F492451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1274 | 531 | 1272 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10029049|Ga0207695_100290492 |
| Length | 304 |
| Sequence | MSKDNMTDASRRALLAGGVGIAPAMATSRMADGYVTTADGTKIYYKDWGSGQPIVFSHGWPLSADDWDPQMMFFLQNRYRVIAHDRRGHGRSTQTDTGNDMDHYAPDLAALTAHLDLHNAIHVGHSTGGGEVVHYVARHQERVAKAAIISAVPPVMVKSASNPEGIPLEGFEPYRQQTAFNRPQFYLDVPSGPFYGFNRPGVKTIPGLVQNWWRQGMMGGVKAQVDCVKAFSETDFTEDLKKITVPVLVMHSKDDQVVPYADSGPKSAALLKNGTLKTYENYPHGMITTQADVINADLLAFFKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 2 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 3 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 144 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 145 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 146 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 147 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 150 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 151 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 243 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 245 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 246 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 249 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 254 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 261 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 265 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 266 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 269 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 274 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 275 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 282 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 294 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 299 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 300 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 301 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 302 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 303 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 304 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 305 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 306 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 307 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 308 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 309 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 310 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 311 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 312 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 313 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 314 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 315 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 316 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 317 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 318 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 319 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 320 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 321 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 322 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 323 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 324 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 325 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 326 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 327 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 328 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 329 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 330 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 331 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 332 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 333 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 334 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 335 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 336 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 337 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 338 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 339 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 432 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 433 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 434 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 435 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 436 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 437 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 440 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 441 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 442 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 443 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 444 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 445 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 446 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 447 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 448 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 449 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 450 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 451 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 452 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 453 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 454 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 455 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 456 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 478 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 481 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 482 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 483 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 484 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 485 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 486 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 496 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 502 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 503 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 505 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 507 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 508 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 509 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 510 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 511 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 512 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 513 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 514 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 515 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 516 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 517 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 518 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 519 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 520 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 522 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 523 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 524 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 525 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 526 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 0.86 |
| Isolates | 0.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.15 |
| Nodule | 0.63 |
| Rhizoplane | 7.85 |
| Rhizosphere | 74.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1000662 | 3300002739 | Bacteria | 6722 |
| 2 | JGI25164J39214_1000349 | 3300002772 | Bacteria | 28764 |
| 3 | JGI25150J39212_1015276 | 3300002774 | Bacteria | 1284 |
| 4 | JGI25159J45721_1003457 | 3300002987 | Bacteria | 5574 |
| 5 | JGI25153J46596_10001277 | 3300003215 | Bacteria | 15111 |
| 6 | JGI25153J46596_10003243 | 3300003215 | Bacteria | 9147 |
| 7 | JGI25160J50197_1000710 | 3300003354 | Bacteria | 18324 |
| 8 | JGI25160J50197_1000774 | 3300003354 | Bacteria | 17157 |
| 9 | JGI25160J50197_1003342 | 3300003354 | Bacteria | 7212 |
| 10 | JGI25161J50226_1000108 | 3300003374 | Bacteria | 65159 |
| 11 | JGI25161J50226_1009853 | 3300003374 | Bacteria | 1323 |
| 12 | Ga0055532_1000114 | 3300003758 | Bacteria | 85635 |
| 13 | Ga0055542_1003323 | 3300003762 | Bacteria | 4441 |
| 14 | Ga0055536_1001668 | 3300003781 | Bacteria | 13181 |
| 15 | Ga0055530_10005027 | 3300003791 | Bacteria | 6514 |
| 16 | Ga0055540_1001608 | 3300003792 | Bacteria | 13175 |
| 17 | Ga0055540_1004160 | 3300003792 | Bacteria | 6683 |
| 18 | Ga0055540_1005734 | 3300003792 | Bacteria | 5119 |
| 19 | Ga0055540_1010901 | 3300003792 | Bacteria | 2984 |
| 20 | Ga0055531_10009365 | 3300003794 | Bacteria | 5013 |
| 21 | Ga0055531_10010163 | 3300003794 | Bacteria | 4716 |
| 22 | Ga0055543_1000020 | 3300004625 | Bacteria | 150535 |
| 23 | Ga0058861_10089271 | 3300004800 | Bacteria | 2492 |
| 24 | Ga0058862_10085905 | 3300004803 | Bacteria | 2023 |
| 25 | Ga0058862_12278394 | 3300004803 | Bacteria | 895 |
| 26 | Ga0065165_1000721 | 3300005262 | Bacteria | 46476 |
| 27 | Ga0065165_1002238 | 3300005262 | Bacteria | 17195 |
| 28 | Ga0065165_1008083 | 3300005262 | Bacteria | 5018 |
| 29 | Ga0065165_1022880 | 3300005262 | Bacteria | 2130 |
| 30 | Ga0065165_1023885 | 3300005262 | Bacteria | 2064 |
| 31 | Ga0065714_10005120 | 3300005288 | Bacteria | 4919 |
| 32 | Ga0065714_10010177 | 3300005288 | Bacteria | 2937 |
| 33 | Ga0065712_10181387 | 3300005290 | Bacteria | 1191 |
| 34 | Ga0065715_10010704 | 3300005293 | Bacteria | 2411 |
| 35 | Ga0065715_10021897 | 3300005293 | Bacteria | 1377 |
| 36 | Ga0065715_10307578 | 3300005293 | Bacteria | 1027 |
| 37 | Ga0065707_10027623 | 3300005295 | Bacteria | 1235 |
| 38 | Ga0070658_10046828 | 3300005327 | Bacteria | 3499 |
| 39 | Ga0070658_10054420 | 3300005327 | Bacteria | 3250 |
| 40 | Ga0070676_10005631 | 3300005328 | Bacteria | 6672 |
| 41 | Ga0070676_10252359 | 3300005328 | Bacteria | 1178 |
| 42 | Ga0070683_100000936 | 3300005329 | Bacteria | 21719 |
| 43 | Ga0070683_100008708 | 3300005329 | Bacteria | 8628 |
| 44 | Ga0070683_100109810 | 3300005329 | Bacteria | 2601 |
| 45 | Ga0070670_100059090 | 3300005331 | Bacteria | 3291 |
| 46 | Ga0068869_100043066 | 3300005334 | Bacteria | 3240 |
| 47 | Ga0068869_100449642 | 3300005334 | Bacteria | 1068 |
| 48 | Ga0070666_10014585 | 3300005335 | Bacteria | 5004 |
| 49 | Ga0070666_10136178 | 3300005335 | Bacteria | 1709 |
| 50 | Ga0070680_100252253 | 3300005336 | Bacteria | 1492 |
| 51 | Ga0070680_100437927 | 3300005336 | Bacteria | 1116 |
| 52 | Ga0068868_100000053 | 3300005338 | Bacteria | 65580 |
| 53 | Ga0068868_100012606 | 3300005338 | Bacteria | 6182 |
| 54 | Ga0068868_100028072 | 3300005338 | Bacteria | 4298 |
| 55 | Ga0068868_100091761 | 3300005338 | Bacteria | 2447 |
| 56 | Ga0070660_100019335 | 3300005339 | Bacteria | 4988 |
| 57 | Ga0070660_100043845 | 3300005339 | Bacteria | 3419 |
| 58 | Ga0070660_100353830 | 3300005339 | Bacteria | 1210 |
| 59 | Ga0070689_100160422 | 3300005340 | Bacteria | 1817 |
| 60 | Ga0070691_10046396 | 3300005341 | Bacteria | 2064 |
| 61 | Ga0070661_100024549 | 3300005344 | Bacteria | 4324 |
| 62 | Ga0070661_100077584 | 3300005344 | Bacteria | 2449 |
| 63 | Ga0070661_100116522 | 3300005344 | Bacteria | 1998 |
| 64 | Ga0070668_100002970 | 3300005347 | Bacteria | 12540 |
| 65 | Ga0070668_100010579 | 3300005347 | Bacteria | 6863 |
| 66 | Ga0070668_100033360 | 3300005347 | Bacteria | 3920 |
| 67 | Ga0070668_100093912 | 3300005347 | Bacteria | 2368 |
| 68 | Ga0070668_100259241 | 3300005347 | Bacteria | 1445 |
| 69 | Ga0070669_100003310 | 3300005353 | Bacteria | 11585 |
| 70 | Ga0070669_100439084 | 3300005353 | Bacteria | 1074 |
| 71 | Ga0070675_100018024 | 3300005354 | Bacteria | 5619 |
| 72 | Ga0070675_100028318 | 3300005354 | Bacteria | 4510 |
| 73 | Ga0070675_100371124 | 3300005354 | Bacteria | 1272 |
| 74 | Ga0070675_100372051 | 3300005354 | Bacteria | 1270 |
| 75 | Ga0070671_100267490 | 3300005355 | Bacteria | 1453 |
| 76 | Ga0070671_100268451 | 3300005355 | Bacteria | 1450 |
| 77 | Ga0070674_100004168 | 3300005356 | Bacteria | 8214 |
| 78 | Ga0070674_100020678 | 3300005356 | Bacteria | 4212 |
| 79 | Ga0070674_100089083 | 3300005356 | Bacteria | 2222 |
| 80 | Ga0070673_100000010 | 3300005364 | Bacteria | 153851 |
| 81 | Ga0070673_100058879 | 3300005364 | Bacteria | 3039 |
| 82 | Ga0070688_100132325 | 3300005365 | Bacteria | 1684 |
| 83 | Ga0070688_100174886 | 3300005365 | Bacteria | 1485 |
| 84 | Ga0070659_100041691 | 3300005366 | Bacteria | 3589 |
| 85 | Ga0070659_100077903 | 3300005366 | Bacteria | 2644 |
| 86 | Ga0070659_100166133 | 3300005366 | Bacteria | 1806 |
| 87 | Ga0070667_100048193 | 3300005367 | Bacteria | 3586 |
| 88 | Ga0070667_100186665 | 3300005367 | Bacteria | 1835 |
| 89 | Ga0070714_100054764 | 3300005435 | Bacteria | 3408 |
| 90 | Ga0070713_100050254 | 3300005436 | Bacteria | 3443 |
| 91 | Ga0070713_100463626 | 3300005436 | Bacteria | 1192 |
| 92 | Ga0070711_100057300 | 3300005439 | Bacteria | 2697 |
| 93 | Ga0070705_100141910 | 3300005440 | Bacteria | 1582 |
| 94 | Ga0070705_100156878 | 3300005440 | Bacteria | 1517 |
| 95 | Ga0070694_100170321 | 3300005444 | Bacteria | 1604 |
| 96 | Ga0070708_100045773 | 3300005445 | Bacteria | 3857 |
| 97 | Ga0070708_100049795 | 3300005445 | Bacteria | 3707 |
| 98 | Ga0070708_100396425 | 3300005445 | Bacteria | 1301 |
| 99 | Ga0070663_100037787 | 3300005455 | Bacteria | 3363 |
| 100 | Ga0070663_100124305 | 3300005455 | Bacteria | 1952 |
| 101 | Ga0070663_100188240 | 3300005455 | Bacteria | 1605 |
| 102 | Ga0070663_100222134 | 3300005455 | Bacteria | 1483 |
| 103 | Ga0070663_100270756 | 3300005455 | Bacteria | 1350 |
| 104 | Ga0070663_100368519 | 3300005455 | Bacteria | 1167 |
| 105 | Ga0070678_100059686 | 3300005456 | Bacteria | 2804 |
| 106 | Ga0070678_100074297 | 3300005456 | Bacteria | 2554 |
| 107 | Ga0070678_100217819 | 3300005456 | Bacteria | 1585 |
| 108 | Ga0070678_100267727 | 3300005456 | Bacteria | 1440 |
| 109 | Ga0070678_100619333 | 3300005456 | Bacteria | 968 |
| 110 | Ga0070662_100000224 | 3300005457 | Bacteria | 33436 |
| 111 | Ga0070662_100151896 | 3300005457 | Bacteria | 1804 |
| 112 | Ga0070662_100250519 | 3300005457 | Bacteria | 1423 |
| 113 | Ga0070662_100320490 | 3300005457 | Bacteria | 1264 |
| 114 | Ga0070662_100554960 | 3300005457 | Bacteria | 963 |
| 115 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 116 | Ga0068867_100031914 | 3300005459 | Bacteria | 3806 |
| 117 | Ga0070706_100029541 | 3300005467 | Bacteria | 5049 |
| 118 | Ga0070706_100243051 | 3300005467 | Bacteria | 1681 |
| 119 | Ga0070706_100248543 | 3300005467 | Bacteria | 1661 |
| 120 | Ga0070706_100380280 | 3300005467 | Bacteria | 1315 |
| 121 | Ga0070707_100236357 | 3300005468 | Bacteria | 1779 |
| 122 | Ga0070698_100094463 | 3300005471 | Bacteria | 2969 |
| 123 | Ga0070699_100002512 | 3300005518 | Bacteria | 16468 |
| 124 | Ga0070699_100055334 | 3300005518 | Bacteria | 3436 |
| 125 | Ga0070699_100068729 | 3300005518 | Bacteria | 3078 |
| 126 | Ga0070699_100276137 | 3300005518 | Bacteria | 1505 |
| 127 | Ga0070679_100165782 | 3300005530 | Bacteria | 2183 |
| 128 | Ga0070684_100019719 | 3300005535 | Bacteria | 5581 |
| 129 | Ga0070684_100032661 | 3300005535 | Bacteria | 4437 |
| 130 | Ga0070697_100046072 | 3300005536 | Bacteria | 3534 |
| 131 | Ga0070697_100268363 | 3300005536 | Bacteria | 1462 |
| 132 | Ga0068853_100193272 | 3300005539 | Bacteria | 1850 |
| 133 | Ga0070672_100011139 | 3300005543 | Bacteria | 6263 |
| 134 | Ga0070672_100088810 | 3300005543 | Bacteria | 2489 |
| 135 | Ga0070695_100067850 | 3300005545 | Bacteria | 2327 |
| 136 | Ga0070665_100126012 | 3300005548 | Bacteria | 2563 |
| 137 | Ga0070665_100306758 | 3300005548 | Bacteria | 1591 |
| 138 | Ga0070665_100316182 | 3300005548 | Bacteria | 1565 |
| 139 | Ga0070665_100629071 | 3300005548 | Bacteria | 1086 |
| 140 | Ga0070704_100100225 | 3300005549 | Bacteria | 2180 |
| 141 | Ga0068855_100341132 | 3300005563 | Bacteria | 1652 |
| 142 | Ga0068855_100388521 | 3300005563 | Bacteria | 1531 |
| 143 | Ga0070664_100041990 | 3300005564 | Bacteria | 3861 |
| 144 | Ga0070664_100050681 | 3300005564 | Bacteria | 3514 |
| 145 | Ga0068857_100017116 | 3300005577 | Bacteria | 6350 |
| 146 | Ga0068854_100489607 | 3300005578 | Bacteria | 1034 |
| 147 | Ga0070702_100116239 | 3300005615 | Bacteria | 1667 |
| 148 | Ga0068852_100080278 | 3300005616 | Bacteria | 2892 |
| 149 | Ga0068852_100213734 | 3300005616 | Bacteria | 1831 |
| 150 | Ga0068864_100008698 | 3300005618 | Bacteria | 8377 |
| 151 | Ga0068864_100343080 | 3300005618 | Bacteria | 1408 |
| 152 | Ga0068861_100002901 | 3300005719 | Bacteria | 11299 |
| 153 | Ga0068861_100018409 | 3300005719 | Bacteria | 4977 |
| 154 | Ga0068861_100083156 | 3300005719 | Bacteria | 2510 |
| 155 | Ga0068861_100088820 | 3300005719 | Bacteria | 2435 |
| 156 | Ga0068861_100498255 | 3300005719 | Bacteria | 1101 |
| 157 | Ga0068851_10038537 | 3300005834 | Bacteria | 2398 |
| 158 | Ga0068870_10000970 | 3300005840 | Bacteria | 11283 |
| 159 | Ga0068863_100075810 | 3300005841 | Bacteria | 3182 |
| 160 | Ga0068863_100134656 | 3300005841 | Bacteria | 2360 |
| 161 | Ga0068863_100147749 | 3300005841 | Bacteria | 2249 |
| 162 | Ga0068863_100204940 | 3300005841 | Bacteria | 1898 |
| 163 | Ga0068863_100229612 | 3300005841 | Bacteria | 1790 |
| 164 | Ga0068863_100251302 | 3300005841 | Bacteria | 1708 |
| 165 | Ga0068858_100025545 | 3300005842 | Bacteria | 5496 |
| 166 | Ga0068858_100042002 | 3300005842 | Bacteria | 4240 |
| 167 | Ga0068858_100056317 | 3300005842 | Bacteria | 3634 |
| 168 | Ga0068860_100006936 | 3300005843 | Bacteria | 11354 |
| 169 | Ga0068860_100049874 | 3300005843 | Bacteria | 3986 |
| 170 | Ga0068860_100061429 | 3300005843 | Bacteria | 3570 |
| 171 | Ga0068860_100212061 | 3300005843 | Bacteria | 1879 |
| 172 | Ga0068862_100000841 | 3300005844 | Bacteria | 30209 |
| 173 | Ga0068862_100079179 | 3300005844 | Bacteria | 2848 |
| 174 | Ga0081455_10001668 | 3300005937 | Bacteria | 26917 |
| 175 | Ga0081455_10005180 | 3300005937 | Bacteria | 14352 |
| 176 | Ga0081455_10006288 | 3300005937 | Bacteria | 12771 |
| 177 | Ga0081455_10049461 | 3300005937 | Bacteria | 3624 |
| 178 | Ga0081538_10096999 | 3300005981 | Bacteria | 1500 |
| 179 | Ga0081540_1000688 | 3300005983 | Bacteria | 31561 |
| 180 | Ga0081540_1000739 | 3300005983 | Bacteria | 30091 |
| 181 | Ga0081540_1047569 | 3300005983 | Bacteria | 2156 |
| 182 | Ga0081539_10001833 | 3300005985 | Bacteria | 33546 |
| 183 | Ga0075365_10029757 | 3300006038 | Bacteria | 3493 |
| 184 | Ga0075365_10064681 | 3300006038 | Bacteria | 2450 |
| 185 | Ga0075365_10079499 | 3300006038 | Bacteria | 2219 |
| 186 | Ga0075365_10090197 | 3300006038 | Bacteria | 2087 |
| 187 | Ga0075368_10100078 | 3300006042 | Bacteria | 1190 |
| 188 | Ga0075363_100033297 | 3300006048 | Bacteria | 2682 |
| 189 | Ga0075432_10015485 | 3300006058 | Bacteria | 2600 |
| 190 | Ga0070716_100078778 | 3300006173 | Bacteria | 1960 |
| 191 | Ga0070712_100138092 | 3300006175 | Bacteria | 1856 |
| 192 | Ga0070712_100174188 | 3300006175 | Bacteria | 1672 |
| 193 | Ga0070712_100207987 | 3300006175 | Bacteria | 1541 |
| 194 | Ga0070712_100258067 | 3300006175 | Bacteria | 1395 |
| 195 | Ga0075362_10000378 | 3300006177 | Bacteria | 12764 |
| 196 | Ga0075362_10013889 | 3300006177 | Bacteria | 3236 |
| 197 | Ga0075362_10076029 | 3300006177 | Bacteria | 1541 |
| 198 | Ga0075367_10024462 | 3300006178 | Bacteria | 3406 |
| 199 | Ga0075369_10005701 | 3300006186 | Bacteria | 4672 |
| 200 | Ga0075369_10049001 | 3300006186 | Bacteria | 1824 |
| 201 | Ga0075369_10071660 | 3300006186 | Bacteria | 1525 |
| 202 | Ga0075366_10027098 | 3300006195 | Bacteria | 3361 |
| 203 | Ga0075366_10222617 | 3300006195 | Bacteria | 1150 |
| 204 | Ga0097621_100030634 | 3300006237 | Bacteria | 4261 |
| 205 | Ga0068871_100021666 | 3300006358 | Bacteria | 4944 |
| 206 | Ga0068871_100060493 | 3300006358 | Bacteria | 3090 |
| 207 | Ga0075428_100019819 | 3300006844 | Bacteria | 7443 |
| 208 | Ga0075430_100018889 | 3300006846 | Bacteria | 5865 |
| 209 | Ga0075430_100045336 | 3300006846 | Bacteria | 3715 |
| 210 | Ga0075431_100018004 | 3300006847 | Bacteria | 7185 |
| 211 | Ga0075431_100073613 | 3300006847 | Bacteria | 3524 |
| 212 | Ga0075431_100140936 | 3300006847 | Bacteria | 2485 |
| 213 | Ga0075433_10000196 | 3300006852 | Bacteria | 34036 |
| 214 | Ga0075433_10002289 | 3300006852 | Bacteria | 14573 |
| 215 | Ga0075433_10231042 | 3300006852 | Bacteria | 1643 |
| 216 | Ga0075433_10441342 | 3300006852 | Bacteria | 1147 |
| 217 | Ga0075434_100002691 | 3300006871 | Bacteria | 15694 |
| 218 | Ga0075434_100032415 | 3300006871 | Bacteria | 5152 |
| 219 | Ga0075434_100036174 | 3300006871 | Bacteria | 4884 |
| 220 | Ga0075434_100043508 | 3300006871 | Bacteria | 4454 |
| 221 | Ga0075434_100173174 | 3300006871 | Bacteria | 2178 |
| 222 | Ga0075434_100223062 | 3300006871 | Bacteria | 1905 |
| 223 | Ga0075434_100376014 | 3300006871 | Bacteria | 1442 |
| 224 | Ga0075429_100014540 | 3300006880 | Bacteria | 6820 |
| 225 | Ga0075429_100079801 | 3300006880 | Bacteria | 2852 |
| 226 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 227 | Ga0068865_100482870 | 3300006881 | Bacteria | 1030 |
| 228 | Ga0075436_100001361 | 3300006914 | Bacteria | 16623 |
| 229 | Ga0099824_1021533 | 3300006942 | Bacteria | 4473 |
| 230 | Ga0075435_100013352 | 3300007076 | Bacteria | 6107 |
| 231 | Ga0075435_100033111 | 3300007076 | Bacteria | 4084 |
| 232 | Ga0075435_100054651 | 3300007076 | Bacteria | 3223 |
| 233 | Ga0075435_100097774 | 3300007076 | Bacteria | 2429 |
| 234 | Ga0099794_10021388 | 3300007265 | Bacteria | 2939 |
| 235 | Ga0099795_10011474 | 3300007788 | Bacteria | 2650 |
| 236 | Ga0105251_10011088 | 3300009011 | Bacteria | 5170 |
| 237 | Ga0105251_10030142 | 3300009011 | Bacteria | 2726 |
| 238 | Ga0105251_10066235 | 3300009011 | Bacteria | 1689 |
| 239 | Ga0105244_10011278 | 3300009036 | Bacteria | 5374 |
| 240 | Ga0105244_10033048 | 3300009036 | Bacteria | 2732 |
| 241 | Ga0105250_10004415 | 3300009092 | Bacteria | 6478 |
| 242 | Ga0105250_10022797 | 3300009092 | Bacteria | 2523 |
| 243 | Ga0105250_10031236 | 3300009092 | Bacteria | 2139 |
| 244 | Ga0105250_10069898 | 3300009092 | Bacteria | 1417 |
| 245 | Ga0105240_10001146 | 3300009093 | Bacteria | 46418 |
| 246 | Ga0105240_10150877 | 3300009093 | Bacteria | 2768 |
| 247 | Ga0111539_10042650 | 3300009094 | Bacteria | 5445 |
| 248 | Ga0111539_10097826 | 3300009094 | Bacteria | 3447 |
| 249 | Ga0111539_10310362 | 3300009094 | Bacteria | 1836 |
