10000050 Ga0207709_10000050136 276
1236 3300025938 Ga0207704_10000020 Ga0207704_1000002046 276
1237 3300025942 Ga0207689_10000268 Ga0207689_100002684 276
1238 3300025960 Ga0207651_10000005 Ga0207651_10000005115 276
1239 3300025961 Ga0207712_10059303 Ga0207712_100593032 276
1240 3300026023 Ga0207677_10000094 Ga0207677_1000009459 276
1241 3300026067 Ga0207678_10144100 Ga0207678_101441002 276
1242 3300026089 Ga0207648_10000017 Ga0207648_1000001746 276
1243 3300031548 Ga0307408_100153860 Ga0307408_1001538602 276
1244 3300031731 Ga0307405_10123495 Ga0307405_101234951 276
1245 3300031911 Ga0307412_10293696 Ga0307412_102936961 276
1246 3300031995 Ga0307409_100021452 Ga0307409_1000214521 276
1247 3300037418 Ga0395900_0067574 Ga0395900_0067574_269_1150 276
1248 3300041404 Ga0439436_0029214 Ga0439436_0029214_438_1268 276
1249 3300041405 Ga0439438_024445 Ga0439438_024445_410_1240 276
1250 3300041411 Ga0439466_0056601 Ga0439466_0056601_374_1204 276
1251 3300041413 Ga0439465_0028217 Ga0439465_0028217_162_1151 276
1252 3300042007 Ga0439449_0073961 Ga0439449_0073961_45_875 276
1253 3300042015 Ga0439462_0044862 Ga0439462_0044862_24_854 276
1254 3300042145 Ga0450906_015492 Ga0450906_015492_70_900 276
1255 3300045976 Ga0466967_0283194 Ga0466967_0283194_298_1182 276
1256 3300046512 Ga0495610_0027368 Ga0495610_0027368_1644_2621 276
1257 3300046660 Ga0495625_0020975 Ga0495625_0020975_3965_4795 276
1258 3300047446 Ga0495679_001535 Ga0495679_001535_7946_9016 276
1259 3300048920 Ga0496117_0118578 Ga0496117_0118578_508_1485 276
1260 3300048921 Ga0496118_0006416 Ga0496118_0006416_11345_12190 276
1261 3300048921 Ga0496118_0062501 Ga0496118_0062501_698_1528 276
1262 3300048921 Ga0496118_0064285 Ga0496118_0064285_46_876 276
1263 3300048924 Ga0496121_0011940 Ga0496121_0011940_6801_7631 276
1264 3300048925 Ga0496122_0022896 Ga0496122_0022896_1777_2607 276
1265 3300048926 Ga0496123_0009076 Ga0496123_0009076_6147_6977 276
1266 3300048927 Ga0496124_0027989 Ga0496124_0027989_253_1230 276
1267 3300049744 Ga0501083_0011783 Ga0501083_0011783_1582_2505 276
1268 3300053087 Ga0500643_003295 Ga0500643_003295_187_1017 276
1269 3300053104 Ga0500556_0000049 Ga0500556_0000049_40943_41773 276
1270 3300053108 Ga0500562_024014 Ga0500562_024014_708_1538 276
1271 3300053130 Ga0500642_0000002 Ga0500642_0000002_87024_87854 276
1272 3300053156 Ga0500622_0001817 Ga0500622_0001817_7918_8895 276
1273 3300053730 Ga0500645_000173 Ga0500645_000173_31032_31862 276
1274 3300060353 Ga0501082_0134983 Ga0501082_0134983_1184_2107 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

52

289

0.94

PF12146

Hydrolase_4

Serine aminopeptidase, S33

51

170

0.87

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

54

296

0.55

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a88-assembly1.cif.gz_C chloroperoxidase l 0.9976 2 276
1a88-assembly1.cif.gz_C chloroperoxidase l 0.994 2 276
1zoi-assembly1.cif.gz_B crystal structure of a stereoselective esterase from pseudomonas putida ifo12996 0.9899 2 274
4dgq-assembly1.cif.gz_C crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia 0.989 3 276
1a8s-assembly1.cif.gz_A chloroperoxidase f/propionate complex 0.9858 2 276
ID Description Score Start End Superfamily
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9895 3 276 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9825 2 276 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9789 2 276 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9788 3 276 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9726 2 276 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A430CRL9-F1-model_v4 deleted 0.9989 2 276
AF-A0A6G8UDL9-F1-model_v4 Alpha/beta hydrolase 0.9984 3 276 GO:0016787
AF-A0A4V3UWV7-F1-model_v4 Alpha/beta hydrolase 0.9962 3 99 GO:0016787
AF-A0A3A6R6F1-F1-model_v4 Alpha/beta hydrolase 0.9952 3 276 GO:0016787
AF-A0A443LHS6-F1-model_v4 Alpha/beta hydrolase 0.9943 1 276 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.98 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map