| 250 | Ga0105245_10000174 | 3300009098 | Bacteria | 61234 |
| 251 | Ga0105245_10079557 | 3300009098 | Bacteria | 2993 |
| 252 | Ga0105245_10165228 | 3300009098 | Bacteria | 2103 |
| 253 | Ga0105247_10052360 | 3300009101 | Bacteria | 2516 |
| 254 | Ga0105247_10188844 | 3300009101 | Bacteria | 1379 |
| 255 | Ga0114129_10032034 | 3300009147 | Bacteria | 7431 |
| 256 | Ga0114129_10037094 | 3300009147 | Bacteria | 6882 |
| 257 | Ga0114129_10119597 | 3300009147 | Bacteria | 3628 |
| 258 | Ga0114129_10125802 | 3300009147 | Bacteria | 3524 |
| 259 | Ga0114129_10128927 | 3300009147 | Bacteria | 3476 |
| 260 | Ga0114129_10327486 | 3300009147 | Bacteria | 2035 |
| 261 | Ga0114129_10525243 | 3300009147 | Bacteria | 1543 |
| 262 | Ga0105243_10000054 | 3300009148 | Bacteria | 136517 |
| 263 | Ga0105243_10000650 | 3300009148 | Bacteria | 34412 |
| 264 | Ga0105243_10161575 | 3300009148 | Bacteria | 1932 |
| 265 | Ga0105243_10245250 | 3300009148 | Bacteria | 1596 |
| 266 | Ga0105241_10027208 | 3300009174 | Bacteria | 4258 |
| 267 | Ga0105242_10000821 | 3300009176 | Bacteria | 24146 |
| 268 | Ga0105242_10215240 | 3300009176 | Bacteria | 1714 |
| 269 | Ga0105248_10006263 | 3300009177 | Bacteria | 13046 |
| 270 | Ga0105248_10006970 | 3300009177 | Bacteria | 12381 |
| 271 | Ga0105248_10021325 | 3300009177 | Bacteria | 7180 |
| 272 | Ga0105248_10646171 | 3300009177 | Bacteria | 1193 |
| 273 | Ga0105248_10839840 | 3300009177 | Bacteria | 1037 |
| 274 | Ga0105237_10041847 | 3300009545 | Bacteria | 4620 |
| 275 | Ga0105238_10329720 | 3300009551 | Bacteria | 1513 |
| 276 | Ga0105249_10000653 | 3300009553 | Bacteria | 31473 |
| 277 | Ga0105249_10009100 | 3300009553 | Bacteria | 8686 |
| 278 | Ga0105249_10066278 | 3300009553 | Bacteria | 3324 |
| 279 | Ga0105249_10224028 | 3300009553 | Bacteria | 1852 |
| 280 | Ga0105249_10227082 | 3300009553 | Bacteria | 1840 |
| 281 | Ga0105239_10063253 | 3300010375 | Bacteria | 4063 |
| 282 | Ga0105239_10077256 | 3300010375 | Bacteria | 3664 |
| 283 | Ga0105239_10081105 | 3300010375 | Bacteria | 3571 |
| 284 | Ga0105239_10106945 | 3300010375 | Bacteria | 3099 |
| 285 | Ga0105239_10131425 | 3300010375 | Bacteria | 2785 |
| 286 | Ga0105239_10156146 | 3300010375 | Bacteria | 2548 |
| 287 | Ga0105239_10204092 | 3300010375 | Bacteria | 2215 |
| 288 | Ga0105239_10424519 | 3300010375 | Bacteria | 1506 |
| 289 | Ga0105239_10518636 | 3300010375 | Bacteria | 1356 |
| 290 | Ga0105239_10743693 | 3300010375 | Bacteria | 1122 |
| 291 | Ga0105246_10001706 | 3300011119 | Bacteria | 13114 |
| 292 | Ga0157373_10250627 | 3300013100 | Bacteria | 1252 |
| 293 | Ga0157370_10051107 | 3300013104 | Bacteria | 3949 |
| 294 | Ga0157374_10000468 | 3300013296 | Bacteria | 36718 |
| 295 | Ga0157374_10037319 | 3300013296 | Bacteria | 4459 |
| 296 | Ga0157374_10083317 | 3300013296 | Bacteria | 3038 |
| 297 | Ga0157374_10211300 | 3300013296 | Bacteria | 1902 |
| 298 | Ga0157378_10000494 | 3300013297 | Bacteria | 37394 |
| 299 | Ga0157378_10108212 | 3300013297 | Bacteria | 2545 |
| 300 | Ga0157378_10122492 | 3300013297 | Bacteria | 2399 |
| 301 | Ga0157378_10236269 | 3300013297 | Bacteria | 1744 |
| 302 | Ga0163162_10002044 | 3300013306 | Bacteria | 18979 |
| 303 | Ga0163162_10004882 | 3300013306 | Bacteria | 12932 |
| 304 | Ga0163162_10266217 | 3300013306 | Bacteria | 1845 |
| 305 | Ga0163162_10296879 | 3300013306 | Bacteria | 1747 |
| 306 | Ga0163162_10306192 | 3300013306 | Bacteria | 1721 |
| 307 | Ga0163162_10458275 | 3300013306 | Bacteria | 1407 |
| 308 | Ga0157372_10006245 | 3300013307 | Bacteria | 12672 |
| 309 | Ga0157372_10152027 | 3300013307 | Bacteria | 2672 |
| 310 | Ga0157375_10000306 | 3300013308 | Bacteria | 44319 |
| 311 | Ga0157375_10009201 | 3300013308 | Bacteria | 8660 |
| 312 | Ga0157375_10088941 | 3300013308 | Bacteria | 3144 |
| 313 | Ga0157375_10153199 | 3300013308 | Bacteria | 2442 |
| 314 | Ga0157375_10219430 | 3300013308 | Bacteria | 2060 |
| 315 | Ga0163163_10015523 | 3300014325 | Bacteria | 7042 |
| 316 | Ga0163163_10072523 | 3300014325 | Bacteria | 3433 |
| 317 | Ga0163163_10270509 | 3300014325 | Bacteria | 1751 |
| 318 | Ga0163163_10332917 | 3300014325 | Bacteria | 1573 |
| 319 | Ga0163163_10476867 | 3300014325 | Bacteria | 1308 |
| 320 | Ga0157380_10103397 | 3300014326 | Bacteria | 2377 |
| 321 | Ga0157380_10505086 | 3300014326 | Bacteria | 1175 |
| 322 | Ga0182008_10004732 | 3300014497 | Bacteria | 7887 |
| 323 | Ga0157377_10051614 | 3300014745 | Bacteria | 2320 |
| 324 | Ga0157377_10061106 | 3300014745 | Bacteria | 2152 |
| 325 | Ga0157377_10102716 | 3300014745 | Bacteria | 1706 |
| 326 | Ga0157379_10000589 | 3300014968 | Bacteria | 29397 |
| 327 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 328 | Ga0157376_10029686 | 3300014969 | Bacteria | 4358 |
| 329 | Ga0157376_10079589 | 3300014969 | Bacteria | 2809 |
| 330 | Ga0157376_10126954 | 3300014969 | Bacteria | 2270 |
| 331 | Ga0157376_10129146 | 3300014969 | Bacteria | 2252 |
| 332 | Ga0157376_10374350 | 3300014969 | Bacteria | 1370 |
| 333 | Ga0157376_10483416 | 3300014969 | Bacteria | 1214 |
| 334 | Ga0157376_10724175 | 3300014969 | Bacteria | 1002 |
| 335 | Ga0163161_10002676 | 3300017792 | Bacteria | 12659 |
| 336 | Ga0163161_10011963 | 3300017792 | Bacteria | 6020 |
| 337 | Ga0163161_10048757 | 3300017792 | Bacteria | 3059 |
| 338 | Ga0163161_10163935 | 3300017792 | Bacteria | 1696 |
| 339 | Ga0206351_10413641 | 3300020077 | Bacteria | 2894 |
| 340 | Ga0206352_10167672 | 3300020078 | Bacteria | 921 |
| 341 | Ga0206353_10230641 | 3300020082 | Bacteria | 871 |
| 342 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 343 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 344 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 345 | Ga0213872_10031678 | 3300021361 | Bacteria | 2424 |
| 346 | Ga0213874_10027830 | 3300021377 | Bacteria | 1611 |
| 347 | Ga0213874_10051968 | 3300021377 | Bacteria | 1260 |
| 348 | Ga0213876_10000830 | 3300021384 | Bacteria | 20830 |
| 349 | Ga0213876_10153108 | 3300021384 | Bacteria | 1226 |
| 350 | Ga0213871_10003523 | 3300021441 | Bacteria | 3028 |
| 351 | Ga0224572_1006262 | 3300024225 | Bacteria | 2148 |
| 352 | Ga0209436_100095 | 3300025208 | Bacteria | 43584 |
| 353 | Ga0209147_100037 | 3300025229 | Bacteria | 326977 |
| 354 | Ga0209563_102659 | 3300025230 | Bacteria | 3957 |
| 355 | Ga0207427_100044 | 3300025231 | Bacteria | 242623 |
| 356 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 357 | Ga0207425_1005829 | 3300025245 | Bacteria | 3451 |
| 358 | Ga0209677_103672 | 3300025253 | Bacteria | 4826 |
| 359 | Ga0209148_1000216 | 3300025254 | Bacteria | 98209 |
| 360 | Ga0209129_1000449 | 3300025258 | Bacteria | 30679 |
| 361 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 362 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 363 | Ga0209233_1026747 | 3300025261 | Bacteria | 1406 |
| 364 | Ga0209455_1004148 | 3300025272 | Bacteria | 4850 |
| 365 | Ga0209673_1022298 | 3300025273 | Bacteria | 2188 |
| 366 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 367 | Ga0209675_1001965 | 3300025291 | Bacteria | 11055 |
| 368 | Ga0209676_1000102 | 3300025292 | Bacteria | 227372 |
| 369 | Ga0209564_1000630 | 3300025295 | Bacteria | 53795 |
| 370 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 371 | Ga0209758_1000161 | 3300025297 | Bacteria | 154278 |
| 372 | Ga0209758_1000523 | 3300025297 | Bacteria | 61460 |
| 373 | Ga0209758_1000673 | 3300025297 | Bacteria | 51032 |
| 374 | Ga0209758_1001304 | 3300025297 | Bacteria | 30476 |
| 375 | Ga0209758_1002531 | 3300025297 | Bacteria | 18469 |
| 376 | Ga0209758_1012357 | 3300025297 | Bacteria | 4789 |
| 377 | Ga0209050_1000105 | 3300025298 | Bacteria | 227285 |
| 378 | Ga0209256_1004503 | 3300025299 | Bacteria | 8706 |
| 379 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 380 | Ga0207426_1000103 | 3300025302 | Bacteria | 250320 |
| 381 | Ga0207426_1000186 | 3300025302 | Bacteria | 154130 |
| 382 | Ga0207426_1001117 | 3300025302 | Bacteria | 24608 |
| 383 | Ga0207426_1006768 | 3300025302 | Bacteria | 4910 |
| 384 | Ga0207426_1031513 | 3300025302 | Bacteria | 1729 |
| 385 | Ga0209051_1000066 | 3300025303 | Bacteria | 227369 |
| 386 | Ga0209051_1000842 | 3300025303 | Bacteria | 31590 |
| 387 | Ga0209051_1069682 | 3300025303 | Bacteria | 1064 |
| 388 | Ga0209257_1000124 | 3300025304 | Bacteria | 218195 |
| 389 | Ga0209257_1004161 | 3300025304 | Bacteria | 11487 |
| 390 | Ga0209257_1012222 | 3300025304 | Bacteria | 4003 |
| 391 | Ga0209257_1014736 | 3300025304 | Bacteria | 3326 |
| 392 | Ga0207697_10079172 | 3300025315 | Bacteria | 1384 |
| 393 | Ga0207656_10027517 | 3300025321 | Bacteria | 2326 |
| 394 | Ga0207696_1001307 | 3300025711 | Bacteria | 13771 |
| 395 | Ga0207696_1004904 | 3300025711 | Bacteria | 5667 |
| 396 | Ga0207696_1019321 | 3300025711 | Bacteria | 2221 |
| 397 | Ga0207696_1021538 | 3300025711 | Bacteria | 2062 |
| 398 | Ga0207655_1000219 | 3300025728 | Bacteria | 98533 |
| 399 | Ga0207655_1003812 | 3300025728 | Bacteria | 11000 |
| 400 | Ga0207655_1019209 | 3300025728 | Bacteria | 3585 |
| 401 | Ga0207713_1001250 | 3300025735 | Bacteria | 21045 |
| 402 | Ga0207713_1005534 | 3300025735 | Bacteria | 7878 |
| 403 | Ga0207713_1011327 | 3300025735 | Bacteria | 4860 |
| 404 | Ga0207713_1014629 | 3300025735 | Bacteria | 4064 |
| 405 | Ga0207713_1029292 | 3300025735 | Bacteria | 2468 |
| 406 | Ga0207713_1071712 | 3300025735 | Bacteria | 1277 |
| 407 | Ga0207682_10017983 | 3300025893 | Bacteria | 2760 |
| 408 | Ga0207642_10070238 | 3300025899 | Bacteria | 1664 |
| 409 | Ga0207710_10096455 | 3300025900 | Bacteria | 1391 |
| 410 | Ga0207688_10033993 | 3300025901 | Bacteria | 2822 |
| 411 | Ga0207688_10118132 | 3300025901 | Bacteria | 1545 |
| 412 | Ga0207680_10051832 | 3300025903 | Bacteria | 2456 |
| 413 | Ga0207685_10022593 | 3300025905 | Bacteria | 2129 |
| 414 | Ga0207685_10081903 | 3300025905 | Bacteria | 1338 |
| 415 | Ga0207645_10002621 | 3300025907 | Bacteria | 14025 |
| 416 | Ga0207645_10079516 | 3300025907 | Bacteria | 2102 |
| 417 | Ga0207643_10001722 | 3300025908 | Bacteria | 12265 |
| 418 | Ga0207643_10145151 | 3300025908 | Bacteria | 1419 |
| 419 | Ga0207705_10078789 | 3300025909 | Bacteria | 2399 |
| 420 | Ga0207705_10121776 | 3300025909 | Bacteria | 1936 |
| 421 | Ga0207684_10000551 | 3300025910 | Bacteria | 46114 |
| 422 | Ga0207684_10240802 | 3300025910 | Bacteria | 1561 |
| 423 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 424 | Ga0207695_10029049 | 3300025913 | Bacteria | 6119 |
| 425 | Ga0207695_10107951 | 3300025913 | Bacteria | 2768 |
| 426 | Ga0207695_10134837 | 3300025913 | Bacteria | 2423 |
| 427 | Ga0207671_10001982 | 3300025914 | Bacteria | 22573 |
| 428 | Ga0207671_10245185 | 3300025914 | Bacteria | 1408 |
| 429 | Ga0207671_10405747 | 3300025914 | Bacteria | 1084 |
| 430 | Ga0207693_10092501 | 3300025915 | Bacteria | 2370 |
| 431 | Ga0207693_10165227 | 3300025915 | Bacteria | 1742 |
| 432 | Ga0207693_10186568 | 3300025915 | Bacteria | 1632 |
| 433 | Ga0207693_10300660 | 3300025915 | Bacteria | 1257 |
| 434 | Ga0207663_10005081 | 3300025916 | Bacteria | 6606 |
| 435 | Ga0207663_10014189 | 3300025916 | Bacteria | 4354 |
| 436 | Ga0207657_10015056 | 3300025919 | Bacteria | 7511 |
| 437 | Ga0207657_10020505 | 3300025919 | Bacteria | 6244 |
| 438 | Ga0207657_10301289 | 3300025919 | Bacteria | 1269 |
| 439 | Ga0207649_10118716 | 3300025920 | Bacteria | 1780 |
| 440 | Ga0207646_10136484 | 3300025922 | Bacteria | 2209 |
| 441 | Ga0207681_10015796 | 3300025923 | Bacteria | 4713 |
| 442 | Ga0207681_10016589 | 3300025923 | Bacteria | 4609 |
| 443 | Ga0207650_10001184 | 3300025925 | Bacteria | 19164 |
| 444 | Ga0207650_10336880 | 3300025925 | Bacteria | 1238 |
| 445 | Ga0207650_10419538 | 3300025925 | Bacteria | 1110 |
| 446 | Ga0207659_10066989 | 3300025926 | Bacteria | 2607 |
| 447 | Ga0207659_10072643 | 3300025926 | Bacteria | 2516 |
| 448 | Ga0207659_10088213 | 3300025926 | Bacteria | 2310 |
| 449 | Ga0207687_10003479 | 3300025927 | Bacteria | 10598 |
| 450 | Ga0207687_10067976 | 3300025927 | Bacteria | 2537 |
| 451 | Ga0207687_10320104 | 3300025927 | Bacteria | 1255 |
| 452 | Ga0207687_10574693 | 3300025927 | Bacteria | 948 |
| 453 | Ga0207700_10276746 | 3300025928 | Bacteria | 1442 |
| 454 | Ga0207664_10004030 | 3300025929 | Bacteria | 9905 |
| 455 | Ga0207664_10004183 | 3300025929 | Bacteria | 9751 |
| 456 | Ga0207644_10117485 | 3300025931 | Bacteria | 2020 |
| 457 | Ga0207644_10139220 | 3300025931 | Bacteria | 1867 |
| 458 | Ga0207644_10172231 | 3300025931 | Bacteria | 1691 |
| 459 | Ga0207690_10040648 | 3300025932 | Bacteria | 3042 |
| 460 | Ga0207690_10603417 | 3300025932 | Bacteria | 896 |
| 461 | Ga0207706_10000099 | 3300025933 | Bacteria | 90874 |
| 462 | Ga0207706_10074400 | 3300025933 | Bacteria | 2987 |
| 463 | Ga0207706_10144932 | 3300025933 | Bacteria | 2089 |
| 464 | Ga0207706_10146563 | 3300025933 | Bacteria | 2076 |
| 465 | Ga0207706_10455101 | 3300025933 | Bacteria | 1107 |
| 466 | Ga0207686_10000556 | 3300025934 | Bacteria | 24000 |
| 467 | Ga0207686_10092823 | 3300025934 | Bacteria | 1997 |
| 468 | Ga0207686_10533616 | 3300025934 | Bacteria | 915 |
| 469 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 470 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 471 | Ga0207709_10157812 | 3300025935 | Bacteria | 1579 |
| 472 | Ga0207669_10172641 | 3300025937 | Bacteria | 1541 |
| 473 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 474 | Ga0207704_10241666 | 3300025938 | Bacteria | 1350 |
| 475 | Ga0207704_10251728 | 3300025938 | Bacteria | 1326 |
| 476 | Ga0207704_10558423 | 3300025938 | Bacteria | 931 |
| 477 | Ga0207704_10617928 | 3300025938 | Bacteria | 889 |
| 478 | Ga0207665_10057439 | 3300025939 | Bacteria | 2629 |
| 479 | Ga0207691_10019910 | 3300025940 | Bacteria | 6347 |
| 480 | Ga0207691_10084660 | 3300025940 | Bacteria | 2846 |
| 481 | Ga0207711_10008722 | 3300025941 | Bacteria | 8478 |
| 482 | Ga0207711_10033578 | 3300025941 | Bacteria | 4343 |
| 483 | Ga0207711_10044828 | 3300025941 | Bacteria | 3777 |
| 484 | Ga0207711_10151681 | 3300025941 | Bacteria | 2092 |
| 485 | Ga0207711_10156504 | 3300025941 | Bacteria | 2060 |
| 486 | Ga0207711_10178488 | 3300025941 | Bacteria | 1930 |
| 487 | Ga0207711_10465869 | 3300025941 | Bacteria | 1177 |
| 488 | Ga0207711_10676638 | 3300025941 | Bacteria | 963 |
| 489 | Ga0207689_10000268 | 3300025942 | Bacteria | 47140 |
| 490 | Ga0207689_10102081 | 3300025942 | Bacteria | 2356 |
| 491 | Ga0207689_10182450 | 3300025942 | Bacteria | 1731 |
| 492 | Ga0207661_10004116 | 3300025944 | Bacteria | 10164 |
| 493 | Ga0207661_10126476 | 3300025944 | Bacteria | 2183 |
| 494 | Ga0207679_10026618 | 3300025945 | Bacteria | 3990 |
| 495 | Ga0207679_10042358 | 3300025945 | Bacteria | 3272 |
| 496 | Ga0207679_10124704 | 3300025945 | Bacteria | 2056 |
| 497 | Ga0207667_10202935 | 3300025949 | Bacteria | 2034 |
| 498 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 499 | Ga0207651_10036256 | 3300025960 | Bacteria | 3217 |
| 500 | Ga0207712_10000766 | 3300025961 | Bacteria | 24134 |
| 501 | Ga0207712_10059303 | 3300025961 | Bacteria | 2708 |
| 502 | Ga0207668_10001482 | 3300025972 | Bacteria | 13734 |
| 503 | Ga0207668_10025322 | 3300025972 | Bacteria | 3838 |
| 504 | Ga0207668_10187986 | 3300025972 | Bacteria | 1634 |
| 505 | Ga0207640_10264089 | 3300025981 | Bacteria | 1343 |
| 506 | Ga0207640_10350821 | 3300025981 | Bacteria | 1185 |
| 507 | Ga0207658_10259166 | 3300025986 | Bacteria | 1481 |
| 508 | Ga0207658_10419075 | 3300025986 | Bacteria | 1180 |
| 509 | Ga0207658_10432943 | 3300025986 | Bacteria | 1162 |
| 510 | Ga0207677_10000094 | 3300026023 | Bacteria | 73172 |
| 511 | Ga0207677_10736984 | 3300026023 | Bacteria | 877 |
| 512 | Ga0207703_10022818 | 3300026035 | Bacteria | 4916 |
| 513 | Ga0207703_10128817 | 3300026035 | Bacteria | 2182 |
| 514 | Ga0207703_10244529 | 3300026035 | Bacteria | 1614 |
| 515 | Ga0207639_10275045 | 3300026041 | Bacteria | 1479 |
| 516 | Ga0207639_10284319 | 3300026041 | Bacteria | 1456 |
| 517 | Ga0207678_10004996 | 3300026067 | Bacteria | 11889 |
| 518 | Ga0207678_10030395 | 3300026067 | Bacteria | 4716 |
| 519 | Ga0207678_10035091 | 3300026067 | Bacteria | 4367 |
| 520 | Ga0207678_10143463 | 3300026067 | Bacteria | 2038 |
| 521 | Ga0207678_10144100 | 3300026067 | Bacteria | 2033 |
| 522 | Ga0207678_10153886 | 3300026067 | Bacteria | 1963 |
| 523 | Ga0207678_10167776 | 3300026067 | Bacteria | 1874 |
| 524 | Ga0207708_10035930 | 3300026075 | Bacteria | 3770 |
| 525 | Ga0207702_10004466 | 3300026078 | Bacteria | 12430 |
| 526 | Ga0207702_10633823 | 3300026078 | Bacteria | 1051 |
| 527 | Ga0207641_10058824 | 3300026088 | Bacteria | 3272 |
| 528 | Ga0207641_10067525 | 3300026088 | Bacteria | 3063 |
| 529 | Ga0207641_10095784 | 3300026088 | Bacteria | 2606 |
| 530 | Ga0207641_10169684 | 3300026088 | Bacteria | 1990 |
| 531 | Ga0207641_10229583 | 3300026088 | Bacteria | 1724 |
| 532 | Ga0207641_10329544 | 3300026088 | Bacteria | 1450 |
| 533 | Ga0207641_10588017 | 3300026088 | Bacteria | 1089 |
| 534 | Ga0207641_10660400 | 3300026088 | Bacteria | 1027 |
| 535 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 536 | Ga0207648_10056899 | 3300026089 | Bacteria | 3412 |
| 537 | Ga0207648_10352691 | 3300026089 | Bacteria | 1326 |
| 538 | Ga0207676_10019547 | 3300026095 | Bacteria | 4944 |
| 539 | Ga0207674_10015782 | 3300026116 | Bacteria | 8284 |
| 540 | Ga0207675_100000743 | 3300026118 | Bacteria | 32405 |
| 541 | Ga0207675_100111244 | 3300026118 | Bacteria | 2584 |
| 542 | Ga0207675_100122674 | 3300026118 | Bacteria | 2460 |
| 543 | Ga0207675_100129842 | 3300026118 | Bacteria | 2389 |
| 544 | Ga0207675_100459009 | 3300026118 | Bacteria | 1263 |
| 545 | Ga0207675_100824362 | 3300026118 | Bacteria | 942 |
| 546 | Ga0207683_10001266 | 3300026121 | Bacteria | 22940 |
| 547 | Ga0207683_10003380 | 3300026121 | Bacteria | 13917 |
| 548 | Ga0207683_10246292 | 3300026121 | Bacteria | 1630 |
| 549 | Ga0207683_10349685 | 3300026121 | Bacteria | 1356 |
| 550 | Ga0207698_10025077 | 3300026142 | Bacteria | 4194 |
| 551 | Ga0209389_1000440 | 3300027296 | Bacteria | 24698 |
| 552 | Ga0209589_1014238 | 3300027357 | Bacteria | 10051 |
| 553 | Ga0209489_104739 | 3300027361 | Bacteria | 24698 |
| 554 | Ga0209813_10061358 | 3300027866 | Bacteria | 1200 |
| 555 | Ga0209813_10061471 | 3300027866 | Bacteria | 1200 |
| 556 | Ga0207428_10002358 | 3300027907 | Bacteria | 18868 |
| 557 | Ga0207428_10009941 | 3300027907 | Bacteria | 8522 |
| 558 | Ga0207428_10040710 | 3300027907 | Bacteria | 3766 |
| 559 | Ga0207428_10220291 | 3300027907 | Bacteria | 1423 |
| 560 | Ga0268266_10003810 | 3300028379 | Bacteria | 14752 |
| 561 | Ga0268266_10137464 | 3300028379 | Bacteria | 2190 |
| 562 | Ga0268266_10258496 | 3300028379 | Bacteria | 1613 |
| 563 | Ga0268266_10343456 | 3300028379 | Bacteria | 1401 |
| 564 | Ga0268266_10383920 | 3300028379 | Bacteria | 1325 |
| 565 | Ga0268266_10543218 | 3300028379 | Bacteria | 1113 |
| 566 | Ga0268266_10605913 | 3300028379 | Bacteria | 1052 |
| 567 | Ga0268265_10014015 | 3300028380 | Bacteria | 5460 |
| 568 | Ga0268265_10038111 | 3300028380 | Bacteria | 3533 |
| 569 | Ga0268264_10051634 | 3300028381 | Bacteria | 3427 |
| 570 | Ga0268264_10078589 | 3300028381 | Bacteria | 2813 |
| 571 | Ga0268264_10129884 | 3300028381 | Bacteria | 2231 |
| 572 | Ga0268264_10201667 | 3300028381 | Bacteria | 1820 |
| 573 | Ga0265337_1003252 | 3300028556 | Bacteria | 7098 |
| 574 | Ga0265326_10008080 | 3300028558 | Bacteria | 3190 |
| 575 | Ga0265319_1002546 | 3300028563 | Bacteria | 9870 |
| 576 | Ga0265318_10001843 | 3300028577 | Bacteria | 11984 |
| 577 | Ga0265323_10000460 | 3300028653 | Bacteria | 23089 |
| 578 | Ga0265322_10003769 | 3300028654 | Bacteria | 4558 |
| 579 | Ga0265336_10000496 | 3300028666 | Bacteria | 23032 |
| 580 | Ga0307515_10108806 | 3300028794 | Bacteria | 3262 |
| 581 | Ga0307515_10221083 | 3300028794 | Bacteria | 1712 |
| 582 | Ga0265338_10000207 | 3300028800 | Bacteria | 110193 |
| 583 | Ga0265324_10001132 | 3300029957 | Bacteria | 15986 |
| 584 | Ga0265760_10006688 | 3300031090 | Bacteria | 3301 |
| 585 | Ga0265332_10130299 | 3300031238 | Bacteria | 1055 |
| 586 | Ga0265325_10003746 | 3300031241 | Bacteria | 9820 |
| 587 | Ga0265339_10025802 | 3300031249 | Bacteria | 3369 |
| 588 | Ga0265331_10015560 | 3300031250 | Bacteria | 4013 |
| 589 | Ga0307513_10095445 | 3300031456 | Bacteria | 3015 |
| 590 | Ga0307509_10073298 | 3300031507 | Bacteria | 3565 |
| 591 | Ga0307408_100002600 | 3300031548 | Bacteria | 12569 |
| 592 | Ga0307408_100153860 | 3300031548 | Bacteria | 1818 |
| 593 | Ga0265313_10109740 | 3300031595 | Bacteria | 1214 |
| 594 | Ga0307508_10264534 | 3300031616 | Bacteria | 1314 |
| 595 | Ga0307508_10290235 | 3300031616 | Bacteria | 1229 |
| 596 | Ga0265314_10084887 | 3300031711 | Bacteria | 2077 |
| 597 | Ga0307405_10086090 | 3300031731 | Bacteria | 2068 |
| 598 | Ga0307405_10123495 | 3300031731 | Bacteria | 1776 |
| 599 | Ga0307413_10032230 | 3300031824 | Bacteria | 2968 |
| 600 | Ga0307413_10368857 | 3300031824 | Bacteria | 1114 |
| 601 | Ga0307518_10162193 | 3300031838 | Bacteria | 1535 |
| 602 | Ga0307410_10002012 | 3300031852 | Bacteria | 9588 |
| 603 | Ga0307406_10332970 | 3300031901 | Bacteria | 1179 |
| 604 | Ga0307412_10167187 | 3300031911 | Bacteria | 1641 |
| 605 | Ga0307412_10293696 | 3300031911 | Bacteria | 1281 |
| 606 | Ga0307409_100019897 | 3300031995 | Bacteria | 4559 |
| 607 | Ga0307409_100021452 | 3300031995 | Bacteria | 4429 |
| 608 | Ga0307409_100076356 | 3300031995 | Bacteria | 2686 |
| 609 | Ga0307416_100085731 | 3300032002 | Bacteria | 2682 |
| 610 | Ga0307416_100378134 | 3300032002 | Bacteria | 1445 |
| 611 | Ga0307411_10117923 | 3300032005 | Bacteria | 1914 |
| 612 | Ga0307415_100587128 | 3300032126 | Bacteria | 989 |
| 613 | Ga0307415_100771093 | 3300032126 | Bacteria | 875 |
| 614 | Ga0307510_10000010 | 3300033180 | Bacteria | 377457 |
| 615 | Ga0307510_10002425 | 3300033180 | Bacteria | 21169 |
| 616 | Ga0307510_10031827 | 3300033180 | Bacteria | 5949 |
| 617 | Ga0307510_10136414 | 3300033180 | Bacteria | 2110 |
| 618 | Ga0315911_1000017 | 3300033442 | Bacteria | 161609 |
| 619 | Ga0316215_1003916 | 3300033544 | Bacteria | 1424 |
| 620 | Ga0373950_0022648 | 3300034818 | Bacteria | 1119 |
| 621 | Ga0373940_0022910 | 3300035088 | Bacteria | 1608 |
| 622 | Ga0373940_0037550 | 3300035088 | Bacteria | 1319 |
| 623 | Ga0373923_0007823 | 3300035111 | Bacteria | 3777 |
| 624 | Ga0373936_0025520 | 3300035113 | Bacteria | 2311 |
| 625 | Ga0373954_0061010 | 3300035118 | Bacteria | 1779 |
| 626 | Ga0373954_0068969 | 3300035118 | Bacteria | 1678 |
| 627 | Ga0373956_0000975 | 3300035119 | Bacteria | 11900 |
| 628 | Ga0373957_0004073 | 3300035120 | Bacteria | 4405 |
| 629 | Ga0373957_0012267 | 3300035120 | Bacteria | 2880 |
| 630 | Ga0373960_0024655 | 3300035121 | Bacteria | 1629 |
| 631 | Ga0373943_0003909 | 3300035170 | Bacteria | 6783 |
| 632 | Ga0373946_0080865 | 3300035171 | Bacteria | 1422 |
| 633 | Ga0373955_0005613 | 3300035172 | Bacteria | 5644 |
| 634 | Ga0373955_0087939 | 3300035172 | Bacteria | 1766 |
| 635 | Ga0373924_0031466 | 3300035410 | Bacteria | 2134 |
| 636 | Ga0373924_0032874 | 3300035410 | Bacteria | 2091 |
| 637 | Ga0373931_0028816 | 3300035691 | Bacteria | 2847 |
| 638 | Ga0373931_0029512 | 3300035691 | Bacteria | 2816 |
| 639 | Ga0373935_0030339 | 3300035692 | Bacteria | 3350 |
| 640 | Ga0373935_0038926 | 3300035692 | Bacteria | 2979 |
| 641 | Ga0373935_0095961 | 3300035692 | Bacteria | 1948 |
| 642 | Ga0373933_0063572 | 3300035724 | Bacteria | 2231 |
| 643 | Ga0373933_0110245 | 3300035724 | Bacteria | 1716 |
| 644 | Ga0373947_0306169 | 3300035725 | Bacteria | 1060 |
| 645 | Ga0373937_0049532 | 3300036401 | Bacteria | 3846 |
| 646 | Ga0373937_0168741 | 3300036401 | Bacteria | 2053 |
| 647 | Ga0373937_0569882 | 3300036401 | Bacteria | 1075 |
| 648 | Ga0373925_0073646 | 3300037068 | Bacteria | 2585 |
| 649 | Ga0373925_0354679 | 3300037068 | Bacteria | 1191 |
| 650 | Ga0395900_0067574 | 3300037418 | Bacteria | 3672 |
| 651 | Ga0395900_0072770 | 3300037418 | Bacteria | 3533 |
| 652 | Ga0395900_0094148 | 3300037418 | Bacteria | 3077 |
| 653 | Ga0395900_0189853 | 3300037418 | Bacteria | 2085 |
| 654 | Ga0395898_0008708 | 3300037466 | Bacteria | 10706 |
| 655 | Ga0395898_0034738 | 3300037466 | Bacteria | 5019 |
| 656 | Ga0395898_0056803 | 3300037466 | Bacteria | 3814 |
| 657 | Ga0395898_0141503 | 3300037466 | Bacteria | 2303 |
| 658 | Ga0395898_0413047 | 3300037466 | Bacteria | 1286 |
| 659 | Ga0395898_0583670 | 3300037466 | Bacteria | 1060 |
| 660 | Ga0395898_0585390 | 3300037466 | Bacteria | 1058 |
| 661 | Ga0395898_0723277 | 3300037466 | Bacteria | 937 |
| 662 | Ga0395905_0051031 | 3300037471 | Bacteria | 3874 |
| 663 | Ga0395905_0159776 | 3300037471 | Bacteria | 2118 |
| 664 | Ga0395905_0197190 | 3300037471 | Bacteria | 1888 |
| 665 | Ga0436364_0450606 | 3300037853 | Bacteria | 9715 |
| 666 | Ga0436364_1354805 | 3300037853 | Bacteria | 1560 |
| 667 | Ga0436364_1478902 | 3300037853 | Bacteria | 2634 |
| 668 | Ga0395901_0035212 | 3300038443 | Bacteria | 5173 |
| 669 | Ga0395901_0081439 | 3300038443 | Bacteria | 3381 |
| 670 | Ga0395901_0104579 | 3300038443 | Bacteria | 2971 |
| 671 | Ga0395901_0313904 | 3300038443 | Bacteria | 1623 |
| 672 | Ga0395901_0423159 | 3300038443 | Bacteria | 1365 |
| 673 | Ga0395901_0641588 | 3300038443 | Bacteria | 1066 |
| 674 | Ga0395901_0851711 | 3300038443 | Bacteria | 897 |
| 675 | Ga0436365_0421020 | 3300039437 | Bacteria | 15417 |
| 676 | Ga0436365_0584558 | 3300039437 | Bacteria | 1694 |
| 677 | Ga0436365_1571889 | 3300039437 | Bacteria | 1297 |
| 678 | Ga0436360_0531402 | 3300039438 | Bacteria | 3545 |
| 679 | Ga0436360_0608758 | 3300039438 | Bacteria | 5905 |
| 680 | Ga0436361_0279311 | 3300039447 | Bacteria | 1961 |
| 681 | Ga0436361_0795914 | 3300039447 | Bacteria | 15178 |
| 682 | Ga0436363_0108190 | 3300039450 | Bacteria | 3336 |
| 683 | Ga0436363_0115736 | 3300039450 | Bacteria | 1819 |
| 684 | Ga0436362_0133091 | 3300039453 | Bacteria | 6169 |
| 685 | Ga0436362_0392491 | 3300039453 | Bacteria | 16385 |
| 686 | Ga0436362_0462054 | 3300039453 | Bacteria | 13636 |
| 687 | Ga0439436_0029214 | 3300041404 | Bacteria | 1606 |
| 688 | Ga0439438_000188 | 3300041405 | Bacteria | 27781 |
| 689 | Ga0439438_021439 | 3300041405 | Bacteria | 1801 |
| 690 | Ga0439438_024445 | 3300041405 | Bacteria | 1654 |
| 691 | Ga0439447_000289 | 3300041407 | Bacteria | 17867 |
| 692 | Ga0439447_044189 | 3300041407 | Bacteria | 1078 |
| 693 | Ga0439466_0001316 | 3300041411 | Bacteria | 9680 |
| 694 | Ga0439466_0009307 | 3300041411 | Bacteria | 3675 |
| 695 | Ga0439466_0056601 | 3300041411 | Bacteria | 1272 |
| 696 | Ga0439465_0028217 | 3300041413 | Bacteria | 1779 |
| 697 | Ga0451833_1484977 | 3300041491 | Bacteria | 1735 |
| 698 | Ga0439441_008523 | 3300042001 | Bacteria | 1678 |
| 699 | Ga0439448_0081193 | 3300042005 | Bacteria | 1089 |
| 700 | Ga0439449_0073961 | 3300042007 | Bacteria | 1256 |
| 701 | Ga0439451_000373 | 3300042009 | Bacteria | 8672 |
| 702 | Ga0439452_000077 | 3300042010 | Bacteria | 84014 |
| 703 | Ga0439452_001743 | 3300042010 | Bacteria | 8522 |
| 704 | Ga0439462_0044862 | 3300042015 | Bacteria | 1183 |
| 705 | Ga0439463_020400 | 3300042016 | Bacteria | 1653 |
| 706 | Ga0450919_001810 | 3300042121 | Bacteria | 2783 |
| 707 | Ga0450920_000770 | 3300042122 | Bacteria | 5162 |
| 708 | Ga0450922_000106 | 3300042124 | Bacteria | 8074 |
| 709 | Ga0450906_006336 | 3300042145 | Bacteria | 2392 |
| 710 | Ga0450906_015492 | 3300042145 | Bacteria | 1385 |
| 711 | Ga0450907_000035 | 3300042146 | Bacteria | 60070 |
| 712 | Ga0439446_0016435 | 3300042156 | Bacteria | 2061 |
| 713 | Ga0439458_0015364 | 3300042157 | Bacteria | 1734 |
| 714 | Ga0439458_0017524 | 3300042157 | Bacteria | 1637 |
| 715 | Ga0450908_013341 | 3300042184 | Bacteria | 1482 |
| 716 | Ga0439434_0000053 | 3300042435 | Bacteria | 28044 |
| 717 | Ga0439434_0039928 | 3300042435 | Bacteria | 1440 |
| 718 | Ga0439459_0005704 | 3300042438 | Bacteria | 2054 |
| 719 | Ga0439440_0046737 | 3300042993 | Bacteria | 1070 |
| 720 | Ga0466972_0000136 | 3300044658 | Bacteria | 60410 |
| 721 | Ga0466972_0005603 | 3300044658 | Bacteria | 6291 |
| 722 | Ga0466972_0019144 | 3300044658 | Bacteria | 3423 |
| 723 | Ga0466978_0032140 | 3300044671 | Bacteria | 3208 |
| 724 | Ga0466965_0023854 | 3300044683 | Bacteria | 2956 |
| 725 | Ga0466965_0102968 | 3300044683 | Bacteria | 1461 |
| 726 | Ga0466961_0000418 | 3300044693 | Bacteria | 27114 |
| 727 | Ga0466964_0008332 | 3300044706 | Bacteria | 3890 |
| 728 | Ga0466968_0001216 | 3300044735 | Bacteria | 9120 |
| 729 | Ga0466968_0175419 | 3300044735 | Bacteria | 995 |
| 730 | Ga0466970_0005495 | 3300044765 | Bacteria | 6290 |
| 731 | Ga0466970_0054899 | 3300044765 | Bacteria | 2127 |
| 732 | Ga0466957_0037807 | 3300044842 | Bacteria | 2906 |
| 733 | Ga0466957_0168668 | 3300044842 | Bacteria | 1425 |
| 734 | Ga0466960_0008953 | 3300044901 | Bacteria | 4115 |
| 735 | Ga0466960_0112981 | 3300044901 | Bacteria | 1413 |
| 736 | Ga0466959_0027721 | 3300045049 | Bacteria | 4200 |
| 737 | Ga0451576_0067557 | 3300045051 | Bacteria | 3721 |
| 738 | Ga0451576_0306918 | 3300045051 | Bacteria | 1660 |
| 739 | Ga0451576_0402191 | 3300045051 | Bacteria | 1436 |
| 740 | Ga0466967_0061249 | 3300045976 | Bacteria | 3338 |
| 741 | Ga0466967_0073392 | 3300045976 | Bacteria | 3070 |
| 742 | Ga0466967_0188800 | 3300045976 | Bacteria | 1947 |
| 743 | Ga0466967_0283194 | 3300045976 | Bacteria | 1591 |
| 744 | Ga0495617_000492 | 3300046452 | Bacteria | 20885 |
| 745 | Ga0495617_004483 | 3300046452 | Bacteria | 5080 |
| 746 | Ga0495617_046140 | 3300046452 | Bacteria | 1452 |
| 747 | Ga0495627_000874 | 3300046453 | Bacteria | 21347 |
| 748 | Ga0495627_001078 | 3300046453 | Bacteria | 17940 |
| 749 | Ga0495627_003617 | 3300046453 | Bacteria | 6727 |
| 750 | Ga0495592_0111335 | 3300046454 | Bacteria | 1937 |
| 751 | Ga0495603_0067969 | 3300046455 | Bacteria | 2096 |
| 752 | Ga0495590_0001642 | 3300046457 | Bacteria | 9554 |
| 753 | Ga0495590_0026636 | 3300046457 | Bacteria | 2029 |
| 754 | Ga0495590_0029225 | 3300046457 | Bacteria | 1933 |
| 755 | Ga0495591_001976 | 3300046458 | Bacteria | 11974 |
| 756 | Ga0495591_020413 | 3300046458 | Bacteria | 2189 |
| 757 | Ga0495629_0091342 | 3300046459 | Bacteria | 2125 |
| 758 | Ga0495638_0001077 | 3300046460 | Bacteria | 26593 |
| 759 | Ga0495638_0002448 | 3300046460 | Bacteria | 15154 |
| 760 | Ga0495638_0031716 | 3300046460 | Bacteria | 3393 |
| 761 | Ga0495638_0034928 | 3300046460 | Bacteria | 3207 |
| 762 | Ga0495638_0065947 | 3300046460 | Bacteria | 2227 |
| 763 | Ga0495651_0003859 | 3300046462 | Bacteria | 11459 |
| 764 | Ga0495651_0052046 | 3300046462 | Bacteria | 3155 |
| 765 | Ga0495651_0100107 | 3300046462 | Bacteria | 2159 |
| 766 | Ga0495653_0012646 | 3300046463 | Bacteria | 6893 |
| 767 | Ga0495650_0003064 | 3300046471 | Bacteria | 12577 |
| 768 | Ga0495580_0003180 | 3300046472 | Bacteria | 14073 |
| 769 | Ga0495580_0011169 | 3300046472 | Bacteria | 6955 |
| 770 | Ga0495580_0120717 | 3300046472 | Bacteria | 1820 |
| 771 | Ga0495582_0037715 | 3300046473 | Bacteria | 2658 |
| 772 | Ga0495605_0015127 | 3300046474 | Bacteria | 4206 |
| 773 | Ga0495605_0166224 | 3300046474 | Bacteria | 977 |
| 774 | Ga0495639_0000023 | 3300046475 | Bacteria | 70927 |
| 775 | Ga0495639_0006851 | 3300046475 | Bacteria | 4898 |
| 776 | Ga0495639_0040595 | 3300046475 | Bacteria | 2094 |
| 777 | Ga0495664_0025986 | 3300046477 | Bacteria | 3409 |
| 778 | Ga0495664_0026559 | 3300046477 | Bacteria | 3372 |
| 779 | Ga0495584_0000018 | 3300046491 | Bacteria | 142382 |
| 780 | Ga0495584_0208609 | 3300046491 | Bacteria | 993 |
| 781 | Ga0495584_0235866 | 3300046491 | Bacteria | 930 |
| 782 | Ga0495585_0000020 | 3300046492 | Bacteria | 156639 |
| 783 | Ga0495585_0010657 | 3300046492 | Bacteria | 5462 |
| 784 | Ga0495585_0048186 | 3300046492 | Bacteria | 2370 |
| 785 | Ga0495585_0232386 | 3300046492 | Bacteria | 926 |
| 786 | Ga0495596_0117639 | 3300046500 | Bacteria | 1032 |
| 787 | Ga0495607_0011594 | 3300046501 | Bacteria | 5861 |
| 788 | Ga0495607_0022935 | 3300046501 | Bacteria | 3913 |
| 789 | Ga0495607_0044363 | 3300046501 | Bacteria | 2622 |
| 790 | Ga0495607_0075705 | 3300046501 | Bacteria | 1864 |
| 791 | Ga0495607_0156039 | 3300046501 | Bacteria | 1164 |
| 792 | Ga0495583_0028838 | 3300046506 | Bacteria | 2723 |
| 793 | Ga0495583_0074047 | 3300046506 | Bacteria | 1492 |
| 794 | Ga0495583_0097666 | 3300046506 | Bacteria | 1257 |
| 795 | Ga0495606_0195322 | 3300046507 | Bacteria | 1157 |
| 796 | Ga0495608_0067813 | 3300046511 | Bacteria | 2333 |
| 797 | Ga0495608_0094035 | 3300046511 | Bacteria | 1936 |
| 798 | Ga0495610_0008260 | 3300046512 | Bacteria | 6769 |
| 799 | Ga0495610_0027368 | 3300046512 | Bacteria | 3031 |
| 800 | Ga0495610_0036794 | 3300046512 | Bacteria | 2498 |
| 801 | Ga0495616_0013791 | 3300046513 | Bacteria | 4546 |
| 802 | Ga0495616_0018314 | 3300046513 | Bacteria | 3846 |
| 803 | Ga0495616_0025388 | 3300046513 | Bacteria | 3166 |
| 804 | Ga0495616_0095812 | 3300046513 | Bacteria | 1398 |
| 805 | Ga0495618_0045348 | 3300046514 | Bacteria | 2773 |
| 806 | Ga0495618_0222282 | 3300046514 | Bacteria | 1191 |
| 807 | Ga0495620_0013312 | 3300046515 | Bacteria | 4216 |
| 808 | Ga0495620_0053632 | 3300046515 | Bacteria | 1706 |
| 809 | Ga0495628_0005397 | 3300046516 | Bacteria | 11206 |
| 810 | Ga0495628_0048965 | 3300046516 | Bacteria | 3347 |
| 811 | Ga0495630_0040029 | 3300046517 | Bacteria | 3503 |
| 812 | Ga0495631_0000012 | 3300046518 | Bacteria | 110338 |
| 813 | Ga0495631_0017638 | 3300046518 | Bacteria | 3372 |
| 814 | Ga0495632_0003144 | 3300046519 | Bacteria | 11932 |
| 815 | Ga0495632_0005156 | 3300046519 | Bacteria | 8717 |
| 816 | Ga0495632_0018652 | 3300046519 | Bacteria | 3802 |
| 817 | Ga0495632_0024920 | 3300046519 | Bacteria | 3171 |
| 818 | Ga0495632_0035423 | 3300046519 | Bacteria | 2547 |
| 819 | Ga0495632_0062989 | 3300046519 | Bacteria | 1796 |
| 820 | Ga0495637_0001867 | 3300046520 | Bacteria | 12036 |
| 821 | Ga0495637_0030210 | 3300046520 | Bacteria | 2404 |
| 822 | Ga0495643_0004784 | 3300046522 | Bacteria | 9343 |
| 823 | Ga0495643_0078738 | 3300046522 | Bacteria | 1720 |
| 824 | Ga0495643_0123611 | 3300046522 | Bacteria | 1305 |
| 825 | Ga0495643_0141479 | 3300046522 | Bacteria | 1199 |
| 826 | Ga0495644_0000104 | 3300046523 | Bacteria | 40103 |
| 827 | Ga0495644_0007261 | 3300046523 | Bacteria | 4283 |
| 828 | Ga0495644_0020211 | 3300046523 | Bacteria | 2540 |
| 829 | Ga0495648_0000031 | 3300046524 | Bacteria | 213136 |
| 830 | Ga0495648_0007265 | 3300046524 | Bacteria | 8892 |
| 831 | Ga0495648_0008944 | 3300046524 | Bacteria | 7828 |
| 832 | Ga0495648_0113277 | 3300046524 | Bacteria | 1471 |
| 833 | Ga0495648_0175873 | 3300046524 | Bacteria | 1092 |
| 834 | Ga0495663_0010270 | 3300046525 | Bacteria | 2602 |
| 835 | Ga0495663_0051861 | 3300046525 | Bacteria | 1272 |
| 836 | Ga0495663_0078914 | 3300046525 | Bacteria | 1058 |
| 837 | Ga0495642_0007224 | 3300046528 | Bacteria | 4262 |
| 838 | Ga0495642_0039226 | 3300046528 | Bacteria | 1921 |
| 839 | Ga0495652_0003519 | 3300046529 | Bacteria | 15399 |
| 840 | Ga0495652_0017024 | 3300046529 | Bacteria | 6494 |
| 841 | Ga0495652_0067937 | 3300046529 | Bacteria | 2987 |
| 842 | Ga0495652_0216192 | 3300046529 | Bacteria | 1443 |
| 843 | Ga0495654_0009404 | 3300046530 | Bacteria | 5358 |
| 844 | Ga0495654_0039877 | 3300046530 | Bacteria | 2342 |
| 845 | Ga0495665_0020435 | 3300046531 | Bacteria | 3557 |
| 846 | Ga0495640_0009890 | 3300046533 | Bacteria | 7398 |
| 847 | Ga0495640_0010505 | 3300046533 | Bacteria | 7147 |
| 848 | Ga0495640_0012541 | 3300046533 | Bacteria | 6470 |
| 849 | Ga0495640_0036104 | 3300046533 | Bacteria | 3493 |
| 850 | Ga0495640_0214458 | 3300046533 | Bacteria | 1216 |
| 851 | Ga0495640_0233608 | 3300046533 | Bacteria | 1156 |
| 852 | Ga0495587_0045588 | 3300046536 | Bacteria | 2606 |
| 853 | Ga0495587_0063414 | 3300046536 | Bacteria | 2161 |
| 854 | Ga0495609_0018660 | 3300046538 | Bacteria | 3214 |
| 855 | Ga0495621_0009132 | 3300046539 | Bacteria | 3000 |
| 856 | Ga0495597_0004749 | 3300046542 | Bacteria | 7355 |
| 857 | Ga0495645_0088940 | 3300046543 | Bacteria | 2208 |
| 858 | Ga0495622_0000135 | 3300046557 | Bacteria | 63001 |
| 859 | Ga0495622_0006392 | 3300046557 | Bacteria | 5469 |
| 860 | Ga0495633_0010860 | 3300046558 | Bacteria | 4951 |
| 861 | Ga0495633_0011162 | 3300046558 | Bacteria | 4866 |
| 862 | Ga0495633_0078201 | 3300046558 | Bacteria | 1540 |
| 863 | Ga0495667_0013972 | 3300046559 | Bacteria | 5421 |
| 864 | Ga0495667_0037568 | 3300046559 | Bacteria | 3227 |
| 865 | Ga0495667_0098706 | 3300046559 | Bacteria | 1891 |
| 866 | Ga0495656_0000458 | 3300046615 | Bacteria | 13288 |
| 867 | Ga0495656_0091438 | 3300046615 | Bacteria | 1392 |
| 868 | Ga0495668_0000379 | 3300046616 | Bacteria | 58955 |
| 869 | Ga0495668_0001460 | 3300046616 | Bacteria | 22743 |
| 870 | Ga0495668_0061698 | 3300046616 | Bacteria | 2067 |
| 871 | Ga0495668_0129588 | 3300046616 | Bacteria | 1381 |
| 872 | Ga0495634_0012519 | 3300046642 | Bacteria | 6138 |
| 873 | Ga0495634_0019109 | 3300046642 | Bacteria | 4870 |
| 874 | Ga0495634_0040724 | 3300046642 | Bacteria | 3157 |
| 875 | Ga0495634_0185462 | 3300046642 | Bacteria | 1300 |
| 876 | Ga0495611_0025905 | 3300046648 | Bacteria | 2557 |
| 877 | Ga0495611_0067561 | 3300046648 | Bacteria | 1631 |
| 878 | Ga0495625_0003166 | 3300046660 | Bacteria | 16750 |
| 879 | Ga0495625_0006295 | 3300046660 | Bacteria | 10614 |
| 880 | Ga0495625_0008990 | 3300046660 | Bacteria | 8435 |
| 881 | Ga0495625_0009366 | 3300046660 | Bacteria | 8200 |
| 882 | Ga0495625_0010307 | 3300046660 | Bacteria | 7749 |
| 883 | Ga0495625_0020975 | 3300046660 | Bacteria | 5037 |
| 884 | Ga0495625_0066618 | 3300046660 | Bacteria | 2536 |
| 885 | Ga0495625_0092097 | 3300046660 | Bacteria | 2095 |
| 886 | Ga0495625_0099537 | 3300046660 | Bacteria | 1999 |
| 887 | Ga0495625_0185471 | 3300046660 | Bacteria | 1381 |
| 888 | Ga0495635_0008082 | 3300046663 | Bacteria | 7352 |
| 889 | Ga0495635_0008097 | 3300046663 | Bacteria | 7345 |
| 890 | Ga0495635_0008697 | 3300046663 | Bacteria | 7091 |
| 891 | Ga0495661_0008974 | 3300046665 | Bacteria | 6881 |
| 892 | Ga0495661_0016063 | 3300046665 | Bacteria | 4973 |
| 893 | Ga0495661_0020003 | 3300046665 | Bacteria | 4377 |
| 894 | Ga0495661_0020284 | 3300046665 | Bacteria | 4341 |
| 895 | Ga0495661_0132157 | 3300046665 | Bacteria | 1366 |
| 896 | Ga0495588_0020268 | 3300046674 | Bacteria | 3265 |
| 897 | Ga0495657_0002707 | 3300046675 | Bacteria | 14796 |
| 898 | Ga0495657_0016628 | 3300046675 | Bacteria | 5357 |
| 899 | Ga0495657_0243340 | 3300046675 | Bacteria | 1085 |
| 900 | Ga0495599_0002038 | 3300046678 | Bacteria | 11701 |
| 901 | Ga0495623_0016423 | 3300046679 | Bacteria | 4783 |
| 902 | Ga0495646_0066697 | 3300046680 | Bacteria | 2128 |
| 903 | Ga0495647_0014698 | 3300046681 | Bacteria | 2731 |
| 904 | Ga0495658_0022238 | 3300046683 | Bacteria | 3351 |
| 905 | Ga0495669_0055671 | 3300046684 | Bacteria | 1781 |
| 906 | Ga0495613_0039833 | 3300046689 | Bacteria | 3482 |
| 907 | Ga0495613_0064133 | 3300046689 | Bacteria | 2687 |
| 908 | Ga0495624_0010916 | 3300046690 | Bacteria | 6262 |
| 909 | Ga0495624_0019352 | 3300046690 | Bacteria | 4547 |
| 910 | Ga0495670_0014224 | 3300046691 | Bacteria | 3915 |
| 911 | Ga0495670_0015862 | 3300046691 | Bacteria | 3702 |
| 912 | Ga0495671_0017068 | 3300046692 | Bacteria | 3865 |
| 913 | Ga0495671_0120811 | 3300046692 | Bacteria | 1278 |
| 914 | Ga0495649_0010770 | 3300046694 | Bacteria | 5386 |
| 915 | Ga0495649_0014859 | 3300046694 | Bacteria | 4449 |
| 916 | Ga0495589_0015892 | 3300046794 | Bacteria | 3870 |
| 917 | Ga0495589_0137756 | 3300046794 | Bacteria | 1170 |
| 918 | Ga0495600_0015865 | 3300046809 | Bacteria | 4771 |
| 919 | Ga0495600_0016359 | 3300046809 | Bacteria | 4706 |
| 920 | Ga0495600_0049123 | 3300046809 | Bacteria | 2752 |
| 921 | Ga0495660_0006726 | 3300046810 | Bacteria | 6788 |
| 922 | Ga0495660_0020038 | 3300046810 | Bacteria | 3835 |
| 923 | Ga0495660_0054864 | 3300046810 | Bacteria | 2158 |
| 924 | Ga0495660_0074516 | 3300046810 | Bacteria | 1793 |
| 925 | Ga0495660_0074756 | 3300046810 | Bacteria | 1789 |
| 926 | Ga0495581_0180834 | 3300047315 | Bacteria | 1233 |
| 927 | Ga0495581_0195438 | 3300047315 | Bacteria | 1183 |
| 928 | Ga0495604_0002138 | 3300047317 | Bacteria | 15893 |
| 929 | Ga0495604_0014695 | 3300047317 | Bacteria | 6240 |
| 930 | Ga0495604_0043019 | 3300047317 | Bacteria | 3538 |
| 931 | Ga0495604_0147158 | 3300047317 | Bacteria | 1678 |
| 932 | Ga0495604_0156087 | 3300047317 | Bacteria | 1616 |
| 933 | Ga0495636_0017552 | 3300047318 | Bacteria | 2866 |
| 934 | Ga0495674_0007907 | 3300047319 | Bacteria | 10149 |
| 935 | Ga0495674_0011599 | 3300047319 | Bacteria | 8311 |
| 936 | Ga0495674_0027876 | 3300047319 | Bacteria | 5158 |
| 937 | Ga0495674_0031722 | 3300047319 | Bacteria | 4797 |
| 938 | Ga0495672_0004293 | 3300047320 | Bacteria | 11753 |
| 939 | Ga0495672_0011045 | 3300047320 | Bacteria | 6396 |
| 940 | Ga0495672_0016133 | 3300047320 | Bacteria | 5047 |
| 941 | Ga0495672_0037660 | 3300047320 | Bacteria | 2957 |
| 942 | Ga0495680_0002914 | 3300047322 | Bacteria | 17181 |
| 943 | Ga0495680_0017078 | 3300047322 | Bacteria | 6209 |
| 944 | Ga0495680_0103519 | 3300047322 | Bacteria | 2119 |
| 945 | Ga0495680_0165952 | 3300047322 | Bacteria | 1601 |
| 946 | Ga0495683_0000710 | 3300047323 | Bacteria | 24349 |
| 947 | Ga0495683_0001671 | 3300047323 | Bacteria | 14129 |
| 948 | Ga0495683_0008766 | 3300047323 | Bacteria | 5397 |
| 949 | Ga0495687_000921 | 3300047443 | Bacteria | 30536 |
| 950 | Ga0495687_007170 | 3300047443 | Bacteria | 6639 |
| 951 | Ga0495675_0146703 | 3300047444 | Bacteria | 1459 |
| 952 | Ga0495679_001535 | 3300047446 | Bacteria | 13026 |
| 953 | Ga0495679_002871 | 3300047446 | Bacteria | 8539 |
| 954 | Ga0495679_004458 | 3300047446 | Bacteria | 6452 |
| 955 | Ga0495685_006282 | 3300047447 | Bacteria | 3883 |
| 956 | Ga0495673_0078696 | 3300047469 | Bacteria | 1369 |
| 957 | Ga0495673_0079243 | 3300047469 | Bacteria | 1363 |
| 958 | Ga0495673_0099085 | 3300047469 | Bacteria | 1181 |
| 959 | Ga0495681_0000397 | 3300047470 | Bacteria | 33833 |
| 960 | Ga0495681_0000547 | 3300047470 | Bacteria | 28724 |
| 961 | Ga0495681_0001186 | 3300047470 | Bacteria | 19820 |
| 962 | Ga0495681_0012872 | 3300047470 | Bacteria | 4891 |
| 963 | Ga0495681_0017947 | 3300047470 | Bacteria | 3915 |
| 964 | Ga0495681_0126519 | 3300047470 | Bacteria | 1091 |
| 965 | Ga0495684_0017357 | 3300047471 | Bacteria | 5539 |
| 966 | Ga0495684_0017725 | 3300047471 | Bacteria | 5484 |
| 967 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 968 | Ga0495686_0109171 | 3300047472 | Bacteria | 1661 |
| 969 | Ga0495686_0233070 | 3300047472 | Bacteria | 1041 |
| 970 | Ga0495593_0015883 | 3300047673 | Bacteria | 4254 |
| 971 | Ga0495593_0082237 | 3300047673 | Bacteria | 1664 |
| 972 | Ga0495602_0019051 | 3300048088 | Bacteria | 6827 |
| 973 | Ga0495602_0056943 | 3300048088 | Bacteria | 3433 |
| 974 | Ga0495602_0447260 | 3300048088 | Bacteria | 913 |
| 975 | Ga0495626_0000845 | 3300048091 | Bacteria | 27398 |
| 976 | Ga0495626_0029000 | 3300048091 | Bacteria | 2680 |
| 977 | Ga0496100_0009364 | 3300048903 | Bacteria | 5504 |
| 978 | Ga0496100_0082011 | 3300048903 | Bacteria | 2180 |
| 979 | Ga0496100_0087564 | 3300048903 | Bacteria | 2118 |
| 980 | Ga0496101_0003793 | 3300048904 | Bacteria | 9440 |
| 981 | Ga0496101_0284140 | 3300048904 | Bacteria | 1294 |
| 982 | Ga0496102_0058370 | 3300048905 | Bacteria | 3526 |
| 983 | Ga0496102_0100652 | 3300048905 | Bacteria | 2684 |
| 984 | Ga0496102_0170509 | 3300048905 | Bacteria | 2049 |
| 985 | Ga0496102_0207435 | 3300048905 | Bacteria | 1847 |
| 986 | Ga0496102_0208728 | 3300048905 | Bacteria | 1841 |
| 987 | Ga0496102_0369840 | 3300048905 | Bacteria | 1349 |
| 988 | Ga0496102_0434422 | 3300048905 | Bacteria | 1232 |
| 989 | Ga0496103_0004902 | 3300048906 | Bacteria | 8080 |
| 990 | Ga0496103_0009846 | 3300048906 | Bacteria | 5659 |
| 991 | Ga0496103_0014190 | 3300048906 | Bacteria | 4730 |
| 992 | Ga0496104_0005066 | 3300048907 | Bacteria | 11494 |
| 993 | Ga0496104_0009671 | 3300048907 | Bacteria | 8589 |
| 994 | Ga0496104_0010700 | 3300048907 | Bacteria | 8203 |
| 995 | Ga0496104_0015598 | 3300048907 | Bacteria | 6887 |
| 996 | Ga0496104_0032718 | 3300048907 | Bacteria | 4840 |
| 997 | Ga0496104_0102177 | 3300048907 | Bacteria | 2745 |
| 998 | Ga0496104_0118272 | 3300048907 | Bacteria | 2544 |
| 999 | Ga0496104_0131059 | 3300048907 | Bacteria | 2408 |
| 1000 | Ga0496104_0304657 | 3300048907 | Bacteria | 1506 |
| 1001 | Ga0496104_0423708 | 3300048907 | Bacteria | 1243 |
| 1002 | Ga0496104_0617881 | 3300048907 | Bacteria | 993 |
| 1003 | Ga0496104_0681228 | 3300048907 | Bacteria | 936 |
| 1004 | Ga0496105_0006092 | 3300048908 | Bacteria | 9231 |
| 1005 | Ga0496105_0009651 | 3300048908 | Bacteria | 7555 |
| 1006 | Ga0496105_0014216 | 3300048908 | Bacteria | 6335 |
| 1007 | Ga0496105_0014320 | 3300048908 | Bacteria | 6313 |
| 1008 | Ga0496105_0031903 | 3300048908 | Bacteria | 4321 |
| 1009 | Ga0496105_0034869 | 3300048908 | Bacteria | 4141 |
| 1010 | Ga0496105_0037646 | 3300048908 | Bacteria | 3983 |
| 1011 | Ga0496105_0079967 | 3300048908 | Bacteria | 2699 |
| 1012 | Ga0496105_0494034 | 3300048908 | Bacteria | 961 |
| 1013 | Ga0496106_0007532 | 3300048909 | Bacteria | 8052 |
| 1014 | Ga0496106_0136867 | 3300048909 | Bacteria | 1924 |
| 1015 | Ga0496107_0002250 | 3300048910 | Bacteria | 12441 |
| 1016 | Ga0496107_0033508 | 3300048910 | Bacteria | 3675 |
| 1017 | Ga0496107_0040983 | 3300048910 | Bacteria | 3325 |
| 1018 | Ga0496107_0203050 | 3300048910 | Bacteria | 1473 |
| 1019 | Ga0496107_0281526 | 3300048910 | Bacteria | 1238 |
| 1020 | Ga0496108_0000085 | 3300048911 | Bacteria | 101144 |
| 1021 | Ga0496108_0001801 | 3300048911 | Bacteria | 17081 |
| 1022 | Ga0496108_0006400 | 3300048911 | Bacteria | 9549 |
| 1023 | Ga0496108_0020352 | 3300048911 | Bacteria | 5454 |
| 1024 | Ga0496108_0042363 | 3300048911 | Bacteria | 3801 |
| 1025 | Ga0496108_0072132 | 3300048911 | Bacteria | 2914 |
| 1026 | Ga0496108_0072840 | 3300048911 | Bacteria | 2900 |
| 1027 | Ga0496108_0243586 | 3300048911 | Bacteria | 1564 |
| 1028 | Ga0496108_0295921 | 3300048911 | Bacteria | 1409 |
| 1029 | Ga0496109_0001374 | 3300048912 | Bacteria | 20185 |
| 1030 | Ga0496109_0004444 | 3300048912 | Bacteria | 11712 |
| 1031 | Ga0496109_0036931 | 3300048912 | Bacteria | 4412 |
| 1032 | Ga0496109_0053693 | 3300048912 | Bacteria | 3676 |
| 1033 | Ga0496109_0082176 | 3300048912 | Bacteria | 2969 |
| 1034 | Ga0496109_0086856 | 3300048912 | Bacteria | 2889 |
| 1035 | Ga0496109_0387451 | 3300048912 | Bacteria | 1320 |
| 1036 | Ga0496109_0408682 | 3300048912 | Bacteria | 1283 |
| 1037 | Ga0496109_0443578 | 3300048912 | Bacteria | 1226 |
| 1038 | Ga0496109_0478057 | 3300048912 | Bacteria | 1176 |
| 1039 | Ga0496110_0018710 | 3300048913 | Bacteria | 5811 |
| 1040 | Ga0496110_0029557 | 3300048913 | Bacteria | 4718 |
| 1041 | Ga0496110_0045912 | 3300048913 | Bacteria | 3820 |
| 1042 | Ga0496110_0053216 | 3300048913 | Bacteria | 3558 |
| 1043 | Ga0496110_0074262 | 3300048913 | Bacteria | 3019 |
| 1044 | Ga0496110_0088189 | 3300048913 | Bacteria | 2771 |
| 1045 | Ga0496110_0143362 | 3300048913 | Bacteria | 2160 |
| 1046 | Ga0496110_0144931 | 3300048913 | Bacteria | 2148 |
| 1047 | Ga0496110_0243531 | 3300048913 | Bacteria | 1636 |
| 1048 | Ga0496110_0406893 | 3300048913 | Bacteria | 1240 |
| 1049 | Ga0496111_0064299 | 3300048914 | Bacteria | 2661 |
| 1050 | Ga0496111_0067113 | 3300048914 | Bacteria | 2606 |
| 1051 | Ga0496111_0095491 | 3300048914 | Bacteria | 2181 |
| 1052 | Ga0496111_0104796 | 3300048914 | Bacteria | 2080 |
| 1053 | Ga0496111_0315307 | 3300048914 | Bacteria | 1158 |
| 1054 | Ga0496111_0380680 | 3300048914 | Bacteria | 1043 |
| 1055 | Ga0496112_0021643 | 3300048915 | Bacteria | 6116 |
| 1056 | Ga0496112_0033033 | 3300048915 | Bacteria | 5025 |
| 1057 | Ga0496112_0045443 | 3300048915 | Bacteria | 4305 |
| 1058 | Ga0496112_0112479 | 3300048915 | Bacteria | 2693 |
| 1059 | Ga0496112_0224235 | 3300048915 | Bacteria | 1835 |
| 1060 | Ga0496112_0260771 | 3300048915 | Bacteria | 1682 |
| 1061 | Ga0496112_0537154 | 3300048915 | Bacteria | 1103 |
| 1062 | Ga0496113_0012688 | 3300048916 | Bacteria | 5671 |
| 1063 | Ga0496113_0014036 | 3300048916 | Bacteria | 5450 |
| 1064 | Ga0496113_0022391 | 3300048916 | Bacteria | 4469 |
| 1065 | Ga0496113_0063348 | 3300048916 | Bacteria | 2794 |
| 1066 | Ga0496113_0095656 | 3300048916 | Bacteria | 2296 |
| 1067 | Ga0496113_0137702 | 3300048916 | Bacteria | 1919 |
| 1068 | Ga0496113_0225110 | 3300048916 | Bacteria | 1495 |
| 1069 | Ga0496114_0045265 | 3300048917 | Bacteria | 3655 |
| 1070 | Ga0496114_0145281 | 3300048917 | Bacteria | 2056 |
| 1071 | Ga0496114_0169480 | 3300048917 | Bacteria | 1902 |
| 1072 | Ga0496115_0005716 | 3300048918 | Bacteria | 9053 |
| 1073 | Ga0496115_0018829 | 3300048918 | Bacteria | 5308 |
| 1074 | Ga0496115_0077044 | 3300048918 | Bacteria | 2711 |
| 1075 | Ga0496115_0173765 | 3300048918 | Bacteria | 1781 |
| 1076 | Ga0496115_0229361 | 3300048918 | Bacteria | 1532 |
| 1077 | Ga0496116_0027763 | 3300048919 | Bacteria | 4113 |
| 1078 | Ga0496117_0118578 | 3300048920 | Bacteria | 1631 |
| 1079 | Ga0496118_0003627 | 3300048921 | Bacteria | 19165 |
| 1080 | Ga0496118_0006416 | 3300048921 | Bacteria | 12932 |
| 1081 | Ga0496118_0026860 | 3300048921 | Bacteria | 4891 |
| 1082 | Ga0496118_0062501 | 3300048921 | Bacteria | 2748 |
| 1083 | Ga0496118_0064285 | 3300048921 | Bacteria | 2693 |
| 1084 | Ga0496118_0074260 | 3300048921 | Bacteria | 2432 |
| 1085 | Ga0496118_0104134 | 3300048921 | Bacteria | 1906 |
| 1086 | Ga0496118_0116038 | 3300048921 | Bacteria | 1761 |
| 1087 | Ga0496119_0016733 | 3300048922 | Bacteria | 5559 |
| 1088 | Ga0496119_0130230 | 3300048922 | Bacteria | 1372 |
| 1089 | Ga0496120_0024839 | 3300048923 | Bacteria | 3729 |
| 1090 | Ga0496120_0036314 | 3300048923 | Bacteria | 2935 |
| 1091 | Ga0496120_0138042 | 3300048923 | Bacteria | 1241 |
| 1092 | Ga0496121_0011940 | 3300048924 | Bacteria | 9558 |
| 1093 | Ga0496121_0022098 | 3300048924 | Bacteria | 6191 |
| 1094 | Ga0496121_0033120 | 3300048924 | Bacteria | 4683 |
| 1095 | Ga0496121_0047098 | 3300048924 | Bacteria | 3681 |
| 1096 | Ga0496121_0061226 | 3300048924 | Bacteria | 3090 |
| 1097 | Ga0496121_0086490 | 3300048924 | Bacteria | 2463 |
| 1098 | Ga0496121_0104919 | 3300048924 | Bacteria | 2170 |
| 1099 | Ga0496121_0199799 | 3300048924 | Bacteria | 1426 |
| 1100 | Ga0496122_0022896 | 3300048925 | Bacteria | 5531 |
| 1101 | Ga0496122_0049351 | 3300048925 | Bacteria | 3225 |
| 1102 | Ga0496123_0009076 | 3300048926 | Bacteria | 9007 |
| 1103 | Ga0496124_0001884 | 3300048927 | Bacteria | 28875 |
| 1104 | Ga0496124_0027989 | 3300048927 | Bacteria | 5047 |
| 1105 | Ga0496124_0126529 | 3300048927 | Bacteria | 2034 |
| 1106 | Ga0496125_0000398 | 3300048928 | Bacteria | 81112 |
| 1107 | Ga0496125_0000583 | 3300048928 | Bacteria | 62446 |
| 1108 | Ga0496125_0053998 | 3300048928 | Bacteria | 3288 |
| 1109 | Ga0496125_0095590 | 3300048928 | Bacteria | 2210 |
| 1110 | Ga0496126_0001707 | 3300048929 | Bacteria | 32618 |
| 1111 | Ga0496126_0009017 | 3300048929 | Bacteria | 10667 |
| 1112 | Ga0496126_0029280 | 3300048929 | Bacteria | 5232 |
| 1113 | Ga0496126_0089745 | 3300048929 | Bacteria | 2705 |
| 1114 | Ga0496126_0119397 | 3300048929 | Bacteria | 2288 |
| 1115 | Ga0496126_0132022 | 3300048929 | Bacteria | 2157 |
| 1116 | Ga0496126_0178374 | 3300048929 | Bacteria | 1806 |
| 1117 | Ga0496126_0286070 | 3300048929 | Bacteria | 1364 |
| 1118 | Ga0495678_000022 | 3300049459 | Bacteria | 237031 |
| 1119 | Ga0495678_001125 | 3300049459 | Bacteria | 22215 |
| 1120 | Ga0495678_098343 | 3300049459 | Bacteria | 1018 |
| 1121 | Ga0495682_0000574 | 3300049460 | Bacteria | 24911 |
| 1122 | Ga0495682_0040027 | 3300049460 | Bacteria | 1719 |
| 1123 | Ga0501032_0013596 | 3300049569 | Bacteria | 5782 |
| 1124 | Ga0501033_0006993 | 3300049570 | Bacteria | 8807 |
| 1125 | Ga0501034_0018551 | 3300049571 | Bacteria | 7131 |
| 1126 | Ga0501034_0052501 | 3300049571 | Bacteria | 4106 |
| 1127 | Ga0501034_0711227 | 3300049571 | Bacteria | 902 |
| 1128 | Ga0501036_0112415 | 3300049572 | Bacteria | 2302 |
| 1129 | Ga0501036_0119131 | 3300049572 | Bacteria | 2229 |
| 1130 | Ga0501036_0480354 | 3300049572 | Bacteria | 1034 |
| 1131 | Ga0501037_0093757 | 3300049573 | Bacteria | 2171 |
| 1132 | Ga0501038_0316086 | 3300049574 | Bacteria | 1222 |
| 1133 | Ga0501039_0020160 | 3300049575 | Bacteria | 5112 |
| 1134 | Ga0501042_0098751 | 3300049578 | Bacteria | 2099 |
| 1135 | Ga0501043_0026650 | 3300049579 | Bacteria | 4535 |
| 1136 | Ga0501043_0086301 | 3300049579 | Bacteria | 2466 |
| 1137 | Ga0501043_0159620 | 3300049579 | Bacteria | 1762 |
| 1138 | Ga0501046_0092638 | 3300049580 | Bacteria | 2323 |
| 1139 | Ga0501047_0038808 | 3300049581 | Bacteria | 4607 |
| 1140 | Ga0501047_0048403 | 3300049581 | Bacteria | 4105 |
| 1141 | Ga0501047_0075636 | 3300049581 | Bacteria | 3240 |
| 1142 | Ga0501047_0116105 | 3300049581 | Bacteria | 2558 |
| 1143 | Ga0501047_0233825 | 3300049581 | Bacteria | 1690 |
| 1144 | Ga0501047_0245192 | 3300049581 | Bacteria | 1641 |
| 1145 | Ga0501048_0054813 | 3300049582 | Bacteria | 2832 |
| 1146 | Ga0501048_0104477 | 3300049582 | Bacteria | 1999 |
| 1147 | Ga0501067_0059862 | 3300049583 | Bacteria | 2108 |
| 1148 | Ga0501069_0013696 | 3300049585 | Bacteria | 4328 |
| 1149 | Ga0501070_0003666 | 3300049586 | Bacteria | 13277 |
| 1150 | Ga0501070_0556715 | 3300049586 | Bacteria | 917 |
| 1151 | Ga0501072_0148193 | 3300049588 | Bacteria | 1871 |
| 1152 | Ga0501073_0029084 | 3300049589 | Bacteria | 3948 |
| 1153 | Ga0501073_0047240 | 3300049589 | Bacteria | 3026 |
| 1154 | Ga0501080_0002569 | 3300049742 | Bacteria | 15898 |
| 1155 | Ga0501080_0101917 | 3300049742 | Bacteria | 2663 |
| 1156 | Ga0501083_0011783 | 3300049744 | Bacteria | 6127 |
| 1157 | Ga0501241_000151 | 3300049758 | Bacteria | 15510 |
| 1158 | Ga0501035_0051837 | 3300049822 | Bacteria | 3672 |
| 1159 | Ga0501035_0087490 | 3300049822 | Bacteria | 2746 |
| 1160 | Ga0501035_0146140 | 3300049822 | Bacteria | 2053 |
| 1161 | Ga0501044_0096873 | 3300049823 | Bacteria | 2971 |
| 1162 | Ga0501044_0105731 | 3300049823 | Bacteria | 2827 |
| 1163 | nmdc:mga03683_142946_c1 | 3300050489 | Bacteria | 1076 |
| 1164 | nmdc:mga03683_36634_c1 | 3300050489 | Bacteria | 1996 |
| 1165 | nmdc:mga03683_914_c1 | 3300050489 | Bacteria | 8506 |
| 1166 | nmdc:mga00v17_342510_c1 | 3300050491 | Bacteria | 972 |
| 1167 | nmdc:mga00v17_367239_c1 | 3300050491 | Bacteria | 936 |
| 1168 | nmdc:mga00v17_94271_c1 | 3300050491 | Bacteria | 1883 |
| 1169 | nmdc:mga0yw44_107635_c1 | 3300050492 | Bacteria | 1783 |
| 1170 | nmdc:mga0yw44_108109_c1 | 3300050492 | Bacteria | 1779 |
| 1171 | nmdc:mga0yw44_12728_c1 | 3300050492 | Bacteria | 4396 |
| 1172 | nmdc:mga0yw44_302158_c1 | 3300050492 | Bacteria | 1072 |
| 1173 | nmdc:mga0yw44_45018_c1 | 3300050492 | Bacteria | 2643 |
| 1174 | nmdc:mga0yw44_53561_c1 | 3300050492 | Bacteria | 2451 |
| 1175 | nmdc:mga0yw44_5380_c1 | 3300050492 | Bacteria | 6035 |
| 1176 | nmdc:mga0yw44_65075_c1 | 3300050492 | Bacteria | 2246 |
| 1177 | nmdc:mga0k408_101913_c1 | 3300050493 | Bacteria | 1693 |
| 1178 | nmdc:mga0k408_133218_c1 | 3300050493 | Bacteria | 1476 |
| 1179 | nmdc:mga0k408_156449_c1 | 3300050493 | Bacteria | 1357 |
| 1180 | nmdc:mga06z11_24711_c1 | 3300050494 | Bacteria | 2839 |
| 1181 | nmdc:mga06z11_5599_c1 | 3300050494 | Bacteria | 5052 |
| 1182 | nmdc:mga07m45_40912_c1 | 3300050496 | Bacteria | 2595 |
| 1183 | nmdc:mga05p37_12256_c1 | 3300050507 | Bacteria | 10238 |
| 1184 | nmdc:mga05p37_137380_c1 | 3300050507 | Bacteria | 2996 |
| 1185 | nmdc:mga05p37_191551_c1 | 3300050507 | Bacteria | 2482 |
| 1186 | nmdc:mga05p37_198474_c1 | 3300050507 | Bacteria | 2432 |
| 1187 | nmdc:mga05p37_342483_c1 | 3300050507 | Bacteria | 1763 |
| 1188 | nmdc:mga05p37_66088_c1 | 3300050507 | Bacteria | 4449 |
| 1189 | nmdc:mga05p37_756827_c1 | 3300050507 | Bacteria | 1070 |
| 1190 | nmdc:mga09592_10818_c1 | 3300050508 | Bacteria | 7421 |
| 1191 | nmdc:mga09592_472262_c1 | 3300050508 | Bacteria | 1081 |
| 1192 | nmdc:mga09592_85276_c1 | 3300050508 | Bacteria | 2695 |
| 1193 | nmdc:mga0qj67_50665_c1 | 3300050509 | Bacteria | 3284 |
| 1194 | nmdc:mga06r32_12962_c1 | 3300050510 | Bacteria | 7538 |
| 1195 | nmdc:mga06r32_16971_c1 | 3300050510 | Bacteria | 6643 |
| 1196 | nmdc:mga06r32_43327_c1 | 3300050510 | Bacteria | 4282 |
| 1197 | nmdc:mga08y16_160261_c1 | 3300050511 | Bacteria | 2338 |
| 1198 | nmdc:mga08y16_73423_c1 | 3300050511 | Bacteria | 3565 |
| 1199 | nmdc:mga0n895_103480_c1 | 3300050512 | Bacteria | 2859 |
| 1200 | nmdc:mga0n895_151062_c1 | 3300050512 | Bacteria | 2353 |
| 1201 | nmdc:mga0n895_21382_c1 | 3300050512 | Bacteria | 6049 |
| 1202 | nmdc:mga0n895_29435_c1 | 3300050512 | Bacteria | 5239 |
| 1203 | nmdc:mga0n895_4039_c1 | 3300050512 | Bacteria | 11935 |
| 1204 | nmdc:mga0n895_405504_c1 | 3300050512 | Bacteria | 1379 |
| 1205 | nmdc:mga0rr50_3155_c1 | 3300050513 | Bacteria | 9422 |
| 1206 | nmdc:mga0rr50_470_c1 | 3300050513 | Bacteria | 21400 |
| 1207 | nmdc:mga0rr50_47936_c1 | 3300050513 | Bacteria | 3155 |
| 1208 | nmdc:mga0rr50_71799_c1 | 3300050513 | Bacteria | 2642 |
| 1209 | nmdc:mga0rr50_9726_c1 | 3300050513 | Bacteria | 6065 |
| 1210 | nmdc:mga08x19_2945_c1 | 3300050514 | Bacteria | 10233 |
| 1211 | nmdc:mga08x19_42039_c1 | 3300050514 | Bacteria | 2912 |
| 1212 | nmdc:mga0a205_131196_c1 | 3300050515 | Bacteria | 2406 |
| 1213 | nmdc:mga0a205_135822_c1 | 3300050515 | Bacteria | 2360 |
| 1214 | nmdc:mga0a205_16730_c1 | 3300050515 | Bacteria | 6868 |
| 1215 | nmdc:mga0a205_177611_c1 | 3300050515 | Bacteria | 2024 |
| 1216 | nmdc:mga0a205_24882_c1 | 3300050515 | Bacteria | 5698 |
| 1217 | nmdc:mga0a205_282263_c1 | 3300050515 | Bacteria | 1536 |
| 1218 | nmdc:mga0a205_31051_c1 | 3300050515 | Bacteria | 5117 |
| 1219 | nmdc:mga0a205_4844_c1 | 3300050515 | Bacteria | 12102 |
| 1220 | nmdc:mga0sz30_187_c1 | 3300050516 | Bacteria | 22807 |
| 1221 | nmdc:mga0sz30_73028_c1 | 3300050516 | Bacteria | 1479 |
| 1222 | Ga0495601_0377012 | 3300053077 | Bacteria | 921 |
| 1223 | Ga0495612_0132622 | 3300053078 | Bacteria | 1077 |
| 1224 | Ga0500610_0195721 | 3300053079 | Bacteria | 978 |
| 1225 | Ga0495595_0029694 | 3300053084 | Bacteria | 2448 |
| 1226 | Ga0495595_0042897 | 3300053084 | Bacteria | 2073 |
| 1227 | Ga0495595_0193324 | 3300053084 | Bacteria | 1011 |
| 1228 | Ga0495619_0006090 | 3300053085 | Bacteria | 7638 |
| 1229 | Ga0495619_0057341 | 3300053085 | Bacteria | 2584 |
| 1230 | Ga0495619_0081532 | 3300053085 | Bacteria | 2178 |
| 1231 | Ga0500643_000210 | 3300053087 | Bacteria | 55059 |
| 1232 | Ga0500643_003295 | 3300053087 | Bacteria | 7838 |
| 1233 | Ga0500647_0027384 | 3300053091 | Bacteria | 2694 |
| 1234 | Ga0500566_0000908 | 3300053094 | Bacteria | 16964 |
| 1235 | Ga0500566_0008156 | 3300053094 | Bacteria | 6197 |
| 1236 | Ga0500641_0016502 | 3300053096 | Bacteria | 2750 |
| 1237 | Ga0500556_0000049 | 3300053104 | Bacteria | 122572 |
| 1238 | Ga0500556_0009208 | 3300053104 | Bacteria | 2865 |
| 1239 | Ga0500557_000196 | 3300053105 | Bacteria | 10188 |
| 1240 | Ga0500562_024014 | 3300053108 | Bacteria | 1593 |
| 1241 | Ga0500582_069329 | 3300053114 | Bacteria | 1196 |
| 1242 | Ga0500595_000372 | 3300053119 | Bacteria | 28914 |
| 1243 | Ga0500607_098593 | 3300053121 | Bacteria | 1455 |
| 1244 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 1245 | Ga0500642_0000053 | 3300053130 | Bacteria | 71632 |
| 1246 | Ga0500642_0023118 | 3300053130 | Bacteria | 2490 |
| 1247 | Ga0500559_0023878 | 3300053136 | Bacteria | 2597 |
| 1248 | Ga0500559_0029435 | 3300053136 | Bacteria | 2352 |
| 1249 | Ga0500577_0116040 | 3300053142 | Bacteria | 1110 |
| 1250 | Ga0500589_101031 | 3300053147 | Bacteria | 1252 |
| 1251 | Ga0500590_021996 | 3300053148 | Bacteria | 3310 |
| 1252 | Ga0500590_098146 | 3300053148 | Bacteria | 1411 |
| 1253 | Ga0500616_0064762 | 3300053153 | Bacteria | 1881 |
| 1254 | Ga0500619_020259 | 3300053154 | Bacteria | 1898 |
| 1255 | Ga0500622_0001817 | 3300053156 | Bacteria | 16215 |
| 1256 | Ga0500638_001015 | 3300053162 | Bacteria | 8135 |
| 1257 | Ga0500638_140525 | 3300053162 | Bacteria | 1085 |
| 1258 | Ga0500638_158285 | 3300053162 | Bacteria | 1000 |
| 1259 | Ga0500636_0000033 | 3300053177 | Bacteria | 72990 |
| 1260 | Ga0500637_0001490 | 3300053178 | Bacteria | 9968 |
| 1261 | Ga0500645_000173 | 3300053730 | Bacteria | 50903 |
| 1262 | Ga0500645_084030 | 3300053730 | Bacteria | 907 |
| 1263 | Ga0500599_001058 | 3300053736 | Bacteria | 3108 |
| 1264 | Ga0500601_000590 | 3300053737 | Bacteria | 5187 |
| 1265 | Ga0500661_000075 | 3300055283 | Bacteria | 15501 |
| 1266 | Ga0587066_003124 | 3300059490 | Bacteria | 1912 |
| 1267 | Ga0587075_002353 | 3300059644 | Bacteria | 1989 |
| 1268 | Ga0587076_012928 | 3300059645 | Bacteria | 1256 |
| 1269 | Ga0587111_0044713 | 3300060346 | Bacteria | 957 |
| 1270 | Ga0501082_0134983 | 3300060353 | Bacteria | 2141 |
| 1271 | Ga0501082_0196188 | 3300060353 | Bacteria | 1756 |
| 1272 | Ga0466962_0087966 | 3300061719 | Bacteria | 1488 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007788 | Ga0099795_10011474 | Ga0099795_100114743 | 257 |
| 2 | 3300010375 | Ga0105239_10743693 | Ga0105239_107436931 | 260 |
| 3 | 3300006175 | Ga0070712_100138092 | Ga0070712_1001380923 | 271 |
| 4 | 3300004803 | Ga0058862_12278394 | Ga0058862_122783941 | 273 |
| 5 | 3300005329 | Ga0070683_100008708 | Ga0070683_1000087082 | 273 |
| 6 | 3300005338 | Ga0068868_100012606 | Ga0068868_1000126065 | 273 |
| 7 | 3300005339 | Ga0070660_100019335 | Ga0070660_1000193352 | 273 |
| 8 | 3300005339 | Ga0070660_100353830 | Ga0070660_1003538301 | 273 |
| 9 | 3300005344 | Ga0070661_100077584 | Ga0070661_1000775842 | 273 |
| 10 | 3300005355 | Ga0070671_100267490 | Ga0070671_1002674903 | 273 |
| 11 | 3300005366 | Ga0070659_100041691 | Ga0070659_1000416912 | 273 |
| 12 | 3300005455 | Ga0070663_100037787 | Ga0070663_1000377873 | 273 |
| 13 | 3300005455 | Ga0070663_100270756 | Ga0070663_1002707561 | 273 |
| 14 | 3300005535 | Ga0070684_100032661 | Ga0070684_1000326614 | 273 |
| 15 | 3300005539 | Ga0068853_100193272 | Ga0068853_1001932721 | 273 |
| 16 | 3300005563 | Ga0068855_100341132 | Ga0068855_1003411321 | 273 |
| 17 | 3300005564 | Ga0070664_100041990 | Ga0070664_1000419904 | 273 |
| 18 | 3300005577 | Ga0068857_100017116 | Ga0068857_1000171163 | 273 |
| 19 | 3300005618 | Ga0068864_100008698 | Ga0068864_1000086988 | 273 |
| 20 | 3300005618 | Ga0068864_100343080 | Ga0068864_1003430801 | 273 |
| 21 | 3300005841 | Ga0068863_100075810 | Ga0068863_1000758102 | 273 |
| 22 | 3300006173 | Ga0070716_100078778 | Ga0070716_1000787782 | 273 |
| 23 | 3300006846 | Ga0075430_100018889 | Ga0075430_1000188893 | 273 |
| 24 | 3300006847 | Ga0075431_100140936 | Ga0075431_1001409362 | 273 |
| 25 | 3300006852 | Ga0075433_10231042 | Ga0075433_102310422 | 273 |
| 26 | 3300006871 | Ga0075434_100036174 | Ga0075434_1000361749 | 273 |
| 27 | 3300006880 | Ga0075429_100079801 | Ga0075429_1000798012 | 273 |
| 28 | 3300006881 | Ga0068865_100482870 | Ga0068865_1004828701 | 273 |
| 29 | 3300009094 | Ga0111539_10042650 | Ga0111539_100426502 | 273 |
| 30 | 3300009098 | Ga0105245_10079557 | Ga0105245_100795572 | 273 |
| 31 | 3300009147 | Ga0114129_10125802 | Ga0114129_101258022 | 273 |
| 32 | 3300009177 | Ga0105248_10006263 | Ga0105248_100062632 | 273 |
| 33 | 3300010375 | Ga0105239_10131425 | Ga0105239_101314251 | 273 |
| 34 | 3300013100 | Ga0157373_10250627 | Ga0157373_102506272 | 273 |
| 35 | 3300013296 | Ga0157374_10037319 | Ga0157374_100373195 | 273 |
| 36 | 3300013307 | Ga0157372_10006245 | Ga0157372_100062459 | 273 |
| 37 | 3300014325 | Ga0163163_10072523 | Ga0163163_100725233 | 273 |
| 38 | 3300014745 | Ga0157377_10102716 | Ga0157377_101027162 | 273 |
| 39 | 3300014969 | Ga0157376_10029686 | Ga0157376_100296864 | 273 |
| 40 | 3300014969 | Ga0157376_10724175 | Ga0157376_107241751 | 273 |
| 41 | 3300025909 | Ga0207705_10121776 | Ga0207705_101217761 | 273 |
| 42 | 3300025913 | Ga0207695_10029049 | Ga0207695_100290492 | 273 |
| 43 | 3300025919 | Ga0207657_10020505 | Ga0207657_100205052 | 273 |
| 44 | 3300025920 | Ga0207649_10118716 | Ga0207649_101187162 | 273 |
| 45 | 3300025931 | Ga0207644_10172231 | Ga0207644_101722312 | 273 |
| 46 | 3300025944 | Ga0207661_10126476 | Ga0207661_101264761 | 273 |
| 47 | 3300025945 | Ga0207679_10124704 | Ga0207679_101247042 | 273 |
| 48 | 3300026041 | Ga0207639_10275045 | Ga0207639_102750452 | 273 |
| 49 | 3300026041 | Ga0207639_10284319 | Ga0207639_102843192 | 273 |
| 50 | 3300026088 | Ga0207641_10058824 | Ga0207641_100588242 | 273 |
| 51 | 3300026095 | Ga0207676_10019547 | Ga0207676_100195475 | 273 |
| 52 | 3300026116 | Ga0207674_10015782 | Ga0207674_100157825 | 273 |
| 53 | 3300027907 | Ga0207428_10002358 | Ga0207428_1000235817 | 273 |
| 54 | 3300028379 | Ga0268266_10258496 | Ga0268266_102584961 | 273 |
| 55 | 3300037471 | Ga0395905_0197190 | Ga0395905_0197190_899_1744 | 273 |
| 56 | 3300047443 | Ga0495687_000921 | Ga0495687_000921_16054_16878 | 273 |
| 57 | 3300048915 | Ga0496112_0112479 | Ga0496112_0112479_1465_2310 | 273 |
| 58 | 3300050508 | nmdc:mga09592_85276_c1 | nmdc:mga09592_85276_c1_997_1839 | 273 |
| 59 | 3300050510 | nmdc:mga06r32_16971_c1 | nmdc:mga06r32_16971_c1_2195_3037 | 273 |
| 60 | 3300050512 | nmdc:mga0n895_29435_c1 | nmdc:mga0n895_29435_c1_410_1252 | 273 |
| 61 | 3300050515 | nmdc:mga0a205_31051_c1 | nmdc:mga0a205_31051_c1_2290_3132 | 273 |
| 62 | 3300003215 | JGI25153J46596_10001277 | JGI25153J46596_100012774 | 274 |
| 63 | 3300003215 | JGI25153J46596_10003243 | JGI25153J46596_100032437 | 274 |
| 64 | 3300003354 | JGI25160J50197_1000710 | JGI25160J50197_100071010 | 274 |
| 65 | 3300003354 | JGI25160J50197_1003342 | JGI25160J50197_10033429 | 274 |
| 66 | 3300003374 | JGI25161J50226_1009853 | JGI25161J50226_10098533 | 274 |
| 67 | 3300003762 | Ga0055542_1003323 | Ga0055542_10033234 | 274 |
| 68 | 3300003792 | Ga0055540_1004160 | Ga0055540_10041606 | 274 |
| 69 | 3300003792 | Ga0055540_1005734 | Ga0055540_10057343 | 274 |
| 70 | 3300003792 | Ga0055540_1010901 | Ga0055540_10109012 | 274 |
| 71 | 3300003794 | Ga0055531_10009365 | Ga0055531_100093652 | 274 |
| 72 | 3300004800 | Ga0058861_10089271 | Ga0058861_100892713 | 274 |
| 73 | 3300004803 | Ga0058862_10085905 | Ga0058862_100859052 | 274 |
| 74 | 3300005262 | Ga0065165_1000721 | Ga0065165_10007211 | 274 |
| 75 | 3300005262 | Ga0065165_1008083 | Ga0065165_10080834 | 274 |
| 76 | 3300005262 | Ga0065165_1023885 | Ga0065165_10238853 | 274 |
| 77 | 3300005290 | Ga0065712_10181387 | Ga0065712_101813872 | 274 |
| 78 | 3300005293 | Ga0065715_10010704 | Ga0065715_100107043 | 274 |
| 79 | 3300005293 | Ga0065715_10021897 | Ga0065715_100218972 | 274 |
| 80 | 3300005293 | Ga0065715_10307578 | Ga0065715_103075781 | 274 |
| 81 | 3300005295 | Ga0065707_10027623 | Ga0065707_100276231 | 274 |
| 82 | 3300005327 | Ga0070658_10046828 | Ga0070658_100468282 | 274 |
| 83 | 3300005327 | Ga0070658_10054420 | Ga0070658_100544202 | 274 |
| 84 | 3300005328 | Ga0070676_10252359 | Ga0070676_102523591 | 274 |
| 85 | 3300005329 | Ga0070683_100000936 | Ga0070683_1000009364 | 274 |
| 86 | 3300005329 | Ga0070683_100109810 | Ga0070683_1001098102 | 274 |
| 87 | 3300005331 | Ga0070670_100059090 | Ga0070670_1000590901 | 274 |
| 88 | 3300005334 | Ga0068869_100043066 | Ga0068869_1000430664 | 274 |
| 89 | 3300005334 | Ga0068869_100449642 | Ga0068869_1004496421 | 274 |
| 90 | 3300005335 | Ga0070666_10014585 | Ga0070666_100145852 | 274 |
| 91 | 3300005335 | Ga0070666_10136178 | Ga0070666_101361782 | 274 |
| 92 | 3300005336 | Ga0070680_100252253 | Ga0070680_1002522533 | 274 |
| 93 | 3300005336 | Ga0070680_100437927 | Ga0070680_1004379271 | 274 |
| 94 | 3300005338 | Ga0068868_100028072 | Ga0068868_1000280726 | 274 |
| 95 | 3300005338 | Ga0068868_100091761 | Ga0068868_1000917613 | 274 |
| 96 | 3300005339 | Ga0070660_100043845 | Ga0070660_1000438451 | 274 |
| 97 | 3300005340 | Ga0070689_100160422 | Ga0070689_1001604222 | 274 |
| 98 | 3300005341 | Ga0070691_10046396 | Ga0070691_100463961 | 274 |
| 99 | 3300005344 | Ga0070661_100024549 | Ga0070661_1000245492 | 274 |
| 100 | 3300005344 | Ga0070661_100116522 | Ga0070661_1001165222 | 274 |
| 101 | 3300005347 | Ga0070668_100002970 | Ga0070668_1000029706 | 274 |
| 102 | 3300005347 | Ga0070668_100010579 | Ga0070668_1000105798 | 274 |
| 103 | 3300005347 | Ga0070668_100033360 | Ga0070668_1000333603 | 274 |
| 104 | 3300005347 | Ga0070668_100093912 | Ga0070668_1000939122 | 274 |
| 105 | 3300005347 | Ga0070668_100259241 | Ga0070668_1002592412 | 274 |
| 106 | 3300005353 | Ga0070669_100003310 | Ga0070669_1000033106 | 274 |
| 107 | 3300005353 | Ga0070669_100439084 | Ga0070669_1004390841 | 274 |
| 108 | 3300005354 | Ga0070675_100018024 | Ga0070675_1000180245 | 274 |
| 109 | 3300005354 | Ga0070675_100028318 | Ga0070675_1000283183 | 274 |
| 110 | 3300005354 | Ga0070675_100371124 | Ga0070675_1003711241 | 274 |
| 111 | 3300005354 | Ga0070675_100372051 | Ga0070675_1003720512 | 274 |
| 112 | 3300005355 | Ga0070671_100268451 | Ga0070671_1002684511 | 274 |
| 113 | 3300005356 | Ga0070674_100004168 | Ga0070674_1000041684 | 274 |
| 114 | 3300005356 | Ga0070674_100020678 | Ga0070674_1000206785 | 274 |
| 115 | 3300005356 | Ga0070674_100089083 | Ga0070674_1000890832 | 274 |
| 116 | 3300005364 | Ga0070673_100058879 | Ga0070673_1000588791 | 274 |
| 117 | 3300005365 | Ga0070688_100132325 | Ga0070688_1001323252 | 274 |
| 118 | 3300005365 | Ga0070688_100174886 | Ga0070688_1001748862 | 274 |
| 119 | 3300005366 | Ga0070659_100077903 | Ga0070659_1000779033 | 274 |
| 120 | 3300005366 | Ga0070659_100166133 | Ga0070659_1001661331 | 274 |
| 121 | 3300005367 | Ga0070667_100048193 | Ga0070667_1000481932 | 274 |
| 122 | 3300005367 | Ga0070667_100186665 | Ga0070667_1001866652 | 274 |
| 123 | 3300005435 | Ga0070714_100054764 | Ga0070714_1000547642 | 274 |
| 124 | 3300005436 | Ga0070713_100050254 | Ga0070713_1000502542 | 274 |
| 125 | 3300005436 | Ga0070713_100463626 | Ga0070713_1004636261 | 274 |
| 126 | 3300005439 | Ga0070711_100057300 | Ga0070711_1000573002 | 274 |
| 127 | 3300005440 | Ga0070705_100141910 | Ga0070705_1001419102 | 274 |
| 128 | 3300005440 | Ga0070705_100156878 | Ga0070705_1001568781 | 274 |
| 129 | 3300005444 | Ga0070694_100170321 | Ga0070694_1001703211 | 274 |
| 130 | 3300005445 | Ga0070708_100045773 | Ga0070708_1000457735 | 274 |
| 131 | 3300005445 | Ga0070708_100049795 | Ga0070708_1000497952 | 274 |
| 132 | 3300005445 | Ga0070708_100396425 | Ga0070708_1003964252 | 274 |
| 133 | 3300005455 | Ga0070663_100124305 | Ga0070663_1001243052 | 274 |
| 134 | 3300005455 | Ga0070663_100222134 | Ga0070663_1002221342 | 274 |
| 135 | 3300005455 | Ga0070663_100368519 | Ga0070663_1003685192 | 274 |
| 136 | 3300005456 | Ga0070678_100059686 | Ga0070678_1000596862 | 274 |
| 137 | 3300005456 | Ga0070678_100074297 | Ga0070678_1000742972 | 274 |
| 138 | 3300005456 | Ga0070678_100217819 | Ga0070678_1002178193 | 274 |
| 139 | 3300005456 | Ga0070678_100267727 | Ga0070678_1002677271 | 274 |
| 140 | 3300005456 | Ga0070678_100619333 | Ga0070678_1006193331 | 274 |
| 141 | 3300005457 | Ga0070662_100000224 | Ga0070662_10000022413 | 274 |
| 142 | 3300005457 | Ga0070662_100151896 | Ga0070662_1001518962 | 274 |
| 143 | 3300005457 | Ga0070662_100250519 | Ga0070662_1002505191 | 274 |
| 144 | 3300005457 | Ga0070662_100320490 | Ga0070662_1003204901 | 274 |
| 145 | 3300005457 | Ga0070662_100554960 | Ga0070662_1005549601 | 274 |
| 146 | 3300005459 | Ga0068867_100031914 | Ga0068867_1000319142 | 274 |
| 147 | 3300005467 | Ga0070706_100029541 | Ga0070706_1000295414 | 274 |
| 148 | 3300005467 | Ga0070706_100243051 | Ga0070706_1002430512 | 274 |
| 149 | 3300005467 | Ga0070706_100248543 | Ga0070706_1002485431 | 274 |
| 150 | 3300005467 | Ga0070706_100380280 | Ga0070706_1003802802 | 274 |
| 151 | 3300005468 | Ga0070707_100236357 | Ga0070707_1002363572 | 274 |
| 152 | 3300005471 | Ga0070698_100094463 | Ga0070698_1000944632 | 274 |
| 153 | 3300005518 | Ga0070699_100002512 | Ga0070699_1000025129 | 274 |
| 154 | 3300005518 | Ga0070699_100055334 | Ga0070699_1000553344 | 274 |
| 155 | 3300005518 | Ga0070699_100068729 | Ga0070699_1000687292 | 274 |
| 156 | 3300005518 | Ga0070699_100276137 | Ga0070699_1002761372 | 274 |
| 157 | 3300005530 | Ga0070679_100165782 | Ga0070679_1001657822 | 274 |
| 158 | 3300005535 | Ga0070684_100019719 | Ga0070684_1000197195 | 274 |
| 159 | 3300005536 | Ga0070697_100046072 | Ga0070697_1000460721 | 274 |
| 160 | 3300005536 | Ga0070697_100268363 | Ga0070697_1002683632 | 274 |
| 161 | 3300005543 | Ga0070672_100011139 | Ga0070672_1000111398 | 274 |
| 162 | 3300005543 | Ga0070672_100088810 | Ga0070672_1000888102 | 274 |
| 163 | 3300005545 | Ga0070695_100067850 | Ga0070695_1000678503 | 274 |
| 164 | 3300005548 | Ga0070665_100126012 | Ga0070665_1001260122 | 274 |
| 165 | 3300005548 | Ga0070665_100306758 | Ga0070665_1003067582 | 274 |
| 166 | 3300005548 | Ga0070665_100316182 | Ga0070665_1003161822 | 274 |
| 167 | 3300005548 | Ga0070665_100629071 | Ga0070665_1006290712 | 274 |
| 168 | 3300005549 | Ga0070704_100100225 | Ga0070704_1001002253 | 274 |
| 169 | 3300005563 | Ga0068855_100388521 | Ga0068855_1003885211 | 274 |
| 170 | 3300005564 | Ga0070664_100050681 | Ga0070664_1000506812 | 274 |
| 171 | 3300005578 | Ga0068854_100489607 | Ga0068854_1004896071 | 274 |
| 172 | 3300005615 | Ga0070702_100116239 | Ga0070702_1001162392 | 274 |
| 173 | 3300005616 | Ga0068852_100080278 | Ga0068852_1000802782 | 274 |
| 174 | 3300005616 | Ga0068852_100213734 | Ga0068852_1002137342 | 274 |
| 175 | 3300005719 | Ga0068861_100002901 | Ga0068861_1000029016 | 274 |
| 176 | 3300005719 | Ga0068861_100018409 | Ga0068861_1000184093 | 274 |
| 177 | 3300005719 | Ga0068861_100083156 | Ga0068861_1000831564 | 274 |
| 178 | 3300005719 | Ga0068861_100088820 | Ga0068861_1000888202 | 274 |
| 179 | 3300005719 | Ga0068861_100498255 | Ga0068861_1004982551 | 274 |
| 180 | 3300005834 | Ga0068851_10038537 | Ga0068851_100385372 | 274 |
| 181 | 3300005840 | Ga0068870_10000970 | Ga0068870_100009702 | 274 |
| 182 | 3300005841 | Ga0068863_100134656 | Ga0068863_1001346562 | 274 |
| 183 | 3300005841 | Ga0068863_100147749 | Ga0068863_1001477492 | 274 |
| 184 | 3300005841 | Ga0068863_100204940 | Ga0068863_1002049403 | 274 |
| 185 | 3300005841 | Ga0068863_100229612 | Ga0068863_1002296121 | 274 |
| 186 | 3300005841 | Ga0068863_100251302 | Ga0068863_1002513021 | 274 |
| 187 | 3300005842 | Ga0068858_100025545 | Ga0068858_1000255456 | 274 |
| 188 | 3300005842 | Ga0068858_100042002 | Ga0068858_1000420024 | 274 |
| 189 | 3300005842 | Ga0068858_100056317 | Ga0068858_1000563172 | 274 |
| 190 | 3300005843 | Ga0068860_100006936 | Ga0068860_1000069367 | 274 |
| 191 | 3300005843 | Ga0068860_100049874 | Ga0068860_1000498745 | 274 |
| 192 | 3300005843 | Ga0068860_100061429 | Ga0068860_1000614294 | 274 |
| 193 | 3300005843 | Ga0068860_100212061 | Ga0068860_1002120612 | 274 |
| 194 | 3300005844 | Ga0068862_100000841 | Ga0068862_10000084113 | 274 |
| 195 | 3300005844 | Ga0068862_100079179 | Ga0068862_1000791792 | 274 |
| 196 | 3300005937 | Ga0081455_10001668 | Ga0081455_100016682 | 274 |
| 197 | 3300005937 | Ga0081455_10005180 | Ga0081455_100051806 | 274 |
| 198 | 3300005937 | Ga0081455_10006288 | Ga0081455_100062888 | 274 |
| 199 | 3300005937 | Ga0081455_10049461 | Ga0081455_100494612 | 274 |
| 200 | 3300005981 | Ga0081538_10096999 | Ga0081538_100969992 | 274 |
| 201 | 3300005983 | Ga0081540_1000688 | Ga0081540_100068816 | 274 |
| 202 | 3300005983 | Ga0081540_1000739 | Ga0081540_100073945 | 274 |
| 203 | 3300005983 | Ga0081540_1047569 | Ga0081540_10475692 | 274 |
| 204 | 3300005985 | Ga0081539_10001833 | Ga0081539_1000183332 | 274 |
| 205 | 3300006038 | Ga0075365_10029757 | Ga0075365_100297573 | 274 |
| 206 | 3300006038 | Ga0075365_10064681 | Ga0075365_100646812 | 274 |
| 207 | 3300006038 | Ga0075365_10079499 | Ga0075365_100794992 | 274 |
| 208 | 3300006038 | Ga0075365_10090197 | Ga0075365_100901972 | 274 |
| 209 | 3300006042 | Ga0075368_10100078 | Ga0075368_101000782 | 274 |
| 210 | 3300006048 | Ga0075363_100033297 | Ga0075363_1000332973 | 274 |
| 211 | 3300006175 | Ga0070712_100174188 | Ga0070712_1001741882 | 274 |
| 212 | 3300006175 | Ga0070712_100207987 | Ga0070712_1002079872 | 274 |
| 213 | 3300006175 | Ga0070712_100258067 | Ga0070712_1002580672 | 274 |
| 214 | 3300006177 | Ga0075362_10000378 | Ga0075362_1000037817 | 274 |
| 215 | 3300006177 | Ga0075362_10013889 | Ga0075362_100138893 | 274 |
| 216 | 3300006178 | Ga0075367_10024462 | Ga0075367_100244624 | 274 |
| 217 | 3300006186 | Ga0075369_10005701 | Ga0075369_100057012 | 274 |
| 218 | 3300006186 | Ga0075369_10049001 | Ga0075369_100490011 | 274 |
| 219 | 3300006186 | Ga0075369_10071660 | Ga0075369_100716603 | 274 |
| 220 | 3300006195 | Ga0075366_10027098 | Ga0075366_100270984 | 274 |
| 221 | 3300006195 | Ga0075366_10222617 | Ga0075366_102226171 | 274 |
| 222 | 3300006237 | Ga0097621_100030634 | Ga0097621_1000306343 | 274 |
| 223 | 3300006358 | Ga0068871_100021666 | Ga0068871_1000216664 | 274 |
| 224 | 3300006358 | Ga0068871_100060493 | Ga0068871_1000604931 | 274 |
| 225 | 3300006844 | Ga0075428_100019819 | Ga0075428_1000198197 | 274 |
| 226 | 3300006846 | Ga0075430_100045336 | Ga0075430_1000453363 | 274 |
| 227 | 3300006847 | Ga0075431_100018004 | Ga0075431_1000180047 | 274 |
| 228 | 3300006847 | Ga0075431_100073613 | Ga0075431_1000736132 | 274 |
| 229 | 3300006852 | Ga0075433_10000196 | Ga0075433_1000019618 | 274 |
| 230 | 3300006852 | Ga0075433_10002289 | Ga0075433_1000228912 | 274 |
| 231 | 3300006852 | Ga0075433_10441342 | Ga0075433_104413421 | 274 |
| 232 | 3300006871 | Ga0075434_100002691 | Ga0075434_1000026918 | 274 |
| 233 | 3300006871 | Ga0075434_100032415 | Ga0075434_1000324154 | 274 |
| 234 | 3300006871 | Ga0075434_100043508 | Ga0075434_1000435083 | 274 |
| 235 | 3300006871 | Ga0075434_100173174 | Ga0075434_1001731743 | 274 |
| 236 | 3300006871 | Ga0075434_100223062 | Ga0075434_1002230622 | 274 |
| 237 | 3300006871 | Ga0075434_100376014 | Ga0075434_1003760142 | 274 |
| 238 | 3300006880 | Ga0075429_100014540 | Ga0075429_1000145403 | 274 |
| 239 | 3300006914 | Ga0075436_100001361 | Ga0075436_10000136110 | 274 |
| 240 | 3300006942 | Ga0099824_1021533 | Ga0099824_10215333 | 274 |
| 241 | 3300007076 | Ga0075435_100013352 | Ga0075435_1000133526 | 274 |
| 242 | 3300007076 | Ga0075435_100033111 | Ga0075435_1000331114 | 274 |
| 243 | 3300007076 | Ga0075435_100054651 | Ga0075435_1000546511 | 274 |
| 244 | 3300007076 | Ga0075435_100097774 | Ga0075435_1000977743 | 274 |
| 245 | 3300007265 | Ga0099794_10021388 | Ga0099794_100213883 | 274 |
| 246 | 3300009093 | Ga0105240_10001146 | Ga0105240_1000114643 | 274 |
| 247 | 3300009093 | Ga0105240_10150877 | Ga0105240_101508773 | 274 |
| 248 | 3300009094 | Ga0111539_10097826 | Ga0111539_100978263 | 274 |
| 249 | 3300009094 | Ga0111539_10310362 | Ga0111539_103103622 | 274 |
| 250 | 3300009098 | Ga0105245_10165228 | Ga0105245_101652283 | 274 |
| 251 | 3300009101 | Ga0105247_10052360 | Ga0105247_100523602 | 274 |
| 252 | 3300009101 | Ga0105247_10188844 | Ga0105247_101888442 | 274 |
| 253 | 3300009147 | Ga0114129_10032034 | Ga0114129_100320347 | 274 |
| 254 | 3300009147 | Ga0114129_10037094 | Ga0114129_100370941 | 274 |
| 255 | 3300009147 | Ga0114129_10119597 | Ga0114129_101195974 | 274 |
| 256 | 3300009147 | Ga0114129_10128927 | Ga0114129_101289273 | 274 |
| 257 | 3300009147 | Ga0114129_10327486 | Ga0114129_103274862 | 274 |
| 258 | 3300009147 | Ga0114129_10525243 | Ga0114129_105252431 | 274 |
| 259 | 3300009148 | Ga0105243_10161575 | Ga0105243_101615752 | 274 |
| 260 | 3300009148 | Ga0105243_10245250 | Ga0105243_102452502 | 274 |
| 261 | 3300009174 | Ga0105241_10027208 | Ga0105241_100272084 | 274 |
| 262 | 3300009176 | Ga0105242_10215240 | Ga0105242_102152402 | 274 |
| 263 | 3300009177 | Ga0105248_10006970 | Ga0105248_100069706 | 274 |
| 264 | 3300009177 | Ga0105248_10021325 | Ga0105248_100213254 | 274 |
| 265 | 3300009177 | Ga0105248_10646171 | Ga0105248_106461711 | 274 |
| 266 | 3300009177 | Ga0105248_10839840 | Ga0105248_108398401 | 274 |
| 267 | 3300009545 | Ga0105237_10041847 | Ga0105237_100418472 | 274 |
| 268 | 3300009551 | Ga0105238_10329720 | Ga0105238_103297202 | 274 |
| 269 | 3300009553 | Ga0105249_10000653 | Ga0105249_1000065325 | 274 |
| 270 | 3300009553 | Ga0105249_10066278 | Ga0105249_100662783 | 274 |
| 271 | 3300009553 | Ga0105249_10224028 | Ga0105249_102240282 | 274 |
| 272 | 3300009553 | Ga0105249_10227082 | Ga0105249_102270821 | 274 |
| 273 | 3300010375 | Ga0105239_10063253 | Ga0105239_100632532 | 274 |
| 274 | 3300010375 | Ga0105239_10077256 | Ga0105239_100772562 | 274 |
| 275 | 3300010375 | Ga0105239_10081105 | Ga0105239_100811054 | 274 |
| 276 | 3300010375 | Ga0105239_10106945 | Ga0105239_101069452 | 274 |
| 277 | 3300010375 | Ga0105239_10156146 | Ga0105239_101561462 | 274 |
| 278 | 3300010375 | Ga0105239_10204092 | Ga0105239_102040922 | 274 |
| 279 | 3300010375 | Ga0105239_10424519 | Ga0105239_104245192 | 274 |
| 280 | 3300010375 | Ga0105239_10518636 | Ga0105239_105186361 | 274 |
| 281 | 3300013296 | Ga0157374_10083317 | Ga0157374_100833171 | 274 |
| 282 | 3300013296 | Ga0157374_10211300 | Ga0157374_102113002 | 274 |
| 283 | 3300013297 | Ga0157378_10108212 | Ga0157378_101082121 | 274 |
| 284 | 3300013297 | Ga0157378_10122492 | Ga0157378_101224922 | 274 |
| 285 | 3300013297 | Ga0157378_10236269 | Ga0157378_102362691 | 274 |
| 286 | 3300013306 | Ga0163162_10002044 | Ga0163162_1000204413 | 274 |
| 287 | 3300013306 | Ga0163162_10004882 | Ga0163162_100048826 | 274 |
| 288 | 3300013306 | Ga0163162_10266217 | Ga0163162_102662172 | 274 |
| 289 | 3300013306 | Ga0163162_10296879 | Ga0163162_102968792 | 274 |
| 290 | 3300013306 | Ga0163162_10306192 | Ga0163162_103061922 | 274 |
| 291 | 3300013308 | Ga0157375_10088941 | Ga0157375_100889413 | 274 |
| 292 | 3300013308 | Ga0157375_10153199 | Ga0157375_101531991 | 274 |
| 293 | 3300013308 | Ga0157375_10219430 | Ga0157375_102194302 | 274 |
| 294 | 3300014325 | Ga0163163_10015523 | Ga0163163_100155234 | 274 |
| 295 | 3300014325 | Ga0163163_10270509 | Ga0163163_102705092 | 274 |
| 296 | 3300014325 | Ga0163163_10332917 | Ga0163163_103329171 | 274 |
| 297 | 3300014325 | Ga0163163_10476867 | Ga0163163_104768671 | 274 |
| 298 | 3300014326 | Ga0157380_10103397 | Ga0157380_101033973 | 274 |
| 299 | 3300014326 | Ga0157380_10505086 | Ga0157380_105050861 | 274 |
| 300 | 3300014745 | Ga0157377_10061106 | Ga0157377_100611063 | 274 |
| 301 | 3300014968 | Ga0157379_10000589 | Ga0157379_100005896 | 274 |
| 302 | 3300014969 | Ga0157376_10079589 | Ga0157376_100795892 | 274 |
| 303 | 3300014969 | Ga0157376_10126954 | Ga0157376_101269542 | 274 |
| 304 | 3300014969 | Ga0157376_10129146 | Ga0157376_101291462 | 274 |
| 305 | 3300014969 | Ga0157376_10374350 | Ga0157376_103743502 | 274 |
| 306 | 3300014969 | Ga0157376_10483416 | Ga0157376_104834161 | 274 |
| 307 | 3300017792 | Ga0163161_10048757 | Ga0163161_100487573 | 274 |
| 308 | 3300020077 | Ga0206351_10413641 | Ga0206351_104136412 | 274 |
| 309 | 3300020078 | Ga0206352_10167672 | Ga0206352_101676721 | 274 |
| 310 | 3300020082 | Ga0206353_10230641 | Ga0206353_102306411 | 274 |
| 311 | 3300021321 | Ga0214542_1000007 | Ga0214542_1000007125 | 274 |
| 312 | 3300021324 | Ga0214545_1000006 | Ga0214545_1000006168 | 274 |
| 313 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009256 | 274 |
| 314 | 3300021361 | Ga0213872_10031678 | Ga0213872_100316781 | 274 |
| 315 | 3300021377 | Ga0213874_10027830 | Ga0213874_100278301 | 274 |
| 316 | 3300021377 | Ga0213874_10051968 | Ga0213874_100519681 | 274 |
| 317 | 3300021384 | Ga0213876_10000830 | Ga0213876_1000083010 | 274 |
| 318 | 3300021384 | Ga0213876_10153108 | Ga0213876_101531081 | 274 |
| 319 | 3300021441 | Ga0213871_10003523 | Ga0213871_100035233 | 274 |
| 320 | 3300024225 | Ga0224572_1006262 | Ga0224572_10062622 | 274 |
| 321 | 3300025230 | Ga0209563_102659 | Ga0209563_1026595 | 274 |
| 322 | 3300025245 | Ga0207425_1005829 | Ga0207425_10058292 | 274 |
| 323 | 3300025253 | Ga0209677_103672 | Ga0209677_1036725 | 274 |
| 324 | 3300025254 | Ga0209148_1000216 | Ga0209148_100021685 | 274 |
| 325 | 3300025261 | Ga0209233_1000006 | Ga0209233_10000061281 | 274 |
| 326 | 3300025261 | Ga0209233_1026747 | Ga0209233_10267471 | 274 |
| 327 | 3300025272 | Ga0209455_1004148 | Ga0209455_10041484 | 274 |
| 328 | 3300025273 | Ga0209673_1022298 | Ga0209673_10222982 | 274 |
| 329 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015617 | 274 |
| 330 | 3300025297 | Ga0209758_1000161 | Ga0209758_100016149 | 274 |
| 331 | 3300025297 | Ga0209758_1000523 | Ga0209758_100052338 | 274 |
| 332 | 3300025297 | Ga0209758_1000673 | Ga0209758_100067320 | 274 |
| 333 | 3300025297 | Ga0209758_1001304 | Ga0209758_100130431 | 274 |
| 334 | 3300025297 | Ga0209758_1002531 | Ga0209758_100253113 | 274 |
| 335 | 3300025297 | Ga0209758_1012357 | Ga0209758_10123575 | 274 |
| 336 | 3300025299 | Ga0209256_1004503 | Ga0209256_10045039 | 274 |
| 337 | 3300025302 | Ga0207426_1000186 | Ga0207426_1000186143 | 274 |
| 338 | 3300025302 | Ga0207426_1001117 | Ga0207426_10011176 | 274 |
| 339 | 3300025302 | Ga0207426_1006768 | Ga0207426_10067686 | 274 |
| 340 | 3300025302 | Ga0207426_1031513 | Ga0207426_10315133 | 274 |
| 341 | 3300025303 | Ga0209051_1000842 | Ga0209051_100084217 | 274 |
| 342 | 3300025303 | Ga0209051_1069682 | Ga0209051_10696822 | 274 |
| 343 | 3300025304 | Ga0209257_1004161 | Ga0209257_10041616 | 274 |
| 344 | 3300025304 | Ga0209257_1012222 | Ga0209257_10122225 | 274 |
| 345 | 3300025304 | Ga0209257_1014736 | Ga0209257_10147363 | 274 |
| 346 | 3300025315 | Ga0207697_10079172 | Ga0207697_100791721 | 274 |
| 347 | 3300025321 | Ga0207656_10027517 | Ga0207656_100275172 | 274 |
| 348 | 3300025893 | Ga0207682_10017983 | Ga0207682_100179832 | 274 |
| 349 | 3300025899 | Ga0207642_10070238 | Ga0207642_100702382 | 274 |
| 350 | 3300025900 | Ga0207710_10096455 | Ga0207710_100964552 | 274 |
| 351 | 3300025901 | Ga0207688_10033993 | Ga0207688_100339932 | 274 |
| 352 | 3300025901 | Ga0207688_10118132 | Ga0207688_101181322 | 274 |
| 353 | 3300025903 | Ga0207680_10051832 | Ga0207680_100518322 | 274 |
| 354 | 3300025905 | Ga0207685_10022593 | Ga0207685_100225931 | 274 |
| 355 | 3300025905 | Ga0207685_10081903 | Ga0207685_100819031 | 274 |
| 356 | 3300025907 | Ga0207645_10079516 | Ga0207645_100795162 | 274 |
| 357 | 3300025908 | Ga0207643_10001722 | Ga0207643_1000172213 | 274 |
| 358 | 3300025908 | Ga0207643_10145151 | Ga0207643_101451512 | 274 |
| 359 | 3300025909 | Ga0207705_10078789 | Ga0207705_100787892 | 274 |
| 360 | 3300025910 | Ga0207684_10000551 | Ga0207684_100005512 | 274 |
| 361 | 3300025910 | Ga0207684_10240802 | Ga0207684_102408021 | 274 |
| 362 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006247 | 274 |
| 363 | 3300025913 | Ga0207695_10107951 | Ga0207695_101079513 | 274 |
| 364 | 3300025913 | Ga0207695_10134837 | Ga0207695_101348372 | 274 |
| 365 | 3300025914 | Ga0207671_10001982 | Ga0207671_1000198211 | 274 |
| 366 | 3300025914 | Ga0207671_10245185 | Ga0207671_102451851 | 274 |
| 367 | 3300025914 | Ga0207671_10405747 | Ga0207671_104057471 | 274 |
| 368 | 3300025915 | Ga0207693_10092501 | Ga0207693_100925012 | 274 |
| 369 | 3300025915 | Ga0207693_10165227 | Ga0207693_101652272 | 274 |
| 370 | 3300025915 | Ga0207693_10186568 | Ga0207693_101865682 | 274 |
| 371 | 3300025915 | Ga0207693_10300660 | Ga0207693_103006602 | 274 |
| 372 | 3300025916 | Ga0207663_10005081 | Ga0207663_100050812 | 274 |
| 373 | 3300025916 | Ga0207663_10014189 | Ga0207663_100141893 | 274 |
| 374 | 3300025919 | Ga0207657_10015056 | Ga0207657_100150564 | 274 |
| 375 | 3300025919 | Ga0207657_10301289 | Ga0207657_103012892 | 274 |
| 376 | 3300025922 | Ga0207646_10136484 | Ga0207646_101364843 | 274 |
| 377 | 3300025923 | Ga0207681_10016589 | Ga0207681_100165894 | 274 |
| 378 | 3300025925 | Ga0207650_10001184 | Ga0207650_100011841 | 274 |
| 379 | 3300025925 | Ga0207650_10336880 | Ga0207650_103368802 | 274 |
| 380 | 3300025925 | Ga0207650_10419538 | Ga0207650_104195381 | 274 |
| 381 | 3300025926 | Ga0207659_10066989 | Ga0207659_100669891 | 274 |
| 382 | 3300025926 | Ga0207659_10072643 | Ga0207659_100726432 | 274 |
| 383 | 3300025926 | Ga0207659_10088213 | Ga0207659_100882132 | 274 |
| 384 | 3300025927 | Ga0207687_10067976 | Ga0207687_100679762 | 274 |
| 385 | 3300025927 | Ga0207687_10320104 | Ga0207687_103201042 | 274 |
| 386 | 3300025927 | Ga0207687_10574693 | Ga0207687_105746931 | 274 |
| 387 | 3300025928 | Ga0207700_10276746 | Ga0207700_102767461 | 274 |
| 388 | 3300025929 | Ga0207664_10004030 | Ga0207664_100040309 | 274 |
| 389 | 3300025929 | Ga0207664_10004183 | Ga0207664_100041838 | 274 |
| 390 | 3300025931 | Ga0207644_10117485 | Ga0207644_101174852 | 274 |
| 391 | 3300025931 | Ga0207644_10139220 | Ga0207644_101392202 | 274 |
| 392 | 3300025932 | Ga0207690_10040648 | Ga0207690_100406483 | 274 |
| 393 | 3300025932 | Ga0207690_10603417 | Ga0207690_106034171 | 274 |
| 394 | 3300025933 | Ga0207706_10000099 | Ga0207706_1000009932 | 274 |
| 395 | 3300025933 | Ga0207706_10074400 | Ga0207706_100744002 | 274 |
| 396 | 3300025933 | Ga0207706_10144932 | Ga0207706_101449322 | 274 |
| 397 | 3300025933 | Ga0207706_10146563 | Ga0207706_101465631 | 274 |
| 398 | 3300025933 | Ga0207706_10455101 | Ga0207706_104551012 | 274 |
| 399 | 3300025934 | Ga0207686_10092823 | Ga0207686_100928231 | 274 |
| 400 | 3300025934 | Ga0207686_10533616 | Ga0207686_105336161 | 274 |
| 401 | 3300025935 | Ga0207709_10157812 | Ga0207709_101578123 | 274 |
| 402 | 3300025937 | Ga0207669_10172641 | Ga0207669_101726412 | 274 |
| 403 | 3300025938 | Ga0207704_10241666 | Ga0207704_102416662 | 274 |
| 404 | 3300025938 | Ga0207704_10251728 | Ga0207704_102517282 | 274 |
| 405 | 3300025938 | Ga0207704_10558423 | Ga0207704_105584231 | 274 |
| 406 | 3300025938 | Ga0207704_10617928 | Ga0207704_106179281 | 274 |
| 407 | 3300025939 | Ga0207665_10057439 | Ga0207665_100574391 | 274 |
| 408 | 3300025940 | Ga0207691_10019910 | Ga0207691_100199105 | 274 |
| 409 | 3300025940 | Ga0207691_10084660 | Ga0207691_100846602 | 274 |
| 410 | 3300025941 | Ga0207711_10008722 | Ga0207711_100087225 | 274 |
| 411 | 3300025941 | Ga0207711_10033578 | Ga0207711_100335784 | 274 |
| 412 | 3300025941 | Ga0207711_10044828 | Ga0207711_100448284 | 274 |
| 413 | 3300025941 | Ga0207711_10151681 | Ga0207711_101516812 | 274 |
| 414 | 3300025941 | Ga0207711_10156504 | Ga0207711_101565041 | 274 |
| 415 | 3300025941 | Ga0207711_10178488 | Ga0207711_101784882 | 274 |
| 416 | 3300025941 | Ga0207711_10465869 | Ga0207711_104658692 | 274 |
| 417 | 3300025941 | Ga0207711_10676638 | Ga0207711_106766381 | 274 |
| 418 | 3300025942 | Ga0207689_10102081 | Ga0207689_101020812 | 274 |
| 419 | 3300025942 | Ga0207689_10182450 | Ga0207689_101824501 | 274 |
| 420 | 3300025944 | Ga0207661_10004116 | Ga0207661_100041163 | 274 |
| 421 | 3300025945 | Ga0207679_10026618 | Ga0207679_100266183 | 274 |
| 422 | 3300025945 | Ga0207679_10042358 | Ga0207679_100423582 | 274 |
| 423 | 3300025949 | Ga0207667_10202935 | Ga0207667_102029352 | 274 |
| 424 | 3300025960 | Ga0207651_10036256 | Ga0207651_100362562 | 274 |
| 425 | 3300025961 | Ga0207712_10000766 | Ga0207712_1000076611 | 274 |
| 426 | 3300025972 | Ga0207668_10001482 | Ga0207668_100014824 | 274 |
| 427 | 3300025972 | Ga0207668_10025322 | Ga0207668_100253225 | 274 |
| 428 | 3300025972 | Ga0207668_10187986 | Ga0207668_101879862 | 274 |
| 429 | 3300025981 | Ga0207640_10264089 | Ga0207640_102640891 | 274 |
| 430 | 3300025981 | Ga0207640_10350821 | Ga0207640_103508211 | 274 |
| 431 | 3300025986 | Ga0207658_10259166 | Ga0207658_102591662 | 274 |
| 432 | 3300025986 | Ga0207658_10419075 | Ga0207658_104190751 | 274 |
| 433 | 3300025986 | Ga0207658_10432943 | Ga0207658_104329431 | 274 |
| 434 | 3300026023 | Ga0207677_10736984 | Ga0207677_107369841 | 274 |
| 435 | 3300026035 | Ga0207703_10022818 | Ga0207703_100228182 | 274 |
| 436 | 3300026035 | Ga0207703_10128817 | Ga0207703_101288172 | 274 |
| 437 | 3300026035 | Ga0207703_10244529 | Ga0207703_102445291 | 274 |
| 438 | 3300026067 | Ga0207678_10004996 | Ga0207678_1000499612 | 274 |
| 439 | 3300026067 | Ga0207678_10030395 | Ga0207678_100303956 | 274 |
| 440 | 3300026067 | Ga0207678_10035091 | Ga0207678_100350914 | 274 |
| 441 | 3300026067 | Ga0207678_10143463 | Ga0207678_101434632 | 274 |
| 442 | 3300026067 | Ga0207678_10153886 | Ga0207678_101538861 | 274 |
| 443 | 3300026075 | Ga0207708_10035930 | Ga0207708_100359304 | 274 |
| 444 | 3300026078 | Ga0207702_10004466 | Ga0207702_1000446612 | 274 |
| 445 | 3300026078 | Ga0207702_10633823 | Ga0207702_106338231 | 274 |
| 446 | 3300026088 | Ga0207641_10067525 | Ga0207641_100675253 | 274 |
| 447 | 3300026088 | Ga0207641_10095784 | Ga0207641_100957843 | 274 |
| 448 | 3300026088 | Ga0207641_10169684 | Ga0207641_101696842 | 274 |
| 449 | 3300026088 | Ga0207641_10229583 | Ga0207641_102295832 | 274 |
| 450 | 3300026088 | Ga0207641_10329544 | Ga0207641_103295441 | 274 |
| 451 | 3300026088 | Ga0207641_10588017 | Ga0207641_105880171 | 274 |
| 452 | 3300026088 | Ga0207641_10660400 | Ga0207641_106604001 | 274 |
| 453 | 3300026089 | Ga0207648_10056899 | Ga0207648_100568992 | 274 |
| 454 | 3300026089 | Ga0207648_10352691 | Ga0207648_103526911 | 274 |
| 455 | 3300026118 | Ga0207675_100000743 | Ga0207675_10000074323 | 274 |
| 456 | 3300026118 | Ga0207675_100111244 | Ga0207675_1001112442 | 274 |
| 457 | 3300026118 | Ga0207675_100122674 | Ga0207675_1001226742 | 274 |
| 458 | 3300026118 | Ga0207675_100129842 | Ga0207675_1001298424 | 274 |
| 459 | 3300026118 | Ga0207675_100459009 | Ga0207675_1004590092 | 274 |
| 460 | 3300026118 | Ga0207675_100824362 | Ga0207675_1008243621 | 274 |
| 461 | 3300026121 | Ga0207683_10001266 | Ga0207683_100012662 | 274 |
| 462 | 3300026121 | Ga0207683_10003380 | Ga0207683_100033804 | 274 |
| 463 | 3300026121 | Ga0207683_10246292 | Ga0207683_102462921 | 274 |
| 464 | 3300026121 | Ga0207683_10349685 | Ga0207683_103496852 | 274 |
| 465 | 3300026142 | Ga0207698_10025077 | Ga0207698_100250774 | 274 |
| 466 | 3300027296 | Ga0209389_1000440 | Ga0209389_10004408 | 274 |
| 467 | 3300027357 | Ga0209589_1014238 | Ga0209589_10142388 | 274 |
| 468 | 3300027361 | Ga0209489_104739 | Ga0209489_1047398 | 274 |
| 469 | 3300027866 | Ga0209813_10061358 | Ga0209813_100613582 | 274 |
| 470 | 3300027866 | Ga0209813_10061471 | Ga0209813_100614712 | 274 |
| 471 | 3300027907 | Ga0207428_10040710 | Ga0207428_100407104 | 274 |
| 472 | 3300027907 | Ga0207428_10220291 | Ga0207428_102202911 | 274 |
| 473 | 3300028379 | Ga0268266_10003810 | Ga0268266_1000381015 | 274 |
| 474 | 3300028379 | Ga0268266_10137464 | Ga0268266_101374641 | 274 |
| 475 | 3300028379 | Ga0268266_10343456 | Ga0268266_103434562 | 274 |
| 476 | 3300028379 | Ga0268266_10383920 | Ga0268266_103839202 | 274 |
| 477 | 3300028379 | Ga0268266_10543218 | Ga0268266_105432181 | 274 |
| 478 | 3300028379 | Ga0268266_10605913 | Ga0268266_106059132 | 274 |
| 479 | 3300028380 | Ga0268265_10014015 | Ga0268265_100140153 | 274 |
| 480 | 3300028380 | Ga0268265_10038111 | Ga0268265_100381114 | 274 |
| 481 | 3300028381 | Ga0268264_10051634 | Ga0268264_100516344 | 274 |
| 482 | 3300028381 | Ga0268264_10078589 | Ga0268264_100785892 | 274 |
| 483 | 3300028381 | Ga0268264_10129884 | Ga0268264_101298842 | 274 |
| 484 | 3300028381 | Ga0268264_10201667 | Ga0268264_102016672 | 274 |
| 485 | 3300028556 | Ga0265337_1003252 | Ga0265337_10032523 | 274 |
| 486 | 3300028558 | Ga0265326_10008080 | Ga0265326_100080803 | 274 |
| 487 | 3300028563 | Ga0265319_1002546 | Ga0265319_10025468 | 274 |
| 488 | 3300028577 | Ga0265318_10001843 | Ga0265318_1000184310 | 274 |
| 489 | 3300028653 | Ga0265323_10000460 | Ga0265323_1000046012 | 274 |
| 490 | 3300028654 | Ga0265322_10003769 | Ga0265322_100037694 | 274 |
| 491 | 3300028666 | Ga0265336_10000496 | Ga0265336_1000049615 | 274 |
| 492 | 3300028794 | Ga0307515_10108806 | Ga0307515_101088061 | 274 |
| 493 | 3300028794 | Ga0307515_10221083 | Ga0307515_102210833 | 274 |
| 494 | 3300028800 | Ga0265338_10000207 | Ga0265338_1000020778 | 274 |
| 495 | 3300029957 | Ga0265324_10001132 | Ga0265324_100011328 | 274 |
| 496 | 3300031090 | Ga0265760_10006688 | Ga0265760_100066883 | 274 |
| 497 | 3300031241 | Ga0265325_10003746 | Ga0265325_100037462 | 274 |
| 498 | 3300031250 | Ga0265331_10015560 | Ga0265331_100155602 | 274 |
| 499 | 3300031456 | Ga0307513_10095445 | Ga0307513_100954453 | 274 |
| 500 | 3300031507 | Ga0307509_10073298 | Ga0307509_100732982 | 274 |
| 501 | 3300031595 | Ga0265313_10109740 | Ga0265313_101097402 | 274 |
| 502 | 3300031616 | Ga0307508_10290235 | Ga0307508_102902351 | 274 |
| 503 | 3300031711 | Ga0265314_10084887 | Ga0265314_100848872 | 274 |
| 504 | 3300031731 | Ga0307405_10086090 | Ga0307405_100860902 | 274 |
| 505 | 3300031824 | Ga0307413_10032230 | Ga0307413_100322302 | 274 |
| 506 | 3300031824 | Ga0307413_10368857 | Ga0307413_103688571 | 274 |
| 507 | 3300031838 | Ga0307518_10162193 | Ga0307518_101621932 | 274 |
| 508 | 3300031852 | Ga0307410_10002012 | Ga0307410_100020126 | 274 |
| 509 | 3300031901 | Ga0307406_10332970 | Ga0307406_103329702 | 274 |
| 510 | 3300031911 | Ga0307412_10167187 | Ga0307412_101671872 | 274 |
| 511 | 3300031995 | Ga0307409_100019897 | Ga0307409_1000198973 | 274 |
| 512 | 3300031995 | Ga0307409_100076356 | Ga0307409_1000763562 | 274 |
| 513 | 3300032002 | Ga0307416_100085731 | Ga0307416_1000857312 | 274 |
| 514 | 3300032002 | Ga0307416_100378134 | Ga0307416_1003781342 | 274 |
| 515 | 3300032005 | Ga0307411_10117923 | Ga0307411_101179232 | 274 |
| 516 | 3300032126 | Ga0307415_100587128 | Ga0307415_1005871281 | 274 |
| 517 | 3300032126 | Ga0307415_100771093 | Ga0307415_1007710931 | 274 |
| 518 | 3300033180 | Ga0307510_10000010 | Ga0307510_10000010285 | 274 |
| 519 | 3300033180 | Ga0307510_10002425 | Ga0307510_100024254 | 274 |
| 520 | 3300033180 | Ga0307510_10031827 | Ga0307510_100318276 | 274 |
| 521 | 3300033180 | Ga0307510_10136414 | Ga0307510_101364143 | 274 |
| 522 | 3300033442 | Ga0315911_1000017 | Ga0315911_1000017132 | 274 |
| 523 | 3300033544 | Ga0316215_1003916 | Ga0316215_10039162 | 274 |
| 524 | 3300034818 | Ga0373950_0022648 | Ga0373950_0022648_16_840 | 274 |
| 525 | 3300035088 | Ga0373940_0022910 | Ga0373940_0022910_514_1338 | 274 |
| 526 | 3300035088 | Ga0373940_0037550 | Ga0373940_0037550_154_978 | 274 |
| 527 | 3300035111 | Ga0373923_0007823 | Ga0373923_0007823_434_1258 | 274 |
| 528 | 3300035113 | Ga0373936_0025520 | Ga0373936_0025520_1447_2271 | 274 |
| 529 | 3300035118 | Ga0373954_0061010 | Ga0373954_0061010_201_1025 | 274 |
| 530 | 3300035118 | Ga0373954_0068969 | Ga0373954_0068969_330_1154 | 274 |
| 531 | 3300035119 | Ga0373956_0000975 | Ga0373956_0000975_5669_6493 | 274 |
| 532 | 3300035120 | Ga0373957_0004073 | Ga0373957_0004073_570_1394 | 274 |
| 533 | 3300035120 | Ga0373957_0012267 | Ga0373957_0012267_861_1685 | 274 |
| 534 | 3300035121 | Ga0373960_0024655 | Ga0373960_0024655_758_1582 | 274 |
| 535 | 3300035170 | Ga0373943_0003909 | Ga0373943_0003909_2374_3198 | 274 |
| 536 | 3300035171 | Ga0373946_0080865 | Ga0373946_0080865_431_1255 | 274 |
| 537 | 3300035172 | Ga0373955_0005613 | Ga0373955_0005613_3237_4061 | 274 |
| 538 | 3300035172 | Ga0373955_0087939 | Ga0373955_0087939_449_1273 | 274 |
| 539 | 3300035410 | Ga0373924_0031466 | Ga0373924_0031466_1281_2105 | 274 |
| 540 | 3300035410 | Ga0373924_0032874 | Ga0373924_0032874_242_1066 | 274 |
| 541 | 3300035691 | Ga0373931_0028816 | Ga0373931_0028816_522_1388 | 274 |
| 542 | 3300035691 | Ga0373931_0029512 | Ga0373931_0029512_922_1746 | 274 |
| 543 | 3300035692 | Ga0373935_0030339 | Ga0373935_0030339_332_1156 | 274 |
| 544 | 3300035692 | Ga0373935_0038926 | Ga0373935_0038926_368_1192 | 274 |
| 545 | 3300035692 | Ga0373935_0095961 | Ga0373935_0095961_995_1819 | 274 |
| 546 | 3300035724 | Ga0373933_0063572 | Ga0373933_0063572_241_1065 | 274 |
| 547 | 3300035724 | Ga0373933_0110245 | Ga0373933_0110245_758_1582 | 274 |
| 548 | 3300035725 | Ga0373947_0306169 | Ga0373947_0306169_164_988 | 274 |
| 549 | 3300036401 | Ga0373937_0049532 | Ga0373937_0049532_2780_3604 | 274 |
| 550 | 3300036401 | Ga0373937_0168741 | Ga0373937_0168741_121_945 | 274 |
| 551 | 3300036401 | Ga0373937_0569882 | Ga0373937_0569882_60_884 | 274 |
| 552 | 3300037068 | Ga0373925_0073646 | Ga0373925_0073646_783_1607 | 274 |
| 553 | 3300037068 | Ga0373925_0354679 | Ga0373925_0354679_18_842 | 274 |
| 554 | 3300037418 | Ga0395900_0072770 | Ga0395900_0072770_713_1618 | 274 |
| 555 | 3300037418 | Ga0395900_0094148 | Ga0395900_0094148_750_1574 | 274 |
| 556 | 3300037418 | Ga0395900_0189853 | Ga0395900_0189853_981_1805 | 274 |
| 557 | 3300037466 | Ga0395898_0008708 | Ga0395898_0008708_3250_4074 | 274 |
| 558 | 3300037466 | Ga0395898_0034738 | Ga0395898_0034738_290_1333 | 274 |
| 559 | 3300037466 | Ga0395898_0056803 | Ga0395898_0056803_321_1145 | 274 |
| 560 | 3300037466 | Ga0395898_0141503 | Ga0395898_0141503_1171_2076 | 274 |
| 561 | 3300037466 | Ga0395898_0413047 | Ga0395898_0413047_157_981 | 274 |
| 562 | 3300037466 | Ga0395898_0583670 | Ga0395898_0583670_137_961 | 274 |
| 563 | 3300037466 | Ga0395898_0585390 | Ga0395898_0585390_16_840 | 274 |
| 564 | 3300037466 | Ga0395898_0723277 | Ga0395898_0723277_47_871 | 274 |
| 565 | 3300037471 | Ga0395905_0051031 | Ga0395905_0051031_2553_3377 | 274 |
| 566 | 3300037471 | Ga0395905_0159776 | Ga0395905_0159776_1179_2003 | 274 |
| 567 | 3300037853 | Ga0436364_0450606 | Ga0436364_0450606_50_874 | 274 |
| 568 | 3300037853 | Ga0436364_1354805 | Ga0436364_1354805_683_1507 | 274 |
| 569 | 3300037853 | Ga0436364_1478902 | Ga0436364_1478902_1158_1982 | 274 |
| 570 | 3300038443 | Ga0395901_0035212 | Ga0395901_0035212_4018_4842 | 274 |
| 571 | 3300038443 | Ga0395901_0081439 | Ga0395901_0081439_1000_1905 | 274 |
| 572 | 3300038443 | Ga0395901_0104579 | Ga0395901_0104579_1375_2418 | 274 |
| 573 | 3300038443 | Ga0395901_0313904 | Ga0395901_0313904_357_1181 | 274 |
| 574 | 3300038443 | Ga0395901_0423159 | Ga0395901_0423159_156_980 | 274 |
| 575 | 3300038443 | Ga0395901_0641588 | Ga0395901_0641588_219_1043 | 274 |
| 576 | 3300038443 | Ga0395901_0851711 | Ga0395901_0851711_41_865 | 274 |
| 577 | 3300039437 | Ga0436365_0421020 | Ga0436365_0421020_3892_4716 | 274 |
| 578 | 3300039437 | Ga0436365_0584558 | Ga0436365_0584558_40_864 | 274 |
| 579 | 3300039437 | Ga0436365_1571889 | Ga0436365_1571889_40_864 | 274 |
| 580 | 3300039438 | Ga0436360_0531402 | Ga0436360_0531402_2625_3449 | 274 |
| 581 | 3300039438 | Ga0436360_0608758 | Ga0436360_0608758_3162_4019 | 274 |
| 582 | 3300039447 | Ga0436361_0279311 | Ga0436361_0279311_377_1258 | 274 |
| 583 | 3300039447 | Ga0436361_0795914 | Ga0436361_0795914_8105_8962 | 274 |
| 584 | 3300039450 | Ga0436363_0108190 | Ga0436363_0108190_1505_2359 | 274 |
| 585 | 3300039450 | Ga0436363_0115736 | Ga0436363_0115736_660_1484 | 274 |
| 586 | 3300039453 | Ga0436362_0133091 | Ga0436362_0133091_5162_5986 | 274 |
| 587 | 3300039453 | Ga0436362_0392491 | Ga0436362_0392491_15_839 | 274 |
| 588 | 3300039453 | Ga0436362_0462054 | Ga0436362_0462054_5153_6010 | 274 |
| 589 | 3300041491 | Ga0451833_1484977 | Ga0451833_1484977_301_1125 | 274 |
| 590 | 3300042001 | Ga0439441_008523 | Ga0439441_008523_394_1218 | 274 |
| 591 | 3300042005 | Ga0439448_0081193 | Ga0439448_0081193_179_1006 | 274 |
| 592 | 3300042016 | Ga0439463_020400 | Ga0439463_020400_403_1227 | 274 |
| 593 | 3300042157 | Ga0439458_0015364 | Ga0439458_0015364_394_1218 | 274 |
| 594 | 3300042157 | Ga0439458_0017524 | Ga0439458_0017524_601_1461 | 274 |
| 595 | 3300042435 | Ga0439434_0039928 | Ga0439434_0039928_235_1059 | 274 |
| 596 | 3300042438 | Ga0439459_0005704 | Ga0439459_0005704_1189_2013 | 274 |
| 597 | 3300042993 | Ga0439440_0046737 | Ga0439440_0046737_162_986 | 274 |
| 598 | 3300044658 | Ga0466972_0000136 | Ga0466972_0000136_45229_46053 | 274 |
| 599 | 3300044658 | Ga0466972_0005603 | Ga0466972_0005603_1903_2727 | 274 |
| 600 | 3300044683 | Ga0466965_0023854 | Ga0466965_0023854_2041_2865 | 274 |
| 601 | 3300044683 | Ga0466965_0102968 | Ga0466965_0102968_94_918 | 274 |
| 602 | 3300044735 | Ga0466968_0175419 | Ga0466968_0175419_98_922 | 274 |
| 603 | 3300044765 | Ga0466970_0005495 | Ga0466970_0005495_3027_3851 | 274 |
| 604 | 3300044765 | Ga0466970_0054899 | Ga0466970_0054899_949_1773 | 274 |
| 605 | 3300044842 | Ga0466957_0168668 | Ga0466957_0168668_426_1250 | 274 |
| 606 | 3300044901 | Ga0466960_0008953 | Ga0466960_0008953_1633_2457 | 274 |
| 607 | 3300044901 | Ga0466960_0112981 | Ga0466960_0112981_182_1006 | 274 |
| 608 | 3300045051 | Ga0451576_0067557 | Ga0451576_0067557_2866_3690 | 274 |
| 609 | 3300045051 | Ga0451576_0306918 | Ga0451576_0306918_272_1132 | 274 |
| 610 | 3300045051 | Ga0451576_0402191 | Ga0451576_0402191_485_1327 | 274 |
| 611 | 3300045976 | Ga0466967_0061249 | Ga0466967_0061249_1276_2100 | 274 |
| 612 | 3300045976 | Ga0466967_0073392 | Ga0466967_0073392_604_1428 | 274 |
| 613 | 3300045976 | Ga0466967_0188800 | Ga0466967_0188800_749_1573 | 274 |
| 614 | 3300046452 | Ga0495617_000492 | Ga0495617_000492_18402_19226 | 274 |
| 615 | 3300046452 | Ga0495617_046140 | Ga0495617_046140_614_1438 | 274 |
| 616 | 3300046454 | Ga0495592_0111335 | Ga0495592_0111335_350_1174 | 274 |
| 617 | 3300046455 | Ga0495603_0067969 | Ga0495603_0067969_352_1176 | 274 |
| 618 | 3300046457 | Ga0495590_0001642 | Ga0495590_0001642_793_1773 | 274 |
| 619 | 3300046457 | Ga0495590_0029225 | Ga0495590_0029225_686_1510 | 274 |
| 620 | 3300046459 | Ga0495629_0091342 | Ga0495629_0091342_671_1495 | 274 |
| 621 | 3300046460 | Ga0495638_0002448 | Ga0495638_0002448_12043_12867 | 274 |
| 622 | 3300046462 | Ga0495651_0003859 | Ga0495651_0003859_3943_4767 | 274 |
| 623 | 3300046462 | Ga0495651_0052046 | Ga0495651_0052046_929_1753 | 274 |
| 624 | 3300046462 | Ga0495651_0100107 | Ga0495651_0100107_63_887 | 274 |
| 625 | 3300046463 | Ga0495653_0012646 | Ga0495653_0012646_5445_6269 | 274 |
| 626 | 3300046472 | Ga0495580_0003180 | Ga0495580_0003180_9605_10429 | 274 |
| 627 | 3300046472 | Ga0495580_0011169 | Ga0495580_0011169_2125_2949 | 274 |
| 628 | 3300046472 | Ga0495580_0120717 | Ga0495580_0120717_527_1351 | 274 |
| 629 | 3300046473 | Ga0495582_0037715 | Ga0495582_0037715_244_1068 | 274 |
| 630 | 3300046474 | Ga0495605_0015127 | Ga0495605_0015127_2629_3609 | 274 |
| 631 | 3300046475 | Ga0495639_0006851 | Ga0495639_0006851_2790_3614 | 274 |
| 632 | 3300046475 | Ga0495639_0040595 | Ga0495639_0040595_1115_1939 | 274 |
| 633 | 3300046477 | Ga0495664_0025986 | Ga0495664_0025986_304_1128 | 274 |
| 634 | 3300046477 | Ga0495664_0026559 | Ga0495664_0026559_1910_2734 | 274 |
| 635 | 3300046491 | Ga0495584_0208609 | Ga0495584_0208609_44_868 | 274 |
| 636 | 3300046491 | Ga0495584_0235866 | Ga0495584_0235866_51_875 | 274 |
| 637 | 3300046492 | Ga0495585_0000020 | Ga0495585_0000020_141484_142308 | 274 |
| 638 | 3300046492 | Ga0495585_0048186 | Ga0495585_0048186_1008_1832 | 274 |
| 639 | 3300046492 | Ga0495585_0232386 | Ga0495585_0232386_13_837 | 274 |
| 640 | 3300046500 | Ga0495596_0117639 | Ga0495596_0117639_94_918 | 274 |
| 641 | 3300046501 | Ga0495607_0044363 | Ga0495607_0044363_845_1825 | 274 |
| 642 | 3300046501 | Ga0495607_0075705 | Ga0495607_0075705_555_1535 | 274 |
| 643 | 3300046501 | Ga0495607_0156039 | Ga0495607_0156039_308_1132 | 274 |
| 644 | 3300046506 | Ga0495583_0097666 | Ga0495583_0097666_176_1000 | 274 |
| 645 | 3300046507 | Ga0495606_0195322 | Ga0495606_0195322_276_1100 | 274 |
| 646 | 3300046511 | Ga0495608_0067813 | Ga0495608_0067813_994_1818 | 274 |
| 647 | 3300046511 | Ga0495608_0094035 | Ga0495608_0094035_514_1338 | 274 |
| 648 | 3300046513 | Ga0495616_0013791 | Ga0495616_0013791_2841_3665 | 274 |
| 649 | 3300046513 | Ga0495616_0025388 | Ga0495616_0025388_950_1930 | 274 |
| 650 | 3300046513 | Ga0495616_0095812 | Ga0495616_0095812_495_1319 | 274 |
| 651 | 3300046514 | Ga0495618_0045348 | Ga0495618_0045348_1817_2641 | 274 |
| 652 | 3300046514 | Ga0495618_0222282 | Ga0495618_0222282_77_901 | 274 |
| 653 | 3300046515 | Ga0495620_0013312 | Ga0495620_0013312_1243_2067 | 274 |
| 654 | 3300046516 | Ga0495628_0005397 | Ga0495628_0005397_7442_8266 | 274 |
| 655 | 3300046516 | Ga0495628_0048965 | Ga0495628_0048965_1818_2642 | 274 |
| 656 | 3300046517 | Ga0495630_0040029 | Ga0495630_0040029_2295_3119 | 274 |
| 657 | 3300046518 | Ga0495631_0000012 | Ga0495631_0000012_23756_24736 | 274 |
| 658 | 3300046522 | Ga0495643_0078738 | Ga0495643_0078738_15_866 | 274 |
| 659 | 3300046522 | Ga0495643_0141479 | Ga0495643_0141479_62_1042 | 274 |
| 660 | 3300046523 | Ga0495644_0007261 | Ga0495644_0007261_1698_2522 | 274 |
| 661 | 3300046524 | Ga0495648_0000031 | Ga0495648_0000031_174269_175093 | 274 |
| 662 | 3300046524 | Ga0495648_0007265 | Ga0495648_0007265_2200_3180 | 274 |
| 663 | 3300046524 | Ga0495648_0113277 | Ga0495648_0113277_546_1370 | 274 |
| 664 | 3300046525 | Ga0495663_0051861 | Ga0495663_0051861_341_1165 | 274 |
| 665 | 3300046525 | Ga0495663_0078914 | Ga0495663_0078914_168_992 | 274 |
| 666 | 3300046528 | Ga0495642_0007224 | Ga0495642_0007224_2820_3797 | 274 |
| 667 | 3300046528 | Ga0495642_0039226 | Ga0495642_0039226_1001_1825 | 274 |
| 668 | 3300046529 | Ga0495652_0003519 | Ga0495652_0003519_2853_3677 | 274 |
| 669 | 3300046529 | Ga0495652_0017024 | Ga0495652_0017024_3188_4012 | 274 |
| 670 | 3300046529 | Ga0495652_0067937 | Ga0495652_0067937_2048_2872 | 274 |
| 671 | 3300046529 | Ga0495652_0216192 | Ga0495652_0216192_223_1047 | 274 |
| 672 | 3300046530 | Ga0495654_0039877 | Ga0495654_0039877_193_1173 | 274 |
| 673 | 3300046531 | Ga0495665_0020435 | Ga0495665_0020435_2068_2892 | 274 |
| 674 | 3300046533 | Ga0495640_0009890 | Ga0495640_0009890_4254_5078 | 274 |
| 675 | 3300046533 | Ga0495640_0010505 | Ga0495640_0010505_711_1535 | 274 |
| 676 | 3300046533 | Ga0495640_0012541 | Ga0495640_0012541_925_1749 | 274 |
| 677 | 3300046533 | Ga0495640_0036104 | Ga0495640_0036104_2546_3370 | 274 |
| 678 | 3300046533 | Ga0495640_0214458 | Ga0495640_0214458_358_1182 | 274 |
| 679 | 3300046533 | Ga0495640_0233608 | Ga0495640_0233608_251_1075 | 274 |
| 680 | 3300046536 | Ga0495587_0045588 | Ga0495587_0045588_1343_2167 | 274 |
| 681 | 3300046536 | Ga0495587_0063414 | Ga0495587_0063414_850_1674 | 274 |
| 682 | 3300046538 | Ga0495609_0018660 | Ga0495609_0018660_1919_2743 | 274 |
| 683 | 3300046539 | Ga0495621_0009132 | Ga0495621_0009132_1667_2491 | 274 |
| 684 | 3300046543 | Ga0495645_0088940 | Ga0495645_0088940_626_1450 | 274 |
| 685 | 3300046557 | Ga0495622_0006392 | Ga0495622_0006392_3588_4412 | 274 |
| 686 | 3300046558 | Ga0495633_0011162 | Ga0495633_0011162_3030_3854 | 274 |
| 687 | 3300046558 | Ga0495633_0078201 | Ga0495633_0078201_361_1185 | 274 |
| 688 | 3300046559 | Ga0495667_0013972 | Ga0495667_0013972_2858_3682 | 274 |
| 689 | 3300046559 | Ga0495667_0037568 | Ga0495667_0037568_2009_2833 | 274 |
| 690 | 3300046559 | Ga0495667_0098706 | Ga0495667_0098706_591_1415 | 274 |
| 691 | 3300046615 | Ga0495656_0000458 | Ga0495656_0000458_9232_10056 | 274 |
| 692 | 3300046616 | Ga0495668_0001460 | Ga0495668_0001460_11902_12882 | 274 |
| 693 | 3300046616 | Ga0495668_0061698 | Ga0495668_0061698_339_1163 | 274 |
| 694 | 3300046616 | Ga0495668_0129588 | Ga0495668_0129588_515_1339 | 274 |
| 695 | 3300046642 | Ga0495634_0012519 | Ga0495634_0012519_1545_2369 | 274 |
| 696 | 3300046642 | Ga0495634_0019109 | Ga0495634_0019109_3122_3946 | 274 |
| 697 | 3300046642 | Ga0495634_0040724 | Ga0495634_0040724_106_930 | 274 |
| 698 | 3300046642 | Ga0495634_0185462 | Ga0495634_0185462_60_884 | 274 |
| 699 | 3300046648 | Ga0495611_0025905 | Ga0495611_0025905_1677_2501 | 274 |
| 700 | 3300046648 | Ga0495611_0067561 | Ga0495611_0067561_549_1373 | 274 |
| 701 | 3300046660 | Ga0495625_0009366 | Ga0495625_0009366_2391_3371 | 274 |
| 702 | 3300046660 | Ga0495625_0066618 | Ga0495625_0066618_1206_2030 | 274 |
| 703 | 3300046660 | Ga0495625_0092097 | Ga0495625_0092097_322_1146 | 274 |
| 704 | 3300046660 | Ga0495625_0099537 | Ga0495625_0099537_254_1078 | 274 |
| 705 | 3300046660 | Ga0495625_0185471 | Ga0495625_0185471_468_1292 | 274 |
| 706 | 3300046663 | Ga0495635_0008082 | Ga0495635_0008082_1943_2767 | 274 |
| 707 | 3300046663 | Ga0495635_0008097 | Ga0495635_0008097_1537_2361 | 274 |
| 708 | 3300046663 | Ga0495635_0008697 | Ga0495635_0008697_5930_6754 | 274 |
| 709 | 3300046665 | Ga0495661_0020003 | Ga0495661_0020003_2452_3432 | 274 |
| 710 | 3300046665 | Ga0495661_0132157 | Ga0495661_0132157_172_1152 | 274 |
| 711 | 3300046674 | Ga0495588_0020268 | Ga0495588_0020268_674_1498 | 274 |
| 712 | 3300046675 | Ga0495657_0002707 | Ga0495657_0002707_11239_12063 | 274 |
| 713 | 3300046675 | Ga0495657_0016628 | Ga0495657_0016628_1546_2370 | 274 |
| 714 | 3300046675 | Ga0495657_0243340 | Ga0495657_0243340_146_970 | 274 |
| 715 | 3300046678 | Ga0495599_0002038 | Ga0495599_0002038_3772_4596 | 274 |
| 716 | 3300046679 | Ga0495623_0016423 | Ga0495623_0016423_2498_3322 | 274 |
| 717 | 3300046680 | Ga0495646_0066697 | Ga0495646_0066697_595_1419 | 274 |
| 718 | 3300046681 | Ga0495647_0014698 | Ga0495647_0014698_718_1542 | 274 |
| 719 | 3300046683 | Ga0495658_0022238 | Ga0495658_0022238_949_1773 | 274 |
| 720 | 3300046684 | Ga0495669_0055671 | Ga0495669_0055671_405_1229 | 274 |
| 721 | 3300046689 | Ga0495613_0039833 | Ga0495613_0039833_196_1020 | 274 |
| 722 | 3300046689 | Ga0495613_0064133 | Ga0495613_0064133_486_1310 | 274 |
| 723 | 3300046690 | Ga0495624_0010916 | Ga0495624_0010916_697_1521 | 274 |
| 724 | 3300046690 | Ga0495624_0019352 | Ga0495624_0019352_787_1611 | 274 |
| 725 | 3300046692 | Ga0495671_0120811 | Ga0495671_0120811_223_1203 | 274 |
| 726 | 3300046794 | Ga0495589_0137756 | Ga0495589_0137756_191_1015 | 274 |
| 727 | 3300046809 | Ga0495600_0015865 | Ga0495600_0015865_3627_4451 | 274 |
| 728 | 3300046809 | Ga0495600_0016359 | Ga0495600_0016359_1382_2206 | 274 |
| 729 | 3300046809 | Ga0495600_0049123 | Ga0495600_0049123_759_1583 | 274 |
| 730 | 3300046810 | Ga0495660_0054864 | Ga0495660_0054864_233_1213 | 274 |
| 731 | 3300046810 | Ga0495660_0074516 | Ga0495660_0074516_192_1016 | 274 |
| 732 | 3300047315 | Ga0495581_0180834 | Ga0495581_0180834_185_1009 | 274 |
| 733 | 3300047315 | Ga0495581_0195438 | Ga0495581_0195438_117_941 | 274 |
| 734 | 3300047317 | Ga0495604_0002138 | Ga0495604_0002138_3832_4656 | 274 |
| 735 | 3300047317 | Ga0495604_0014695 | Ga0495604_0014695_1100_1924 | 274 |
| 736 | 3300047317 | Ga0495604_0043019 | Ga0495604_0043019_625_1449 | 274 |
| 737 | 3300047317 | Ga0495604_0147158 | Ga0495604_0147158_335_1159 | 274 |
| 738 | 3300047317 | Ga0495604_0156087 | Ga0495604_0156087_782_1606 | 274 |
| 739 | 3300047318 | Ga0495636_0017552 | Ga0495636_0017552_90_914 | 274 |
| 740 | 3300047319 | Ga0495674_0007907 | Ga0495674_0007907_5568_6392 | 274 |
| 741 | 3300047319 | Ga0495674_0011599 | Ga0495674_0011599_2289_3113 | 274 |
| 742 | 3300047319 | Ga0495674_0027876 | Ga0495674_0027876_3760_4584 | 274 |
| 743 | 3300047319 | Ga0495674_0031722 | Ga0495674_0031722_3465_4289 | 274 |
| 744 | 3300047320 | Ga0495672_0011045 | Ga0495672_0011045_2674_3498 | 274 |
| 745 | 3300047322 | Ga0495680_0002914 | Ga0495680_0002914_15712_16536 | 274 |
| 746 | 3300047322 | Ga0495680_0017078 | Ga0495680_0017078_2644_3468 | 274 |
| 747 | 3300047322 | Ga0495680_0103519 | Ga0495680_0103519_1059_1883 | 274 |
| 748 | 3300047322 | Ga0495680_0165952 | Ga0495680_0165952_23_847 | 274 |
| 749 | 3300047323 | Ga0495683_0008766 | Ga0495683_0008766_3052_3876 | 274 |
| 750 | 3300047443 | Ga0495687_007170 | Ga0495687_007170_1527_2351 | 274 |
| 751 | 3300047444 | Ga0495675_0146703 | Ga0495675_0146703_33_857 | 274 |
| 752 | 3300047446 | Ga0495679_004458 | Ga0495679_004458_1292_2272 | 274 |
| 753 | 3300047447 | Ga0495685_006282 | Ga0495685_006282_1830_2810 | 274 |
| 754 | 3300047469 | Ga0495673_0099085 | Ga0495673_0099085_230_1054 | 274 |
| 755 | 3300047470 | Ga0495681_0017947 | Ga0495681_0017947_700_1524 | 274 |
| 756 | 3300047471 | Ga0495684_0017357 | Ga0495684_0017357_2488_3312 | 274 |
| 757 | 3300047471 | Ga0495684_0017725 | Ga0495684_0017725_3996_4820 | 274 |
| 758 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_257580_258404 | 274 |
| 759 | 3300047472 | Ga0495686_0109171 | Ga0495686_0109171_61_912 | 274 |
| 760 | 3300047673 | Ga0495593_0015883 | Ga0495593_0015883_963_1787 | 274 |
| 761 | 3300047673 | Ga0495593_0082237 | Ga0495593_0082237_762_1586 | 274 |
| 762 | 3300048088 | Ga0495602_0019051 | Ga0495602_0019051_2436_3260 | 274 |
| 763 | 3300048088 | Ga0495602_0056943 | Ga0495602_0056943_870_1694 | 274 |
| 764 | 3300048088 | Ga0495602_0447260 | Ga0495602_0447260_44_868 | 274 |
| 765 | 3300048091 | Ga0495626_0029000 | Ga0495626_0029000_775_1755 | 274 |
| 766 | 3300048903 | Ga0496100_0009364 | Ga0496100_0009364_937_1764 | 274 |
| 767 | 3300048903 | Ga0496100_0082011 | Ga0496100_0082011_372_1196 | 274 |
| 768 | 3300048903 | Ga0496100_0087564 | Ga0496100_0087564_378_1202 | 274 |
| 769 | 3300048904 | Ga0496101_0003793 | Ga0496101_0003793_2744_3571 | 274 |
| 770 | 3300048904 | Ga0496101_0284140 | Ga0496101_0284140_187_1011 | 274 |
| 771 | 3300048905 | Ga0496102_0058370 | Ga0496102_0058370_885_1712 | 274 |
| 772 | 3300048905 | Ga0496102_0100652 | Ga0496102_0100652_967_1791 | 274 |
| 773 | 3300048905 | Ga0496102_0170509 | Ga0496102_0170509_285_1109 | 274 |
| 774 | 3300048905 | Ga0496102_0207435 | Ga0496102_0207435_811_1671 | 274 |
| 775 | 3300048905 | Ga0496102_0208728 | Ga0496102_0208728_994_1818 | 274 |
| 776 | 3300048905 | Ga0496102_0369840 | Ga0496102_0369840_89_913 | 274 |
| 777 | 3300048905 | Ga0496102_0434422 | Ga0496102_0434422_379_1203 | 274 |
| 778 | 3300048906 | Ga0496103_0004902 | Ga0496103_0004902_2497_3321 | 274 |
| 779 | 3300048906 | Ga0496103_0009846 | Ga0496103_0009846_4056_4880 | 274 |
| 780 | 3300048906 | Ga0496103_0014190 | Ga0496103_0014190_1415_2275 | 274 |
| 781 | 3300048907 | Ga0496104_0005066 | Ga0496104_0005066_4518_5345 | 274 |
| 782 | 3300048907 | Ga0496104_0009671 | Ga0496104_0009671_4916_5776 | 274 |
| 783 | 3300048907 | Ga0496104_0010700 | Ga0496104_0010700_5473_6297 | 274 |
| 784 | 3300048907 | Ga0496104_0015598 | Ga0496104_0015598_3566_4432 | 274 |
| 785 | 3300048907 | Ga0496104_0032718 | Ga0496104_0032718_2703_3527 | 274 |
| 786 | 3300048907 | Ga0496104_0102177 | Ga0496104_0102177_1201_2025 | 274 |
| 787 | 3300048907 | Ga0496104_0118272 | Ga0496104_0118272_740_1564 | 274 |
| 788 | 3300048907 | Ga0496104_0131059 | Ga0496104_0131059_837_1697 | 274 |
| 789 | 3300048907 | Ga0496104_0304657 | Ga0496104_0304657_505_1329 | 274 |
| 790 | 3300048907 | Ga0496104_0423708 | Ga0496104_0423708_283_1107 | 274 |
| 791 | 3300048907 | Ga0496104_0617881 | Ga0496104_0617881_38_862 | 274 |
| 792 | 3300048907 | Ga0496104_0681228 | Ga0496104_0681228_10_852 | 274 |
| 793 | 3300048908 | Ga0496105_0006092 | Ga0496105_0006092_4144_4968 | 274 |
| 794 | 3300048908 | Ga0496105_0009651 | Ga0496105_0009651_5554_6378 | 274 |
| 795 | 3300048908 | Ga0496105_0014216 | Ga0496105_0014216_162_989 | 274 |
| 796 | 3300048908 | Ga0496105_0014320 | Ga0496105_0014320_2076_2942 | 274 |
| 797 | 3300048908 | Ga0496105_0031903 | Ga0496105_0031903_1269_2093 | 274 |
| 798 | 3300048908 | Ga0496105_0034869 | Ga0496105_0034869_165_989 | 274 |
| 799 | 3300048908 | Ga0496105_0037646 | Ga0496105_0037646_2498_3322 | 274 |
| 800 | 3300048908 | Ga0496105_0079967 | Ga0496105_0079967_1197_2057 | 274 |
| 801 | 3300048908 | Ga0496105_0494034 | Ga0496105_0494034_109_933 | 274 |
| 802 | 3300048909 | Ga0496106_0007532 | Ga0496106_0007532_6774_7598 | 274 |
| 803 | 3300048909 | Ga0496106_0136867 | Ga0496106_0136867_748_1608 | 274 |
| 804 | 3300048910 | Ga0496107_0002250 | Ga0496107_0002250_8649_9476 | 274 |
| 805 | 3300048910 | Ga0496107_0033508 | Ga0496107_0033508_822_1646 | 274 |
| 806 | 3300048910 | Ga0496107_0040983 | Ga0496107_0040983_456_1280 | 274 |
| 807 | 3300048910 | Ga0496107_0203050 | Ga0496107_0203050_327_1151 | 274 |
| 808 | 3300048910 | Ga0496107_0281526 | Ga0496107_0281526_77_901 | 274 |
| 809 | 3300048911 | Ga0496108_0000085 | Ga0496108_0000085_44811_45635 | 274 |
| 810 | 3300048911 | Ga0496108_0001801 | Ga0496108_0001801_13373_14239 | 274 |
| 811 | 3300048911 | Ga0496108_0006400 | Ga0496108_0006400_7794_8654 | 274 |
| 812 | 3300048911 | Ga0496108_0020352 | Ga0496108_0020352_3991_4815 | 274 |
| 813 | 3300048911 | Ga0496108_0042363 | Ga0496108_0042363_1481_2305 | 274 |
| 814 | 3300048911 | Ga0496108_0072132 | Ga0496108_0072132_351_1175 | 274 |
| 815 | 3300048911 | Ga0496108_0072840 | Ga0496108_0072840_897_1757 | 274 |
| 816 | 3300048911 | Ga0496108_0243586 | Ga0496108_0243586_660_1484 | 274 |
| 817 | 3300048911 | Ga0496108_0295921 | Ga0496108_0295921_99_926 | 274 |
| 818 | 3300048912 | Ga0496109_0001374 | Ga0496109_0001374_11456_12316 | 274 |
| 819 | 3300048912 | Ga0496109_0004444 | Ga0496109_0004444_3569_4435 | 274 |
| 820 | 3300048912 | Ga0496109_0036931 | Ga0496109_0036931_3079_3903 | 274 |
| 821 | 3300048912 | Ga0496109_0053693 | Ga0496109_0053693_2162_3022 | 274 |
| 822 | 3300048912 | Ga0496109_0082176 | Ga0496109_0082176_155_982 | 274 |
| 823 | 3300048912 | Ga0496109_0086856 | Ga0496109_0086856_1313_2137 | 274 |
| 824 | 3300048912 | Ga0496109_0387451 | Ga0496109_0387451_47_871 | 274 |
| 825 | 3300048912 | Ga0496109_0408682 | Ga0496109_0408682_85_909 | 274 |
| 826 | 3300048912 | Ga0496109_0443578 | Ga0496109_0443578_361_1197 | 274 |
| 827 | 3300048912 | Ga0496109_0478057 | Ga0496109_0478057_37_861 | 274 |
| 828 | 3300048913 | Ga0496110_0018710 | Ga0496110_0018710_1811_2677 | 274 |
| 829 | 3300048913 | Ga0496110_0029557 | Ga0496110_0029557_3803_4627 | 274 |
| 830 | 3300048913 | Ga0496110_0045912 | Ga0496110_0045912_715_1575 | 274 |
| 831 | 3300048913 | Ga0496110_0053216 | Ga0496110_0053216_2344_3204 | 274 |
| 832 | 3300048913 | Ga0496110_0074262 | Ga0496110_0074262_723_1547 | 274 |
| 833 | 3300048913 | Ga0496110_0088189 | Ga0496110_0088189_1115_1939 | 274 |
| 834 | 3300048913 | Ga0496110_0143362 | Ga0496110_0143362_665_1489 | 274 |
| 835 | 3300048913 | Ga0496110_0144931 | Ga0496110_0144931_957_1781 | 274 |
| 836 | 3300048913 | Ga0496110_0243531 | Ga0496110_0243531_263_1087 | 274 |
| 837 | 3300048913 | Ga0496110_0406893 | Ga0496110_0406893_18_842 | 274 |
| 838 | 3300048914 | Ga0496111_0064299 | Ga0496111_0064299_1116_1976 | 274 |
| 839 | 3300048914 | Ga0496111_0067113 | Ga0496111_0067113_896_1720 | 274 |
| 840 | 3300048914 | Ga0496111_0095491 | Ga0496111_0095491_817_1677 | 274 |
| 841 | 3300048914 | Ga0496111_0104796 | Ga0496111_0104796_50_874 | 274 |
| 842 | 3300048914 | Ga0496111_0315307 | Ga0496111_0315307_26_850 | 274 |
| 843 | 3300048914 | Ga0496111_0380680 | Ga0496111_0380680_71_940 | 274 |
| 844 | 3300048915 | Ga0496112_0021643 | Ga0496112_0021643_734_1594 | 274 |
| 845 | 3300048915 | Ga0496112_0033033 | Ga0496112_0033033_4068_4949 | 274 |
| 846 | 3300048915 | Ga0496112_0045443 | Ga0496112_0045443_18_842 | 274 |
| 847 | 3300048915 | Ga0496112_0224235 | Ga0496112_0224235_133_993 | 274 |
| 848 | 3300048915 | Ga0496112_0260771 | Ga0496112_0260771_731_1555 | 274 |
| 849 | 3300048915 | Ga0496112_0537154 | Ga0496112_0537154_264_1088 | 274 |
| 850 | 3300048916 | Ga0496113_0012688 | Ga0496113_0012688_1440_2306 | 274 |
| 851 | 3300048916 | Ga0496113_0014036 | Ga0496113_0014036_4317_5141 | 274 |
| 852 | 3300048916 | Ga0496113_0022391 | Ga0496113_0022391_3256_4116 | 274 |
| 853 | 3300048916 | Ga0496113_0063348 | Ga0496113_0063348_622_1446 | 274 |
| 854 | 3300048916 | Ga0496113_0095656 | Ga0496113_0095656_1344_2216 | 274 |
| 855 | 3300048916 | Ga0496113_0137702 | Ga0496113_0137702_322_1182 | 274 |
| 856 | 3300048916 | Ga0496113_0225110 | Ga0496113_0225110_194_1018 | 274 |
| 857 | 3300048917 | Ga0496114_0045265 | Ga0496114_0045265_228_1052 | 274 |
| 858 | 3300048917 | Ga0496114_0145281 | Ga0496114_0145281_673_1497 | 274 |
| 859 | 3300048918 | Ga0496115_0005716 | Ga0496115_0005716_6034_6861 | 274 |
| 860 | 3300048918 | Ga0496115_0018829 | Ga0496115_0018829_27_851 | 274 |
| 861 | 3300048918 | Ga0496115_0077044 | Ga0496115_0077044_928_1752 | 274 |
| 862 | 3300048918 | Ga0496115_0173765 | Ga0496115_0173765_886_1710 | 274 |
| 863 | 3300048918 | Ga0496115_0229361 | Ga0496115_0229361_587_1423 | 274 |
| 864 | 3300048919 | Ga0496116_0027763 | Ga0496116_0027763_3126_3950 | 274 |
| 865 | 3300048921 | Ga0496118_0026860 | Ga0496118_0026860_3191_4015 | 274 |
| 866 | 3300048921 | Ga0496118_0074260 | Ga0496118_0074260_1335_2159 | 274 |
| 867 | 3300048921 | Ga0496118_0104134 | Ga0496118_0104134_284_1108 | 274 |
| 868 | 3300048921 | Ga0496118_0116038 | Ga0496118_0116038_357_1181 | 274 |
| 869 | 3300048922 | Ga0496119_0016733 | Ga0496119_0016733_1752_2576 | 274 |
| 870 | 3300048922 | Ga0496119_0130230 | Ga0496119_0130230_33_857 | 274 |
| 871 | 3300048923 | Ga0496120_0024839 | Ga0496120_0024839_315_1139 | 274 |
| 872 | 3300048923 | Ga0496120_0036314 | Ga0496120_0036314_1838_2662 | 274 |
| 873 | 3300048923 | Ga0496120_0138042 | Ga0496120_0138042_169_993 | 274 |
| 874 | 3300048924 | Ga0496121_0022098 | Ga0496121_0022098_321_1145 | 274 |
| 875 | 3300048924 | Ga0496121_0033120 | Ga0496121_0033120_1469_2293 | 274 |
| 876 | 3300048924 | Ga0496121_0047098 | Ga0496121_0047098_1625_2449 | 274 |
| 877 | 3300048924 | Ga0496121_0061226 | Ga0496121_0061226_991_1815 | 274 |
| 878 | 3300048924 | Ga0496121_0086490 | Ga0496121_0086490_768_1592 | 274 |
| 879 | 3300048924 | Ga0496121_0104919 | Ga0496121_0104919_1047_1871 | 274 |
| 880 | 3300048924 | Ga0496121_0199799 | Ga0496121_0199799_44_868 | 274 |
| 881 | 3300048925 | Ga0496122_0049351 | Ga0496122_0049351_929_1753 | 274 |
| 882 | 3300048928 | Ga0496125_0000398 | Ga0496125_0000398_2263_3087 | 274 |
| 883 | 3300048928 | Ga0496125_0000583 | Ga0496125_0000583_58059_58883 | 274 |
| 884 | 3300048928 | Ga0496125_0095590 | Ga0496125_0095590_430_1254 | 274 |
| 885 | 3300048929 | Ga0496126_0009017 | Ga0496126_0009017_2724_3548 | 274 |
| 886 | 3300048929 | Ga0496126_0029280 | Ga0496126_0029280_3287_4111 | 274 |
| 887 | 3300048929 | Ga0496126_0089745 | Ga0496126_0089745_29_853 | 274 |
| 888 | 3300048929 | Ga0496126_0119397 | Ga0496126_0119397_1045_1869 | 274 |
| 889 | 3300048929 | Ga0496126_0132022 | Ga0496126_0132022_653_1477 | 274 |
| 890 | 3300048929 | Ga0496126_0178374 | Ga0496126_0178374_238_1062 | 274 |
| 891 | 3300048929 | Ga0496126_0286070 | Ga0496126_0286070_238_1062 | 274 |
| 892 | 3300049459 | Ga0495678_000022 | Ga0495678_000022_208462_209442 | 274 |
| 893 | 3300049459 | Ga0495678_098343 | Ga0495678_098343_27_851 | 274 |
| 894 | 3300049460 | Ga0495682_0040027 | Ga0495682_0040027_755_1579 | 274 |
| 895 | 3300049570 | Ga0501033_0006993 | Ga0501033_0006993_6881_7705 | 274 |
| 896 | 3300049571 | Ga0501034_0052501 | Ga0501034_0052501_648_1472 | 274 |
| 897 | 3300049571 | Ga0501034_0711227 | Ga0501034_0711227_22_846 | 274 |
| 898 | 3300049572 | Ga0501036_0112415 | Ga0501036_0112415_315_1139 | 274 |
| 899 | 3300049572 | Ga0501036_0480354 | Ga0501036_0480354_48_872 | 274 |
| 900 | 3300049573 | Ga0501037_0093757 | Ga0501037_0093757_308_1132 | 274 |
| 901 | 3300049579 | Ga0501043_0026650 | Ga0501043_0026650_1486_2310 | 274 |
| 902 | 3300049579 | Ga0501043_0159620 | Ga0501043_0159620_912_1736 | 274 |
| 903 | 3300049581 | Ga0501047_0038808 | Ga0501047_0038808_2631_3455 | 274 |
| 904 | 3300049581 | Ga0501047_0048403 | Ga0501047_0048403_2469_3293 | 274 |
| 905 | 3300049581 | Ga0501047_0075636 | Ga0501047_0075636_2156_2980 | 274 |
| 906 | 3300049581 | Ga0501047_0233825 | Ga0501047_0233825_41_865 | 274 |
| 907 | 3300049581 | Ga0501047_0245192 | Ga0501047_0245192_600_1424 | 274 |
| 908 | 3300049582 | Ga0501048_0104477 | Ga0501048_0104477_92_916 | 274 |
| 909 | 3300049586 | Ga0501070_0003666 | Ga0501070_0003666_10087_10911 | 274 |
| 910 | 3300049589 | Ga0501073_0047240 | Ga0501073_0047240_571_1398 | 274 |
| 911 | 3300049742 | Ga0501080_0002569 | Ga0501080_0002569_12314_13138 | 274 |
| 912 | 3300049822 | Ga0501035_0051837 | Ga0501035_0051837_225_1049 | 274 |
| 913 | 3300049822 | Ga0501035_0087490 | Ga0501035_0087490_1896_2720 | 274 |
| 914 | 3300049823 | Ga0501044_0105731 | Ga0501044_0105731_186_1010 | 274 |
| 915 | 3300050489 | nmdc:mga03683_142946_c1 | nmdc:mga03683_142946_c1_155_979 | 274 |
| 916 | 3300050489 | nmdc:mga03683_914_c1 | nmdc:mga03683_914_c1_4290_5114 | 274 |
| 917 | 3300050491 | nmdc:mga00v17_342510_c1 | nmdc:mga00v17_342510_c1_35_859 | 274 |
| 918 | 3300050491 | nmdc:mga00v17_367239_c1 | nmdc:mga00v17_367239_c1_80_904 | 274 |
| 919 | 3300050491 | nmdc:mga00v17_94271_c1 | nmdc:mga00v17_94271_c1_916_1740 | 274 |
| 920 | 3300050492 | nmdc:mga0yw44_107635_c1 | nmdc:mga0yw44_107635_c1_548_1372 | 274 |
| 921 | 3300050492 | nmdc:mga0yw44_108109_c1 | nmdc:mga0yw44_108109_c1_243_1070 | 274 |
| 922 | 3300050492 | nmdc:mga0yw44_12728_c1 | nmdc:mga0yw44_12728_c1_33_857 | 274 |
| 923 | 3300050492 | nmdc:mga0yw44_302158_c1 | nmdc:mga0yw44_302158_c1_77_901 | 274 |
| 924 | 3300050492 | nmdc:mga0yw44_45018_c1 | nmdc:mga0yw44_45018_c1_605_1429 | 274 |
| 925 | 3300050492 | nmdc:mga0yw44_53561_c1 | nmdc:mga0yw44_53561_c1_935_1759 | 274 |
| 926 | 3300050492 | nmdc:mga0yw44_5380_c1 | nmdc:mga0yw44_5380_c1_1551_2375 | 274 |
| 927 | 3300050492 | nmdc:mga0yw44_65075_c1 | nmdc:mga0yw44_65075_c1_624_1448 | 274 |
| 928 | 3300050493 | nmdc:mga0k408_101913_c1 | nmdc:mga0k408_101913_c1_238_1062 | 274 |
| 929 | 3300050493 | nmdc:mga0k408_133218_c1 | nmdc:mga0k408_133218_c1_634_1458 | 274 |
| 930 | 3300050493 | nmdc:mga0k408_156449_c1 | nmdc:mga0k408_156449_c1_79_903 | 274 |
| 931 | 3300050494 | nmdc:mga06z11_24711_c1 | nmdc:mga06z11_24711_c1_1468_2292 | 274 |
| 932 | 3300050494 | nmdc:mga06z11_5599_c1 | nmdc:mga06z11_5599_c1_2285_3169 | 274 |
| 933 | 3300050496 | nmdc:mga07m45_40912_c1 | nmdc:mga07m45_40912_c1_791_1615 | 274 |
| 934 | 3300050507 | nmdc:mga05p37_12256_c1 | nmdc:mga05p37_12256_c1_1954_2778 | 274 |
| 935 | 3300050507 | nmdc:mga05p37_137380_c1 | nmdc:mga05p37_137380_c1_75_986 | 274 |
| 936 | 3300050507 | nmdc:mga05p37_191551_c1 | nmdc:mga05p37_191551_c1_269_1093 | 274 |
| 937 | 3300050507 | nmdc:mga05p37_198474_c1 | nmdc:mga05p37_198474_c1_579_1415 | 274 |
| 938 | 3300050507 | nmdc:mga05p37_342483_c1 | nmdc:mga05p37_342483_c1_284_1108 | 274 |
| 939 | 3300050507 | nmdc:mga05p37_66088_c1 | nmdc:mga05p37_66088_c1_2461_3285 | 274 |
| 940 | 3300050507 | nmdc:mga05p37_756827_c1 | nmdc:mga05p37_756827_c1_226_1050 | 274 |
| 941 | 3300050508 | nmdc:mga09592_10818_c1 | nmdc:mga09592_10818_c1_5475_6299 | 274 |
| 942 | 3300050508 | nmdc:mga09592_472262_c1 | nmdc:mga09592_472262_c1_148_972 | 274 |
| 943 | 3300050509 | nmdc:mga0qj67_50665_c1 | nmdc:mga0qj67_50665_c1_1152_1976 | 274 |
| 944 | 3300050510 | nmdc:mga06r32_12962_c1 | nmdc:mga06r32_12962_c1_5550_6374 | 274 |
| 945 | 3300050510 | nmdc:mga06r32_43327_c1 | nmdc:mga06r32_43327_c1_336_1196 | 274 |
| 946 | 3300050511 | nmdc:mga08y16_160261_c1 | nmdc:mga08y16_160261_c1_371_1195 | 274 |
| 947 | 3300050511 | nmdc:mga08y16_73423_c1 | nmdc:mga08y16_73423_c1_1165_1989 | 274 |
| 948 | 3300050512 | nmdc:mga0n895_103480_c1 | nmdc:mga0n895_103480_c1_624_1448 | 274 |
| 949 | 3300050512 | nmdc:mga0n895_151062_c1 | nmdc:mga0n895_151062_c1_1304_2128 | 274 |
| 950 | 3300050512 | nmdc:mga0n895_21382_c1 | nmdc:mga0n895_21382_c1_4563_5474 | 274 |
| 951 | 3300050512 | nmdc:mga0n895_4039_c1 | nmdc:mga0n895_4039_c1_5770_6594 | 274 |
| 952 | 3300050512 | nmdc:mga0n895_405504_c1 | nmdc:mga0n895_405504_c1_237_1067 | 274 |
| 953 | 3300050513 | nmdc:mga0rr50_3155_c1 | nmdc:mga0rr50_3155_c1_6020_6844 | 274 |
| 954 | 3300050513 | nmdc:mga0rr50_470_c1 | nmdc:mga0rr50_470_c1_14817_15641 | 274 |
| 955 | 3300050513 | nmdc:mga0rr50_47936_c1 | nmdc:mga0rr50_47936_c1_850_1710 | 274 |
| 956 | 3300050513 | nmdc:mga0rr50_71799_c1 | nmdc:mga0rr50_71799_c1_186_1010 | 274 |
| 957 | 3300050513 | nmdc:mga0rr50_9726_c1 | nmdc:mga0rr50_9726_c1_1559_2389 | 274 |
| 958 | 3300050514 | nmdc:mga08x19_2945_c1 | nmdc:mga08x19_2945_c1_1127_1951 | 274 |
| 959 | 3300050515 | nmdc:mga0a205_131196_c1 | nmdc:mga0a205_131196_c1_1546_2370 | 274 |
| 960 | 3300050515 | nmdc:mga0a205_135822_c1 | nmdc:mga0a205_135822_c1_1497_2321 | 274 |
| 961 | 3300050515 | nmdc:mga0a205_16730_c1 | nmdc:mga0a205_16730_c1_2177_3013 | 274 |
| 962 | 3300050515 | nmdc:mga0a205_177611_c1 | nmdc:mga0a205_177611_c1_840_1700 | 274 |
| 963 | 3300050515 | nmdc:mga0a205_24882_c1 | nmdc:mga0a205_24882_c1_3487_4398 | 274 |
| 964 | 3300050515 | nmdc:mga0a205_282263_c1 | nmdc:mga0a205_282263_c1_514_1338 | 274 |
| 965 | 3300050515 | nmdc:mga0a205_4844_c1 | nmdc:mga0a205_4844_c1_5381_6205 | 274 |
| 966 | 3300050516 | nmdc:mga0sz30_187_c1 | nmdc:mga0sz30_187_c1_2335_3159 | 274 |
| 967 | 3300050516 | nmdc:mga0sz30_73028_c1 | nmdc:mga0sz30_73028_c1_244_1068 | 274 |
| 968 | 3300053077 | Ga0495601_0377012 | Ga0495601_0377012_87_911 | 274 |
| 969 | 3300053078 | Ga0495612_0132622 | Ga0495612_0132622_59_883 | 274 |
| 970 | 3300053079 | Ga0500610_0195721 | Ga0500610_0195721_85_909 | 274 |
| 971 | 3300053084 | Ga0495595_0029694 | Ga0495595_0029694_1386_2210 | 274 |
| 972 | 3300053084 | Ga0495595_0042897 | Ga0495595_0042897_542_1366 | 274 |
| 973 | 3300053084 | Ga0495595_0193324 | Ga0495595_0193324_155_979 | 274 |
| 974 | 3300053085 | Ga0495619_0006090 | Ga0495619_0006090_3696_4520 | 274 |
| 975 | 3300053085 | Ga0495619_0057341 | Ga0495619_0057341_469_1293 | 274 |
| 976 | 3300053085 | Ga0495619_0081532 | Ga0495619_0081532_781_1605 | 274 |
| 977 | 3300053087 | Ga0500643_000210 | Ga0500643_000210_36582_37406 | 274 |
| 978 | 3300053091 | Ga0500647_0027384 | Ga0500647_0027384_1059_1883 | 274 |
| 979 | 3300053094 | Ga0500566_0000908 | Ga0500566_0000908_12338_13162 | 274 |
| 980 | 3300053094 | Ga0500566_0008156 | Ga0500566_0008156_2629_3453 | 274 |
| 981 | 3300053096 | Ga0500641_0016502 | Ga0500641_0016502_89_913 | 274 |
| 982 | 3300053104 | Ga0500556_0009208 | Ga0500556_0009208_891_1715 | 274 |
| 983 | 3300053105 | Ga0500557_000196 | Ga0500557_000196_7575_8399 | 274 |
| 984 | 3300053114 | Ga0500582_069329 | Ga0500582_069329_141_965 | 274 |
| 985 | 3300053119 | Ga0500595_000372 | Ga0500595_000372_15534_16358 | 274 |
| 986 | 3300053121 | Ga0500607_098593 | Ga0500607_098593_208_1032 | 274 |
| 987 | 3300053130 | Ga0500642_0000053 | Ga0500642_0000053_2951_3775 | 274 |
| 988 | 3300053130 | Ga0500642_0023118 | Ga0500642_0023118_188_1012 | 274 |
| 989 | 3300053136 | Ga0500559_0023878 | Ga0500559_0023878_1145_1969 | 274 |
| 990 | 3300053136 | Ga0500559_0029435 | Ga0500559_0029435_860_1684 | 274 |
| 991 | 3300053142 | Ga0500577_0116040 | Ga0500577_0116040_260_1084 | 274 |
| 992 | 3300053147 | Ga0500589_101031 | Ga0500589_101031_186_1010 | 274 |
| 993 | 3300053148 | Ga0500590_021996 | Ga0500590_021996_820_1644 | 274 |
| 994 | 3300053148 | Ga0500590_098146 | Ga0500590_098146_400_1224 | 274 |
| 995 | 3300053153 | Ga0500616_0064762 | Ga0500616_0064762_920_1744 | 274 |
| 996 | 3300053154 | Ga0500619_020259 | Ga0500619_020259_716_1540 | 274 |
| 997 | 3300053162 | Ga0500638_001015 | Ga0500638_001015_1249_2073 | 274 |
| 998 | 3300053162 | Ga0500638_140525 | Ga0500638_140525_80_904 | 274 |
| 999 | 3300053162 | Ga0500638_158285 | Ga0500638_158285_30_854 | 274 |
| 1000 | 3300053177 | Ga0500636_0000033 | Ga0500636_0000033_51601_52425 | 274 |
| 1001 | 3300053178 | Ga0500637_0001490 | Ga0500637_0001490_4717_5541 | 274 |
| 1002 | 3300053730 | Ga0500645_084030 | Ga0500645_084030_10_834 | 274 |
| 1003 | 3300053736 | Ga0500599_001058 | Ga0500599_001058_796_1620 | 274 |
| 1004 | 3300053737 | Ga0500601_000590 | Ga0500601_000590_3625_4449 | 274 |
| 1005 | 3300055283 | Ga0500661_000075 | Ga0500661_000075_10512_11336 | 274 |
| 1006 | 3300059490 | Ga0587066_003124 | Ga0587066_003124_958_1782 | 274 |
| 1007 | 3300059644 | Ga0587075_002353 | Ga0587075_002353_146_970 | 274 |
| 1008 | 3300059645 | Ga0587076_012928 | Ga0587076_012928_197_1021 | 274 |
| 1009 | 3300060346 | Ga0587111_0044713 | Ga0587111_0044713_123_947 | 274 |
| 1010 | 3300061719 | Ga0466962_0087966 | Ga0466962_0087966_55_879 | 274 |
| 1011 | iso_pu_bacteria | 2643221545 | 2643749078 | 274 |
| 1012 | iso_pu_bacteria | 2643221691 | 2644509163 | 274 |
| 1013 | 3300002772 | JGI25164J39214_1000349 | JGI25164J39214_100034913 | 275 |
| 1014 | 3300003354 | JGI25160J50197_1000774 | JGI25160J50197_10007748 | 275 |
| 1015 | 3300003758 | Ga0055532_1000114 | Ga0055532_100011464 | 275 |
| 1016 | 3300003781 | Ga0055536_1001668 | Ga0055536_100166810 | 275 |
| 1017 | 3300003791 | Ga0055530_10005027 | Ga0055530_100050276 | 275 |
| 1018 | 3300003792 | Ga0055540_1001608 | Ga0055540_10016086 | 275 |
| 1019 | 3300003794 | Ga0055531_10010163 | Ga0055531_100101634 | 275 |
| 1020 | 3300005262 | Ga0065165_1002238 | Ga0065165_100223812 | 275 |
| 1021 | 3300005288 | Ga0065714_10005120 | Ga0065714_100051205 | 275 |
| 1022 | 3300005288 | Ga0065714_10010177 | Ga0065714_100101772 | 275 |
| 1023 | 3300005455 | Ga0070663_100188240 | Ga0070663_1001882402 | 275 |
| 1024 | 3300006058 | Ga0075432_10015485 | Ga0075432_100154852 | 275 |
| 1025 | 3300006177 | Ga0075362_10076029 | Ga0075362_100760291 | 275 |
| 1026 | 3300009011 | Ga0105251_10011088 | Ga0105251_100110885 | 275 |
| 1027 | 3300009011 | Ga0105251_10030142 | Ga0105251_100301423 | 275 |
| 1028 | 3300009011 | Ga0105251_10066235 | Ga0105251_100662352 | 275 |
| 1029 | 3300009036 | Ga0105244_10011278 | Ga0105244_100112784 | 275 |
| 1030 | 3300009036 | Ga0105244_10033048 | Ga0105244_100330482 | 275 |
| 1031 | 3300009092 | Ga0105250_10004415 | Ga0105250_100044153 | 275 |
| 1032 | 3300009092 | Ga0105250_10022797 | Ga0105250_100227973 | 275 |
| 1033 | 3300009092 | Ga0105250_10031236 | Ga0105250_100312362 | 275 |
| 1034 | 3300009092 | Ga0105250_10069898 | Ga0105250_100698981 | 275 |
| 1035 | 3300009148 | Ga0105243_10000650 | Ga0105243_1000065010 | 275 |
| 1036 | 3300013104 | Ga0157370_10051107 | Ga0157370_100511073 | 275 |
| 1037 | 3300013306 | Ga0163162_10458275 | Ga0163162_104582751 | 275 |
| 1038 | 3300013307 | Ga0157372_10152027 | Ga0157372_101520272 | 275 |
| 1039 | 3300013308 | Ga0157375_10009201 | Ga0157375_100092019 | 275 |
| 1040 | 3300014497 | Ga0182008_10004732 | Ga0182008_100047329 | 275 |
| 1041 | 3300017792 | Ga0163161_10002676 | Ga0163161_100026761 | 275 |
| 1042 | 3300017792 | Ga0163161_10011963 | Ga0163161_100119632 | 275 |
| 1043 | 3300017792 | Ga0163161_10163935 | Ga0163161_101639352 | 275 |
| 1044 | 3300025229 | Ga0209147_100037 | Ga0209147_10003764 | 275 |
| 1045 | 3300025231 | Ga0207427_100044 | Ga0207427_100044149 | 275 |
| 1046 | 3300025233 | Ga0209437_100005 | Ga0209437_100005227 | 275 |
| 1047 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011714 | 275 |
| 1048 | 3300025291 | Ga0209675_1001965 | Ga0209675_10019659 | 275 |
| 1049 | 3300025292 | Ga0209676_1000102 | Ga0209676_100010253 | 275 |
| 1050 | 3300025298 | Ga0209050_1000105 | Ga0209050_100010553 | 275 |
| 1051 | 3300025302 | Ga0207426_1000103 | Ga0207426_1000103158 | 275 |
| 1052 | 3300025303 | Ga0209051_1000066 | Ga0209051_100006653 | 275 |
| 1053 | 3300025304 | Ga0209257_1000124 | Ga0209257_1000124137 | 275 |
| 1054 | 3300025711 | Ga0207696_1001307 | Ga0207696_100130712 | 275 |
| 1055 | 3300025711 | Ga0207696_1004904 | Ga0207696_10049045 | 275 |
| 1056 | 3300025711 | Ga0207696_1019321 | Ga0207696_10193212 | 275 |
| 1057 | 3300025711 | Ga0207696_1021538 | Ga0207696_10215382 | 275 |
| 1058 | 3300025728 | Ga0207655_1000219 | Ga0207655_10002192 | 275 |
| 1059 | 3300025728 | Ga0207655_1003812 | Ga0207655_10038126 | 275 |
| 1060 | 3300025728 | Ga0207655_1019209 | Ga0207655_10192092 | 275 |
| 1061 | 3300025735 | Ga0207713_1001250 | Ga0207713_100125011 | 275 |
| 1062 | 3300025735 | Ga0207713_1005534 | Ga0207713_10055348 | 275 |
| 1063 | 3300025735 | Ga0207713_1011327 | Ga0207713_10113271 | 275 |
| 1064 | 3300025735 | Ga0207713_1014629 | Ga0207713_10146293 | 275 |
| 1065 | 3300025735 | Ga0207713_1029292 | Ga0207713_10292921 | 275 |
| 1066 | 3300025735 | Ga0207713_1071712 | Ga0207713_10717121 | 275 |
| 1067 | 3300025923 | Ga0207681_10015796 | Ga0207681_100157962 | 275 |
| 1068 | 3300025935 | Ga0207709_10000001 | Ga0207709_10000001855 | 275 |
| 1069 | 3300026067 | Ga0207678_10167776 | Ga0207678_101677762 | 275 |
| 1070 | 3300027907 | Ga0207428_10009941 | Ga0207428_100099419 | 275 |
| 1071 | 3300031238 | Ga0265332_10130299 | Ga0265332_101302991 | 275 |
| 1072 | 3300031249 | Ga0265339_10025802 | Ga0265339_100258022 | 275 |
| 1073 | 3300031548 | Ga0307408_100002600 | Ga0307408_1000026004 | 275 |
| 1074 | 3300031616 | Ga0307508_10264534 | Ga0307508_102645342 | 275 |
| 1075 | 3300041405 | Ga0439438_000188 | Ga0439438_000188_6067_6897 | 275 |
| 1076 | 3300041405 | Ga0439438_021439 | Ga0439438_021439_509_1339 | 275 |
| 1077 | 3300041407 | Ga0439447_000289 | Ga0439447_000289_9310_10140 | 275 |
| 1078 | 3300041407 | Ga0439447_044189 | Ga0439447_044189_66_896 | 275 |
| 1079 | 3300041411 | Ga0439466_0001316 | Ga0439466_0001316_2167_2997 | 275 |
| 1080 | 3300041411 | Ga0439466_0009307 | Ga0439466_0009307_826_1656 | 275 |
| 1081 | 3300042009 | Ga0439451_000373 | Ga0439451_000373_2168_2998 | 275 |
| 1082 | 3300042010 | Ga0439452_000077 | Ga0439452_000077_2760_3590 | 275 |
| 1083 | 3300042010 | Ga0439452_001743 | Ga0439452_001743_1635_2465 | 275 |
| 1084 | 3300042121 | Ga0450919_001810 | Ga0450919_001810_1753_2583 | 275 |
| 1085 | 3300042122 | Ga0450920_000770 | Ga0450920_000770_31_861 | 275 |
| 1086 | 3300042124 | Ga0450922_000106 | Ga0450922_000106_7065_7895 | 275 |
| 1087 | 3300042145 | Ga0450906_006336 | Ga0450906_006336_697_1527 | 275 |
| 1088 | 3300042146 | Ga0450907_000035 | Ga0450907_000035_9630_10460 | 275 |
| 1089 | 3300042156 | Ga0439446_0016435 | Ga0439446_0016435_232_1062 | 275 |
| 1090 | 3300042184 | Ga0450908_013341 | Ga0450908_013341_548_1378 | 275 |
| 1091 | 3300042435 | Ga0439434_0000053 | Ga0439434_0000053_9602_10432 | 275 |
| 1092 | 3300044658 | Ga0466972_0019144 | Ga0466972_0019144_1843_2673 | 275 |
| 1093 | 3300044671 | Ga0466978_0032140 | Ga0466978_0032140_2307_3137 | 275 |
| 1094 | 3300044693 | Ga0466961_0000418 | Ga0466961_0000418_10045_10875 | 275 |
| 1095 | 3300044706 | Ga0466964_0008332 | Ga0466964_0008332_1629_2459 | 275 |
| 1096 | 3300044735 | Ga0466968_0001216 | Ga0466968_0001216_330_1160 | 275 |
| 1097 | 3300044842 | Ga0466957_0037807 | Ga0466957_0037807_975_1805 | 275 |
| 1098 | 3300045049 | Ga0466959_0027721 | Ga0466959_0027721_613_1443 | 275 |
| 1099 | 3300046452 | Ga0495617_004483 | Ga0495617_004483_1253_2083 | 275 |
| 1100 | 3300046453 | Ga0495627_000874 | Ga0495627_000874_1779_2609 | 275 |
| 1101 | 3300046453 | Ga0495627_001078 | Ga0495627_001078_4919_5749 | 275 |
| 1102 | 3300046453 | Ga0495627_003617 | Ga0495627_003617_140_970 | 275 |
| 1103 | 3300046457 | Ga0495590_0026636 | Ga0495590_0026636_50_880 | 275 |
| 1104 | 3300046458 | Ga0495591_001976 | Ga0495591_001976_145_975 | 275 |
| 1105 | 3300046458 | Ga0495591_020413 | Ga0495591_020413_1332_2162 | 275 |
| 1106 | 3300046460 | Ga0495638_0001077 | Ga0495638_0001077_25155_25985 | 275 |
| 1107 | 3300046460 | Ga0495638_0031716 | Ga0495638_0031716_2028_2858 | 275 |
| 1108 | 3300046460 | Ga0495638_0034928 | Ga0495638_0034928_1574_2404 | 275 |
| 1109 | 3300046460 | Ga0495638_0065947 | Ga0495638_0065947_1175_2005 | 275 |
| 1110 | 3300046471 | Ga0495650_0003064 | Ga0495650_0003064_11419_12249 | 275 |
| 1111 | 3300046474 | Ga0495605_0166224 | Ga0495605_0166224_120_950 | 275 |
| 1112 | 3300046475 | Ga0495639_0000023 | Ga0495639_0000023_20463_21293 | 275 |
| 1113 | 3300046491 | Ga0495584_0000018 | Ga0495584_0000018_111667_112497 | 275 |
| 1114 | 3300046492 | Ga0495585_0010657 | Ga0495585_0010657_1788_2618 | 275 |
| 1115 | 3300046501 | Ga0495607_0011594 | Ga0495607_0011594_2665_3495 | 275 |
| 1116 | 3300046501 | Ga0495607_0022935 | Ga0495607_0022935_2743_3573 | 275 |
| 1117 | 3300046506 | Ga0495583_0028838 | Ga0495583_0028838_613_1443 | 275 |
| 1118 | 3300046506 | Ga0495583_0074047 | Ga0495583_0074047_202_1032 | 275 |
| 1119 | 3300046512 | Ga0495610_0008260 | Ga0495610_0008260_731_1561 | 275 |
| 1120 | 3300046512 | Ga0495610_0036794 | Ga0495610_0036794_634_1464 | 275 |
| 1121 | 3300046513 | Ga0495616_0018314 | Ga0495616_0018314_1571_2401 | 275 |
| 1122 | 3300046515 | Ga0495620_0053632 | Ga0495620_0053632_754_1584 | 275 |
| 1123 | 3300046518 | Ga0495631_0017638 | Ga0495631_0017638_2488_3318 | 275 |
| 1124 | 3300046519 | Ga0495632_0003144 | Ga0495632_0003144_185_1015 | 275 |
| 1125 | 3300046519 | Ga0495632_0005156 | Ga0495632_0005156_1654_2484 | 275 |
| 1126 | 3300046519 | Ga0495632_0018652 | Ga0495632_0018652_153_983 | 275 |
| 1127 | 3300046519 | Ga0495632_0024920 | Ga0495632_0024920_2149_2979 | 275 |
| 1128 | 3300046519 | Ga0495632_0035423 | Ga0495632_0035423_945_1775 | 275 |
| 1129 | 3300046519 | Ga0495632_0062989 | Ga0495632_0062989_903_1733 | 275 |
| 1130 | 3300046520 | Ga0495637_0001867 | Ga0495637_0001867_10969_11799 | 275 |
| 1131 | 3300046520 | Ga0495637_0030210 | Ga0495637_0030210_237_1067 | 275 |
| 1132 | 3300046522 | Ga0495643_0004784 | Ga0495643_0004784_1285_2115 | 275 |
| 1133 | 3300046522 | Ga0495643_0123611 | Ga0495643_0123611_211_1041 | 275 |
| 1134 | 3300046523 | Ga0495644_0000104 | Ga0495644_0000104_30209_31039 | 275 |
| 1135 | 3300046523 | Ga0495644_0020211 | Ga0495644_0020211_1475_2305 | 275 |
| 1136 | 3300046524 | Ga0495648_0008944 | Ga0495648_0008944_469_1299 | 275 |
| 1137 | 3300046524 | Ga0495648_0175873 | Ga0495648_0175873_119_949 | 275 |
| 1138 | 3300046525 | Ga0495663_0010270 | Ga0495663_0010270_1560_2390 | 275 |
| 1139 | 3300046530 | Ga0495654_0009404 | Ga0495654_0009404_1366_2196 | 275 |
| 1140 | 3300046542 | Ga0495597_0004749 | Ga0495597_0004749_359_1189 | 275 |
| 1141 | 3300046557 | Ga0495622_0000135 | Ga0495622_0000135_41701_42531 | 275 |
| 1142 | 3300046558 | Ga0495633_0010860 | Ga0495633_0010860_1500_2330 | 275 |
| 1143 | 3300046615 | Ga0495656_0091438 | Ga0495656_0091438_332_1162 | 275 |
| 1144 | 3300046616 | Ga0495668_0000379 | Ga0495668_0000379_356_1186 | 275 |
| 1145 | 3300046660 | Ga0495625_0003166 | Ga0495625_0003166_1264_2094 | 275 |
| 1146 | 3300046660 | Ga0495625_0006295 | Ga0495625_0006295_8950_9780 | 275 |
| 1147 | 3300046660 | Ga0495625_0008990 | Ga0495625_0008990_4880_5710 | 275 |
| 1148 | 3300046660 | Ga0495625_0010307 | Ga0495625_0010307_4827_5657 | 275 |
| 1149 | 3300046665 | Ga0495661_0008974 | Ga0495661_0008974_1345_2175 | 275 |
| 1150 | 3300046665 | Ga0495661_0016063 | Ga0495661_0016063_3860_4690 | 275 |
| 1151 | 3300046665 | Ga0495661_0020284 | Ga0495661_0020284_2510_3340 | 275 |
| 1152 | 3300046691 | Ga0495670_0014224 | Ga0495670_0014224_1809_2639 | 275 |
| 1153 | 3300046691 | Ga0495670_0015862 | Ga0495670_0015862_422_1252 | 275 |
| 1154 | 3300046692 | Ga0495671_0017068 | Ga0495671_0017068_3010_3840 | 275 |
| 1155 | 3300046694 | Ga0495649_0010770 | Ga0495649_0010770_2580_3410 | 275 |
| 1156 | 3300046694 | Ga0495649_0014859 | Ga0495649_0014859_3029_3859 | 275 |
| 1157 | 3300046794 | Ga0495589_0015892 | Ga0495589_0015892_2842_3672 | 275 |
| 1158 | 3300046810 | Ga0495660_0006726 | Ga0495660_0006726_4707_5537 | 275 |
| 1159 | 3300046810 | Ga0495660_0020038 | Ga0495660_0020038_1797_2627 | 275 |
| 1160 | 3300046810 | Ga0495660_0074756 | Ga0495660_0074756_820_1650 | 275 |
| 1161 | 3300047320 | Ga0495672_0004293 | Ga0495672_0004293_5586_6416 | 275 |
| 1162 | 3300047320 | Ga0495672_0016133 | Ga0495672_0016133_1796_2632 | 275 |
| 1163 | 3300047320 | Ga0495672_0037660 | Ga0495672_0037660_1275_2105 | 275 |
| 1164 | 3300047323 | Ga0495683_0000710 | Ga0495683_0000710_17798_18628 | 275 |
| 1165 | 3300047323 | Ga0495683_0001671 | Ga0495683_0001671_2209_3039 | 275 |
| 1166 | 3300047446 | Ga0495679_002871 | Ga0495679_002871_93_923 | 275 |
| 1167 | 3300047469 | Ga0495673_0078696 | Ga0495673_0078696_382_1212 | 275 |
| 1168 | 3300047469 | Ga0495673_0079243 | Ga0495673_0079243_154_984 | 275 |
| 1169 | 3300047470 | Ga0495681_0000397 | Ga0495681_0000397_23682_24512 | 275 |
| 1170 | 3300047470 | Ga0495681_0000547 | Ga0495681_0000547_10129_10959 | 275 |
| 1171 | 3300047470 | Ga0495681_0001186 | Ga0495681_0001186_10822_11652 | 275 |
| 1172 | 3300047470 | Ga0495681_0012872 | Ga0495681_0012872_1822_2652 | 275 |
| 1173 | 3300047470 | Ga0495681_0126519 | Ga0495681_0126519_131_961 | 275 |
| 1174 | 3300047472 | Ga0495686_0233070 | Ga0495686_0233070_162_992 | 275 |
| 1175 | 3300048091 | Ga0495626_0000845 | Ga0495626_0000845_14973_15803 | 275 |
| 1176 | 3300048917 | Ga0496114_0169480 | Ga0496114_0169480_535_1365 | 275 |
| 1177 | 3300048921 | Ga0496118_0003627 | Ga0496118_0003627_7867_8697 | 275 |
| 1178 | 3300048927 | Ga0496124_0001884 | Ga0496124_0001884_10719_11549 | 275 |
| 1179 | 3300048927 | Ga0496124_0126529 | Ga0496124_0126529_814_1644 | 275 |
| 1180 | 3300048928 | Ga0496125_0053998 | Ga0496125_0053998_539_1369 | 275 |
| 1181 | 3300048929 | Ga0496126_0001707 | Ga0496126_0001707_24979_25809 | 275 |
| 1182 | 3300049459 | Ga0495678_001125 | Ga0495678_001125_232_1062 | 275 |
| 1183 | 3300049460 | Ga0495682_0000574 | Ga0495682_0000574_21292_22122 | 275 |
| 1184 | 3300049569 | Ga0501032_0013596 | Ga0501032_0013596_4573_5406 | 275 |
| 1185 | 3300049571 | Ga0501034_0018551 | Ga0501034_0018551_658_1491 | 275 |
| 1186 | 3300049572 | Ga0501036_0119131 | Ga0501036_0119131_1143_1976 | 275 |
| 1187 | 3300049574 | Ga0501038_0316086 | Ga0501038_0316086_379_1212 | 275 |
| 1188 | 3300049575 | Ga0501039_0020160 | Ga0501039_0020160_1600_2433 | 275 |
| 1189 | 3300049578 | Ga0501042_0098751 | Ga0501042_0098751_1232_2065 | 275 |
| 1190 | 3300049579 | Ga0501043_0086301 | Ga0501043_0086301_507_1340 | 275 |
| 1191 | 3300049580 | Ga0501046_0092638 | Ga0501046_0092638_32_865 | 275 |
| 1192 | 3300049581 | Ga0501047_0116105 | Ga0501047_0116105_1113_1946 | 275 |
| 1193 | 3300049582 | Ga0501048_0054813 | Ga0501048_0054813_1529_2362 | 275 |
| 1194 | 3300049583 | Ga0501067_0059862 | Ga0501067_0059862_390_1223 | 275 |
| 1195 | 3300049585 | Ga0501069_0013696 | Ga0501069_0013696_2674_3507 | 275 |
| 1196 | 3300049586 | Ga0501070_0556715 | Ga0501070_0556715_69_902 | 275 |
| 1197 | 3300049588 | Ga0501072_0148193 | Ga0501072_0148193_936_1769 | 275 |
| 1198 | 3300049589 | Ga0501073_0029084 | Ga0501073_0029084_971_1804 | 275 |
| 1199 | 3300049742 | Ga0501080_0101917 | Ga0501080_0101917_271_1104 | 275 |
| 1200 | 3300049758 | Ga0501241_000151 | Ga0501241_000151_4985_5815 | 275 |
| 1201 | 3300049822 | Ga0501035_0146140 | Ga0501035_0146140_325_1158 | 275 |
| 1202 | 3300049823 | Ga0501044_0096873 | Ga0501044_0096873_1552_2385 | 275 |
| 1203 | 3300050489 | nmdc:mga03683_36634_c1 | nmdc:mga03683_36634_c1_695_1525 | 275 |
| 1204 | 3300050514 | nmdc:mga08x19_42039_c1 | nmdc:mga08x19_42039_c1_451_1281 | 275 |
| 1205 | 3300060353 | Ga0501082_0196188 | Ga0501082_0196188_314_1147 | 275 |
| 1206 | 3300002739 | JGI25158J39367_1000662 | JGI25158J39367_10006628 | 276 |
| 1207 | 3300002774 | JGI25150J39212_1015276 | JGI25150J39212_10152762 | 276 |
| 1208 | 3300002987 | JGI25159J45721_1003457 | JGI25159J45721_10034574 | 276 |
| 1209 | 3300003374 | JGI25161J50226_1000108 | JGI25161J50226_100010824 | 276 |
| 1210 | 3300004625 | Ga0055543_1000020 | Ga0055543_100002061 | 276 |
| 1211 | 3300005262 | Ga0065165_1022880 | Ga0065165_10228801 | 276 |
| 1212 | 3300005328 | Ga0070676_10005631 | Ga0070676_100056314 | 276 |
| 1213 | 3300005338 | Ga0068868_100000053 | Ga0068868_1000000535 | 276 |
| 1214 | 3300005364 | Ga0070673_100000010 | Ga0070673_10000001012 | 276 |
| 1215 | 3300005459 | Ga0068867_100000007 | Ga0068867_100000007116 | 276 |
| 1216 | 3300006881 | Ga0068865_100000010 | Ga0068865_10000001063 | 276 |
| 1217 | 3300009098 | Ga0105245_10000174 | Ga0105245_1000017455 | 276 |
| 1218 | 3300009148 | Ga0105243_10000054 | Ga0105243_1000005492 | 276 |
| 1219 | 3300009176 | Ga0105242_10000821 | Ga0105242_1000082124 | 276 |
| 1220 | 3300009553 | Ga0105249_10009100 | Ga0105249_100091007 | 276 |
| 1221 | 3300011119 | Ga0105246_10001706 | Ga0105246_100017064 | 276 |
| 1222 | 3300013296 | Ga0157374_10000468 | Ga0157374_1000046839 | 276 |
| 1223 | 3300013297 | Ga0157378_10000494 | Ga0157378_1000049439 | 276 |
| 1224 | 3300013308 | Ga0157375_10000306 | Ga0157375_1000030620 | 276 |
| 1225 | 3300014745 | Ga0157377_10051614 | Ga0157377_100516143 | 276 |
| 1226 | 3300014969 | Ga0157376_10000047 | Ga0157376_10000047117 | 276 |
| 1227 | 3300025208 | Ga0209436_100095 | Ga0209436_10009524 | 276 |
| 1228 | 3300025258 | Ga0209129_1000449 | Ga0209129_100044925 | 276 |
| 1229 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004224 | 276 |
| 1230 | 3300025295 | Ga0209564_1000630 | Ga0209564_100063052 | 276 |
| 1231 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003504 | 276 |
| 1232 | 3300025907 | Ga0207645_10002621 | Ga0207645_100026214 | 276 |
| 1233 | 3300025927 | Ga0207687_10003479 | Ga0207687_1000347910 | 276 |
| 1234 | 3300025934 | Ga0207686_10000556 | Ga0207686_1000055624 | 276 |
| 1235 | 3300025935 | Ga0207709_10000050 | Ga0207709_10000050136 | 276 |
| 1236 | 3300025938 | Ga0207704_10000020 | Ga0207704_1000002046 | 276 |
| 1237 | 3300025942 | Ga0207689_10000268 | Ga0207689_100002684 | 276 |
| 1238 | 3300025960 | Ga0207651_10000005 | Ga0207651_10000005115 | 276 |
| 1239 | 3300025961 | Ga0207712_10059303 | Ga0207712_100593032 | 276 |
| 1240 | 3300026023 | Ga0207677_10000094 | Ga0207677_1000009459 | 276 |
| 1241 | 3300026067 | Ga0207678_10144100 | Ga0207678_101441002 | 276 |
| 1242 | 3300026089 | Ga0207648_10000017 | Ga0207648_1000001746 | 276 |
| 1243 | 3300031548 | Ga0307408_100153860 | Ga0307408_1001538602 | 276 |
| 1244 | 3300031731 | Ga0307405_10123495 | Ga0307405_101234951 | 276 |
| 1245 | 3300031911 | Ga0307412_10293696 | Ga0307412_102936961 | 276 |
| 1246 | 3300031995 | Ga0307409_100021452 | Ga0307409_1000214521 | 276 |
| 1247 | 3300037418 | Ga0395900_0067574 | Ga0395900_0067574_269_1150 | 276 |
| 1248 | 3300041404 | Ga0439436_0029214 | Ga0439436_0029214_438_1268 | 276 |
| 1249 | 3300041405 | Ga0439438_024445 | Ga0439438_024445_410_1240 | 276 |
| 1250 | 3300041411 | Ga0439466_0056601 | Ga0439466_0056601_374_1204 | 276 |
| 1251 | 3300041413 | Ga0439465_0028217 | Ga0439465_0028217_162_1151 | 276 |
| 1252 | 3300042007 | Ga0439449_0073961 | Ga0439449_0073961_45_875 | 276 |
| 1253 | 3300042015 | Ga0439462_0044862 | Ga0439462_0044862_24_854 | 276 |
| 1254 | 3300042145 | Ga0450906_015492 | Ga0450906_015492_70_900 | 276 |
| 1255 | 3300045976 | Ga0466967_0283194 | Ga0466967_0283194_298_1182 | 276 |
| 1256 | 3300046512 | Ga0495610_0027368 | Ga0495610_0027368_1644_2621 | 276 |
| 1257 | 3300046660 | Ga0495625_0020975 | Ga0495625_0020975_3965_4795 | 276 |
| 1258 | 3300047446 | Ga0495679_001535 | Ga0495679_001535_7946_9016 | 276 |
| 1259 | 3300048920 | Ga0496117_0118578 | Ga0496117_0118578_508_1485 | 276 |
| 1260 | 3300048921 | Ga0496118_0006416 | Ga0496118_0006416_11345_12190 | 276 |
| 1261 | 3300048921 | Ga0496118_0062501 | Ga0496118_0062501_698_1528 | 276 |
| 1262 | 3300048921 | Ga0496118_0064285 | Ga0496118_0064285_46_876 | 276 |
| 1263 | 3300048924 | Ga0496121_0011940 | Ga0496121_0011940_6801_7631 | 276 |
| 1264 | 3300048925 | Ga0496122_0022896 | Ga0496122_0022896_1777_2607 | 276 |
| 1265 | 3300048926 | Ga0496123_0009076 | Ga0496123_0009076_6147_6977 | 276 |
| 1266 | 3300048927 | Ga0496124_0027989 | Ga0496124_0027989_253_1230 | 276 |
| 1267 | 3300049744 | Ga0501083_0011783 | Ga0501083_0011783_1582_2505 | 276 |
| 1268 | 3300053087 | Ga0500643_003295 | Ga0500643_003295_187_1017 | 276 |
| 1269 | 3300053104 | Ga0500556_0000049 | Ga0500556_0000049_40943_41773 | 276 |
| 1270 | 3300053108 | Ga0500562_024014 | Ga0500562_024014_708_1538 | 276 |
| 1271 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_87024_87854 | 276 |
| 1272 | 3300053156 | Ga0500622_0001817 | Ga0500622_0001817_7918_8895 | 276 |
| 1273 | 3300053730 | Ga0500645_000173 | Ga0500645_000173_31032_31862 | 276 |
| 1274 | 3300060353 | Ga0501082_0134983 | Ga0501082_0134983_1184_2107 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1a88-assembly1.cif.gz_C | chloroperoxidase l | 0.9976 | 2 | 276 |
| 1a88-assembly1.cif.gz_C | chloroperoxidase l | 0.994 | 2 | 276 |
| 1zoi-assembly1.cif.gz_B | crystal structure of a stereoselective esterase from pseudomonas putida ifo12996 | 0.9899 | 2 | 274 |
| 4dgq-assembly1.cif.gz_C | crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia | 0.989 | 3 | 276 |
| 1a8s-assembly1.cif.gz_A | chloroperoxidase f/propionate complex | 0.9858 | 2 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dgqB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9895 | 3 | 276 | 3.40.50.1820 |
| 1va4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9825 | 2 | 276 | 3.40.50.1820 |
| 1va4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9789 | 2 | 276 | 3.40.50.1820 |
| 4dgqB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9788 | 3 | 276 | 3.40.50.1820 |
| 1a8qA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9726 | 2 | 276 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A430CRL9-F1-model_v4 | deleted | 0.9989 | 2 | 276 |
|
| AF-A0A6G8UDL9-F1-model_v4 | Alpha/beta hydrolase | 0.9984 | 3 | 276 |
GO:0016787
|
| AF-A0A4V3UWV7-F1-model_v4 | Alpha/beta hydrolase | 0.9962 | 3 | 99 |
GO:0016787
|
| AF-A0A3A6R6F1-F1-model_v4 | Alpha/beta hydrolase | 0.9952 | 3 | 276 |
GO:0016787
|
| AF-A0A443LHS6-F1-model_v4 | Alpha/beta hydrolase | 0.9943 | 1 | 276 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar